1I2EA

Ribonuclease t1 v16a mutant, form i
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i2eA00
1BRHA 1BSDA 1GMQA 1YGWA 1X1WA 3DGYA 4HOHA 1B2SA 1RN4A 4RNTA 1RN1A 5BIRA 1RGCA 3AHSA 2C4BA 7RNTA 3HOHA 1BRIA 4BU4A 3A5EA 1I2EA 1UCLA 1JBRA 3GSPA 1GMRA 1YNVX 4J5GA 6RNTA 1BIRA 1RGKA 1BNEA 1ZGXA 3D5IA 1BSAA 2BU4A 1RGGA 4GHOA 1BNJA 1BSCA 2HOHA 1GMPA 1GSPA 7GSPA 1UCIA 3WHOA 1I2GA 1RDSA 1BOXA 3SYUA 1RGEA 2F5WA 8RNTA 1FUTA 2KF6A 1CH0A 1I70A 1RNBA 1BRGA 2KAAA 4HAAA 1FUSA 1B21A 1DETA 1BSBA 1I8VA 2GSPA 1BNIA 3BIRA 1RGLA 1B2UA 1PY3A 1BAOA 2SARA 1B2ZA 1B20A 1BNSA 3AGOA 5GSPA 3Q3FA 1IYYA 1RLSA 1MGWA 1PYLA 2ZA4A 1BNRA 2KF3A 1BRNL 1T2HA 1X1UA 1LOYA 1G02A 2AADA 1TRQA 2KF4A 1X1XA 1I3FA 2BIRA 3KCHA 1I0XA 3D4AA 1RSNA 1I3IA 1BNGA 1X1YA 2AAEA 1LOVA 1BRJA 5HOHA 1R4YA 6GSPA 1I2FA 1RCLA 1JBTA 9RNTA 1LRAA 1RMSA 3RNTA 1HZ1A 1C54A 1JBSA 3AHWA 1UCKA 3BU4A 1BU4A 1TRPA 1FYSA 1BRSA 1UCJA 1BRKA 3AGNA 2F5MA 3D5GA 1BUJA 1BNFA 1BSEA 1BGSA 1LNIA 1RCKA 1Q9EA 2F4YA 1AY7A 1BANA 3URPA 5RNTA 1HYFA 3DH2A 1RGFA 1LOWA 1AQZA 1MGRA 4GSPA 3WR2A 1B3SA 2RBIA 1B27A 2F56A 1B2MA 1YVSA 1BVIA 1GOYA 1RTUA 1RGHA 1FZUA 2RNTA 1TTOA 5BU4A 1DE3A 4J5KA 1A2PA 1B2XA 1T2IA 1FW7A 1SARA 2KF5A 1RNTA 4BIRA 1GOVA 1GOUA 1I0VA 1RGAA 1RHLA
chains in the Genus database with same CATH superfamily
4R1KA 1VQ63 1PU4A 1DYUA 3SLUA 3UL6A 1BSDA 3CNMA 1U8CB 1GMQA 1ZO2A 3F7XA 3PYJA 4R9LA 2Z76A 2OOVA 3DGYA 3MPHA 2XEPA 1K734 3CMA3 4RNTA 4QWTA 5BIRA 3UL5A 1IU7A 3AHSA 3KE7A 4XDVA 4RNZA 2CH9A 3MWZA 1T5YA 4KFDA 5IEOA 1WMPA 3A5EA 3K7CA 1IT7A 1W7CA 2BMOB 4HM2B 3B4PA 3S67A 2JQ5A 2RGQA 6RNTA 1W2B2 1YNVX 4J5GA 1RGKA 1UGIA 5G1LA 1ULIB 5DRVA 3GZXB 1OHPA 4HM4B 1OACA 5HGRA 3WOEB 1N5PA 2BU4A 1JB5A 3CNXA 3DMCA 4GHOA 2M7OA 2XGNA 2MC8A 3S5CA 2GBWB 5KP3A 1GD3A 1KSIA 1UCIA 2GU1A 4XB5A 1Y4KA 5EQLA 3WHOA 3CPW2 1YIT3 1NO3A 1VQ43 4XBTA 2F5WA 3KZTA 3NM7A 3FGYA 2W2CA 4BTXA 1OGXA 3NM2A 1QVF2 2WOFA 1Q40A 4H3UA 2CKFB 2KRTA 2W04A 3OWUA 1I8VA 4O02B 3CC43 3UB1A 2XFSA 1BNIA 3MG2A 2BMQB 4HYZA 1E3VA 1RGLA 3HX8A 4RNYA 3ECFA 3H3HA 2BT3A 3DY5A 5D81A 2SARA 3OV4A 1TIJA 2GU3A 1BNSA 3AGOA 5A0OB 1IYYA 1MGWA 4N3VA 4FCJA 4HM7B 2HMNB 1BRNL 5M1AA 1RKYA 1G02A 3STDA 4EYCA 1TRQA 4K90B 1EEJA 1MWUA 2XR8B 4HBRA 3KCHA 1O7GB 4ORLA 1I0XA 2LYXA 3D4AA 5AIFA 3CCE3 1GY6A 1K41A 4KT3B 2RSXA 1I3IA 4TX4A 1X1YA 4O8SA 3EB8A 1OCVA 2ZL8A 5JPPA 2C11A 4EW5A 1NU3A 1Q824 2P09A 5BVBA 1I2FA 1TU5A 3CD63 2BHMA 3QRDA 2IYJA 3X3XA 3OX9A 1CYVA 3CCU3 3PCRA 1JBSA 4OVMA 3Q90A 3ZG5A 3O8YA 1UCKA 1K9M4 2PZVA 3BU4A 2OWPA 3CC23 1BU4A 3LTDA 3MYTA 1L5GB 3X3YA 3CU3A 1QMAA 5LC6A 1KWIA 1TJDA 3SX1A 1TUHA 3K9MC 3CCS3 1QJGA 1VQ93 1BNFA 3HK4A 1BGSA 1HKXA 2Q07A 1VQP3 1AY7A 1YVBI 3URPA 4RBNA 3X42A 1HYFA 1MWTA 4BTYA 2QEX3 1IT8A 1D6UA 5IG5A 1JZOA 2PNCA 1GY7A 2RFRA 