1I2EA

Ribonuclease t1 v16a mutant, form i
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i2eA00
3WHOA 5BU4A 1BNIA 1BRNL 1ZGXA 1TRPA 1X1YA 3AHWA 1DETA 1BOXA 2HOHA 1RGAA 1I0VA 1RHLA 1I8VA 1TTOA 2RBIA 1DE3A 1BSEA 2KF6A 4GSPA 1PY3A 1BRIA 1T2IA 2F56A 1IYYA 2KF4A 3Q3FA 1RGHA 1RGFA 1RGLA 1I3FA 1PYLA 1T2HA 1G02A 2F5MA 4GHOA 1A2PA 5HOHA 2KAAA 1LNIA 1B27A 1B2ZA 1BSCA 1X1XA 1I2GA 1RN1A 2AADA 1RN4A 1BGSA 1SARA 6GSPA 7GSPA 1JBTA 4HAAA 1FZUA 1RGCA 3A5EA 1BSAA 1B2MA 1GMPA 1HZ1A 1Q9EA 3HOHA 3D4AA 3D5IA 5GSPA 2KF3A 8RNTA 1RLSA 1RMSA 1BUJA 1BRJA 1FYSA 1I2FA 3BIRA 3DGYA 1MGWA 1GOYA 1X1WA 1BRKA 3DH2A 1I70A 1BNRA 3SYUA 1B3SA 1BRHA 1I0XA 1I2EA 1UCJA 2F5WA 1TRQA 1RCKA 1GOUA 1B20A 1UCKA 1GSPA 1RSNA 4HOHA 1LOYA 2KF5A 1RNBA 3AGNA 1GMRA 5RNTA 1AQZA 1RDSA 4J5KA 1YNVX 1AY7A 1BNEA 1UCLA 9RNTA 2AAEA 1FUTA 1B21A 1GMQA 3GSPA 1YGWA 1B2XA 1HYFA 3URPA 1LOWA 2BU4A 4J5GA 1FW7A 1JBRA 3AGOA 1BNGA 2ZA4A 3KCHA 1BANA 1BNSA 1X1UA 4BIRA 1BRGA 1LOVA 1B2SA 1RNTA 3AHSA 2SARA 6RNTA 1R4YA 1BIRA 1RCLA 1B2UA 3WR2A 1LRAA 1FUSA 1CH0A 1RGEA 2C4BA 1BNJA 1BRSA 5BIRA 3RNTA 2GSPA 1I3IA 1YVSA 1MGRA 1RGGA 2BIRA 3D5GA 1BAOA 1RGKA 1C54A 1BNFA 1BSBA 1JBSA 4RNTA 1GOVA 7RNTA 1BSDA 1BU4A 1UCIA 1BVIA 4BU4A 2F4YA 1RTUA 3BU4A 2RNTA
chains in the Genus database with same CATH superfamily
3WHOA 3L0RA 1VQ43 2Y74A 2L4VA 3V98A 3J7Yd 1BNIA 1IQYA 4EBGA 1BRNL 1N8QA 1RRHA 1X1YA 1NDOB 3JUMA 5D83A 3V92A 3IJEB 1YI23 1MWUA 4HM3B 4NREA 1N5HA 1I8VA 3RGRA 2IY2A 1VQM3 3OXAA 3EX9A 3AMOB 1BSEA 4TX4A 4XBTA 3MG1A 1PY3A 4HKVB 3NQZA 5G2GA 3K9MC 1YVBI 2W03A 1EA2A 2GXFA 3Q3FA 2CX0A 3F8HA 1RRLA 3D3LA 4CJNA 1U5OA 3NQYA 5JPUA 2IUJA 2WOFA 1WMOA 1ROAA 2HMOB 5BXQA 3F8XA 5HOHA 2IA7A 5AIIA 1KSIA 1LNIA 2ZHXB 3Q90A 2OCTA 1ULIB 2BO9B 1X1XA 1I2GA 2GU3A 3N54B 3NXJA 7GSPA 1JBTA 1R4CA 2UX0A 1E3RA 1DVDA 2XEPA 1BSAA 1UGIA 1JN5A 1Q9EA 3D4AA 3D5IA 1VQQA 3KN4A 4JRFA 3H51A 1K41A 4Q53A 3CCL3 4STDA 4G1MB 4EC6A 3JUQA 2A15A 1GOYA 1O7GB 3DH2A 4I5QA 3K7CA 2CFKA 1VQ83 1IV9A 1EUIC 3SYUA 2R41A 1BRHA 1UCJA 1I2EA 2K0MA 3B4PA 2CG1A 4N6TA 2ML5A 5JPPA 1TP6A 3EN8A 3DY5A 2ZDJA 1UUGB 4HJLB 4RZMA 4HM6B 1UCKA 5KP4A 4AKZA 4BTYA 4CCVA 1GSPA 1LNHA 4HOHA 3X41A 1QVF2 2HMJB 2E2UA 5HGRA 1VQ53 1MWRA 4J5KA 3ZFZA 3LTAA 4IPBA 3RGAA 3S67A 2W2CA 9RNTA 1JKGA 3MG2A 2CX1A 3GSPA 4NHFA 1QAFA 4WFOA 1HYFA 5M18A 4NPBA 4HM2B 2OTL3 3GAXA 2CWTA 4BTWA 1A2VA 3AGOA 2ZA4A 3KCHA 4KZ1A 4FCJA 4BIRA 5EVHA 3LTDA 4DKIA 3OWSA 3K63A 2OTJ3 3FG4A 1QAKA 3LH4A 3PXMA 3CCM3 3SLUA 3D79A 1IVWA 1B2UA 3M8CA 1LRAA 3WOFB 4XBXA 4L7KA 3B7CA 3VSYA 3PZWA 3GZRA 2CK3H 2BNGA 3DXOA 1O7HB 3HZPA 3NHXA 2J8XB 1SPUA 1RGGA 2CKFB 1LQGC 1C54A 1J2BA 3EQQB 3GZXB 1HKXA 1CYVA 3NV0A 2M7OA 3DGLA 2F98A 3KSED 1IVVA 1YHQ3 1JBSA 4U13A 1C7HA 1BU4A 2HMNB 2V1LA 2W56A 3OV4A 4HM5B 4R1KA 