1U5OA

Structure of the d23a mutant of the nuclear transport carrier ntf2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFANDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Nuclear transport factor 2
publication title Computational and biochemical identification of a nuclear pore complex binding site on the nuclear transport carrier NTF2.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1u5oA00
1OF5B 4CDLA 1JB5A 2BMOB 2UX0A 4X2HA 1U5OA 4HM6B 1GY6A 1UUWB 3GRDA 1EA2A 5AIFA 5CK6A 3JUOA 3KKGA 3OWUA 3B4PA 1JB2A 3Q90A 4WYKA 1Q40B 2BNGA 4J9AA 1DMQA 1AR0A 1SJWA 5STDA 3MYTA 1UUVB 2B1XB 3H3HA 1NDOB 4XM4A 2BMQB 3EJVA 4HKVB 4LGQA 2INXA 1O7GB 2F86B 5CF1A 4HM1B 1OPYA 3G16A 1OGXA 2IMJA 2XRXB 4H3UA 5D82A 1OH0A 1K41A 5D81A 5DREA 1VZZA 1C7HA 2GEXA 1O7NB 3FZWA 3K0ZA 5IENA 1S5AA 3DUKA 3UJMA 1E97A 1OF5A 5IG3A 1BUQA 1E3RA 5IEOA 3MG2A 2RCDA 3EBYA 4XDVA 3ECFA 3DM8A 2XSHB 4N3VA 3HX8A 3SOAA 3MG3A 1Z1SA 4K1VA 3GWRA 3G0KA 3B7CA 5JPUA 3RGRA 5G2GA 4U13A 1Q40A 1EG9B 3CU3A 3ER7A 5CXOA 5D83A 3FKAA 3NHXA 2QGUA 5AIHA 2CHCA 3CNMA 1OCVA 3NUVA 3RGAA 3ROBA 1OUNA 3FGYA 1OGZA 3MKIA 3NM2A 8CHOA 3STDA 1W00A 2RGQA 3DZLA 4I4KA 3EF8A 3OV4A 2YFLB 4XBXA 1ZX2A 5KP3A 5AI1A 3DMCA 4HJLB 1GY5A 3FLJA 2A15A 2R4IA 3JUPA 5CLKA 5CF2A 4L7KA 1OHOA 3MG1A 3NBRA 4J8TA 3EN8A 3G8ZA 4HM3B 3LYGA 4OUQA 1GS3A 1ISKA 1O7MB 3EQQB 3VGNA 5IF6A 4HM7B 5IEPA 4HVNA 1TUHA 3KSPA 3F9SA 4XDWA 5EVHA 3EC9A 3FF0A 4R1KA 3E99A 1JKGB 3MHEA 3T8UA 1OHPA 2HMJB 2GEYA 4WP5A 5IG4A 4R9KA 3IPTA 3CPOA 4HM8B 3B4OA 3K7CA 1GYBA 1O7WB 1IDPA 5IERA 3OX9A 2HMNB 3FF2A 1OHSA 4R9LA 3EBTA 5HGRA 3KZTA 4OVMA 3CNXA 3DXOA 3SOYA 3F8XA 2QIYA 1WQLB 4PEJA 1W01A 1QJGA 2YFJB 2BMRB 5JPPA 1E3VA 3EX9A 3M8CA 3S5CA 1CQSA 3HZPA 5FW5A 3KE7A 2HMMB 1HKXA 4HZ9B 3GZXB 1ULJB 5KP4A 1JKGA 4XB5A 2I9WA 5AEWB 4HM5B 2Z76A 5AEUB 3NV0B 3F14A 4FCJA 4WWUC 4GB5A 4XBTA 5DRVA 3A76A 3NXJA 3I0YA 1ULIB 5IG0A 3EN1B 1ZO2A 4IIAA 2B24B 3FH1A 1O7HB 3FSDA 1JN5B 2HMLB 2YFIB 1O7PB 2OWPA 3WMDA 2GXFA 4L8PA 4HM0B 4LEHA 3BLZA 4RZMA 6STDA 3OWYA 1GY7A 