2D42A 2W56A 4N6TA 3I553 3AMOB 1TP6A 1AVKA 3JUQA 4HJLB 3BNDA 2RNTA 5LC7A 2L4VA 5AI1A 4FMDA 2XGLA 3JUMA 2KF5A 4H61A 4JRFA 1VQN3 1D6YA 3PZWA 2K3DA 1I0VA 1DE3A 3N9HA 1NB3I 1BRHA 1S5AA 1IQ8A 1MWRA 2B24B 3IPTA 4X2OA 3LXUX 5JPUA 2CX0A 1PFPA 3MG1A 3ZFZA 2XSHB 2Z7AA 4N6UA 1B2SA 3EF8A 1CYUA 3TDGA 1W5ZA 2CG1A 3PS8A 1RN1A 1SIIA 2UX0A 2Z6BA 2CFGA 3NBJA 5IG3A 1W6YA 2R4IA 3LT9A 2K54A 4BTWA 7RNTA 1U5OA 1LNHA 2CK3H 4BU4A 3CCL3 5M18A 1O7MB 1UCLA 5KP1A 3DZLA 1BIRA 1Q40B 1CQSA 1BNEA 1NNVA 2CX1A 1WNHA 3LH4A 1OGZA 2FXTA 1IVXA 3D3LA 1BSAA 2XFTA 1FGQA 1JKGA 4RZMA 5I97A 1JN5B 1M904 1GMPA 2H0IA 1V74A 2QIYA 5IW9A 1IVWA 1VQK3 1NB5I 1VQO3 1RDSA 1BOXA 1MOLA 1MNLA 1RGEA 3SYUA 8RNTA 1RJOA 1FUTA 2HMLB 3FSDA 5TGNA 1SPUA 1BRGA 3CCV3 3JUPA 4OUQA 2W0QA 1FUSA 3LT8A 2ZHXB 4IIAA 1BSBA 4WFOA 3BB9A 3BIRA 4LEHA 4LZIA 1B2UA 1ROVA 1UI7A 4FCMA 5CF2A 1IDPA 4FMAA 1B2ZA 2B1XB 4HM3B 3WA2X 4MEIA 2IUKA 5GSPA 3DGMA 3Q3FA 4HM1B 2ZA4A 1YJN3 2W6JH 4AEQA 3EN8A 1T2HA 2YFIB 3J7Yd 3T8NA 1FA3A 1V58A 1OF5A 3EBYA 5AYSC 1Q7Y4 1I3FA 1Q42A 2GEXA 3D9RA 3FLJA 3HI7A 3NV0B 3G713 2FGTA 2W03A 5AYRB 4FCZA 2F86B 1BNGA 2IA7A 4AKYA 5FW5A 1JNQA 1LOVA 3LZAA 3EC9A 5DREA 1AVLA 1BRJA 3ZG0A 5HOHA 1JRQA 4HVNA 3SVAA 3IMAB 1RCLA 1NJI4 1QAKA 1JBTA 4KFEA 3WOFB 1LRAA 1RMSA 2HMMB 1US1A 3LMLA 3NHXA 1HZ1A 4G1MB 1QALA 3DGLA 2D1WA 2QA43 2CFKA 1A2VA 3FCSB 3CCM3 1N5HA 3OWYA 1BRSA 3F9SA 3HIIA 3NBRA 1BRKA 4WWUC 3LTBA 2F5MA 1G0TA 1BUJA 2UGIA 1LNIA 1ZS7A 5RNTA 3CCJ3 3WMDA 2P05A 3B8LA 1AQZA 3DM8A 2ZDJA 6STDA 4Q53A 1E97A 1T3BA 3PXMA 1KD14 1E3RA 1OUNA 5FGOA 1B27A 1EA2A 4XBXA 1B2MA 1GOYA 3CCQ3 2SBLA 2IUJA 5G2GA 4CJNA 3FF2A 5JBSA 4EV2A 2WGOA 1SARA 3F8XA 3LYGA 4HM6B 4NHFA 1RNTA 2ML5A 3FG1A 2E2TA 2YFJB 2GBXB 1RHLA 3VGNA 1O7NB 4EV5A 4ILFA 2CW9A 4O2HA 5EVHA 2WGQA 4JF8A 1FGRA 3V98A 3X3ZA 1STFI 1YGEA 3S29A 3U97A 4XBYA 3PGBA 4MJDA 3GWRA 1LQGC 2P0XA 4BL3A 1O7WB 3N54B 1BRIA 3A76A 3M8CA 3VSYA 1YI23 2CFWA 1VQ53 1O7HB 2CFLA 1AR0A 2BMRB 3CCR3 4HZBB 4XDWA 3SXXA 3EJVA 1GMRA 2LQVA 3CPOA 1S723 2IMJA 4IT7A 2OTL3 1ZGXA 1RN7A 2P38A 3LTAA 3D5IA 1Q864 1N8R4 1OHOA 1BSCA 1NDOB 3G16A 4HM8B 1VQL3 3DXOA 4WYKA 1LVNA 1GSPA 7GSPA 5ELJA 3NQZA 3I0YA 1EKMA 1I2GA 4FMCA 2O3OA 4GL6A 1UW1A 2H0HA 1I70A 1Z1SA 1VQM3 3CC73 3Q2PA 1FUWA 4HAAA 4J9AA 5IF6A 1OF5B 1WMOA 1DETA 4KZ1A 3F8HA 2GSPA 2GEYA 3E99A 3LTCA 1YJW3 2BNGA 1PY3A 2Y73A 1SQWA 3EBTA 3JUNA 1DMNA 3FKAA 3EE1A 3EN1B 2KCDA 1F8NA 2J8XB 4K1VA 1RLSA 4R9KA 1PYLA 3FH1A 1LOXA 3Q1CA 1LOYA 1O7PB 1GS3A 5AEWB 1IQYA 1YJ93 2XH9A 1GY5A 2KF4A 2R41A 3N8BA 4NPBA 2ML6A 4DKIA 1DMQA 1RSNA 2OQEC 1K8A4 3F7SA 1JB2A 3LOYA 1MWSA 2H0GA 1ROAA 1GD4A 2MF7A 4I5QA 3UJMA 2OQEA 1LXEA 2Z77A 2STDA 6GSPA 4HM0B 1KC84 2P0MA 3OW22 1D6ZA 3G4S3 5IERA 1IV7A 1LQMB 4LGQA 4N6OB 3NX0A 1N8QA 2KXGA 3V99A 5CF1A 4CDLA 