1JZOA 2UGIA 5CXOA 3CCJ3 3FG3A 3BU4A 4LSOA 4LMIA 3JVCA 3B8LA 1JB2A 3UNLA 2QEX3 1GD4A 3LYGA 3EB8A 3LZAA 3WMDA 1T3BA 3CNXA 5CK6A 5ELJA 3CCU3 4EV5A 2KXGA 3AHWA 1L5GB 4WYKB 2OOVC 1IVXA 5A0OB 1STDA 1OHOA 1RGAA 2HOHA 2OWPA 3MKIA 5STDA 1RHLA 3G0KA 3RDEA 2SBLA 4XBYA 1DE3A 4JF8A 2KF6A 1CQSA 1UGHI 4RNZA 3NM7A 2H0GA 6STDA 3KSPA 1IYYA 3QRDA 2JDIH 2KF4A 4O02B 1YGEA 3O8YA 4CDLA 1KQS2 1NJI4 1W7CA 1RGLA 4RNYA 2OQEA 1I3FA 1PYLA 2O9UX 1YJW3 1T2HA 1G02A 2F5MA 4ILFA 1N9JA 4N6OB 1S723 3ER7A 1TUHA 2KAAA 1B27A 1B2ZA 4MMZB 3G16A 3E99A 1RN1A 6GSPA 1BGSA 1SARA 3F9SA 3CU3A 3G713 4HZBB 2WGOA 4LYLB 1NNVA 1RGCA 3A5EA 1GY7A 2YFLB 3PYJA 1T5YA 4L8PA 1UDII 1HZ1A 2F86B 3AMOA 3HOHA 3BNBA 1SJWA 3MWZA 5GSPA 1RJOA 2K54A 8RNTA 1WMNA 2GBXB 1WQLB 4HZ9B 2ML6A 1JNQA 3ECFA 4IIAA 3BIRA 2B1XB 3LTBA 3STDA 3MG3A 1X1WA 4WHAA 2UUGC 5KP3A 2CFGA 3BNEA 3SX1A 1I0XA 3NM2A 4RBNA 2WO0A 1RCKA 1OF5B 1IT8A 3OWUA 1LQMB 1WTHA 3OX9A 4OVMA 4AKYA 1W02A 1W2ZA 1B20A 1W6CA 2IUKA 3K0ZA 5M19A 3ROBA 5ELUA 1D6ZA 1MWSA 4J8TA 5IEOA 2KF5A 1RNBA 1OCVA 4XB5A 1GMRA 5BVBA 5RNTA 3N8BA 1AY7A 3GZBA 1SIHA 4HM1B 3I0YA 1GYBA 3FZWA 4EXRA 2K3DA 4XDWA 2CC3A 1FUTA 1D6YA 4BTXA 5IEPA 2CG0A 1TFOA 3CMA3 3F14A 1B2XA 1LOWA 3MHEA 1SIIA 4J5GA 1AV4A 1LVNA 1RN7A 1LXEA 1ROVA 2Z6BA 3BNDA 3K5TA 4HBRA 4KFFA 5AI1A 3X40A 5AEUB 4KFEA 5M1AA 1GS3A 1IDPA 1B2SA 3EE1A 4FR9A 3Q2PA 3AHSA 3CPOA 3PGBA 1YIJ3 4K61A 5IG5A 1A90A 1JV2B 2PZVA 5LC6A 3FLJA 1DVCA 1K28A 3GZYB 4GB5A 3CXC2 1CH0A 3KFQC 4R80A 4H3UA 2C4BA 1BNJA 3HIIA 3HI7A 3NUVA 1PFPA 2CIUA 3JUNA 3DGNA 4N6LA 2GSPA 1I3IA 1RKYA 3CME3 1YVSA 1NB5I 4J9AA 1MGRA 1OHPA 2STDA 3PCSA 1NU3A 3D5GA 3D9RA 1BAOA 4GL6A 3V99A 2IMJA 1JB4A 1F8NA 2F99A 4N6MA 3FF2A 1TFKA 1YJN3 1O7NB 5AYSC 1Q814 2INXA 4OK0A 1GOVA 1ZO2A 7RNTA 1ULJB 1US1A 2MF7A 1BVIA 1M9GA 2GBWB 1QALA 2CFDA 3I553 2QA43 2BMQB 2RNTA 2HMLB 5DREA 2P0MA 2OOVA 5BU4A 2PNCA 5TGNA 1Q864 1ZGXA 1TRPA 4R9LA 1O7MB 1SQWA 5AIGA 1A2KA 1N5PA 1VQL3 1IU7A 3WDGB 1MOLA 1MWTA 3Q1CA 5EEOA 3X3XA 2MC8A 1TTOA 3CC43 2Z77A 3FH1A 4GSPA 3NBBA 1T2IA 1Y4KA 3I563 1DMQA 1VQK3 2RFRA 1FGOA 2XRXB 1UUWB 2KCDA 1JB5A 2FGTA 1N8R4 1RGHA 3X3YA 1A67A 1RGFA 3S5CA 1JJ22 4GHOA 4N3VA 3KIIA 1YIT3 3G4S3 3EHCA 1BSCA 4MJDA 2AADA 3PS8A 4FCZA 4WYKA 1RN4A 5AIFA 3H3HA 1M1K4 1FZUA 2XSHB 4N6NB 4KVHA 3KE7A 4O3VA 4FMDA 2D42A 2KF3A 1U8CB 2W9QA 4HVNA 4QWTA 1RLSA 2Z7AA 4X2OA 1KD14 1RMSA 3X42A 3HK4A 4KT3B 1BUJA 1BRJA 1FYSA 1I2FA 3DGYA 3A76A 4X2HA 1MGWA 4XM4A 2GEXA 3OW22 1VQN3 1DYUA 5IERA 1CEWI 1I70A 3BNCA 1BNRA 3ZG5A 1WNHA 3S29A 2ZL8A 2BHMA 3LMLA 3CC73 4LEHA 4HM0B 2F5WA 4EYCA 1TRQA 1D6UA 1W00A 2L1SA 3GWRA 3FSDA 5IG3A 3UL6A 4FCMA 4XDVA 2QIYA 3MYTA 5IG0A 1IK3A 3DGMA 4O8SA 5CF1A 1ISKA 1RSNA 1EKMA 1LOYA 2CWUA 3JUOA 3CD63 1IT7A 2BT3A 4L8OA 1AQZA 5CF2A 1HU9A 1BNEA 4ZM8A 