1I2EA

Ribonuclease t1 v16a mutant, form i
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i2eA00
1I3FA 1HZ1A 1T2IA 1BRKA 3D5GA 1GSPA 3KCHA 1FW7A 1BSBA 1RNTA 1RGLA 2KF6A 1JBRA 1SARA 1IYYA 1HYFA 1GOVA 1A2PA 2KF4A 7RNTA 1I70A 1YNVX 1BRHA 2AADA 1RCKA 3HOHA 3URPA 1RHLA 1BGSA 1FZUA 2AAEA 2F5WA 3AHSA 5RNTA 1PYLA 1JBSA 1MGRA 1LOYA 1BNRA 1I8VA 1RDSA 3RNTA 9RNTA 5HOHA 4J5KA 4J5GA 4HAAA 1RGKA 3D5IA 1RCLA 1GMQA 1JBTA 1GMRA 1BAOA 1C54A 1I0XA 1LNIA 1B20A 1RGCA 3D4AA 1B2ZA 1RNBA 1I3IA 4BIRA 1BRSA 1GOUA 1YGWA 8RNTA 1ZGXA 5BU4A 1BNGA 1B2SA 1BSEA 1RGEA 1PY3A 3AGOA 1I2EA 1GOYA 1UCKA 3BIRA 1RSNA 3BU4A 1B2UA 1TRQA 2KF3A 1RN4A 1BNJA 1CH0A 2HOHA 1LOVA 3DH2A 3DGYA 2F56A 1BSDA 1B21A 1BNSA 1Q9EA 1RGAA 1T2HA 3AHWA 1FUTA 1FYSA 2KF5A 1BNIA 2RBIA 2RNTA 1BSAA 3WR2A 4RNTA 1BU4A 4HOHA 3AGNA 5GSPA 6RNTA 2F5MA 1I0VA 1AY7A 1BRIA 1BNFA 2F4YA 1RLSA 1BRGA 1BOXA 1UCJA 3A5EA 1FUSA 1YVSA 1BIRA 3SYUA 1X1YA 7GSPA 3GSPA 1X1UA 1UCLA 1RN1A 1X1XA 1BRJA 3WHOA 1BRNL 1X1WA 1UCIA 1LRAA 1BVIA 1LOWA 1BSCA 1GMPA 1B2XA 1B3SA 2BU4A 1BUJA 1R4YA 1I2GA 1RTUA 1MGWA 1TRPA 6GSPA 2ZA4A 1DETA 4BU4A 4GSPA 2SARA 1B27A 1TTOA 2KAAA 2BIRA 1I2FA 3Q3FA 1RGGA 1DE3A 1AQZA 1BANA 1RMSA 2GSPA 5BIRA 1G02A 2C4BA 1RGHA 4GHOA 1BNEA 1RGFA 1B2MA
chains in the Genus database with same CATH superfamily
1OF5B 1A67A 3T0UA 2HMLB 1JNQA 1UDII 4AKYA 3EF8A 1OH0A 4FMCA 4G1MB 3D5GA 1JKGA 3JUNA 1GSPA 3DUKA 1C7HA 4KZ1A 2P09A 1VQM3 1O7GB 3J7Yd 1VQ63 4R9LA 1JJ22 2GU1A 3KE7A 4FCJA 4HM5B 1W7CA 3D3LA 1WMPA 3F14A 1A2PA 2KF4A 3K5TA 2GBWB 1M1XB 3F8HA 1GD3A 1IQ8A 3H51A 1BRHA 3VGNA 1MWRA 3URPA 1RHLA 1BGSA 1FZUA 3K0ZA 2AAEA 2F5WA 2MF7A 1DMNA 3CCS3 1PYLA 4J8TA 1M1K4 1MGRA 1LOYA 1RJOA 2CX1A 2IYJA 4FCZA 1I8VA 1NO3A 1W01A 4AKZA 4BTWA 2XF3A 3SEDA 9RNTA 4FR9A 5HOHA 2WGQA 4J5GA 5JBSA 1VQP3 1RCLA 3GAXA 1VZZA 1US1A 2CFLA 3IJEB 7STDA 5IG5A 3ALAA 4HM1B 1LNIA 1B20A 2F98A 4AEQA 4LZIA 4BIRA 4RBNA 4CJNA 4OK0A 1GOUA 1FA3A 3ZFZA 1YGWA 2W56A 4HM3B 3EHCA 4GL6A 2K54A 3X3XA 1BNGA 1WMOA 3JVCA 1VQ43 1BSEA 1GY6A 3MKIA 4HM4B 3SX1A 5M19A 3LOYA 1UCKA 4KT3B 3VSYA 2XGNA 3S29A 4QWTA 1VQ53 5AI1A 1NNVA 1IVUA 3KIIA 3FGYA 1TRQA 5STDA 2CFWA 4HM2B 1PU4A 1JRQA 3M8CA 1IU7A 4NHFA 2ZHXB 1A90A 3LTBA 3MHEA 3DGYA 2R41A 3CPOA 3S28A 4JF8A 1NB5I 2RFRA 2P0XA 3IPTA 2KCDA 1W5ZA 1RGAA 2K3DA 4N6TA 3SXXA 1FYSA 1Q40B 4HJLB 3FKAA 3NQZA 1MNLA 1Q7Y4 1A2KA 1LNHA 1ULIB 3SVAA 1BU4A 4CPKA 3X41A 1SJWA 3DXOA 3EBYA 5GSPA 2JQ5A 1W02A 4J9AA 1I0VA 1ROVA 1AY7A 4N3VA 2F4YA 3BB9A 1BOXA 1O7WB 4HVNA 2W9PA 3V92A 3SYUA 1N5HA 1X1YA 1J2BA 2C11A 2Z77A 3BNEA 3GSPA 4HYZA 3WMDA 1X1UA 1ZO2A 2Q07A 2RSXA 3KKGA 3B4OA 1V74A 3WHOA 4RNYA 3RGAA 5CK6A 1UI7A 2CG1A 3CME3 2KXGA 5CLKA 3L0RA 4N6NB 1TRPA 6GSPA 3PZWA 1DETA 2CIUA 2H0GA 4GSPA 5FGOA 1L5GB 4BTXA 2Z76A 2SARA 1IV7A 