1I2EA

Ribonuclease t1 v16a mutant, form i
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i2eA00
1I2FA 3DGYA 4J5GA 1B2MA 1BSAA 3D4AA 1GOVA 1G02A 1LNIA 1X1XA 1BRSA 3WR2A 1I0XA 1C54A 4HAAA 2GSPA 2BIRA 1BNGA 4BU4A 1BSEA 1T2HA 1BANA 5RNTA 1DETA 3AGNA 1HYFA 1B2UA 1R4YA 3BU4A 1RNTA 1RGLA 3URPA 1RGFA 3D5IA 1TRPA 1I2GA 3A5EA 1LOYA 1BSBA 1BNEA 2KF3A 1ZGXA 1MGWA 2KF6A 2ZA4A 1BSCA 2HOHA 1BNJA 1X1UA 1RGGA 2BU4A 1BRNL 1RTUA 5BU4A 1FW7A 1B2XA 1BUJA 1FZUA 1RGEA 1RMSA 4HOHA 3WHOA 1T2IA 2F5MA 8RNTA 1BRJA 1GOUA 1FUSA 1HZ1A 1RN1A 1UCKA 1BNSA 1BIRA 1X1WA 4GSPA 1BGSA 3AHSA 6RNTA 7GSPA 1RGHA 1Q9EA 1BAOA 1JBSA 2F4YA 1RGKA 3SYUA 3RNTA 1BVIA 1BSDA 4RNTA 3BIRA 1B27A 1B21A 1MGRA 1BRHA 1BRKA 1BNIA 1AQZA 1I3IA 2F5WA 1RHLA 1BOXA 1LOVA 1JBRA 1A2PA 1TRQA 9RNTA 2RNTA 3KCHA 1GSPA 4BIRA 1YGWA 3AHWA 5BIRA 1FYSA 1UCIA 6GSPA 1AY7A 1B2SA 1UCLA 1B2ZA 1BNFA 1X1YA 2C4BA 1GMPA 2F56A 1RCKA 1RLSA 3AGOA 1B3SA 1RN4A 1TTOA 3GSPA 1I3FA 1BRIA 1FUTA 1RGCA 2KF4A 1GOYA 3D5GA 2AADA 1JBTA 7RNTA 1BNRA 1DE3A 1B20A 1YNVX 1I70A 1RNBA 1IYYA 1GMRA 1I0VA 3Q3FA 1CH0A 2AAEA 2RBIA 1SARA 1RSNA 1RCLA 2KF5A 1RGAA 5HOHA 1I8VA 4GHOA 1UCJA 1YVSA 1I2EA 1LOWA 1BU4A 2KAAA 1PY3A 3DH2A 4J5KA 1LRAA 2SARA 5GSPA 1PYLA 3HOHA 1BRGA 1RDSA 1GMQA
chains in the Genus database with same CATH superfamily
2CX1A 4HM5B 4STDA 4J5GA 4KZ1A 4O2HA 3CCQ3 4PEJA 1AVLA 4EC6A 3HX8A 1VQN3 1QAFA 5EQLA 1QAKA 3CC23 4AKYA 3F8XA 5G1KA 1JN5A 1YJW3 5M19A 4KFEA 1WTHA 5DRVA 1AVKA 3FSDA 4HM0B 3UL5A 4LSOA 1NJI4 5RNTA 2K0MA 1R4YA 1B2UA 1EUIC 3BU4A 1RGLA 4RBNA 3URPA 1RGFA 2UUGC 3HZPA 3BB9A 4FR9A 4X2HA 1IVVA 2RFRA 1W6YA 3A5EA 1LOYA 1Q42A 2I9WA 4NREA 1S723 5KP1A 3EBTA 5I97A 3CCJ3 1U8CB 2HMOB 2LYXA 1MGWA 3JUMA 2ZA4A 3S28A 1EA2A 2W03A 3WMDA 3PYJA 3G713 3DZLA 3CNMA 4XB5A 3MKIA 3M8CA 1IVWA 1WNHA 3WOFB 2Z77A 1B2XA 2IY2A 2OCTA 3X40A 1FZUA 1RRHA 3OWSA 2CFDA 3UJMA 4HOHA 1ASKA 2P0XA 4O02B 3TDGA 3EB8A 2F5MA 2BHMA 8RNTA 2IUJA 5IG5A 4HM1B 5ELUA 1FA3A 1A2VA 1UCKA 3I563 3CCU3 2BMOB 3EE1A 4OUQA 3EN8A 1OACA 2CG0A 3NBRA 1TFKA 2ZL8A 1O7GB 4XM4A 3QK9A 4XDWA 1QVG2 4L7KA 5JPUA 1RGKA 1UUGB 3DMCA 2WOFA 3DGMA 3SYUA 3CMA3 4CDLA 5JBSA 4OVMA 1J2BA 3CD63 1STDA 1Z1SA 3BIRA 1M1K4 1B21A 1WMPA 1I3IA 2F5WA 1AQZA 2W2CA 2CC3A 1RJOA 1BOXA 1US1A 1V57A 4HM3B 3NUVA 1JNQA 1A2PA 2QGUA 1VQO3 2CX0A 1DVDA 3KCHA 2SBLA 4K1UA 4LZIA 1Q864 1VQ73 2M7OA 4FMDA 5JPPA 1FGRA 3AHWA 6GSPA 5KP3A 3X3ZA 7STDA 3F7SA 1ROAA 2FGTA 1LQMB 2UGIA 3AMOB 2E2UA 1X1YA 2C4BA 2F56A 3J7Yd 4IPBA 2IUKA 1RCKA 2P38A 3CC73 3CCR3 1RLSA 2PZVA 2HMNB 2XRXB 4HZ9B 2MC8A 1TTOA 3UB1A 4R9LA 3CPW2 1T5YA 3GSPA 4HVNA 4CJNA 1BRIA 1FUTA 3X3XA 4OK0A 2D1WA 1ISKA 5AIHA 5IEPA 1D6UA 1OGZA 1W4NA 2B24B 1SIIA 1N8R4 1WMOA 1I70A 4U13A 2FXTA 2CFKA 3GZXB 1O7PB 4KVHA 4N6LA 2AAEA 2RBIA 2F99A 1SARA 