3CNMA 1VQO3 1UCLA 4ORLA 3MSOA 2XR8B 1B21A 1DMNA 2WOHA 2LQVA 2XF3A 1GMQA 4N6V0 5EQLA 3U1WA 2XGNA 1DMMA 3KKGA 3DMCA 1AVLA 3OWYA 1BNGA 3EC9A 1AR0A 1VQ73 1BANA 4KFDA 2XFTA 1X1UA 2D1WA 1OF5A 1BRGA 1LOVA 3EBYA 1Q40B 4HM8B 1JBRA 1OPYA 5AEWB 3FG1A 1BIRA 2E2VA 1OH0A 4PEJA 1YJ93 2P09A 2CFLA 1VQP3 3S27A 3UB1A 3LTCA 1MNLA 5IENA 4MMXB 1Q7Y4 5KP1A 5BIRA 3CCE3 2CW9A 3EF8A 1M1XB 2LYXA 2HMMB 2WGQA 4H61A 4AEQA 2BIRA 1W6GA 1G0TA 4HM7B 1G96A 1JZDA 3NBRA 1M904 2W04A 1BSBA 1W2B2 3F7XA 1W4NA 4O2HA 4RNTA 3LXUX 1QVG2 1BSDA 2YFIB 3N9HA 1E3VA 3CC23 7STDA 4BU4A 1V58A 2F4YA 3MPHA 4EW5A 2OQEC 4MMYB 3CCV3 2GU1A 3DGOA 3WOEB 8CHOA 1N9EA 1UW1A 1DETA 1V74A 2I9WA 3EJVA 1BOXA 4LGQA 4LZIA 3CCQ3 1I0VA 1NB3I 2P05A 2XH9A 4K1VA 3S28A 1JN5B 2RBIA 1E97A 3WA3A 1V57A 4FMAA 3FCSB 1BRIA 2P38A 1TJDA 3FKAA 5I97A 1VQ93 2F56A 3CPW2 3FF0A 4HM4B 3QK9A 2QGUA 4FMCA 2XGLA 2W6JH 1IVUA 1JRQA 3BB9A 1FGRA 1ZX2A 3KZTA 1A2PA 2C10A 3DZLA 1QMAA 1FGMA 3VF1A 3WODG 1O7WB 2KRTA 1OGXA 2E2TA 2RGQA 3EBTA 3LT8A 4HAAA 1K734 3NBJA 1B2MA 1UI7A 4I4KA 1GMPA 1OHSA 5AYRB 3CCS3 1ZS7A 4MEIA 4R9KA 1FUWA 1JKGB 1IQ8A 3DM8A 5IF6A 1W5ZA 2CFWA 1BRKA 1UI8A 2GEYA 4WP5A 5G1KA 4FMBA 2C11A 3TDGA 1EQKA 1FGTA 2YX9A 1B3SA 3IMAB 5AIHA 3SOYA 3B4OA 3SXXA 1BUQA 3SEDA 2CHCA 3U97A 1OACA 1GOUA 5FGOA 5FW5A 2R4IA 2O3OA 2P0XA 3EN1B 3F7SA 3T0UA 2W9PA 5G1LA 1LOXA 1IQXA 1KWIA 4K1UA 3BLZA 3T8NA 3UJMA 3AGNA 2IYJA 1W6YA 3ALAA 4CPKA 1NO3A 5D81A 1RDSA 3T8UA 3X3ZA 3SOAA 1YNVX 4BL2A 3F40A 2BMOB 1VQ63 1TIJA 3SVAA 3G6E3 2AAEA 3NX0A 5CLKA 2Y73A 3DUKA 3IPTA 3UL5A 5JBSA 1KC84 1AVKA 4N6UA 2B24B 2XFSA 1YGWA 3URPA 1VZZA 2BU4A 3VGNA 1CYUA 1Z1SA 2RCDA 4R4KA 3FGYA 3CCR3 1FW7A 1NWWA 2W0QA 2HMKB 3HX8A 2Q07A 1K8A4 3G8ZA 3NV0B 1BNSA 2H0HA 3WA2X 1FA3A 2CH9A 2JQ5A 2W56B 3JUPA 1GD3A 1RNTA 1GY6A 2SARA 2H0IA 1R4YA 1O7PB 3ZG0A 1ASKA 6RNTA 3PCRA 1UUVB 2FNQA 1RCLA 5IG4A 3GRDA 3WR2A 1IV7A 1Q824 2CWVA 1FUSA 4K90B 1RGEA 1GY5A 3LOYA 4BL3A 1TU5A 1QJGA 1BRSA 1Q7HA 1K9M4 3RNTA 1W01A 2Z76A 2YFJB 5DRVA 4WWUC 3LT9A 4HYZA 1PU4A 1Q42A 1OGZA 1FGQA 1RGKA 1S5AA 1STFI 4EV2A 2FXTA 1BNFA 1EG9B 2RSXA 4OUQA 1WMPA 3HIGA 1OUNA 4IT7A 5D82A 1EEJA 1UCIA 1Q40A 5LC7A 5IW9A 1RTUA 2BMRB 2XSOB
chains in the Genus database with same CATH topology
3WHOA 5BU4A 1BNIA 1BRNL 1ZGXA 1TRPA 1X1YA 3AHWA 1DETA 1BOXA 2HOHA 1RGAA 1I0VA 1RHLA 1I8VA 1TTOA 2RBIA 1DE3A 1BSEA 2KF6A 4GSPA 1PY3A 1BRIA 1T2IA 2F56A 1IYYA 2KF4A 3Q3FA 1RGHA 1RGFA 1RGLA 1I3FA 1PYLA 1T2HA 1G02A 2F5MA 4GHOA 1A2PA 5HOHA 2KAAA 1LNIA 1B27A 1B2ZA 1BSCA 1X1XA 1I2GA 1RN1A 2AADA 1RN4A 1BGSA 1SARA 6GSPA 7GSPA 1JBTA 4HAAA 1FZUA 1RGCA 3A5EA 1BSAA 1B2MA 1GMPA 1HZ1A 1Q9EA 3HOHA 3D4AA 3D5IA 5GSPA 2KF3A 8RNTA 1RLSA 1RMSA 1BUJA 1BRJA 1FYSA 1I2FA 3BIRA 3DGYA 1MGWA 1GOYA 1X1WA 1BRKA 3DH2A 1I70A 1BNRA 3SYUA 1B3SA 