5BXQA 3HK4A 3UNLA 3MSOA 1W6YA 3F7SA 1NWWA 2F98A 1A2KA 1ASKA 5IG5A 3JUQA 3BB9A 3JUMA 3B8LA 2STDA 4K1UA 2CKFB 1W02A 3GZBA 4HM4B 1TP6A 4WYKB 3D9RA 2PZVA 2W2CA 3F40A 3T8NA 4KVHA 3NV0A 3F7XA 3OXAA 4MJDA 4Q53A 4FCMA 1DMNA 7STDA 4HZBB 3GZRA 1DMMA 4L8OA 3JUNA 1JB4A 2XR8B 4HM2B 5KP1A 2HMOB 2F99A 3F8HA 4ORLA 2XSOB 5BVBA 1JN5A 2HMKB 2K54A 3SEDA 1STDA 3EHCA 1Q42A 4STDA 3OWSA 2GBXB 2Z7AA 4XBYA 5AIGA 3GZYB 3H51A 2JQ5A 3VSYA 4LMIA 3LZAA 5AIIA 4X2OA 1QMAA 1NU3A 2GBWB 2RFRA 5TGNA 2Z77A
chains in the Genus database with same CATH superfamily
1JRQA 1OF5B 3X3XA 1Q7HA 1RRHA 3DGMA 1I2EA 1R4CA 2E2TA 1JB5A 2H0HA 2BMOB 3KFQC 2UX0A 3N8BA 3NM7A 2OQEC 4X2HA 1U5OA 1NO3A 4HM6B 4N6V0 3TDGA 1GY6A 1B20A 1IVVA 6RNTA 1S723 1BNGA 4O8SA 1B2UA 3QK9A 1UUWB 3GRDA 1EA2A 3A5EA 5AIFA 1I2GA 1RCLA 1J2BA 5CK6A 1BRJA 1TJDA 1V74A 5G1KA 3JUOA 1OACA 1N9EA 1RGLA 3ZFZA 3KKGA 3OWUA 3AGOA 1UCKA 2W6JH 1FZUA 3GAXA 3AHWA 3B4PA 1JB2A 1A90A 3Q90A 4WYKA 4FMCA 1Q40B 1RN4A 2BNGA 4J9AA 1DMQA 2KAAA 4K90B 1AR0A 2ZA4A 1LOVA 1BNSA 2CFWA 1US1A 2RBIA 3RDEA 2R41A 1SJWA 1KQS2 5STDA 1JNQA 2IUKA 4MMXB 3LXUX 1IVUA 2LYXA 3MYTA 1X1UA 1UUVB 3RNTA 3CME3 3NQYA 2OTL3 5EEOA 2B1XB 1YHQ3 4IT7A 1VQO3 3H3HA 4CPKA 1NDOB 5BU4A 4GSPA 4XM4A 1HYFA 4AKYA 2BMQB 3EJVA 4HKVB 4LGQA 2MC8A 1ZGXA 4N6MA 1YIT3 1VQ83 1GMQA 2INXA 1O7GB 5A0OB 1RGFA 2D1WA 2F86B 2WGOA 3UL6A 3WOFB 1N8QA 4HM1B 5CF1A 1OPYA 3X3YA 3G16A 1OGXA 4WFOA 1EKMA 3S27A 1LXEA 1YIJ3 3KSED 2IMJA 2XRXB 3JVCA 3WOEB 1AVLA 3PCSA 4HOHA 4H3UA 3HOHA 5D82A 1OH0A 1FGTA 1K41A 5D81A 1VQP3 5DREA 4R80A 1VZZA 5M19A 1RJOA 1C7HA 2GEXA 1EUIC 1O7NB 3KCHA 3V92A 3FZWA 3K0ZA 1UGIA 5IENA 1W4NA 1S5AA 1IQ8A 3K5TA 3AMOA 5JBSA 1QVG2 3DUKA 1WMNA 1IQXA 3UJMA 3LH4A 3IJEB 1M904 1E97A 3DH2A 1FUWA 4FMBA 1OF5A 1WMOA 4N6TA 1LOXA 1K28A 1BSAA 5IG3A 1BUQA 1SQWA 1E3RA 1I2FA 1N8R4 2ML6A 5IEOA 2RSXA 3MG2A 2RCDA 8RNTA 1Y4KA 3PXMA 3FG3A 4RNTA 4RBNA 1KWIA 3EBYA 1BAOA 4XDVA 2KXGA 3ECFA 1T2HA 3D3LA 1B2ZA 1GOVA 1LOWA 1UCIA 1RSNA 1UDII 1RGCA 2XSHB 3DM8A 3HX8A 4N3VA 7GSPA 1GMPA 1LNHA 3MG3A 