1N9EA 1C54A 3KSED 3K63A 3AHWA 1ASKA 4FR9A 5CXOA 2XRXB 1KQS2 3F14A 1WMNA 3KSPA 3HIGA 1W2ZA 3AMOA 5BXQA 1UGHI 1UCJA 3AGNA 3EHCA 2OCTA 1BSEA 2QGUA 3G0KA 1W01A 2YFLB 3ALAA 4OK0A 1Q9EA 1BANA 1FGOA 1CEWI 1W00A 4N6MA 3DH2A 1M1K4 3X41A 4LMIA 1IV9A 3NXJA 4GSPA 3RGRA 3ROBA 1A90A 1M9GA 2JDIH 3BLZA 1FGTA 1YVSA 4KFFA 3I563 4HZ9B 4J5KA 4X2HA 1NWWA 1HU9A 2W56B 1FW7A 1Q7HA 3FZWA 3RGAA 4BIRA 2OTJ3 1GOVA 3KKGA 1QVG2 1GOUA 1RGAA 4K61A 1EQKA 4GB5A 1VQQA 3RDEA 1ZX2A 4K1UA 3NUVA 4MMYB 1W02A 1YGWA 4CCVA 3IJEB 5AEUB 3SOYA 1X1WA 3JUOA 4O3VA 1QAFA 2BO9B 3GRDA 4HOHA 3CME3 1J2BA 5D83A 1RN4A 3BNBA 4R80A 8CHOA 1TFKA 1RGCA 2C4BA 2FNQA 1R4CA 4EBGA 4WYKB 1M1XB 1JZDA 3HOHA 4HM5B 5G1KA 4EXRA 1Q814 1GYBA 1JN5A 2E2VA 1I2EA 4L8PA 1W6GA 1JBRA 3SEDA 3GSPA 3HZPA 3BNEA 2A15A 3JVCA 1UUWB 1JV2B 2F99A 3G8ZA 4MMZB 1K28A 3U1WA 1IQXA 5IG0A 4IPBA 1RGGA 1BNJA 4NREA 2HOHA 1SIHA 2C10A 1UUGB 2CFDA 3S27A 3OWSA 3MSOA 2YX9A 1YHQ3 4PEJA 1FGMA 2KF6A 1CH0A 3FF0A 4WHAA 1RNBA 2KAAA 2Y74A 3KIIA 1JKGB 5IG4A 1A2KA 3FG3A 4L8OA 1B21A 5IEPA 5D82A 2CHCA 4U13A 3NBBA 1UDII 2CC3A 1BAOA 3DUKA 1JB4A 2CWTA 3NV0A 5AIIA 5M19A 1B20A 3GZYB 2I9WA 1DMMA 1OPYA 4N6NB 1YIJ3 1BNRA 2KF3A 3V92A 2RCDA 1X1UA 1IVUA 1RRLA 2E2UA 1W6CA 3ER7A 3FG4A 5CK6A 3WODG 1AV4A 1C7HA 2AADA 2CG0A 1X1XA 2XF3A 1UUVB 2BIRA 1BUQA 2WOHA 3WA3A 4EC6A 1G96A 3KFQC 4N6V0 4MMXB 4CPKA 1N9JA 2AAEA 2CIUA 3K5TA 3CXC2 5AIHA 1R4YA 2F98A 1ULJB 4KVHA 1V57A 1STDA 2XSOB 3DGOA 1W4NA 1OH0A 4WP5A 2CWVA 2K0MA 4XM4A 3L0RA 2INXA 3H51A 1EG9B 2WO0A 1SJWA 3MG3A 3OXAA 4LSOA 3X40A 9RNTA 3B4OA 3RNTA 3B7CA 3T8UA 5AIGA 3WDGB 1DVDA 3D79A 1WTHA 3MKIA 4J8TA 3S28A 1EUIC 4R4KA 1RRHA 1TRPA 2GXFA 3KN4A 3K0ZA 1ISKA 2HMKB 1IVVA 2HMJB 4I4KA 1FYSA 3QK9A 2CWUA 5KP4A 1DVCA 4STDA 3GAXA 3D5GA 2UUGC 4N6LA 3G6E3 3BNCA 3GZBA 1RCKA 5EEOA 1OHSA 2F4YA 4BL2A 5IENA 2IY2A 4HKVB 1RGFA 1LOWA 2HMOB 1VZZA 3GZRA 3T0UA 4ZM8A 1MGRA 2L1SA 3MHEA 1VQ83 3WR2A 1B3SA 2RBIA 5ELUA 3VF1A 4LYLB 3DGNA 5CLKA 2F56A 2O9UX 1BVIA 1RTUA 3F40A 1RGHA 1FZUA 1UI8A 1TTOA 3EX9A 3PCSA 5BU4A 1A67A 4L7KA 1A2PA 1B2XA 1IK3A 1JJ22 1T2IA 3NQYA 3EQQB 1TFOA 2W9QA 4AKZA 2V1LA 2W9PA 7STDA 1WQLB 1VQ73 2OOVC 4FMBA 5STDA 3UNLA 3SOAA
chains in the Genus database with same CATH topology
1BRHA 1BSDA 1GMQA 1YGWA 1X1WA 3DGYA 4HOHA 1B2SA 1RN4A 4RNTA 1RN1A 5BIRA 1RGCA 3AHSA 2C4BA 7RNTA 3HOHA 1BRIA 4BU4A 3A5EA 1I2EA 1UCLA 1JBRA 3GSPA 1GMRA 1YNVX 4J5GA 6RNTA 1BIRA 1RGKA 1BNEA 1ZGXA 3D5IA 1BSAA 2BU4A 1RGGA 4GHOA 1BNJA 1BSCA 2HOHA 1GMPA 1GSPA 7GSPA 1UCIA 3WHOA 1I2GA 1RDSA 1BOXA 3SYUA 1RGEA 2F5WA 8RNTA 1FUTA 2KF6A 1CH0A 1I70A 1RNBA 1BRGA 2KAAA 4HAAA 1FUSA 1B21A 1DETA 1BSBA 1I8VA 2GSPA 1BNIA 3BIRA 1RGLA 1B2UA 1PY3A 1BAOA 2SARA 1B2ZA 1B20A 1BNSA 3AGOA 5GSPA 3Q3FA 1IYYA 1RLSA 1MGWA 1PYLA 2ZA4A 1BNRA 2KF3A 