1BRHA 1I0XA 1I2EA 1UCJA 2F5WA 1TRQA 1RCKA 1GOUA 1B20A 1UCKA 1GSPA 1RSNA 4HOHA 1LOYA 2KF5A 1RNBA 3AGNA 1GMRA 5RNTA 1AQZA 1RDSA 4J5KA 1YNVX 1AY7A 1BNEA 1UCLA 9RNTA 2AAEA 1FUTA 1B21A 1GMQA 3GSPA 1YGWA 1B2XA 1HYFA 3URPA 1LOWA 2BU4A 4J5GA 1FW7A 1JBRA 3AGOA 1BNGA 2ZA4A 3KCHA 1BANA 1BNSA 1X1UA 4BIRA 1BRGA 1LOVA 1B2SA 1RNTA 3AHSA 2SARA 6RNTA 1R4YA 1BIRA 1RCLA 1B2UA 3WR2A 1LRAA 1FUSA 1CH0A 1RGEA 2C4BA 1BNJA 1BRSA 5BIRA 3RNTA 2GSPA 1I3IA 1YVSA 1MGRA 1RGGA 2BIRA 3D5GA 1BAOA 1RGKA 1C54A 1BNFA 1BSBA 1JBSA 4RNTA 1GOVA 7RNTA 1BSDA 1BU4A 1UCIA 1BVIA 4BU4A 2F4YA 1RTUA 3BU4A 2RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHO A;  5BU4 A;  1BNI A;  1BRN L;  1ZGX A;  1TRP A;  1X1Y A;  3AHW A;  1DET A;  1BOX A;  2HOH A;  1RGA A;  1I0V A;  1RHL A;  1I8V A;  1TTO A;  2RBI A;  1DE3 A;  1BSE A;  2KF6 A;  4GSP A;  1PY3 A;  1BRI A;  1T2I A;  2F56 A;  1IYY A;  2KF4 A;  3Q3F A;  1RGH A;  1RGF A;  1RGL A;  1I3F A;  1PYL A;  1T2H A;  1G02 A;  2F5M A;  4GHO A;  1A2P A;  5HOH A;  2KAA A;  1LNI A;  1B27 A;  1B2Z A;  1BSC A;  1X1X A;  1I2G A;  1RN1 A;  2AAD A;  1RN4 A;  1BGS A;  1SAR A;  6GSP A;  7GSP A;  1JBT A;  4HAA A;  1FZU A;  1RGC A;  3A5E A;  1BSA A;  1B2M A;  1GMP A;  1HZ1 A;  1Q9E A;  3HOH A;  3D4A A;  3D5I A;  5GSP A;  2KF3 A;  8RNT A;  1RLS A;  1RMS A;  1BUJ A;  1BRJ A;  1FYS A;  1I2F A;  3BIR A;  3DGY A;  1MGW A;  1GOY A;  1X1W A;  1BRK A;  3DH2 A;  1I70 A;  1BNR A;  3SYU A;  1B3S A;  1BRH A;  1I0X A;  1I2E A;  1UCJ A;  2F5W A;  1TRQ A;  1RCK A;  1GOU A;  1B20 A;  1UCK A;  1GSP A;  1RSN A;  4HOH A;  1LOY A;  2KF5 A;  1RNB A;  3AGN A;  1GMR A;  5RNT A;  1AQZ A;  1RDS A;  4J5K A;  1YNV X;  1AY7 A;  1BNE A;  1UCL A;  9RNT A;  2AAE A;  1FUT A;  1B21 A;  1GMQ A;  3GSP A;  1YGW A;  1B2X A;  1HYF A;  3URP A;  1LOW A;  2BU4 A;  4J5G A;  1FW7 A;  1JBR A;  3AGO A;  1BNG A;  2ZA4 A;  3KCH A;  1BAN A;  1BNS A;  1X1U A;  4BIR A;  1BRG A;  1LOV A;  1B2S A;  1RNT A;  3AHS A;  2SAR A;  6RNT A;  1R4Y A;  1BIR A;  1RCL A;  1B2U A;  3WR2 A;  1LRA A;  1FUS A;  1CH0 A;  1RGE A;  2C4B A;  1BNJ A;  1BRS A;  5BIR A;  3RNT A;  2GSP A;  1I3I A;  1YVS A;  1MGR A;  1RGG A;  2BIR A;  3D5G A;  1BAO A;  1RGK A;  1C54 A;  1BNF A;  1BSB A;  1JBS A;  4RNT A;  1GOV A;  7RNT A;  1BSD A;  1BU4 A;  1UCI A;  1BVI A;  4BU4 A;  2F4Y A;  1RTU A;  3BU4 A;  2RNT A; 
#chains in the Genus database with same CATH topology