3F8HA 2IA7A 1RCLA 3MWZA 1IVUA 3HIGA 1HU9A 3KZTA 2E2VA 2WO0A 1TJDA 2XH9A 3CCV3 8CHOA 1YIJ3 3MYTA 3S5CA 1YVSA 3JUNA 1Q40A 1ULIB 5LC7A 1I2EA 2KAAA 1UGIA 1WQLB 1GD3A 1WMNA 2BMRB 2ML5A 2OQEC 4J5KA 4N6V0 2GU1A 1E97A 2Z6BA 4HZBB 4GB5A 4AKZA 3PS8A 4EW5A 2W9PA 5M18A 3HOHA 1GMQA 2H0GA 1V74A 1B2MA 3EC9A 1ZX2A 1BSAA 3D4AA 4BL3A 4K61A 2XR8B 1GOVA 2W6JH 2QA43 3U1WA 1QMAA 1X1XA 3NBJA 1LNHA 1I0XA 3H51A 1C54A 2Y73A 3G6E3 1BNGA 4BU4A 2H0HA 2GXFA 1BSEA 2Q07A 2KCDA 1BUQA 3LTDA 3FG1A 1M9GA 3MHEA 2GU3A 4HJLB 4KT3B 1MWUA 2C10A 1BANA 1N5HA 2XF3A 1DETA 1HYFA 1JN5B 1NB3I 2Z7AA 2K54A 5BVBA 1N9EA 1JRQA 1AV4A 2PNCA 3D9RA 1HKXA 5LC6A 3WA2X 1YJN3 1BSBA 1BNEA 2FNQA 1W6GA 2YFLB 3LZAA 4RNYA 2KF3A 3EBYA 3NQYA 4N6UA 2KF6A 2HOHA 5AIGA 3SVAA 1X1UA 2W56A 3CCL3 2CKFB 1Q814 3OWUA 3KN4A 2W0QA 4WWUC 4N6NB 1JV2B 2O3OA 1FW7A 3OX9A 3SEDA 1GY7A 2RGQA 5STDA 1FGQA 1NO3A 3EHCA 1RMSA 3K9MC 3STDA 1T3BA 3WHOA 2BO9B 3E99A 1JB2A 3KKGA 5CLKA 3BLZA 1VQ93 1BNSA 2WGQA 5M1AA 1BGSA 3IMAB 5HGRA 3KIIA 4H61A 2K3DA 1Q9EA 1NNVA 1W2ZA 4HBRA 3G4S3 1JB4A 2HMJB 1AR0A 2GEYA 1BVIA 3DUKA 1ZS7A 1NU3A 2CG1A 3RDEA 1B27A 1MGRA 1BRHA 1BRKA 2XGLA 1VQK3 1LOVA 2IMJA 3MSOA 1TRQA 3PCSA 1MWRA 3JVCA 2BNGA 5BIRA 3G8ZA 1IU7A 1D6ZA 1OPYA 1IQXA 4JF8A 1AY7A 1OF5B 4X2OA 1A90A 1E3RA 1B2SA 1LQGC 1BNFA 2XFSA 3FF2A 5FGOA 3SOAA 2C11A 3PCRA 1N8QA 4H3UA 3V98A 3AGOA 1YIT3 5AEUB 1RN4A 3NV0B 2MF7A 2H0IA 1W6CA 1G96A 1MNLA 2YFJB 1M1XB 2XEPA 1RGCA 3FG3A 2KF4A 1DE3A 4FCMA 2AADA 4J8TA 7RNTA 1VQ63 4NHFA 1B20A 2W04A 1TIJA 3WODG 1Y4KA 2CFWA 3JUQA 3T8UA 2XFTA 3DGOA 1IV7A 5AIFA 3VF1A 3VSYA 1CH0A 3ZFZA 3BNEA 3O8YA 4I4KA 2BMQB 5CK6A 3V99A 3NXJA 3HIIA 1RGAA 1I8VA 4FMAA 4GHOA 1LVNA 3EJVA 3FCSB 1OHOA 3H3HA 1LOWA 3X3YA 3MPHA 2OQEA 3KSPA 3DH2A 3KFQC 1LRAA 4NPBA 4TX4A 1UI8A 3ALAA 1PYLA 3CU3A 1F8NA 3LT9A 1BRGA 3Q2PA 1I2FA 3DGYA 2XSHB 2L4VA 5CXOA 3OXAA 3VGNA 3LOYA 1A2KA 1G02A 1LNIA 3ECFA 2F98A 1BRSA 3UL6A 4ORLA 3B4OA 1CQSA 5DREA 3OWYA 3V92A 3WR2A 1JKGA 2GSPA 2BIRA 2CWVA 3S27A 1E3VA 3QRDA 4HKVB 4CPKA 1MWSA 2OOVC 5AEWB 2OTL3 3AGNA 1RNTA 3MG3A 3N8BA 3EX9A 1KD14 1CYVA 3D5IA 1GS3A 3WA3A 1KSIA 1I2GA 1TRPA 2W56B 1TUHA 3T8NA 4EBGA 5EEOA 1YI23 4K1VA 4KFDA 4HM8B 1DMNA 1O7WB 1IT8A 1Q7HA 1W5ZA 1JKGB 2A15A 2BU4A 2J8XB 1W2B2 1BRNL 1EQKA 1W02A 2YX9A 3K7CA 5BU4A 2OWPA 3LTAA 6STDA 3BNCA 2CHCA 1BUJA 1EEJA 1VZZA 2IYJA 4L8PA 3A76A 4XBTA 1UDII 2KXGA 4JRFA 1R4CA 1L5GB 3PXMA 3ER7A 1T2IA 4XBXA 1NB5I 1GOUA 1FUSA 1HZ1A 3IPTA 5D83A 1UW1A 2R4IA 1X1WA 1O7MB 4GSPA 2CFLA 3BNBA 5G1LA 3GRDA 3D79A 1LXEA 1OUNA 5CF2A 1RKYA 5TGNA 3AHSA 3UNLA 2L1SA 3AMOA 4FCZA 7GSPA 2CWUA 3MG1A 1BAOA 1YJ93 2F4YA 2HMKB 3IJEB 2QEX3 2KRTA 2LQVA 1JBSA 1GY6A 1FUWA 2JQ5A 4DKIA 3RNTA 1MOLA 2CFGA 1KWIA 4RNTA 4BTYA 5IF6A 1RN7A 4RZMA 5AI1A 1RHLA 1JBRA 1D6YA 2O9UX 