1BRNL 1T2HA 1X1UA 1LOYA 1G02A 2AADA 1TRQA 2KF4A 1X1XA 1I3FA 2BIRA 3KCHA 1I0XA 3D4AA 1RSNA 1I3IA 1BNGA 1X1YA 2AAEA 1LOVA 1BRJA 5HOHA 1R4YA 6GSPA 1I2FA 1RCLA 1JBTA 9RNTA 1LRAA 1RMSA 3RNTA 1HZ1A 1C54A 1JBSA 3AHWA 1UCKA 3BU4A 1BU4A 1TRPA 1FYSA 1BRSA 1UCJA 1BRKA 3AGNA 2F5MA 3D5GA 1BUJA 1BNFA 1BSEA 1BGSA 1LNIA 1RCKA 1Q9EA 2F4YA 1AY7A 1BANA 3URPA 5RNTA 1HYFA 3DH2A 1RGFA 1LOWA 1AQZA 1MGRA 4GSPA 3WR2A 1B3SA 2RBIA 1B27A 2F56A 1B2MA 1YVSA 1BVIA 1GOYA 1RTUA 1RGHA 1FZUA 2RNTA 1TTOA 5BU4A 1DE3A 4J5KA 1A2PA 1B2XA 1T2IA 1FW7A 1SARA 2KF5A 1RNTA 4BIRA 1GOVA 1GOUA 1I0VA 1RGAA 1RHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRH A;  1BSD A;  1GMQ A;  1YGW A;  1X1W A;  3DGY A;  4HOH A;  1B2S A;  1RN4 A;  4RNT A;  1RN1 A;  5BIR A;  1RGC A;  3AHS A;  2C4B A;  7RNT A;  3HOH A;  1BRI A;  4BU4 A;  3A5E A;  1I2E A;  1UCL A;  1JBR A;  3GSP A;  1GMR A;  1YNV X;  4J5G A;  6RNT A;  1BIR A;  1RGK A;  1BNE A;  1ZGX A;  3D5I A;  1BSA A;  2BU4 A;  1RGG A;  4GHO A;  1BNJ A;  1BSC A;  2HOH A;  1GMP A;  1GSP A;  7GSP A;  1UCI A;  3WHO A;  1I2G A;  1RDS A;  1BOX A;  3SYU A;  1RGE A;  2F5W A;  8RNT A;  1FUT A;  2KF6 A;  1CH0 A;  1I70 A;  1RNB A;  1BRG A;  2KAA A;  4HAA A;  1FUS A;  1B21 A;  1DET A;  1BSB A;  1I8V A;  2GSP A;  1BNI A;  3BIR A;  1RGL A;  1B2U A;  1PY3 A;  1BAO A;  2SAR A;  1B2Z A;  1B20 A;  1BNS A;  3AGO A;  5GSP A;  3Q3F A;  1IYY A;  1RLS A;  1MGW A;  1PYL A;  2ZA4 A;  1BNR A;  2KF3 A;  1BRN L;  1T2H A;  1X1U A;  1LOY A;  1G02 A;  2AAD A;  1TRQ A;  2KF4 A;  1X1X A;  1I3F A;  2BIR A;  3KCH A;  1I0X A;  3D4A A;  1RSN A;  1I3I A;  1BNG A;  1X1Y A;  2AAE A;  1LOV A;  1BRJ A;  5HOH A;  1R4Y A;  6GSP A;  1I2F A;  1RCL A;  1JBT A;  9RNT A;  1LRA A;  1RMS A;  3RNT A;  1HZ1 A;  1C54 A;  1JBS A;  3AHW A;  1UCK A;  3BU4 A;  1BU4 A;  1TRP A;  1FYS A;  1BRS A;  1UCJ A;  1BRK A;  3AGN A;  2F5M A;  3D5G A;  1BUJ A;  1BNF A;  1BSE A;  1BGS A;  1LNI A;  1RCK A;  1Q9E A;  2F4Y A;  1AY7 A;  1BAN A;  3URP A;  5RNT A;  1HYF A;  3DH2 A;  1RGF A;  1LOW A;  1AQZ A;  1MGR A;  4GSP A;  3WR2 A;  1B3S A;  2RBI A;  1B27 A;  2F56 A;  1B2M A;  1YVS A;  1BVI A;  1GOY A;  1RTU A;  1RGH A;  1FZU A;  2RNT A;  1TTO A;  5BU4 A;  1DE3 A;  4J5K A;  1A2P A;  1B2X A;  1T2I A;  1FW7 A;  1SAR A;  2KF5 A;  1RNT A;  4BIR A;  1GOV A;  1GOU A;  1I0V A;  1RGA A;  1RHL A; 
#chains in the Genus database with same CATH topology