1QAKA 1YJW3 2KAAA 1IT7A 1Z1SA 3NBBA 5ELJA 3RDEA 1FUWA 3PS8A 4XBXA 3Q3FA 4N6V0 3CCV3 1MWTA 1AQZA 4K61A 3LMLA 3HI7A 4HM7B 4L8PA 1WQLB 3HK4A 1G02A 3NM2A 1IDPA 3K63A 1GY7A 1RGHA 4LYLB 2QA43 3CCE3 2IY2A 3WA3A 1B2MA 1IK3A 5AIHA 1DVDA 3FCSB 1PFPA 1N9JA 4PEJA 1K41A 1QMAA 3UB1A 5KP1A 1HZ1A 1R4CA 3NHXA 1RN7A 3KCHA 3N8BA 4XB5A 5D83A 1FW7A 1OGZA 1RNTA 2KF6A 1VQQA 8CHOA 1Q42A 4XM4A 1GOVA 3F8XA 4HZ9B 1IQYA 3OX9A 1UGHI 3CCU3 2P0MA 2YX9A 3EE1A 3WOEB 4EXRA 1JB5A 2Y73A 4KFEA 5FW5A 5TGNA 4U13A 1O7HB 3G16A 1JBSA 5M1AA 3GZYB 4FMBA 2YFIB 1BNRA 1Q7HA 3RNTA 5A0OB 3CNXA 1ULJB 5AYSC 3OWSA 4HAAA 1RGKA 3EJVA 1CYVA 5G2GA 1NJI4 3NXJA 4LSOA 3KN4A 3CU3A 1JBTA 1GMRA 2D42A 3MG2A 1JN5A 2CWVA 2A15A 2FGTA 3KSPA 3ECFA 1I3IA 1YIJ3 3DGLA 3G4S3 2W2CA 3FG4A 3D79A 3HX8A 3CCR3 3U97A 5BXQA 1UUVB 8RNTA 1N9EA 1KQS2 3PCRA 1KWIA 1YVBI 1UI8A 1YGEA 5HGRA 2C10A 1PY3A 2CKFB 1GOYA 2Y74A 1CEWI 3CCM3 1TP6A 3STDA 3G713 1W6YA 3QRDA 3G0KA 4R80A 1OF5A 5IG0A 4BL3A 1CH0A 3LYGA 1YIT3 1EQKA 2O3OA 3DH2A 4Q53A 3CCL3 3PCSA 4K90B 1VQK3 2F56A 4I5QA 1BSDA 2B1XB 2KRTA 3PXMA 1O7MB 4MMXB 1B21A 3S27A 1T3BA 3EC9A 1Q9EA 3NQYA 4KFDA 3AHWA 1FUTA 2KF5A 4EBGA 2OTJ3 2XFSA 2QIYA 1IQXA 4WYKB 4BL2A 3DGOA 3SLUA 3MWZA 1OPYA 3A76A 6RNTA 1E97A 3CD63 5KP4A 2E2VA 2F5MA 2OWPA 3T8NA 1BRIA 2M7OA 4IIAA 1RLSA 1QJGA 1QALA 1K28A 3A5EA 1FUSA 1BIRA 1QVF2 3X40A 7GSPA 2GEXA 3EQQB 1EG9B 1UCLA 3CC23 4CCVA 1BRJA 5AEWB 1EUIC 2XR8B 1LRAA 2L1SA 1W00A 1K8A4 1B3SA 3CMA3 3G8ZA 1W4NA 2HMKB 4O3VA 2Z7AA 4EYCA 2J8XB 2W03A 2UUGC 5G1LA 3LZAA 2RCDA 4O02B 2IA7A 2RGQA 3BNBA 3UL5A 1D6ZA 1N8QA 2HMNB 5M18A 2BIRA 3I553 3FSDA 3EB8A 1RGGA 1AVKA 3BLZA 5DREA 1BANA 1T5YA 1LXEA 3ER7A 2D1WA 2W0QA 1WMNA 4R4KA 4X2OA 5IENA 5IG3A 1O7NB 1BNEA 1KSIA 3DMCA 1JB2A 3O8YA 4HM8B 2WOHA 1I3FA 2P38A 3AMOB 3G6E3 1D6UA 2W6JH 1T2IA 1MOLA 3X42A 1BSBA 3JUQA 4KFFA 1Q40A 1RGLA 3FG1A 1JBRA 1SARA 2QEX3 1HYFA 4RZMA 4XDWA 7RNTA 3NV0B 1I70A 3I0YA 1M904 1YNVX 5JPPA 1DMMA 1S723 4ORLA 1V57A 3GRDA 2AADA 1RCKA 1UUGB 3D9RA 3HOHA 3EN8A 3K7CA 3Q1CA 4R9KA 5G1KA 3FF2A 3QK9A 3F7SA 1OHOA 3DY5A 1IVVA 1RDSA 3NBJA 1VQ83 2XSHB 4DKIA 4J5KA 2PNCA 1G96A 1GMQA 2H0HA 4N6MA 1ASKA 2XEPA 1BAOA 3LTDA 3MSOA 1F8NA 1Y4KA 2FNQA 3FH1A 4WP5A 2ML5A 3D4AA 1B2ZA 3UL6A 1C54A 1STDA 1QAFA 2INXA 3CNMA 2HMMB 1BRSA 1KC84 2SBLA 4WHAA 5BU4A 1Q824 3HIGA 2CHCA 3V99A 1WNHA 3E99A 4LEHA 1B2SA 1TUHA 2BMOB 3AGOA 3HZPA 3PGBA 3EX9A 3OXAA 3LTAA 1U8CB 2BO9B 2CK3H 3FZWA 2OQEC 3GZXB 4FMAA 4TX4A 4EW5A 4HZBB 3SOAA 1RSNA 3OV4A 3KSED 2YFJB 1B2UA 2CFGA 1IT8A 4WWUC 1WTHA 4EV5A 1W2B2 2I9WA 2KF3A 2CFDA 3NUVA 1ZS7A 1ZX2A 4O8SA 1RN4A 1BNJA 1IVWA 3GZRA 3V98A 3CC43 2HOHA 4EC6A 1GD4A 1E3RA 2XRXB 3WOFB 1NWWA 1V58A 2R4IA 1JKGB 4HM6B 1DVCA 5AIIA 3WDGB 3EN1B 2GU3A 3CC73 3OW22 3BNCA 1O7PB 1YJ93 5EEOA 3VF1A 