3GWRA 3LTCA 3BNDA 2RNTA 3S29A 3WOEB 1CYUA 3FLJA 1GSPA 1FYSA 1UCIA 3SX1A 1NDOB 3FH1A 3FZWA 1UCLA 1B2ZA 5IG0A 1K41A 2R41A 1GMPA 3T0UA 3JUPA 3OW22 2P0MA 4WP5A 2INXA 3LT8A 1I3FA 2CH9A 4HM6B 4N6MA 2UX0A 1GOYA 3D5GA 3N54B 1BNRA 3EN1B 1VQ53 1O7NB 2F86B 1VQP3 3GAXA 1YHQ3 1JZOA 1V58A 1GMRA 1N9JA 3NM2A 1IYYA 1I0VA 3B8LA 1DMMA 3HI7A 4N3VA 5G2GA 3G0KA 1JZDA 3RGAA 4BTWA 1ROVA 2KF5A 3GZRA 1SJWA 3K5TA 4IT7A 3RGRA 5HOHA 4MMYB 1OHSA 3DGNA 1W01A 4LMIA 5IENA 1UCJA 4L8OA 5FW5A 4AEQA 3CCE3 4ZM8A 3Q90A 1JB5A 2CK3H 1TU5A 3CXC2 2XGNA 1PY3A 4WFOA 1VQM3 2SARA 4MEIA 3Q1CA 1TP6A 2ML6A 3LMLA 4LGQA 4R9KA 5A0OB 1EG9B 1ZO2A 3N9HA 1RDSA 2CWTA 4BL2A 3D3LA 1UUVB 2E2TA 1A67A 1VQQA 1OHPA 3LH4A 4K90B 3NQZA 3PGBA 5EVHA 4ILFA 2GBXB 3ZG5A 3ROBA 4HAAA 1KC84 3B7CA 3FF0A 4R4KA 5IW9A 3K0ZA 3KSED 4WYKB 3I0YA 4XDVA 1T2HA 1W00A 3LTBA 3F9SA 1KQS2 1PU4A 3OV4A 3DGLA 1GY5A 4HM4B 1JJ22 1DYUA 3KE7A 4EXRA 3DM8A 1Q40B 4HM2B 5AIIA 5BXQA 1ZGXA 1RRLA 4GL6A 1OH0A 1BSCA 1C7HA 1BNJA 5IG3A 1RGGA 1VQL3 1RTUA 3F14A 4EV2A 2YFIB 5AYSC 2ZDJA 1Q824 3L0RA 3F7XA 4N6OB 1SPUA 1RGEA 4R1KA 4XBYA 1MWTA 3DY5A 5AYRB 4MJDA 1BRJA 1RN1A 2P05A 4O3VA 1IT7A 3CPOA 3X42A 1CEWI 4CCVA 4HYZA 4KFFA 1BIRA 1VQ83 2QIYA 4BTXA 4I5QA 4LYLB 1FGTA 1OGXA 4EYCA 4Q53A 1O7HB 6RNTA 3FG4A 1DMQA 1RGHA 1UUWB 2CW9A 4IIAA 2Y74A 5CF1A 3CCM3 3JUOA 3X41A 3NBBA 1LOXA 1SQWA 1TFOA 3NX0A 4WHAA 1S5AA 3NHXA 1K734 3NV0A 1BSDA 3WDGB 2RCDA 1G0TA 2RSXA 2V1LA 2XSOB 3F40A 4HM7B 4LEHA 2JDIH 1BNIA 2HMMB 3K63A 2OTJ3 3FGYA 3CME3 1IQYA 9RNTA 3MG2A 2P09A 1SIHA 2W9QA 4MMZB 5ELJA 3S67A 1IQ8A 3I553 1FGOA 2ZHXB 4BIRA 1EKMA 1YGWA 3SXXA 3U97A 1M904 1ULJB 3FKAA 3CCS3 5IERA 2CIUA 3CNXA 3PZWA 1IV9A 1Q7Y4 1B3SA 4EV5A 1QJGA 1UI7A 3G16A 2GEXA 3EQQB 2OOVA 3NM7A 5D82A 1YVBI 2Z76A 1JBTA 1K8A4 3HK4A 1STFI 4MMXB 4R80A 3SLUA 4J9AA 1PFPA 3SOYA 1OCVA 4RNZA 5IEOA 1YNVX 1RNBA 1W7CA 1FGMA 1QALA 1UGHI 3Q3FA 3GZYB 3CC43 1RSNA 3EF8A 2GBWB 3B4PA 3GZBA 2HMLB 1IDPA 3DXOA 5D81A 2STDA 1IVXA 1N5PA 2WGOA 1YGEA 2BT3A 2WOHA 3LXUX 1DVCA 2B1XB 4FMCA 3ZG0A 1K9M4 1VQ43 1GYBA 1QVF2 1OF5A 5KP4A 1BU4A 4WYKA 4G1MB 4O8SA 5IG4A 4QWTA 1IK3A 1U5OA 3LYGA 4FCJA 2D42A 4N6TA 5GSPA 1GD4A 4FMBA 1NWWA 1K28A
chains in the Genus database with same CATH topology
1I2FA 3DGYA 4J5GA 1B2MA 1BSAA 3D4AA 1GOVA 1G02A 1LNIA 1X1XA 1BRSA 3WR2A 1I0XA 1C54A 4HAAA 2GSPA 2BIRA 1BNGA 4BU4A 1BSEA 1T2HA 1BANA 5RNTA 1DETA 3AGNA 1HYFA 1B2UA 1R4YA 3BU4A 1RNTA 1RGLA 3URPA 1RGFA 3D5IA 1TRPA 1I2GA 3A5EA 1LOYA 1BSBA 1BNEA 2KF3A 1ZGXA 1MGWA 2KF6A 2ZA4A 1BSCA 2HOHA 1BNJA 1X1UA 1RGGA 2BU4A 1BRNL 1RTUA 5BU4A 1FW7A 1B2XA 1BUJA 1FZUA 1RGEA 1RMSA 4HOHA 3WHOA 1T2IA 2F5MA 8RNTA 1BRJA 1GOUA 1FUSA 1HZ1A 1RN1A 1UCKA 1BNSA 1BIRA 1X1WA 4GSPA 1BGSA 3AHSA 6RNTA 7GSPA 1RGHA 1Q9EA 1BAOA 1JBSA 2F4YA 1RGKA 3SYUA 