 4R1K A;  1VQ6 3;  1PU4 A;  1DYU A;  3SLU A;  3UL6 A;  1BSD A;  3CNM A;  1U8C B;  1GMQ A;  1ZO2 A;  3F7X A;  3PYJ A;  4R9L A;  2Z76 A;  2OOV A;  3DGY A;  3MPH A;  2XEP A;  1K73 4;  3CMA 3;  4RNT A;  4QWT A;  5BIR A;  3UL5 A;  1IU7 A;  3AHS A;  3KE7 A;  4XDV A;  4RNZ A;  2CH9 A;  3MWZ A;  1T5Y A;  4KFD A;  5IEO A;  1WMP A;  3A5E A;  3K7C A;  1IT7 A;  1W7C A;  2BMO B;  4HM2 B;  3B4P A;  3S67 A;  2JQ5 A;  2RGQ A;  6RNT A;  1W2B 2;  1YNV X;  4J5G A;  1RGK A;  1UGI A;  5G1L A;  1ULI B;  5DRV A;  3GZX B;  1OHP A;  4HM4 B;  1OAC A;  5HGR A;  3WOE B;  1N5P A;  2BU4 A;  1JB5 A;  3CNX A;  3DMC A;  4GHO A;  2M7O A;  2XGN A;  2MC8 A;  3S5C A;  2GBW B;  5KP3 A;  1GD3 A;  1KSI A;  1UCI A;  2GU1 A;  4XB5 A;  1Y4K A;  5EQL A;  3WHO A;  3CPW 2;  1YIT 3;  1NO3 A;  1VQ4 3;  4XBT A;  2F5W A;  3KZT A;  3NM7 A;  3FGY A;  2W2C A;  4BTX A;  1OGX A;  3NM2 A;  1QVF 2;  2WOF A;  1Q40 A;  4H3U A;  2CKF B;  2KRT A;  2W04 A;  3OWU A;  1I8V A;  4O02 B;  3CC4 3;  3UB1 A;  2XFS A;  1BNI A;  3MG2 A;  2BMQ B;  4HYZ A;  1E3V A;  1RGL A;  3HX8 A;  4RNY A;  3ECF A;  3H3H A;  2BT3 A;  3DY5 A;  5D81 A;  2SAR A;  3OV4 A;  1TIJ A;  2GU3 A;  1BNS A;  3AGO A;  5A0O B;  1IYY A;  1MGW A;  4N3V A;  4FCJ A;  4HM7 B;  2HMN B;  1BRN L;  5M1A A;  1RKY A;  1G02 A;  3STD A;  4EYC A;  1TRQ A;  4K90 B;  1EEJ A;  1MWU A;  2XR8 B;  4HBR A;  3KCH A;  1O7G B;  4ORL A;  1I0X A;  2LYX A;  3D4A A;  5AIF A;  3CCE 3;  1GY6 A;  1K41 A;  4KT3 B;  2RSX A;  1I3I A;  4TX4 A;  1X1Y A;  4O8S A;  3EB8 A;  1OCV A;  2ZL8 A;  5JPP A;  2C11 A;  4EW5 A;  1NU3 A;  1Q82 4;  2P09 A;  5BVB A;  1I2F A;  1TU5 A;  3CD6 3;  2BHM A;  3QRD A;  2IYJ A;  3X3X A;  3OX9 A;  1CYV A;  3CCU 3;  3PCR A;  1JBS A;  4OVM A;  3Q90 A;  3ZG5 A;  3O8Y A;  1UCK A;  1K9M 4;  2PZV A;  3BU4 A;  2OWP A;  3CC2 3;  1BU4 A;  3LTD A;  3MYT A;  1L5G B;  3X3Y A;  3CU3 A;  1QMA A;  5LC6 A;  1KWI A;  1TJD A;  3SX1 A;  1TUH A;  3K9M C;  3CCS 3;  1QJG A;  1VQ9 3;  1BNF A;  3HK4 A;  1BGS A;  1HKX A;  2Q07 A;  1VQP 3;  1AY7 A;  1YVB I;  3URP A;  4RBN A;  3X42 A;  1HYF A;  1MWT A;  4BTY A;  2QEX 3;  1IT8 A;  1D6U A;  5IG5 A;  1JZO A;  2PNC A;  1GY7 A;  2RFR A;  2D42 A;  2W56 A;  4N6T A;  3I55 3;  3AMO B;  1TP6 A;  1AVK A;  3JUQ A;  4HJL B;  3BND A;  2RNT A;  5LC7 A;  2L4V A;  5AI1 A;  4FMD A;  2XGL A;  3JUM A;  2KF5 A;  4H61 A;  4JRF A;  1VQN 3;  1D6Y A;  3PZW A;  2K3D A;  1I0V A;  1DE3 A;  3N9H A;  1NB3 I;  1BRH A;  1S5A A;  1IQ8 A;  1MWR A;  2B24 B;  3IPT A;  4X2O A;  3LXU X;  5JPU A;  2CX0 A;  1PFP A;  3MG1 A;  3ZFZ A;  2XSH B;  2Z7A A;  4N6U A;  1B2S A;  3EF8 A;  1CYU A;  3TDG A;  1W5Z A;  2CG1 A;  3PS8 A;  1RN1 A;  1SII A;  2UX0 A;  2Z6B A;  2CFG A;  3NBJ A;  5IG3 A;  1W6Y A;  2R4I A;  3LT9 A;  2K54 A;  4BTW A;  7RNT A;  1U5O A;  1LNH A;  2CK3 H;  4BU4 A;  3CCL 3;  5M18 A;  1O7M B;  1UCL A;  5KP1 A;  3DZL A;  1BIR A;  1Q40 B;  1CQS A;  1BNE A;  1NNV A;  2CX1 A;  1WNH A;  3LH4 A;  1OGZ A;  2FXT A;  1IVX A;  3D3L A;  1BSA A;  2XFT A;  1FGQ A;  1JKG A;  4RZM A;  5I97 A;  1JN5 B;  1M90 4;  1GMP A;  2H0I A;  1V74 A;  2QIY A;  