5DRVA 2RBIA 2RNTA 1BSAA 1OHSA 3KFQC 3OWUA 1DYUA 1TJDA 5CF1A 1VQO3 4EV2A 3AGNA 4IT7A 2K0MA 1AVLA 3JUMA 5IEOA 3ROBA 2L4VA 3FF0A 4HKVB 4L7KA 2IMJA 1IVXA 1BRGA 3CCJ3 3LXUX 1YVSA 2OOVC 4MMZB 2CWTA 1GYBA 3FG3A 1CYUA 3MPHA 3DGMA 4MJDA 3DGNA 1RN1A 5EVHA 1X1XA 3B8LA 5IERA 4XDVA 2O9UX 4OUQA 1X1WA 1UCIA 3B7CA 1BVIA 1JZOA 3HIIA 4WFOA 1LOWA 2XSOB 1BSCA 1GMPA 1B2XA 1NB3I 3S5CA 1R4YA 2W56B 1G0TA 1I2GA 5AIGA 2V1LA 1RTUA 3JUOA 1U5OA 2ZA4A 4I4KA 1AR0A 1NU3A 2YFLB 4BU4A 1MWSA 1UGIA 1TTOA 2UX0A 2CFKA 1VQ93 2CWUA 3K9MC 1I2FA 5IG4A 1LVNA 1DE3A 3B4PA 2GSPA 2BNGA 5BIRA 1JZDA 3WA2X 1LOXA 1TIJA 4K1UA 4GHOA 2HMOB 1RGCA 3LT8A 2CC3A 4GB5A 3UNLA 5AIFA 4H61A 2W9QA 5LC6A 1BRKA 2WO0A 4CDLA 2UGIA 1N8R4 3F9SA 2GBXB 2HMJB 1YI23 2BMQB 5JPUA 4MMYB 1GY5A 1SIIA 1JV2B 1IYYA 4RNZA 1K9M4 4N6UA 4LGQA 4ILFA 3I563 2GEYA 3EBTA 4WYKA 1FGQA 4K1VA 1FGRA 5EQLA 5AYRB 1W6CA 3X3YA 2JDIH 2OTL3 1RKYA 4X2HA 1ROAA 1RRHA 1YJN3 3TDGA 3AHSA 1GS3A 3DZLA 5RNTA 4HM0B 3KZTA 1VQN3 2BMRB 3ZG0A 3RGRA 1OACA 2F99A 4JRFA 4FCMA 3D5IA 4ZM8A 3MYTA 4NPBA 1EEJA 3UJMA 1STFI 1A2VA 2IUJA 5IEPA 1I0XA 1S5AA 4R1KA 3T8UA 1RNBA 5I97A 1W6GA 1LQGC 2PZVA 2ZDJA 3MG1A 3S67A 1QVG2 1HU9A 1TFOA 3ZG5A 1ZGXA 1RRLA 2H0IA 2CH9A 1VQ73 5IW9A 5D81A 1RGEA 4L8OA 2CW9A 1I2EA 1OGXA 2WOFA 3LTCA 3JUPA 3PYJA 2CG0A 2Z6BA 3BIRA 3FLJA 3SOYA 1FGMA 1FGTA 3F40A 3BU4A 1SIHA 2LQVA 4NREA 2BHMA 4O2HA 1UUWB 4FMDA 3U1WA 5IF6A 2B24B 1LOVA 1UW1A 3AMOA 1OUNA 5ELUA 2W04A 4BTYA 3LT9A 1N5PA 5D82A 2OQEA 6STDA 1D6YA 3Q90A 2OCTA 1K734 3CPW2 2XH9A 1BNSA 1T2HA 3F7XA 2P05A 1M9GA 2MC8A 5KP3A 4N6LA 1JB4A 1SPUA 1BNIA 3NV0A 4KVHA 3WR2A 4RNTA 1EA2A 5BVBA 1MWUA 4IPBA 1YHQ3 1W2ZA 1AV4A 3GZBA 4LMIA 5LC7A 4HOHA 1DMQA 4OVMA 3BNDA 1BNFA 3N9HA 3DM8A 1SQWA 2E2UA 4HBRA 1UCJA 3CXC2 1NDOB 3N54B 1E3VA 3X3ZA 1BUQA 5CF2A 2CX0A 3WODG 3NBRA 3LH4A 4XBTA 1KD14 1JN5B 2ML6A 2WGOA 1CQSA 3CCQ3 1BRNL 1OCVA 2XGLA 3NM7A 2XFTA 1OHPA 3OWYA 2BU4A 5AEUB 2F86B 1BUJA 2OOVA 3IMAB 2E2TA 3GWRA 1Q864 4XBYA 3H3HA 1MGWA 2GXFA 4N6OB 1FGOA 1TFKA 2BT3A 2QGUA 1B27A 3MG3A 5CXOA 1TU5A 1EKMA 2FXTA 4MEIA 3Q2PA 1LQMB 1RMSA 2STDA 1IV9A 2ZL8A 1ISKA 2C4BA 2LYXA 1HKXA 4STDA 4H3UA 1VQL3 1RGFA 1Q814 3NX0A 2IUKA
chains in the Genus database with same CATH topology
1I3FA 1HZ1A 1T2IA 1BRKA 3D5GA 1GSPA 3KCHA 1FW7A 1BSBA 1RNTA 1RGLA 2KF6A 1JBRA 1SARA 1IYYA 1HYFA 1GOVA 1A2PA 2KF4A 7RNTA 1I70A 1YNVX 1BRHA 2AADA 1RCKA 3HOHA 3URPA 1RHLA 1BGSA 1FZUA 2AAEA 2F5WA 3AHSA 5RNTA 1PYLA 1JBSA 1MGRA 1LOYA 1BNRA 1I8VA 1RDSA 3RNTA 9RNTA 5HOHA 4J5KA 4J5GA 4HAAA 1RGKA 3D5IA 1RCLA 1GMQA 1JBTA 1GMRA 1BAOA 1C54A 1I0XA 1LNIA 1B20A 1RGCA 3D4AA 1B2ZA 1RNBA 1I3IA 4BIRA 1BRSA 1GOUA 1YGWA 8RNTA 1ZGXA 5BU4A 1BNGA 1B2SA 1BSEA 1RGEA 1PY3A 3AGOA 1I2EA 1GOYA 1UCKA 3BIRA 1RSNA 3BU4A 1B2UA 1TRQA 2KF3A 1RN4A 