 3WHO A;  3L0R A;  1VQ4 3;  2Y74 A;  2L4V A;  3V98 A;  3J7Y d;  1BNI A;  1IQY A;  4EBG A;  1BRN L;  1N8Q A;  1RRH A;  1X1Y A;  1NDO B;  3JUM A;  5D83 A;  3V92 A;  3IJE B;  1YI2 3;  1MWU A;  4HM3 B;  4NRE A;  1N5H A;  1I8V A;  3RGR A;  2IY2 A;  1VQM 3;  3OXA A;  3EX9 A;  3AMO B;  1BSE A;  4TX4 A;  4XBT A;  3MG1 A;  1PY3 A;  4HKV B;  3NQZ A;  5G2G A;  3K9M C;  1YVB I;  2W03 A;  1EA2 A;  2GXF A;  3Q3F A;  2CX0 A;  3F8H A;  1RRL A;  3D3L A;  4CJN A;  1U5O A;  3NQY A;  5JPU A;  2IUJ A;  2WOF A;  1WMO A;  1ROA A;  2HMO B;  5BXQ A;  3F8X A;  5HOH A;  2IA7 A;  5AII A;  1KSI A;  1LNI A;  2ZHX B;  3Q90 A;  2OCT A;  1ULI B;  2BO9 B;  1X1X A;  1I2G A;  2GU3 A;  3N54 B;  3NXJ A;  7GSP A;  1JBT A;  1R4C A;  2UX0 A;  1E3R A;  1DVD A;  2XEP A;  1BSA A;  1UGI A;  1JN5 A;  1Q9E A;  3D4A A;  3D5I A;  1VQQ A;  3KN4 A;  4JRF A;  3H51 A;  1K41 A;  4Q53 A;  3CCL 3;  4STD A;  4G1M B;  4EC6 A;  3JUQ A;  2A15 A;  1GOY A;  1O7G B;  3DH2 A;  4I5Q A;  3K7C A;  2CFK A;  1VQ8 3;  1IV9 A;  1EUI C;  3SYU A;  2R41 A;  1BRH A;  1UCJ A;  1I2E A;  2K0M A;  3B4P A;  2CG1 A;  4N6T A;  2ML5 A;  5JPP A;  1TP6 A;  3EN8 A;  3DY5 A;  2ZDJ A;  1UUG B;  4HJL B;  4RZM A;  4HM6 B;  1UCK A;  5KP4 A;  4AKZ A;  4BTY A;  4CCV A;  1GSP A;  1LNH A;  4HOH A;  3X41 A;  1QVF 2;  2HMJ B;  2E2U A;  5HGR A;  1VQ5 3;  1MWR A;  4J5K A;  3ZFZ A;  3LTA A;  4IPB A;  3RGA A;  3S67 A;  2W2C A;  9RNT A;  1JKG A;  3MG2 A;  2CX1 A;  3GSP A;  4NHF A;  1QAF A;  4WFO A;  1HYF A;  5M18 A;  4NPB A;  4HM2 B;  2OTL 3;  3GAX A;  2CWT A;  4BTW A;  1A2V A;  3AGO A;  2ZA4 A;  3KCH A;  4KZ1 A;  4FCJ A;  4BIR A;  5EVH A;  3LTD A;  4DKI A;  3OWS A;  3K63 A;  2OTJ 3;  3FG4 A;  1QAK A;  3LH4 A;  3PXM A;  3CCM 3;  3SLU A;  3D79 A;  1IVW A;  1B2U A;  3M8C A;  1LRA A;  3WOF B;  4XBX A;  4L7K A;  3B7C A;  3VSY A;  3PZW A;  3GZR A;  2CK3 H;  2BNG A;  3DXO A;  1O7H B;  3HZP A;  3NHX A;  2J8X B;  1SPU A;  1RGG A;  2CKF B;  1LQG C;  1C54 A;  1J2B A;  3EQQ B;  3GZX B;  1HKX A;  1CYV A;  3NV0 A;  2M7O A;  3DGL A;  2F98 A;  3KSE D;  1IVV A;  1YHQ 3;  1JBS A;  4U13 A;  1C7H A;  1BU4 A;  2HMN B;  2V1L A;  2W56 A;  3OV4 A;  4HM5 B;  4R1K A;  1JZO A;  2UGI A;  5CXO A;  3CCJ 3;  3FG3 A;  3BU4 A;  4LSO A;  4LMI A;  3JVC A;  3B8L A;  1JB2 A;  3UNL A;  2QEX 3;  1GD4 A;  3LYG A;  3EB8 A;  3LZA A;  3WMD A;  1T3B A;  3CNX A;  5CK6 A;  5ELJ A;  3CCU 3;  4EV5 A;  2KXG A;  3AHW A;  1L5G B;  4WYK B;  2OOV C;  1IVX A;  5A0O B;  1STD A;  1OHO A;  1RGA A;  2HOH A;  2OWP A;  3MKI A;  5STD A;  1RHL A;  3G0K A;  3RDE A;  2SBL A;  4XBY A;  1DE3 A;  4JF8 A;  2KF6 A;  1CQS A;  1UGH I;  4RNZ A;  3NM7 A;  2H0G A;  6STD A;  3KSP A;  1IYY A;  3QRD A;  2JDI H;  2KF4 A;  4O02 B;  1YGE A;  3O8Y A;  4CDL A;  1KQS 2;  1NJI 4;  1W7C A;  1RGL A;  4RNY A;  2OQE A;  1I3F A;  1PYL A;  2O9U X;  1YJW 3;  1T2H A;  1G02 A;  2F5M A;  4ILF A;  1N9J A;  4N6O B;  1S72 3;  3ER7 A;  1TUH A;  2KAA A;  1B27 A;  1B2Z A;  4MMZ B;  3G16 A;  3E99 A;  1RN1 A;  6GSP A;  1BGS A;  1SAR A;  3F9S A;  3CU3 A;  3G71 3;  4HZB B;  2WGO A;  4LYL B;  1NNV A;  1RGC