5IW9 A;  1IVW A;  1VQK 3;  1NB5 I;  1VQO 3;  1RDS A;  1BOX A;  1MOL A;  1MNL A;  1RGE A;  3SYU A;  8RNT A;  1RJO A;  1FUT A;  2HML B;  3FSD A;  5TGN A;  1SPU A;  1BRG A;  3CCV 3;  3JUP A;  4OUQ A;  2W0Q A;  1FUS A;  3LT8 A;  2ZHX B;  4IIA A;  1BSB A;  4WFO A;  3BB9 A;  3BIR A;  4LEH A;  4LZI A;  1B2U A;  1ROV A;  1UI7 A;  4FCM A;  5CF2 A;  1IDP A;  4FMA A;  1B2Z A;  2B1X B;  4HM3 B;  3WA2 X;  4MEI A;  2IUK A;  5GSP A;  3DGM A;  3Q3F A;  4HM1 B;  2ZA4 A;  1YJN 3;  2W6J H;  4AEQ A;  3EN8 A;  1T2H A;  2YFI B;  3J7Y d;  3T8N A;  1FA3 A;  1V58 A;  1OF5 A;  3EBY A;  5AYS C;  1Q7Y 4;  1I3F A;  1Q42 A;  2GEX A;  3D9R A;  3FLJ A;  3HI7 A;  3NV0 B;  3G71 3;  2FGT A;  2W03 A;  5AYR B;  4FCZ A;  2F86 B;  1BNG A;  2IA7 A;  4AKY A;  5FW5 A;  1JNQ A;  1LOV A;  3LZA A;  3EC9 A;  5DRE A;  1AVL A;  1BRJ A;  3ZG0 A;  5HOH A;  1JRQ A;  4HVN A;  3SVA A;  3IMA B;  1RCL A;  1NJI 4;  1QAK A;  1JBT A;  4KFE A;  3WOF B;  1LRA A;  1RMS A;  2HMM B;  1US1 A;  3LML A;  3NHX A;  1HZ1 A;  4G1M B;  1QAL A;  3DGL A;  2D1W A;  2QA4 3;  2CFK A;  1A2V A;  3FCS B;  3CCM 3;  1N5H A;  3OWY A;  1BRS A;  3F9S A;  3HII A;  3NBR A;  1BRK A;  4WWU C;  3LTB A;  2F5M A;  1G0T A;  1BUJ A;  2UGI A;  1LNI A;  1ZS7 A;  5RNT A;  3CCJ 3;  3WMD A;  2P05 A;  3B8L A;  1AQZ A;  3DM8 A;  2ZDJ A;  6STD A;  4Q53 A;  1E97 A;  1T3B A;  3PXM A;  1KD1 4;  1E3R A;  1OUN A;  5FGO A;  1B27 A;  1EA2 A;  4XBX A;  1B2M A;  1GOY A;  3CCQ 3;  2SBL A;  2IUJ A;  5G2G A;  4CJN A;  3FF2 A;  5JBS A;  4EV2 A;  2WGO A;  1SAR A;  3F8X A;  3LYG A;  4HM6 B;  4NHF A;  1RNT A;  2ML5 A;  3FG1 A;  2E2T A;  2YFJ B;  2GBX B;  1RHL A;  3VGN A;  1O7N B;  4EV5 A;  4ILF A;  2CW9 A;  4O2H A;  5EVH A;  2WGQ A;  4JF8 A;  1FGR A;  3V98 A;  3X3Z A;  1STF I;  1YGE A;  3S29 A;  3U97 A;  4XBY A;  3PGB A;  4MJD A;  3GWR A;  1LQG C;  2P0X A;  4BL3 A;  1O7W B;  3N54 B;  1BRI A;  3A76 A;  3M8C A;  3VSY A;  1YI2 3;  2CFW A;  1VQ5 3;  1O7H B;  2CFL A;  1AR0 A;  2BMR B;  3CCR 3;  4HZB B;  4XDW A;  3SXX A;  3EJV A;  1GMR A;  2LQV A;  3CPO A;  1S72 3;  2IMJ A;  4IT7 A;  2OTL 3;  1ZGX A;  1RN7 A;  2P38 A;  3LTA A;  3D5I A;  1Q86 4;  1N8R 4;  1OHO A;  1BSC A;  1NDO B;  3G16 A;  4HM8 B;  1VQL 3;  3DXO A;  4WYK A;  1LVN A;  1GSP A;  7GSP A;  5ELJ A;  3NQZ A;  3I0Y A;  1EKM A;  1I2G A;  4FMC A;  2O3O A;  4GL6 A;  1UW1 A;  2H0H A;  1I70 A;  1Z1S A;  1VQM 3;  3CC7 3;  3Q2P A;  1FUW A;  4HAA A;  4J9A A;  5IF6 A;  1OF5 B;  1WMO A;  1DET A;  4KZ1 A;  3F8H A;  2GSP A;  2GEY A;  3E99 A;  3LTC A;  1YJW 3;  2BNG A;  1PY3 A;  2Y73 A;  1SQW A;  3EBT A;  3JUN A;  1DMN A;  3FKA A;  3EE1 A;  3EN1 B;  2KCD A;  1F8N A;  2J8X B;  4K1V A;  1RLS A;  4R9K A;  1PYL A;  3FH1 A;  1LOX A;  3Q1C A;  1LOY A;  1O7P B;  