1BNJA 1CH0A 2HOHA 1LOVA 3DH2A 3DGYA 2F56A 1BSDA 1B21A 1BNSA 1Q9EA 1RGAA 1T2HA 3AHWA 1FUTA 1FYSA 2KF5A 1BNIA 2RBIA 2RNTA 1BSAA 3WR2A 4RNTA 1BU4A 4HOHA 3AGNA 5GSPA 6RNTA 2F5MA 1I0VA 1AY7A 1BRIA 1BNFA 2F4YA 1RLSA 1BRGA 1BOXA 1UCJA 3A5EA 1FUSA 1YVSA 1BIRA 3SYUA 1X1YA 7GSPA 3GSPA 1X1UA 1UCLA 1RN1A 1X1XA 1BRJA 3WHOA 1BRNL 1X1WA 1UCIA 1LRAA 1BVIA 1LOWA 1BSCA 1GMPA 1B2XA 1B3SA 2BU4A 1BUJA 1R4YA 1I2GA 1RTUA 1MGWA 1TRPA 6GSPA 2ZA4A 1DETA 4BU4A 4GSPA 2SARA 1B27A 1TTOA 2KAAA 2BIRA 1I2FA 3Q3FA 1RGGA 1DE3A 1AQZA 1BANA 1RMSA 2GSPA 5BIRA 1G02A 2C4BA 1RGHA 4GHOA 1BNEA 1RGFA 1B2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3F A;  1HZ1 A;  1T2I A;  1BRK A;  3D5G A;  1GSP A;  3KCH A;  1FW7 A;  1BSB A;  1RNT A;  1RGL A;  2KF6 A;  1JBR A;  1SAR A;  1IYY A;  1HYF A;  1GOV A;  1A2P A;  2KF4 A;  7RNT A;  1I70 A;  1YNV X;  1BRH A;  2AAD A;  1RCK A;  3HOH A;  3URP A;  1RHL A;  1BGS A;  1FZU A;  2AAE A;  2F5W A;  3AHS A;  5RNT A;  1PYL A;  1JBS A;  1MGR A;  1LOY A;  1BNR A;  1I8V A;  1RDS A;  3RNT A;  9RNT A;  5HOH A;  4J5K A;  4J5G A;  4HAA A;  1RGK A;  3D5I A;  1RCL A;  1GMQ A;  1JBT A;  1GMR A;  1BAO A;  1C54 A;  1I0X A;  1LNI A;  1B20 A;  1RGC A;  3D4A A;  1B2Z A;  1RNB A;  1I3I A;  4BIR A;  1BRS A;  1GOU A;  1YGW A;  8RNT A;  1ZGX A;  5BU4 A;  1BNG A;  1B2S A;  1BSE A;  1RGE A;  1PY3 A;  3AGO A;  1I2E A;  1GOY A;  1UCK A;  3BIR A;  1RSN A;  3BU4 A;  1B2U A;  1TRQ A;  2KF3 A;  1RN4 A;  1BNJ A;  1CH0 A;  2HOH A;  1LOV A;  3DH2 A;  3DGY A;  2F56 A;  1BSD A;  1B21 A;  1BNS A;  1Q9E A;  1RGA A;  1T2H A;  3AHW A;  1FUT A;  1FYS A;  2KF5 A;  1BNI A;  2RBI A;  2RNT A;  1BSA A;  3WR2 A;  4RNT A;  1BU4 A;  4HOH A;  3AGN A;  5GSP A;  6RNT A;  2F5M A;  1I0V A;  1AY7 A;  1BRI A;  1BNF A;  2F4Y A;  1RLS A;  1BRG A;  1BOX A;  1UCJ A;  3A5E A;  1FUS A;  1YVS A;  1BIR A;  3SYU A;  1X1Y A;  7GSP A;  3GSP A;  1X1U A;  1UCL A;  1RN1 A;  1X1X A;  1BRJ A;  3WHO A;  1BRN L;  1X1W A;  1UCI A;  1LRA A;  1BVI A;  1LOW A;  1BSC A;  1GMP A;  1B2X A;  1B3S A;  2BU4 A;  1BUJ A;  1R4Y A;  1I2G A;  1RTU A;  1MGW A;  1TRP A;  6GSP A;  2ZA4 A;  1DET A;  4BU4 A;  4GSP A;  2SAR A;  1B27 A;  1TTO A;  2KAA A;  2BIR A;  1I2F A;  3Q3F A;  1RGG A;  1DE3 A;  1AQZ A;  1BAN A;  1RMS A;  2GSP A;  5BIR A;  1G02 A;  2C4B A;  1RGH A;  4GHO A;  1BNE A;  1RGF A;  1B2M A; 
#chains in the Genus database with same CATH topology