A;  3A5E A;  1GY7 A;  2YFL B;  3PYJ A;  1T5Y A;  4L8P A;  1UDI I;  1HZ1 A;  2F86 B;  3AMO A;  3HOH A;  3BNB A;  1SJW A;  3MWZ A;  5GSP A;  1RJO A;  2K54 A;  8RNT A;  1WMN A;  2GBX B;  1WQL B;  4HZ9 B;  2ML6 A;  1JNQ A;  3ECF A;  4IIA A;  3BIR A;  2B1X B;  3LTB A;  3STD A;  3MG3 A;  1X1W A;  4WHA A;  2UUG C;  5KP3 A;  2CFG A;  3BNE A;  3SX1 A;  1I0X A;  3NM2 A;  4RBN A;  2WO0 A;  1RCK A;  1OF5 B;  1IT8 A;  3OWU A;  1LQM B;  1WTH A;  3OX9 A;  4OVM A;  4AKY A;  1W02 A;  1W2Z A;  1B20 A;  1W6C A;  2IUK A;  3K0Z A;  5M19 A;  3ROB A;  5ELU A;  1D6Z A;  1MWS A;  4J8T A;  5IEO A;  2KF5 A;  1RNB A;  1OCV A;  4XB5 A;  1GMR A;  5BVB A;  5RNT A;  3N8B A;  1AY7 A;  3GZB A;  1SIH A;  4HM1 B;  3I0Y A;  1GYB A;  3FZW A;  4EXR A;  2K3D A;  4XDW A;  2CC3 A;  1FUT A;  1D6Y A;  4BTX A;  5IEP A;  2CG0 A;  1TFO A;  3CMA 3;  3F14 A;  1B2X A;  1LOW A;  3MHE A;  1SII A;  4J5G A;  1AV4 A;  1LVN A;  1RN7 A;  1LXE A;  1ROV A;  2Z6B A;  3BND A;  3K5T A;  4HBR A;  4KFF A;  5AI1 A;  3X40 A;  5AEU B;  4KFE A;  5M1A A;  1GS3 A;  1IDP A;  1B2S A;  3EE1 A;  4FR9 A;  3Q2P A;  3AHS A;  3CPO A;  3PGB A;  1YIJ 3;  4K61 A;  5IG5 A;  1A90 A;  1JV2 B;  2PZV A;  5LC6 A;  3FLJ A;  1DVC A;  1K28 A;  3GZY B;  4GB5 A;  3CXC 2;  1CH0 A;  3KFQ C;  4R80 A;  4H3U A;  2C4B A;  1BNJ A;  3HII A;  3HI7 A;  3NUV A;  1PFP A;  2CIU A;  3JUN A;  3DGN A;  4N6L A;  2GSP A;  1I3I A;  1RKY A;  3CME 3;  1YVS A;  1NB5 I;  4J9A A;  1MGR A;  1OHP A;  2STD A;  3PCS A;  1NU3 A;  3D5G A;  3D9R A;  1BAO A;  4GL6 A;  3V99 A;  2IMJ A;  1JB4 A;  1F8N A;  2F99 A;  4N6M A;  3FF2 A;  1TFK A;  1YJN 3;  1O7N B;  5AYS C;  1Q81 4;  2INX A;  4OK0 A;  1GOV A;  1ZO2 A;  7RNT A;  1ULJ B;  1US1 A;  2MF7 A;  1BVI A;  1M9G A;  2GBW B;  1QAL A;  2CFD A;  3I55 3;  2QA4 3;  2BMQ B;  2RNT A;  2HML B;  5DRE A;  2P0M A;  2OOV A;  5BU4 A;  2PNC A;  5TGN A;  1Q86 4;  1ZGX A;  1TRP A;  4R9L A;  1O7M B;  1SQW A;  5AIG A;  1A2K A;  1N5P A;  1VQL 3;  1IU7 A;  3WDG B;  1MOL A;  1MWT A;  3Q1C A;  5EEO A;  3X3X A;  2MC8 A;  1TTO A;  3CC4 3;  2Z77 A;  3FH1 A;  4GSP A;  3NBB A;  1T2I A;  1Y4K A;  3I56 3;  1DMQ A;  1VQK 3;  2RFR A;  1FGO A;  2XRX B;  1UUW B;  2KCD A;  1JB5 A;  2FGT A;  1N8R 4;  1RGH A;  3X3Y A;  1A67 A;  1RGF A;  3S5C A;  1JJ2 2;  4GHO A;  4N3V A;  3KII A;  1YIT 3;  3G4S 3;  3EHC A;  1BSC A;  4MJD A;  2AAD A;  3PS8 A;  4FCZ A;  4WYK A;  1RN4 A;  5AIF A;  3H3H A;  1M1K 4;  1FZU A;  2XSH B;  4N6N B;  4KVH A;  3KE7 A;  4O3V A;  4FMD A;  2D42 A;  2KF3 A;  1U8C B;  2W9Q A;  4HVN A;  4QWT A;  1RLS A;  2Z7A A;  4X2O A;  1KD1 4;  1RMS A;  3X42 A;  3HK4 A;  4KT3 B;  1BUJ A;  1BRJ A;  1FYS A;  1I2F A;  3DGY A;  3A76 A;  4X2H A;  1MGW A;  4XM4 A;  2GEX A;  3OW2 2;  1VQN 3;  1DYU A;  