3RNTA 1BVIA 1BSDA 4RNTA 3BIRA 1B27A 1B21A 1MGRA 1BRHA 1BRKA 1BNIA 1AQZA 1I3IA 2F5WA 1RHLA 1BOXA 1LOVA 1JBRA 1A2PA 1TRQA 9RNTA 2RNTA 3KCHA 1GSPA 4BIRA 1YGWA 3AHWA 5BIRA 1FYSA 1UCIA 6GSPA 1AY7A 1B2SA 1UCLA 1B2ZA 1BNFA 1X1YA 2C4BA 1GMPA 2F56A 1RCKA 1RLSA 3AGOA 1B3SA 1RN4A 1TTOA 3GSPA 1I3FA 1BRIA 1FUTA 1RGCA 2KF4A 1GOYA 3D5GA 2AADA 1JBTA 7RNTA 1BNRA 1DE3A 1B20A 1YNVX 1I70A 1RNBA 1IYYA 1GMRA 1I0VA 3Q3FA 1CH0A 2AAEA 2RBIA 1SARA 1RSNA 1RCLA 2KF5A 1RGAA 5HOHA 1I8VA 4GHOA 1UCJA 1YVSA 1I2EA 1LOWA 1BU4A 2KAAA 1PY3A 3DH2A 4J5KA 1LRAA 2SARA 5GSPA 1PYLA 3HOHA 1BRGA 1RDSA 1GMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2F A;  3DGY A;  4J5G A;  1B2M A;  1BSA A;  3D4A A;  1GOV A;  1G02 A;  1LNI A;  1X1X A;  1BRS A;  3WR2 A;  1I0X A;  1C54 A;  4HAA A;  2GSP A;  2BIR A;  1BNG A;  4BU4 A;  1BSE A;  1T2H A;  1BAN A;  5RNT A;  1DET A;  3AGN A;  1HYF A;  1B2U A;  1R4Y A;  3BU4 A;  1RNT A;  1RGL A;  3URP A;  1RGF A;  3D5I A;  1TRP A;  1I2G A;  3A5E A;  1LOY A;  1BSB A;  1BNE A;  2KF3 A;  1ZGX A;  1MGW A;  2KF6 A;  2ZA4 A;  1BSC A;  2HOH A;  1BNJ A;  1X1U A;  1RGG A;  2BU4 A;  1BRN L;  1RTU A;  5BU4 A;  1FW7 A;  1B2X A;  1BUJ A;  1FZU A;  1RGE A;  1RMS A;  4HOH A;  3WHO A;  1T2I A;  2F5M A;  8RNT A;  1BRJ A;  1GOU A;  1FUS A;  1HZ1 A;  1RN1 A;  1UCK A;  1BNS A;  1BIR A;  1X1W A;  4GSP A;  1BGS A;  3AHS A;  6RNT A;  7GSP A;  1RGH A;  1Q9E A;  1BAO A;  1JBS A;  2F4Y A;  1RGK A;  3SYU A;  3RNT A;  1BVI A;  1BSD A;  4RNT A;  3BIR A;  1B27 A;  1B21 A;  1MGR A;  1BRH A;  1BRK A;  1BNI A;  1AQZ A;  1I3I A;  2F5W A;  1RHL A;  1BOX A;  1LOV A;  1JBR A;  1A2P A;  1TRQ A;  9RNT A;  2RNT A;  3KCH A;  1GSP A;  4BIR A;  1YGW A;  3AHW A;  5BIR A;  1FYS A;  1UCI A;  6GSP A;  1AY7 A;  1B2S A;  1UCL A;  1B2Z A;  1BNF A;  1X1Y A;  2C4B A;  1GMP A;  2F56 A;  1RCK A;  1RLS A;  3AGO A;  1B3S A;  1RN4 A;  1TTO A;  3GSP A;  1I3F A;  1BRI A;  1FUT A;  1RGC A;  2KF4 A;  1GOY A;  3D5G A;  2AAD A;  1JBT A;  7RNT A;  1BNR A;  1DE3 A;  1B20 A;  1YNV X;  1I70 A;  1RNB A;  1IYY A;  1GMR A;  1I0V A;  3Q3F A;  1CH0 A;  2AAE A;  2RBI A;  1SAR A;  1RSN A;  1RCL A;  2KF5 A;  1RGA A;  5HOH A;  1I8V A;  4GHO A;  1UCJ A;  1YVS A;  1I2E A;  1LOW A;  1BU4 A;  2KAA A;  1PY3 A;  3DH2 A;  4J5K A;  1LRA A;  2SAR A;  5GSP A;  1PYL A;  3HOH A;  1BRG A;  1RDS A;  1GMQ A; 
#chains in the Genus database with same CATH topology