 1OF5 B;  1A67 A;  3T0U A;  2HML B;  1JNQ A;  1UDI I;  4AKY A;  3EF8 A;  1OH0 A;  4FMC A;  4G1M B;  3D5G A;  1JKG A;  3JUN A;  1GSP A;  3DUK A;  1C7H A;  4KZ1 A;  2P09 A;  1VQM 3;  1O7G B;  3J7Y d;  1VQ6 3;  4R9L A;  1JJ2 2;  2GU1 A;  3KE7 A;  4FCJ A;  4HM5 B;  1W7C A;  3D3L A;  1WMP A;  3F14 A;  1A2P A;  2KF4 A;  3K5T A;  2GBW B;  1M1X B;  3F8H A;  1GD3 A;  1IQ8 A;  3H51 A;  1BRH A;  3VGN A;  1MWR A;  3URP A;  1RHL A;  1BGS A;  1FZU A;  3K0Z A;  2AAE A;  2F5W A;  2MF7 A;  1DMN A;  3CCS 3;  1PYL A;  4J8T A;  1M1K 4;  1MGR A;  1LOY A;  1RJO A;  2CX1 A;  2IYJ A;  4FCZ A;  1I8V A;  1NO3 A;  1W01 A;  4AKZ A;  4BTW A;  2XF3 A;  3SED A;  9RNT A;  4FR9 A;  5HOH A;  2WGQ A;  4J5G A;  5JBS A;  1VQP 3;  1RCL A;  3GAX A;  1VZZ A;  1US1 A;  2CFL A;  3IJE B;  7STD A;  5IG5 A;  3ALA A;  4HM1 B;  1LNI A;  1B20 A;  2F98 A;  4AEQ A;  4LZI A;  4BIR A;  4RBN A;  4CJN A;  4OK0 A;  1GOU A;  1FA3 A;  3ZFZ A;  1YGW A;  2W56 A;  4HM3 B;  3EHC A;  4GL6 A;  2K54 A;  3X3X A;  1BNG A;  1WMO A;  3JVC A;  1VQ4 3;  1BSE A;  1GY6 A;  3MKI A;  4HM4 B;  3SX1 A;  5M19 A;  3LOY A;  1UCK A;  4KT3 B;  3VSY A;  2XGN A;  3S29 A;  4QWT A;  1VQ5 3;  5AI1 A;  1NNV A;  1IVU A;  3KII A;  3FGY A;  1TRQ A;  5STD A;  2CFW A;  4HM2 B;  1PU4 A;  1JRQ A;  3M8C A;  1IU7 A;  4NHF A;  2ZHX B;  1A90 A;  3LTB A;  3MHE A;  3DGY A;  2R41 A;  3CPO A;  3S28 A;  4JF8 A;  1NB5 I;  2RFR A;  2P0X A;  3IPT A;  2KCD A;  1W5Z A;  1RGA A;  2K3D A;  4N6T A;  3SXX A;  1FYS A;  1Q40 B;  4HJL B;  3FKA A;  3NQZ A;  1MNL A;  1Q7Y 4;  1A2K A;  1LNH A;  1ULI B;  3SVA A;  1BU4 A;  4CPK A;  3X41 A;  1SJW A;  3DXO A;  3EBY A;  5GSP A;  2JQ5 A;  1W02 A;  4J9A A;  1I0V A;  1ROV A;  1AY7 A;  4N3V A;  2F4Y A;  3BB9 A;  1BOX A;  1O7W B;  4HVN A;  2W9P A;  3V92 A;  3SYU A;  1N5H A;  1X1Y A;  1J2B A;  2C11 A;  2Z77 A;  3BNE A;  3GSP A;  4HYZ A;  3WMD A;  1X1U A;  1ZO2 A;  2Q07 A;  2RSX A;  3KKG A;  3B4O A;  1V74 A;  3WHO A;  4RNY A;  3RGA A;  5CK6 A;  1UI7 A;  2CG1 A;  3CME 3;  2KXG A;  5CLK A;  3L0R A;  4N6N B;  1TRP A;  6GSP A;  3PZW A;  1DET A;  2CIU A;  2H0G A;  4GSP A;  5FGO A;  1L5G B;  4BTX A;  2Z76 A;  2SAR A;  1IV7 A;  1QAK A;  1YJW 3;  2KAA A;  1IT7 A;  1Z1S A;  3NBB A;  5ELJ A;  3RDE A;  1FUW A;  3PS8 A;  4XBX A;  3Q3F A;  4N6V 0;  3CCV 3;  1MWT A;  1AQZ A;  4K61 A;  3LML A;  3HI7 A;  4HM7 B;  4L8P A;  1WQL B;  3HK4 A;  1G02 A;  3NM2 A;  1IDP A;  3K63 A;  1GY7 A;  1RGH A;  4LYL B;  2QA4 3;  3CCE 3;  2IY2 A;  3WA3 A;  1B2M A;  1IK3 A;  5AIH A;  1DVD A;  3FCS B;  1PFP A;  1N9J A;  4PEJ A;  1K41 A;  1QMA A;  3UB1 A;  5KP1 A;  1HZ1 A;  1R4C A;  3NHX A;  1RN7 A;  3KCH A;  3N8B A;  4XB5 A;  5D83 A;  1FW7 A;  1OGZ A;  1RNT A;  2KF6 A;  1VQQ A;  8CHO A;  1Q42 A;  4XM4 A;  1GOV A;  3F8X A;  4HZ9 B;  1IQY A;  3OX9 A;  1UGH I;  3CCU 3;  2P0M A;  2YX9 A;  3EE1 A;  3WOE B;  4EXR A;  1JB5 A;  2Y73 A;  4KFE A;  5FW5 A;  5TGN A;  4U13 A;  1O7H B;  3G16 A;  1JBS A;  5M1A A;  3GZY B;  4FMB A;  2YFI B;  1BNR A;  1Q7H A;  3RNT A;  5A0O B;  3CNX A;  1ULJ B;  5AYS C;  3OWS A;  4HAA A;  1RGK A;  3EJV A;  