5IER A;  1CEW I;  1I70 A;  3BNC A;  1BNR A;  3ZG5 A;  1WNH A;  3S29 A;  2ZL8 A;  2BHM A;  3LML A;  3CC7 3;  4LEH A;  4HM0 B;  2F5W A;  4EYC A;  1TRQ A;  1D6U A;  1W00 A;  2L1S A;  3GWR A;  3FSD A;  5IG3 A;  3UL6 A;  4FCM A;  4XDV A;  2QIY A;  3MYT A;  5IG0 A;  1IK3 A;  3DGM A;  4O8S A;  5CF1 A;  1ISK A;  1RSN A;  1EKM A;  1LOY A;  2CWU A;  3JUO A;  3CD6 3;  1IT7 A;  2BT3 A;  4L8O A;  1AQZ A;  5CF2 A;  1HU9 A;  1BNE A;  4ZM8 A;  3CNM A;  1VQO 3;  1UCL A;  4ORL A;  3MSO A;  2XR8 B;  1B21 A;  1DMN A;  2WOH A;  2LQV A;  2XF3 A;  1GMQ A;  4N6V 0;  5EQL A;  3U1W A;  2XGN A;  1DMM A;  3KKG A;  3DMC A;  1AVL A;  3OWY A;  1BNG A;  3EC9 A;  1AR0 A;  1VQ7 3;  1BAN A;  4KFD A;  2XFT A;  1X1U A;  2D1W A;  1OF5 A;  1BRG A;  1LOV A;  3EBY A;  1Q40 B;  4HM8 B;  1JBR A;  1OPY A;  5AEW B;  3FG1 A;  1BIR A;  2E2V A;  1OH0 A;  4PEJ A;  1YJ9 3;  2P09 A;  2CFL A;  1VQP 3;  3S27 A;  3UB1 A;  3LTC A;  1MNL A;  5IEN A;  4MMX B;  1Q7Y 4;  5KP1 A;  5BIR A;  3CCE 3;  2CW9 A;  3EF8 A;  1M1X B;  2LYX A;  2HMM B;  2WGQ A;  4H61 A;  4AEQ A;  2BIR A;  1W6G A;  1G0T A;  4HM7 B;  1G96 A;  1JZD A;  3NBR A;  1M90 4;  2W04 A;  1BSB A;  1W2B 2;  3F7X A;  1W4N A;  4O2H A;  4RNT A;  3LXU X;  1QVG 2;  1BSD A;  2YFI B;  3N9H A;  1E3V A;  3CC2 3;  7STD A;  4BU4 A;  1V58 A;  2F4Y A;  3MPH A;  4EW5 A;  2OQE C;  4MMY B;  3CCV 3;  2GU1 A;  3DGO A;  3WOE B;  8CHO A;  1N9E A;  1UW1 A;  1DET A;  1V74 A;  2I9W A;  3EJV A;  1BOX A;  4LGQ A;  4LZI A;  3CCQ 3;  1I0V A;  1NB3 I;  2P05 A;  2XH9 A;  4K1V A;  3S28 A;  1JN5 B;  2RBI A;  1E97 A;  3WA3 A;  1V57 A;  4FMA A;  3FCS B;  1BRI A;  2P38 A;  1TJD A;  3FKA A;  5I97 A;  1VQ9 3;  2F56 A;  3CPW 2;  3FF0 A;  4HM4 B;  3QK9 A;  2QGU A;  4FMC A;  2XGL A;  2W6J H;  1IVU A;  1JRQ A;  3BB9 A;  1FGR A;  1ZX2 A;  3KZT A;  1A2P A;  2C10 A;  3DZL A;  1QMA A;  1FGM A;  3VF1 A;  3WOD G;  1O7W B;  2KRT A;  1OGX A;  2E2T A;  2RGQ A;  3EBT A;  3LT8 A;  4HAA A;  1K73 4;  3NBJ A;  1B2M A;  1UI7 A;  4I4K A;  1GMP A;  1OHS A;  5AYR B;  3CCS 3;  1ZS7 A;  4MEI A;  4R9K A;  1FUW A;  1JKG B;  1IQ8 A;  3DM8 A;  5IF6 A;  1W5Z A;  2CFW A;  1BRK A;  1UI8 A;  2GEY A;  4WP5 A;  5G1K A;  4FMB A;  2C11 A;  3TDG A;  1EQK A;  1FGT A;  2YX9 A;  1B3S A;  3IMA B;  5AIH A;  3SOY A;  3B4O A;  3SXX A;  1BUQ A;  3SED A;  2CHC A;  3U97 A;  1OAC A;  1GOU A;  5FGO A;  5FW5 A;  2R4I A;  2O3O A;  2P0X A;  3EN1 B;  3F7S A;  3T0U A;  2W9P A;  5G1L A;  1LOX A;  1IQX A;  1KWI A;  4K1U A;  3BLZ A;  3T8N A;  3UJM A;  3AGN A;  2IYJ A;  1W6Y A;  3ALA A;  4CPK A;  1NO3 A;  5D81 A;  1RDS A;  3T8U A;  3X3Z A;  3SOA A;  1YNV X;  4BL2 A;  3F40 A;  2BMO B;  1VQ6 3;  1TIJ A;  3SVA A;  3G6E 3;  2AAE A;  3NX0 A;  5CLK A;  2Y73 A;  3DUK A;  3IPT A;  3UL5 