1GS3 A;  5AEW B;  1IQY A;  1YJ9 3;  2XH9 A;  1GY5 A;  2KF4 A;  2R41 A;  3N8B A;  4NPB A;  2ML6 A;  4DKI A;  1DMQ A;  1RSN A;  2OQE C;  1K8A 4;  3F7S A;  1JB2 A;  3LOY A;  1MWS A;  2H0G A;  1ROA A;  1GD4 A;  2MF7 A;  4I5Q A;  3UJM A;  2OQE A;  1LXE A;  2Z77 A;  2STD A;  6GSP A;  4HM0 B;  1KC8 4;  2P0M A;  3OW2 2;  1D6Z A;  3G4S 3;  5IER A;  1IV7 A;  1LQM B;  4LGQ A;  4N6O B;  3NX0 A;  1N8Q A;  2KXG A;  3V99 A;  5CF1 A;  4CDL A;  1N9E A;  1C54 A;  3KSE D;  3K63 A;  3AHW A;  1ASK A;  4FR9 A;  5CXO A;  2XRX B;  1KQS 2;  3F14 A;  1WMN A;  3KSP A;  3HIG A;  1W2Z A;  3AMO A;  5BXQ A;  1UGH I;  1UCJ A;  3AGN A;  3EHC A;  2OCT A;  1BSE A;  2QGU A;  3G0K A;  1W01 A;  2YFL B;  3ALA A;  4OK0 A;  1Q9E A;  1BAN A;  1FGO A;  1CEW I;  1W00 A;  4N6M A;  3DH2 A;  1M1K 4;  3X41 A;  4LMI A;  1IV9 A;  3NXJ A;  4GSP A;  3RGR A;  3ROB A;  1A90 A;  1M9G A;  2JDI H;  3BLZ A;  1FGT A;  1YVS A;  4KFF A;  3I56 3;  4HZ9 B;  4J5K A;  4X2H A;  1NWW A;  1HU9 A;  2W56 B;  1FW7 A;  1Q7H A;  3FZW A;  3RGA A;  4BIR A;  2OTJ 3;  1GOV A;  3KKG A;  1QVG 2;  1GOU A;  1RGA A;  4K61 A;  1EQK A;  4GB5 A;  1VQQ A;  3RDE A;  1ZX2 A;  4K1U A;  3NUV A;  4MMY B;  1W02 A;  1YGW A;  4CCV A;  3IJE B;  5AEU B;  3SOY A;  1X1W A;  3JUO A;  4O3V A;  1QAF A;  2BO9 B;  3GRD A;  4HOH A;  3CME 3;  1J2B A;  5D83 A;  1RN4 A;  3BNB A;  4R80 A;  8CHO A;  1TFK A;  1RGC A;  2C4B A;  2FNQ A;  1R4C A;  4EBG A;  4WYK B;  1M1X B;  1JZD A;  3HOH A;  4HM5 B;  5G1K A;  4EXR A;  1Q81 4;  1GYB A;  1JN5 A;  2E2V A;  1I2E A;  4L8P A;  1W6G A;  1JBR A;  3SED A;  3GSP A;  3HZP A;  3BNE A;  2A15 A;  3JVC A;  1UUW B;  1JV2 B;  2F99 A;  3G8Z A;  4MMZ B;  1K28 A;  3U1W A;  1IQX A;  5IG0 A;  4IPB A;  1RGG A;  1BNJ A;  4NRE A;  2HOH A;  1SIH A;  2C10 A;  1UUG B;  2CFD A;  3S27 A;  3OWS A;  3MSO A;  2YX9 A;  1YHQ 3;  4PEJ A;  1FGM A;  2KF6 A;  1CH0 A;  3FF0 A;  4WHA A;  1RNB A;  2KAA A;  2Y74 A;  3KII A;  1JKG B;  5IG4 A;  1A2K A;  3FG3 A;  4L8O A;  1B21 A;  5IEP A;  5D82 A;  2CHC A;  4U13 A;  3NBB A;  1UDI I;  2CC3 A;  1BAO A;  3DUK A;  1JB4 A;  2CWT A;  3NV0 A;  5AII A;  5M19 A;  1B20 A;  3GZY B;  2I9W A;  1DMM A;  1OPY A;  4N6N B;  1YIJ 3;  1BNR A;  2KF3 A;  3V92 A;  2RCD A;  1X1U A;  1IVU A;  1RRL A;  2E2U A;  1W6C A;  3ER7 A;  3FG4 A;  5CK6 A;  3WOD G;  1AV4 A;  1C7H A;  2AAD A;  2CG0 A;  1X1X A;  2XF3 A;  1UUV B;  2BIR A;  1BUQ A;  2WOH A;  3WA3 A;  4EC6 A;  1G96 A;  3KFQ C;  4N6V 0;  4MMX B;  4CPK A;  1N9J A;  2AAE A;  2CIU A;  3K5T A;  3CXC 2;  5AIH A;  1R4Y A;  2F98 A;  1ULJ B;  4KVH A;  1V57 A;  1STD A;  2XSO B;  3DGO A;  1W4N A;  1OH0 A;  4WP5 A;  2CWV A;  2K0M A;  4XM4 A;  3L0R A;  2INX A;  3H51 A;  1EG9 B;  2WO0 A;  1SJW A;  3MG3 A;  3OXA A;  4LSO A;  3X40 