1CYV A;  5G2G A;  1NJI 4;  3NXJ A;  4LSO A;  3KN4 A;  3CU3 A;  1JBT A;  1GMR A;  2D42 A;  3MG2 A;  1JN5 A;  2CWV A;  2A15 A;  2FGT A;  3KSP A;  3ECF A;  1I3I A;  1YIJ 3;  3DGL A;  3G4S 3;  2W2C A;  3FG4 A;  3D79 A;  3HX8 A;  3CCR 3;  3U97 A;  5BXQ A;  1UUV B;  8RNT A;  1N9E A;  1KQS 2;  3PCR A;  1KWI A;  1YVB I;  1UI8 A;  1YGE A;  5HGR A;  2C10 A;  1PY3 A;  2CKF B;  1GOY A;  2Y74 A;  1CEW I;  3CCM 3;  1TP6 A;  3STD A;  3G71 3;  1W6Y A;  3QRD A;  3G0K A;  4R80 A;  1OF5 A;  5IG0 A;  4BL3 A;  1CH0 A;  3LYG A;  1YIT 3;  1EQK A;  2O3O A;  3DH2 A;  4Q53 A;  3CCL 3;  3PCS A;  4K90 B;  1VQK 3;  2F56 A;  4I5Q A;  1BSD A;  2B1X B;  2KRT A;  3PXM A;  1O7M B;  4MMX B;  1B21 A;  3S27 A;  1T3B A;  3EC9 A;  1Q9E A;  3NQY A;  4KFD A;  3AHW A;  1FUT A;  2KF5 A;  4EBG A;  2OTJ 3;  2XFS A;  2QIY A;  1IQX A;  4WYK B;  4BL2 A;  3DGO A;  3SLU A;  3MWZ A;  1OPY A;  3A76 A;  6RNT A;  1E97 A;  3CD6 3;  5KP4 A;  2E2V A;  2F5M A;  2OWP A;  3T8N A;  1BRI A;  2M7O A;  4IIA A;  1RLS A;  1QJG A;  1QAL A;  1K28 A;  3A5E A;  1FUS A;  1BIR A;  1QVF 2;  3X40 A;  7GSP A;  2GEX A;  3EQQ B;  1EG9 B;  1UCL A;  3CC2 3;  4CCV A;  1BRJ A;  5AEW B;  1EUI C;  2XR8 B;  1LRA A;  2L1S A;  1W00 A;  1K8A 4;  1B3S A;  3CMA 3;  3G8Z A;  1W4N A;  2HMK B;  4O3V A;  2Z7A A;  4EYC A;  2J8X B;  2W03 A;  2UUG C;  5G1L A;  3LZA A;  2RCD A;  4O02 B;  2IA7 A;  2RGQ A;  3BNB A;  3UL5 A;  1D6Z A;  1N8Q A;  2HMN B;  5M18 A;  2BIR A;  3I55 3;  3FSD A;  3EB8 A;  1RGG A;  1AVK A;  3BLZ A;  5DRE A;  1BAN A;  1T5Y A;  1LXE A;  3ER7 A;  2D1W A;  2W0Q A;  1WMN A;  4R4K A;  4X2O A;  5IEN A;  5IG3 A;  1O7N B;  1BNE A;  1KSI A;  3DMC A;  1JB2 A;  3O8Y A;  4HM8 B;  2WOH A;  1I3F A;  2P38 A;  3AMO B;  3G6E 3;  1D6U A;  2W6J H;  1T2I A;  1MOL A;  3X42 A;  1BSB A;  3JUQ A;  4KFF A;  1Q40 A;  1RGL A;  3FG1 A;  1JBR A;  1SAR A;  2QEX 3;  1HYF A;  4RZM A;  4XDW A;  7RNT A;  3NV0 B;  1I70 A;  3I0Y A;  1M90 4;  1YNV X;  5JPP A;  1DMM A;  1S72 3;  4ORL A;  1V57 A;  3GRD A;  2AAD A;  1RCK A;  1UUG B;  3D9R A;  3HOH A;  3EN8 A;  3K7C A;  3Q1C A;  4R9K A;  5G1K A;  3FF2 A;  3QK9 A;  3F7S A;  1OHO A;  3DY5 A;  1IVV A;  1RDS A;  3NBJ A;  1VQ8 3;  2XSH B;  4DKI A;  4J5K A;  2PNC A;  1G96 A;  1GMQ A;  2H0H A;  4N6M A;  1ASK A;  2XEP A;  1BAO A;  3LTD A;  3MSO A;  1F8N A;  1Y4K A;  2FNQ A;  3FH1 A;  4WP5 A;  2ML5 A;  3D4A A;  1B2Z A;  3UL6 A;  1C54 A;  1STD A;  1QAF A;  2INX A;  3CNM A;  2HMM B;  1BRS A;  1KC8 4;  2SBL A;  4WHA A;  5BU4 A;  1Q82 4;  3HIG A;  2CHC A;  3V99 A;  1WNH A;  3E99 A;  4LEH A;  1B2S A;  1TUH A;  2BMO B;  3AGO A;  3HZP A;  3PGB A;  3EX9 A;  3OXA A;  3LTA A;  1U8C B;  2BO9 B;  2CK3 H;  3FZW A;  2OQE C;  3GZX B;  4FMA A;  4TX4 A;  4EW5 A;  4HZB B;  