A;  5JBS A;  1KC8 4;  1AVK A;  4N6U A;  2B24 B;  2XFS A;  1YGW A;  3URP A;  1VZZ A;  2BU4 A;  3VGN A;  1CYU A;  1Z1S A;  2RCD A;  4R4K A;  3FGY A;  3CCR 3;  1FW7 A;  1NWW A;  2W0Q A;  2HMK B;  3HX8 A;  2Q07 A;  1K8A 4;  3G8Z A;  3NV0 B;  1BNS A;  2H0H A;  3WA2 X;  1FA3 A;  2CH9 A;  2JQ5 A;  2W56 B;  3JUP A;  1GD3 A;  1RNT A;  1GY6 A;  2SAR A;  2H0I A;  1R4Y A;  1O7P B;  3ZG0 A;  1ASK A;  6RNT A;  3PCR A;  1UUV B;  2FNQ A;  1RCL A;  5IG4 A;  3GRD A;  3WR2 A;  1IV7 A;  1Q82 4;  2CWV A;  1FUS A;  4K90 B;  1RGE A;  1GY5 A;  3LOY A;  4BL3 A;  1TU5 A;  1QJG A;  1BRS A;  1Q7H A;  1K9M 4;  3RNT A;  1W01 A;  2Z76 A;  2YFJ B;  5DRV A;  4WWU C;  3LT9 A;  4HYZ A;  1PU4 A;  1Q42 A;  1OGZ A;  1FGQ A;  1RGK A;  1S5A A;  1STF I;  4EV2 A;  2FXT A;  1BNF A;  1EG9 B;  2RSX A;  4OUQ A;  1WMP A;  3HIG A;  1OUN A;  4IT7 A;  5D82 A;  1EEJ A;  1UCI A;  1Q40 A;  5LC7 A;  5IW9 A;  1RTU A;  2BMR B;  2XSO B; 
#chains in the Genus database with same CATH homology
 3WHO A;  5BU4 A;  1BNI A;  1BRN L;  1ZGX A;  1TRP A;  1X1Y A;  3AHW A;  1DET A;  1BOX A;  2HOH A;  1RGA A;  1I0V A;  1RHL A;  1I8V A;  1TTO A;  2RBI A;  1DE3 A;  1BSE A;  2KF6 A;  4GSP A;  1PY3 A;  1BRI A;  1T2I A;  2F56 A;  1IYY A;  2KF4 A;  3Q3F A;  1RGH A;  1RGF A;  1RGL A;  1I3F A;  1PYL A;  1T2H A;  1G02 A;  2F5M A;  4GHO A;  1A2P A;  5HOH A;  2KAA A;  1LNI A;  1B27 A;  1B2Z A;  1BSC A;  1X1X A;  1I2G A;  1RN1 A;  2AAD A;  1RN4 A;  1BGS A;  1SAR A;  6GSP A;  7GSP A;  1JBT A;  4HAA A;  1FZU A;  1RGC A;  3A5E A;  1BSA A;  1B2M A;  1GMP A;  1HZ1 A;  1Q9E A;  3HOH A;  3D4A A;  3D5I A;  5GSP A;  2KF3 A;  8RNT A;  1RLS A;  1RMS A;  1BUJ A;  1BRJ A;  1FYS A;  1I2F A;  3BIR A;  3DGY A;  1MGW A;  1GOY A;  1X1W A;  1BRK A;  3DH2 A;  1I70 A;  1BNR A;  3SYU A;  1B3S A;  1BRH A;  1I0X A;  1I2E A;  1UCJ A;  2F5W A;  1TRQ A;  1RCK A;  1GOU A;  1B20 A;  1UCK A;  1GSP A;  1RSN A;  4HOH A;  1LOY A;  2KF5 A;  1RNB A;  3AGN A;  1GMR A;  5RNT A;  1AQZ A;  1RDS A;  4J5K A;  1YNV X;  1AY7 A;  1BNE A;  1UCL A;  9RNT A;  2AAE A;  1FUT A;  1B21 A;  1GMQ A;  3GSP A;  1YGW A;  1B2X A;  1HYF A;  3URP A;  1LOW A;  2BU4 A;  4J5G A;  1FW7 A;  1JBR A;  3AGO A;  1BNG A;  2ZA4 A;  3KCH A;  1BAN A;  1BNS A;  1X1U A;  4BIR A;  1BRG A;  1LOV A;  1B2S A;  1RNT A;  3AHS A;  2SAR A;  6RNT A;  1R4Y A;  1BIR A;  1RCL A;  1B2U A;  3WR2 A;  1LRA A;  1FUS A;  1CH0 A;  1RGE A;  2C4B A;  1BNJ A;  1BRS A;  5BIR A;  3RNT A;  2GSP A;  1I3I A;  1YVS A;  1MGR A;  1RGG A;  2BIR A;  3D5G A;  1BAO A;  1RGK A;  1C54 A;  1BNF A;  1BSB A;  1JBS A;  4RNT A;  1GOV A;  7RNT A;  1BSD A;  1BU4 A;  1UCI A;  1BVI A;  4BU4 A;  2F4Y A;  1RTU A;  3BU4 A;  2RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...