 2CX1 A;  4HM5 B;  4STD A;  4J5G A;  4KZ1 A;  4O2H A;  3CCQ 3;  4PEJ A;  1AVL A;  4EC6 A;  3HX8 A;  1VQN 3;  1QAF A;  5EQL A;  1QAK A;  3CC2 3;  4AKY A;  3F8X A;  5G1K A;  1JN5 A;  1YJW 3;  5M19 A;  4KFE A;  1WTH A;  5DRV A;  1AVK A;  3FSD A;  4HM0 B;  3UL5 A;  4LSO A;  1NJI 4;  5RNT A;  2K0M A;  1R4Y A;  1B2U A;  1EUI C;  3BU4 A;  1RGL A;  4RBN A;  3URP A;  1RGF A;  2UUG C;  3HZP A;  3BB9 A;  4FR9 A;  4X2H A;  1IVV A;  2RFR A;  1W6Y A;  3A5E A;  1LOY A;  1Q42 A;  2I9W A;  4NRE A;  1S72 3;  5KP1 A;  3EBT A;  5I97 A;  3CCJ 3;  1U8C B;  2HMO B;  2LYX A;  1MGW A;  3JUM A;  2ZA4 A;  3S28 A;  1EA2 A;  2W03 A;  3WMD A;  3PYJ A;  3G71 3;  3DZL A;  3CNM A;  4XB5 A;  3MKI A;  3M8C A;  1IVW A;  1WNH A;  3WOF B;  2Z77 A;  1B2X A;  2IY2 A;  2OCT A;  3X40 A;  1FZU A;  1RRH A;  3OWS A;  2CFD A;  3UJM A;  4HOH A;  1ASK A;  2P0X A;  4O02 B;  3TDG A;  3EB8 A;  2F5M A;  2BHM A;  8RNT A;  2IUJ A;  5IG5 A;  4HM1 B;  5ELU A;  1FA3 A;  1A2V A;  1UCK A;  3I56 3;  3CCU 3;  2BMO B;  3EE1 A;  4OUQ A;  3EN8 A;  1OAC A;  2CG0 A;  3NBR A;  1TFK A;  2ZL8 A;  1O7G B;  4XM4 A;  3QK9 A;  4XDW A;  1QVG 2;  4L7K A;  5JPU A;  1RGK A;  1UUG B;  3DMC A;  2WOF A;  3DGM A;  3SYU A;  3CMA 3;  4CDL A;  5JBS A;  4OVM A;  1J2B A;  3CD6 3;  1STD A;  1Z1S A;  3BIR A;  1M1K 4;  1B21 A;  1WMP A;  1I3I A;  2F5W A;  1AQZ A;  2W2C A;  2CC3 A;  1RJO A;  1BOX A;  1US1 A;  1V57 A;  4HM3 B;  3NUV A;  1JNQ A;  1A2P A;  2QGU A;  1VQO 3;  2CX0 A;  1DVD A;  3KCH A;  2SBL A;  4K1U A;  4LZI A;  1Q86 4;  1VQ7 3;  2M7O A;  4FMD A;  5JPP A;  1FGR A;  3AHW A;  6GSP A;  5KP3 A;  3X3Z A;  7STD A;  3F7S A;  1ROA A;  2FGT A;  1LQM B;  2UGI A;  3AMO B;  2E2U A;  1X1Y A;  2C4B A;  2F56 A;  3J7Y d;  4IPB A;  2IUK A;  1RCK A;  2P38 A;  3CC7 3;  3CCR 3;  1RLS A;  2PZV A;  2HMN B;  2XRX B;  4HZ9 B;  2MC8 A;  1TTO A;  3UB1 A;  4R9L A;  3CPW 2;  1T5Y A;  3GSP A;  4HVN A;  4CJN A;  1BRI A;  1FUT A;  3X3X A;  4OK0 A;  2D1W A;  1ISK A;  5AIH A;  5IEP A;  1D6U A;  1OGZ A;  1W4N A;  2B24 B;  1SII A;  1N8R 4;  1WMO A;  1I70 A;  4U13 A;  2FXT A;  2CFK A;  3GZX B;  1O7P B;  4KVH A;  4N6L A;  2AAE A;  2RBI A;  2F99 A;  1SAR A;  3F8H A;  2IA7 A;  1RCL A;  3MWZ A;  1IVU A;  3HIG A;  1HU9 A;  3KZT A;  2E2V A;  2WO0 A;  1TJD A;  2XH9 A;  3CCV 3;  8CHO A;  1YIJ 3;  3MYT A;  3S5C A;  1YVS A;  3JUN A;  1Q40 A;  1ULI B;  5LC7 A;  1I2E A;  2KAA A;  1UGI A;  1WQL B;  1GD3 A;  1WMN A;  2BMR B;  2ML5 A;  2OQE C;  4J5K A;  4N6V 0;  2GU1 A;  1E97 A;  2Z6B A;  4HZB B;  4GB5 A;  4AKZ A;  3PS8 A;  4EW5 A;  2W9P A;  5M18 A;  3HOH A;  1GMQ A;  2H0G A;  1V74 A;  1B2M A;  3EC9 A;  1ZX2 A;  1BSA A;  3D4A A;  4BL3 A;  4K61 A;  2XR8 B;  1GOV A;  2W6J H;  2QA4 3;  3U1W A;  1QMA A;  1X1X A;  3NBJ A;  1LNH A;  1I0X A;  3H51 A;  1C54 A;  2Y73 A;  3G6E 3;  1BNG A;  4BU4 A;  2H0H A;  2GXF A;  1BSE A;  2Q07 A;  2KCD A;  1BUQ A;  3LTD A;  3FG1 A;  1M9G A;  3MHE A;  2GU3 A;  4HJL B;  4KT3 B;  1MWU A;  2C10 A;  1BAN A;  1N5H A;  2XF3 A;  1DET A;  1HYF A;  1JN5 B;  1NB3 I;  2Z7A A;  2K54 A;  5BVB A;  1N9E A;  1JRQ A;  1AV4 A;  