3SOA A;  1RSN A;  3OV4 A;  3KSE D;  2YFJ B;  1B2U A;  2CFG A;  1IT8 A;  4WWU C;  1WTH A;  4EV5 A;  1W2B 2;  2I9W A;  2KF3 A;  2CFD A;  3NUV A;  1ZS7 A;  1ZX2 A;  4O8S A;  1RN4 A;  1BNJ A;  1IVW A;  3GZR A;  3V98 A;  3CC4 3;  2HOH A;  4EC6 A;  1GD4 A;  1E3R A;  2XRX B;  3WOF B;  1NWW A;  1V58 A;  2R4I A;  1JKG B;  4HM6 B;  1DVC A;  5AII A;  3WDG B;  3EN1 B;  2GU3 A;  3CC7 3;  3OW2 2;  3BNC A;  1O7P B;  1YJ9 3;  5EEO A;  3VF1 A;  5DRV A;  2RBI A;  2RNT A;  1BSA A;  1OHS A;  3KFQ C;  3OWU A;  1DYU A;  1TJD A;  5CF1 A;  1VQO 3;  4EV2 A;  3AGN A;  4IT7 A;  2K0M A;  1AVL A;  3JUM A;  5IEO A;  3ROB A;  2L4V A;  3FF0 A;  4HKV B;  4L7K A;  2IMJ A;  1IVX A;  1BRG A;  3CCJ 3;  3LXU X;  1YVS A;  2OOV C;  4MMZ B;  2CWT A;  1GYB A;  3FG3 A;  1CYU A;  3MPH A;  3DGM A;  4MJD A;  3DGN A;  1RN1 A;  5EVH A;  1X1X A;  3B8L A;  5IER A;  4XDV A;  2O9U X;  4OUQ A;  1X1W A;  1UCI A;  3B7C A;  1BVI A;  1JZO A;  3HII A;  4WFO A;  1LOW A;  2XSO B;  1BSC A;  1GMP A;  1B2X A;  1NB3 I;  3S5C A;  1R4Y A;  2W56 B;  1G0T A;  1I2G A;  5AIG A;  2V1L A;  1RTU A;  3JUO A;  1U5O A;  2ZA4 A;  4I4K A;  1AR0 A;  1NU3 A;  2YFL B;  4BU4 A;  1MWS A;  1UGI A;  1TTO A;  2UX0 A;  2CFK A;  1VQ9 3;  2CWU A;  3K9M C;  1I2F A;  5IG4 A;  1LVN A;  1DE3 A;  3B4P A;  2GSP A;  2BNG A;  5BIR A;  1JZD A;  3WA2 X;  1LOX A;  1TIJ A;  4K1U A;  4GHO A;  2HMO B;  1RGC A;  3LT8 A;  2CC3 A;  4GB5 A;  3UNL A;  5AIF A;  4H61 A;  2W9Q A;  5LC6 A;  1BRK A;  2WO0 A;  4CDL A;  2UGI A;  1N8R 4;  3F9S A;  2GBX B;  2HMJ B;  1YI2 3;  2BMQ B;  5JPU A;  4MMY B;  1GY5 A;  1SII A;  1JV2 B;  1IYY A;  4RNZ A;  1K9M 4;  4N6U A;  4LGQ A;  4ILF A;  3I56 3;  2GEY A;  3EBT A;  4WYK A;  1FGQ A;  4K1V A;  1FGR A;  5EQL A;  5AYR B;  1W6C A;  3X3Y A;  2JDI H;  2OTL 3;  1RKY A;  4X2H A;  1ROA A;  1RRH A;  1YJN 3;  3TDG A;  3AHS A;  1GS3 A;  3DZL A;  5RNT A;  4HM0 B;  3KZT A;  1VQN 3;  2BMR B;  3ZG0 A;  3RGR A;  1OAC A;  2F99 A;  4JRF A;  4FCM A;  3D5I A;  4ZM8 A;  3MYT A;  4NPB A;  1EEJ A;  3UJM A;  1STF I;  1A2V A;  2IUJ A;  5IEP A;  1I0X A;  1S5A A;  4R1K A;  3T8U A;  1RNB A;  5I97 A;  1W6G A;  1LQG C;  2PZV A;  2ZDJ A;  3MG1 A;  3S67 A;  1QVG 2;  1HU9 A;  1TFO A;  3ZG5 A;  1ZGX A;  1RRL A;  2H0I A;  2CH9 A;  1VQ7 3;  5IW9 A;  5D81 A;  1RGE A;  4L8O A;  2CW9 A;  1I2E A;  1OGX A;  2WOF A;  3LTC A;  3JUP A;  3PYJ A;  2CG0 A;  2Z6B A;  3BIR A;  3FLJ A;  3SOY A;  1FGM A;  1FGT A;  3F40 A;  3BU4 A;  1SIH A;  2LQV A;  4NRE A;  2BHM A;  4O2H A;  1UUW B;  4FMD A;  3U1W A;  5IF6 A;  2B24 B;  1LOV A;  1UW1 A;  3AMO A;  1OUN A;  5ELU A;  2W04 A;  4BTY A;  3LT9 A;  1N5P A;  5D82 A;  2OQE A;  6STD A;  1D6Y A;  3Q90 A;  2OCT A;  1K73 4;  3CPW 2;  2XH9 A;  1BNS A;  1T2H A;  3F7X A;  2P05 