A;  9RNT A;  3B4O A;  3RNT A;  3B7C A;  3T8U A;  5AIG A;  3WDG B;  1DVD A;  3D79 A;  1WTH A;  3MKI A;  4J8T A;  3S28 A;  1EUI C;  4R4K A;  1RRH A;  1TRP A;  2GXF A;  3KN4 A;  3K0Z A;  1ISK A;  2HMK B;  1IVV A;  2HMJ B;  4I4K A;  1FYS A;  3QK9 A;  2CWU A;  5KP4 A;  1DVC A;  4STD A;  3GAX A;  3D5G A;  2UUG C;  4N6L A;  3G6E 3;  3BNC A;  3GZB A;  1RCK A;  5EEO A;  1OHS A;  2F4Y A;  4BL2 A;  5IEN A;  2IY2 A;  4HKV B;  1RGF A;  1LOW A;  2HMO B;  1VZZ A;  3GZR A;  3T0U A;  4ZM8 A;  1MGR A;  2L1S A;  3MHE A;  1VQ8 3;  3WR2 A;  1B3S A;  2RBI A;  5ELU A;  3VF1 A;  4LYL B;  3DGN A;  5CLK A;  2F56 A;  2O9U X;  1BVI A;  1RTU A;  3F40 A;  1RGH A;  1FZU A;  1UI8 A;  1TTO A;  3EX9 A;  3PCS A;  5BU4 A;  1A67 A;  4L7K A;  1A2P A;  1B2X A;  1IK3 A;  1JJ2 2;  1T2I A;  3NQY A;  3EQQ B;  1TFO A;  2W9Q A;  4AKZ A;  2V1L A;  2W9P A;  7STD A;  1WQL B;  1VQ7 3;  2OOV C;  4FMB A;  5STD A;  3UNL A;  3SOA A; 
#chains in the Genus database with same CATH homology
 1BRH A;  1BSD A;  1GMQ A;  1YGW A;  1X1W A;  3DGY A;  4HOH A;  1B2S A;  1RN4 A;  4RNT A;  1RN1 A;  5BIR A;  1RGC A;  3AHS A;  2C4B A;  7RNT A;  3HOH A;  1BRI A;  4BU4 A;  3A5E A;  1I2E A;  1UCL A;  1JBR A;  3GSP A;  1GMR A;  1YNV X;  4J5G A;  6RNT A;  1BIR A;  1RGK A;  1BNE A;  1ZGX A;  3D5I A;  1BSA A;  2BU4 A;  1RGG A;  4GHO A;  1BNJ A;  1BSC A;  2HOH A;  1GMP A;  1GSP A;  7GSP A;  1UCI A;  3WHO A;  1I2G A;  1RDS A;  1BOX A;  3SYU A;  1RGE A;  2F5W A;  8RNT A;  1FUT A;  2KF6 A;  1CH0 A;  1I70 A;  1RNB A;  1BRG A;  2KAA A;  4HAA A;  1FUS A;  1B21 A;  1DET A;  1BSB A;  1I8V A;  2GSP A;  1BNI A;  3BIR A;  1RGL A;  1B2U A;  1PY3 A;  1BAO A;  2SAR A;  1B2Z A;  1B20 A;  1BNS A;  3AGO A;  5GSP A;  3Q3F A;  1IYY A;  1RLS A;  1MGW A;  1PYL A;  2ZA4 A;  1BNR A;  2KF3 A;  1BRN L;  1T2H A;  1X1U A;  1LOY A;  1G02 A;  2AAD A;  1TRQ A;  2KF4 A;  1X1X A;  1I3F A;  2BIR A;  3KCH A;  1I0X A;  3D4A A;  1RSN A;  1I3I A;  1BNG A;  1X1Y A;  2AAE A;  1LOV A;  1BRJ A;  5HOH A;  1R4Y A;  6GSP A;  1I2F A;  1RCL A;  1JBT A;  9RNT A;  1LRA A;  1RMS A;  3RNT A;  1HZ1 A;  1C54 A;  1JBS A;  3AHW A;  1UCK A;  3BU4 A;  1BU4 A;  1TRP A;  1FYS A;  1BRS A;  1UCJ A;  1BRK A;  3AGN A;  2F5M A;  3D5G A;  1BUJ A;  1BNF A;  1BSE A;  1BGS A;  1LNI A;  1RCK A;  1Q9E A;  2F4Y A;  1AY7 A;  1BAN A;  3URP A;  5RNT A;  1HYF A;  3DH2 A;  1RGF A;  1LOW A;  1AQZ A;  1MGR A;  4GSP A;  3WR2 A;  1B3S A;  2RBI A;  1B27 A;  2F56 A;  1B2M A;  1YVS A;  1BVI A;  1GOY A;  1RTU A;  1RGH A;  1FZU A;  2RNT A;  1TTO A;  5BU4 A;  1DE3 A;  4J5K A;  1A2P A;  1B2X A;  1T2I A;  1FW7 A;  1SAR A;  2KF5 A;  1RNT A;  4BIR A;  1GOV A;  1GOU A;  1I0V A;  1RGA A;  1RHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...