2PNC A;  3D9R A;  1HKX A;  5LC6 A;  3WA2 X;  1YJN 3;  1BSB A;  1BNE A;  2FNQ A;  1W6G A;  2YFL B;  3LZA A;  4RNY A;  2KF3 A;  3EBY A;  3NQY A;  4N6U A;  2KF6 A;  2HOH A;  5AIG A;  3SVA A;  1X1U A;  2W56 A;  3CCL 3;  2CKF B;  1Q81 4;  3OWU A;  3KN4 A;  2W0Q A;  4WWU C;  4N6N B;  1JV2 B;  2O3O A;  1FW7 A;  3OX9 A;  3SED A;  1GY7 A;  2RGQ A;  5STD A;  1FGQ A;  1NO3 A;  3EHC A;  1RMS A;  3K9M C;  3STD A;  1T3B A;  3WHO A;  2BO9 B;  3E99 A;  1JB2 A;  3KKG A;  5CLK A;  3BLZ A;  1VQ9 3;  1BNS A;  2WGQ A;  5M1A A;  1BGS A;  3IMA B;  5HGR A;  3KII A;  4H61 A;  2K3D A;  1Q9E A;  1NNV A;  1W2Z A;  4HBR A;  3G4S 3;  1JB4 A;  2HMJ B;  1AR0 A;  2GEY A;  1BVI A;  3DUK A;  1ZS7 A;  1NU3 A;  2CG1 A;  3RDE A;  1B27 A;  1MGR A;  1BRH A;  1BRK A;  2XGL A;  1VQK 3;  1LOV A;  2IMJ A;  3MSO A;  1TRQ A;  3PCS A;  1MWR A;  3JVC A;  2BNG A;  5BIR A;  3G8Z A;  1IU7 A;  1D6Z A;  1OPY A;  1IQX A;  4JF8 A;  1AY7 A;  1OF5 B;  4X2O A;  1A90 A;  1E3R A;  1B2S A;  1LQG C;  1BNF A;  2XFS A;  3FF2 A;  5FGO A;  3SOA A;  2C11 A;  3PCR A;  1N8Q A;  4H3U A;  3V98 A;  3AGO A;  1YIT 3;  5AEU B;  1RN4 A;  3NV0 B;  2MF7 A;  2H0I A;  1W6C A;  1G96 A;  1MNL A;  2YFJ B;  1M1X B;  2XEP A;  1RGC A;  3FG3 A;  2KF4 A;  1DE3 A;  4FCM A;  2AAD A;  4J8T A;  7RNT A;  1VQ6 3;  4NHF A;  1B20 A;  2W04 A;  1TIJ A;  3WOD G;  1Y4K A;  2CFW A;  3JUQ A;  3T8U A;  2XFT A;  3DGO A;  1IV7 A;  5AIF A;  3VF1 A;  3VSY A;  1CH0 A;  3ZFZ A;  3BNE A;  3O8Y A;  4I4K A;  2BMQ B;  5CK6 A;  3V99 A;  3NXJ A;  3HII A;  1RGA A;  1I8V A;  4FMA A;  4GHO A;  1LVN A;  3EJV A;  3FCS B;  1OHO A;  3H3H A;  1LOW A;  3X3Y A;  3MPH A;  2OQE A;  3KSP A;  3DH2 A;  3KFQ C;  1LRA A;  4NPB A;  4TX4 A;  1UI8 A;  3ALA A;  1PYL A;  3CU3 A;  1F8N A;  3LT9 A;  1BRG A;  3Q2P A;  1I2F A;  3DGY A;  2XSH B;  2L4V A;  5CXO A;  3OXA A;  3VGN A;  3LOY A;  1A2K A;  1G02 A;  1LNI A;  3ECF A;  2F98 A;  1BRS A;  3UL6 A;  4ORL A;  3B4O A;  1CQS A;  5DRE A;  3OWY A;  3V92 A;  3WR2 A;  1JKG A;  2GSP A;  2BIR A;  2CWV A;  3S27 A;  1E3V A;  3QRD A;  4HKV B;  4CPK A;  1MWS A;  2OOV C;  5AEW B;  2OTL 3;  3AGN A;  1RNT A;  3MG3 A;  3N8B A;  3EX9 A;  1KD1 4;  1CYV A;  3D5I A;  1GS3 A;  3WA3 A;  1KSI A;  1I2G A;  1TRP A;  2W56 B;  1TUH A;  3T8N A;  4EBG A;  5EEO A;  1YI2 3;  4K1V A;  4KFD A;  4HM8 B;  1DMN A;  1O7W B;  1IT8 A;  1Q7H A;  1W5Z A;  1JKG B;  2A15 A;  2BU4 A;  2J8X B;  1W2B 2;  1BRN L;  1EQK A;  1W02 A;  2YX9 A;  3K7C A;  5BU4 A;  2OWP A;  3LTA A;  6STD A;  3BNC A;  2CHC A;  1BUJ A;  1EEJ A;  1VZZ A;  2IYJ A;  4L8P A;  3A76 A;  4XBT A;  1UDI I;  2KXG A;  4JRF A;  1R4C A;  1L5G B;  3PXM A;  3ER7 A;  1T2I A;  4XBX A;  1NB5 I;  1GOU A;  1FUS A;  1HZ1 A;  3IPT A;  5D83 A;  1UW1 A;  2R4I A;  