A;  1M9G A;  2MC8 A;  5KP3 A;  4N6L A;  1JB4 A;  1SPU A;  1BNI A;  3NV0 A;  4KVH A;  3WR2 A;  4RNT A;  1EA2 A;  5BVB A;  1MWU A;  4IPB A;  1YHQ 3;  1W2Z A;  1AV4 A;  3GZB A;  4LMI A;  5LC7 A;  4HOH A;  1DMQ A;  4OVM A;  3BND A;  1BNF A;  3N9H A;  3DM8 A;  1SQW A;  2E2U A;  4HBR A;  1UCJ A;  3CXC 2;  1NDO B;  3N54 B;  1E3V A;  3X3Z A;  1BUQ A;  5CF2 A;  2CX0 A;  3WOD G;  3NBR A;  3LH4 A;  4XBT A;  1KD1 4;  1JN5 B;  2ML6 A;  2WGO A;  1CQS A;  3CCQ 3;  1BRN L;  1OCV A;  2XGL A;  3NM7 A;  2XFT A;  1OHP A;  3OWY A;  2BU4 A;  5AEU B;  2F86 B;  1BUJ A;  2OOV A;  3IMA B;  2E2T A;  3GWR A;  1Q86 4;  4XBY A;  3H3H A;  1MGW A;  2GXF A;  4N6O B;  1FGO A;  1TFK A;  2BT3 A;  2QGU A;  1B27 A;  3MG3 A;  5CXO A;  1TU5 A;  1EKM A;  2FXT A;  4MEI A;  3Q2P A;  1LQM B;  1RMS A;  2STD A;  1IV9 A;  2ZL8 A;  1ISK A;  2C4B A;  2LYX A;  1HKX A;  4STD A;  4H3U A;  1VQL 3;  1RGF A;  1Q81 4;  3NX0 A;  2IUK A; 
#chains in the Genus database with same CATH homology
 1I3F A;  1HZ1 A;  1T2I A;  1BRK A;  3D5G A;  1GSP A;  3KCH A;  1FW7 A;  1BSB A;  1RNT A;  1RGL A;  2KF6 A;  1JBR A;  1SAR A;  1IYY A;  1HYF A;  1GOV A;  1A2P A;  2KF4 A;  7RNT A;  1I70 A;  1YNV X;  1BRH A;  2AAD A;  1RCK A;  3HOH A;  3URP A;  1RHL A;  1BGS A;  1FZU A;  2AAE A;  2F5W A;  3AHS A;  5RNT A;  1PYL A;  1JBS A;  1MGR A;  1LOY A;  1BNR A;  1I8V A;  1RDS A;  3RNT A;  9RNT A;  5HOH A;  4J5K A;  4J5G A;  4HAA A;  1RGK A;  3D5I A;  1RCL A;  1GMQ A;  1JBT A;  1GMR A;  1BAO A;  1C54 A;  1I0X A;  1LNI A;  1B20 A;  1RGC A;  3D4A A;  1B2Z A;  1RNB A;  1I3I A;  4BIR A;  1BRS A;  1GOU A;  1YGW A;  8RNT A;  1ZGX A;  5BU4 A;  1BNG A;  1B2S A;  1BSE A;  1RGE A;  1PY3 A;  3AGO A;  1I2E A;  1GOY A;  1UCK A;  3BIR A;  1RSN A;  3BU4 A;  1B2U A;  1TRQ A;  2KF3 A;  1RN4 A;  1BNJ A;  1CH0 A;  2HOH A;  1LOV A;  3DH2 A;  3DGY A;  2F56 A;  1BSD A;  1B21 A;  1BNS A;  1Q9E A;  1RGA A;  1T2H A;  3AHW A;  1FUT A;  1FYS A;  2KF5 A;  1BNI A;  2RBI A;  2RNT A;  1BSA A;  3WR2 A;  4RNT A;  1BU4 A;  4HOH A;  3AGN A;  5GSP A;  6RNT A;  2F5M A;  1I0V A;  1AY7 A;  1BRI A;  1BNF A;  2F4Y A;  1RLS A;  1BRG A;  1BOX A;  1UCJ A;  3A5E A;  1FUS A;  1YVS A;  1BIR A;  3SYU A;  1X1Y A;  7GSP A;  3GSP A;  1X1U A;  1UCL A;  1RN1 A;  1X1X A;  1BRJ A;  3WHO A;  1BRN L;  1X1W A;  1UCI A;  1LRA A;  1BVI A;  1LOW A;  1BSC A;  1GMP A;  1B2X A;  1B3S A;  2BU4 A;  1BUJ A;  1R4Y A;  1I2G A;  1RTU A;  1MGW A;  1TRP A;  6GSP A;  2ZA4 A;  1DET A;  4BU4 A;  4GSP A;  2SAR A;  1B27 A;  1TTO A;  2KAA A;  2BIR A;  1I2F A;  3Q3F A;  1RGG A;  1DE3 A;  1AQZ A;  1BAN A;  1RMS A;  2GSP A;  5BIR A;  1G02 A;  2C4B A;  1RGH A;  4GHO A;  1BNE A;  1RGF A;  1B2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...