1X1W A;  1O7M B;  4GSP A;  2CFL A;  3BNB A;  5G1L A;  3GRD A;  3D79 A;  1LXE A;  1OUN A;  5CF2 A;  1RKY A;  5TGN A;  3AHS A;  3UNL A;  2L1S A;  3AMO A;  4FCZ A;  7GSP A;  2CWU A;  3MG1 A;  1BAO A;  1YJ9 3;  2F4Y A;  2HMK B;  3IJE B;  2QEX 3;  2KRT A;  2LQV A;  1JBS A;  1GY6 A;  1FUW A;  2JQ5 A;  4DKI A;  3RNT A;  1MOL A;  2CFG A;  1KWI A;  4RNT A;  4BTY A;  5IF6 A;  1RN7 A;  4RZM A;  5AI1 A;  1RHL A;  1JBR A;  1D6Y A;  2O9U X;  3GWR A;  3LTC A;  3BND A;  2RNT A;  3S29 A;  3WOE B;  1CYU A;  3FLJ A;  1GSP A;  1FYS A;  1UCI A;  3SX1 A;  1NDO B;  3FH1 A;  3FZW A;  1UCL A;  1B2Z A;  5IG0 A;  1K41 A;  2R41 A;  1GMP A;  3T0U A;  3JUP A;  3OW2 2;  2P0M A;  4WP5 A;  2INX A;  3LT8 A;  1I3F A;  2CH9 A;  4HM6 B;  4N6M A;  2UX0 A;  1GOY A;  3D5G A;  3N54 B;  1BNR A;  3EN1 B;  1VQ5 3;  1O7N B;  2F86 B;  1VQP 3;  3GAX A;  1YHQ 3;  1JZO A;  1V58 A;  1GMR A;  1N9J A;  3NM2 A;  1IYY A;  1I0V A;  3B8L A;  1DMM A;  3HI7 A;  4N3V A;  5G2G A;  3G0K A;  1JZD A;  3RGA A;  4BTW A;  1ROV A;  2KF5 A;  3GZR A;  1SJW A;  3K5T A;  4IT7 A;  3RGR A;  5HOH A;  4MMY B;  1OHS A;  3DGN A;  1W01 A;  4LMI A;  5IEN A;  1UCJ A;  4L8O A;  5FW5 A;  4AEQ A;  3CCE 3;  4ZM8 A;  3Q90 A;  1JB5 A;  2CK3 H;  1TU5 A;  3CXC 2;  2XGN A;  1PY3 A;  4WFO A;  1VQM 3;  2SAR A;  4MEI A;  3Q1C A;  1TP6 A;  2ML6 A;  3LML A;  4LGQ A;  4R9K A;  5A0O B;  1EG9 B;  1ZO2 A;  3N9H A;  1RDS A;  2CWT A;  4BL2 A;  3D3L A;  1UUV B;  2E2T A;  1A67 A;  1VQQ A;  1OHP A;  3LH4 A;  4K90 B;  3NQZ A;  3PGB A;  5EVH A;  4ILF A;  2GBX B;  3ZG5 A;  3ROB A;  4HAA A;  1KC8 4;  3B7C A;  3FF0 A;  4R4K A;  5IW9 A;  3K0Z A;  3KSE D;  4WYK B;  3I0Y A;  4XDV A;  1T2H A;  1W00 A;  3LTB A;  3F9S A;  1KQS 2;  1PU4 A;  3OV4 A;  3DGL A;  1GY5 A;  4HM4 B;  1JJ2 2;  1DYU A;  3KE7 A;  4EXR A;  3DM8 A;  1Q40 B;  4HM2 B;  5AII A;  5BXQ A;  1ZGX A;  1RRL A;  4GL6 A;  1OH0 A;  1BSC A;  1C7H A;  1BNJ A;  5IG3 A;  1RGG A;  1VQL 3;  1RTU A;  3F14 A;  4EV2 A;  2YFI B;  5AYS C;  2ZDJ A;  1Q82 4;  3L0R A;  3F7X A;  4N6O B;  1SPU A;  1RGE A;  4R1K A;  4XBY A;  1MWT A;  3DY5 A;  5AYR B;  4MJD A;  1BRJ A;  1RN1 A;  2P05 A;  4O3V A;  1IT7 A;  3CPO A;  3X42 A;  1CEW I;  4CCV A;  4HYZ A;  4KFF A;  1BIR A;  1VQ8 3;  2QIY A;  4BTX A;  4I5Q A;  4LYL B;  1FGT A;  1OGX A;  4EYC A;  4Q53 A;  1O7H B;  6RNT A;  3FG4 A;  1DMQ A;  1RGH A;  1UUW B;  2CW9 A;  4IIA A;  2Y74 A;  5CF1 A;  3CCM 3;  3JUO A;  3X41 A;  3NBB A;  1LOX A;  1SQW A;  1TFO A;  3NX0 A;  4WHA A;  1S5A A;  3NHX A;  1K73 4;  3NV0 A;  1BSD A;  3WDG B;  2RCD A;  1G0T A;  2RSX A;  2V1L A;  2XSO B;  3F40 A;  4HM7 B;  4LEH A;  2JDI H;  1BNI A;  2HMM B;  3K63 A;  2OTJ 3;  3FGY A;  3CME 3;  1IQY A;  9RNT A;  3MG2 A;  2P09 A;  1SIH A;  2W9Q A;  4MMZ B;  5ELJ A;  3S67 A;  1IQ8 A;  3I55 3;  1FGO A;  2ZHX B;  4BIR A;  1EKM A;  1YGW A;  3SXX A;  3U97 A;  1M90 4;  1ULJ B;  3FKA A;  3CCS 3;  5IER A;  2CIU A;  3CNX A;  3PZW A;  1IV9 A;  1Q7Y 4;  1B3S A;  4EV5 A;  1QJG A;  1UI7 A;  3G16 A;  2GEX A;  3EQQ B;  2OOV A;  3NM7 A;  5D82 A;  1YVB I;  2Z76 A;  1JBT A;  1K8A 4;  3HK4 A;  1STF I;  4MMX B;  4R80 A;  3SLU A;  4J9A A;  1PFP A;  3SOY A;  1OCV A;  4RNZ A;  5IEO A;  1YNV X;  1RNB A;  1W7C A;  1FGM A;  1QAL A;  1UGH I;  3Q3F A;  3GZY B;  3CC4 3;  1RSN A;  3EF8 A;  2GBW B;  3B4P A;  3GZB A;  2HML B;  1IDP A;  3DXO A;  5D81 A;  2STD A;  1IVX A;  1N5P A;  2WGO A;  1YGE A;  2BT3 A;  2WOH A;  3LXU X;  1DVC A;  2B1X B;  4FMC A;  3ZG0 A;  1K9M 4;  1VQ4 3;  1GYB A;  1QVF 2;  1OF5 A;  5KP4 A;  1BU4 A;  4WYK A;  4G1M B;  4O8S A;  5IG4 A;  4QWT A;  1IK3 A;  1U5O A;  3LYG A;  4FCJ A;  2D42 A;  4N6T A;  5GSP A;  1GD4 A;  4FMB A;  1NWW A;  1K28 A; 
#chains in the Genus database with same CATH homology
 1I2F A;  3DGY A;  4J5G A;  1B2M A;  1BSA A;  3D4A A;  1GOV A;  1G02 A;  1LNI A;  1X1X A;  1BRS A;  3WR2 A;  1I0X A;  1C54 A;  4HAA A;  2GSP A;  2BIR A;  1BNG A;  4BU4 A;  1BSE A;  1T2H A;  1BAN A;  5RNT A;  1DET A;  3AGN A;  1HYF A;  1B2U A;  1R4Y A;  3BU4 A;  1RNT A;  1RGL A;  3URP A;  1RGF A;  3D5I A;  1TRP A;  1I2G A;  3A5E A;  1LOY A;  1BSB A;  1BNE A;  2KF3 A;  1ZGX A;  1MGW A;  2KF6 A;  2ZA4 A;  1BSC A;  2HOH A;  1BNJ A;  1X1U A;  1RGG A;  2BU4 A;  1BRN L;  1RTU A;  5BU4 A;  1FW7 A;  1B2X A;  1BUJ A;  1FZU A;  1RGE A;  1RMS A;  4HOH A;  3WHO A;  1T2I A;  2F5M A;  8RNT A;  1BRJ A;  1GOU A;  1FUS A;  1HZ1 A;  1RN1 A;  1UCK A;  1BNS A;  1BIR A;  1X1W A;  4GSP A;  1BGS A;  3AHS A;  6RNT A;  7GSP A;  1RGH A;  1Q9E A;  1BAO A;  1JBS A;  2F4Y A;  1RGK A;  3SYU A;  3RNT A;  1BVI A;  1BSD A;  4RNT A;  3BIR A;  1B27 A;  1B21 A;  1MGR A;  1BRH A;  1BRK A;  1BNI A;  1AQZ A;  1I3I A;  2F5W A;  1RHL A;  1BOX A;  1LOV A;  1JBR A;  1A2P A;  1TRQ A;  9RNT A;  2RNT A;  3KCH A;  1GSP A;  4BIR A;  1YGW A;  3AHW A;  5BIR A;  1FYS A;  1UCI A;  6GSP A;  1AY7 A;  1B2S A;  1UCL A;  1B2Z A;  1BNF A;  1X1Y A;  2C4B A;  1GMP A;  2F56 A;  1RCK A;  1RLS A;  3AGO A;  1B3S A;  1RN4 A;  1TTO A;  3GSP A;  1I3F A;  1BRI A;  1FUT A;  1RGC A;  2KF4 A;  1GOY A;  3D5G A;  2AAD A;  1JBT A;  7RNT A;  1BNR A;  1DE3 A;  1B20 A;  1YNV X;  1I70 A;  1RNB A;  1IYY A;  1GMR A;  1I0V A;  3Q3F A;  1CH0 A;  2AAE A;  2RBI A;  1SAR A;  1RSN A;  1RCL A;  2KF5 A;  1RGA A;  5HOH A;  1I8V A;  4GHO A;  1UCJ A;  1YVS A;  1I2E A;  1LOW A;  1BU4 A;  2KAA A;  1PY3 A;  3DH2 A;  4J5K A;  1LRA A;  2SAR A;  5GSP A;  1PYL A;  3HOH A;  1BRG A;  1RDS A;  1GMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...