3SOAA 2FNQA 1SIIA 1Z1SA 4K1VA 1CH0A 2C4BA 2H0IA 1UCLA 1UI7A 3KN4A 3GWRA 1VQ53 4EBGA 2L1SA 3G0KA 2Y74A 3B7CA 5JPUA 3RGRA 1AV4A 5G2GA 1SPUA 2GSPA 1Q40A 4U13A 3BNCA 1EG9B 3CU3A 3ER7A 3D5IA 2AAEA 5CXOA 5D83A 4EC6A 3FKAA 3NHXA 1DVDA 1I0XA 2QGUA 1MWRA 5AIHA 3S28A 1YJN3 1K9M4 1A2PA 2CHCA 2GU3A 3CCV3 3CNMA 1OCVA 3O8YA 3NUVA 2CWVA 2MF7A 2FXTA 4N6UA 1W6GA 3BU4A 4ILFA 3Q2PA 3RGAA 1JJ22 3ROBA 1OUNA 3FGYA 1RGKA 1OGZA 3MKIA 3CC43 1FA3A 1BRIA 3PCRA 3NM2A 4N6OB 8CHOA 1BNRA 3STDA 1WMPA 2CX1A 2OQEA 2SBLA 1W00A 2RGQA 1RKYA 2WGQA 1KSIA 1BSCA 3BNDA 1IVWA 2K3DA 3DZLA 4I4KA 3OW22 4NREA 3HIGA 3EF8A 1B2MA 2W9PA 1MWUA 1UW1A 2Y73A 3OV4A 4AEQA 1MWSA 1JZDA 2YFLB 1STFI 2CFLA 1BANA 1IU7A 1ZX2A 4XBXA 1EEJA 5KP3A 3UL5A 2XH9A 5AI1A 4LYLB 3DMCA 4NHFA 2L4VA 1BOXA 1MNLA 1FUTA 1Q9EA 1HZ1A 1QALA 1GY5A 4HJLB 4TX4A 3WR2A 3CCS3 1RTUA 5GSPA 1C54A 1BRSA 3FLJA 2A15A 2R4IA 1FYSA 3SXXA 1LQGC 3JUPA 1RGEA 5CLKA 1PU4A 3BIRA 5CF2A 3CCQ3 4L7KA 2W0QA 1OHOA 4JF8A 3MG1A 3V99A 2UUGC 3NBRA 4J8TA 4R4KA 1Q824 2OOVC 2O3OA 2KF3A 3EN8A 1FGOA 2KF4A 3G8ZA 1G0TA 3IMAB 3LYGA 4HM3B 4OUQA 2CG0A 1JBTA 2IA7A 1GS3A 3WA2X 1K734 3PZWA 1O7MB 2BT3A 3EQQB 3V98A 1ISKA 2P0XA 3VGNA 1I70A 3HI7A 1FGMA 2D42A 3FG1A 4KFFA 3CCL3 5IF6A 4HM7B 3DGYA 2W56B 1QVF2 3PYJA 2F56A 5EQLA 3CCE3 5IEPA 1VQ73 1V58A 1X1XA 4FR9A 4HVNA 2JDIH 3LT9A 1RGHA 1TUHA 3KSPA 3F9SA 4BU4A 3VF1A 4KT3B 1RRLA 4NPBA 4XDWA 3LMLA 5EVHA 1MWTA 3EC9A 3FF0A 4R1KA 1VQ43 3E99A 1RNTA 1JKGB 1MGWA 1UCJA 3AGNA 1T3BA 3MHEA 1BUJA 3T8UA 2BU4A 1F8NA 4BTYA 3LT8A 1BGSA 4CJNA 1OHPA 2HMJB 1VQ63 2GEYA 3X42A 1D6ZA 1LNIA 4MMZB 4WP5A 5IG4A 2XGNA 7RNTA 4R9KA 3IPTA 3I563 3CPOA 1BIRA 2CFKA 4K61A 2AADA 1TFKA 5G1LA 3WHOA 1RNBA 1B2SA 2Z6BA 4HM8B 3B4OA 3DY5A 2WOFA 3K7CA 4MMYB 2HOHA 1GYBA 1L5GB 1O7WB 1TFOA 1BNFA 2E2VA 1YGEA 3K9MC 1FGRA 1IDPA 5IERA 1BRHA 3OX9A 1N5PA 2HMNB 4RNYA 5HOHA 2W04A 3NX0A 2CWUA 1W2ZA 2V1LA 3FF2A 1Q7Y4 2RNTA 4ZM8A 4BTXA 1RGAA 1OHSA 1W7CA 2CW9A 3NQZA 4R9LA 3EBTA 5HGRA 3KZTA 1VQN3 4OVMA 1VQM3 4H61A 3ALAA 1RDSA 1WTHA 2IYJA 3CNXA 1IQYA 2J8XB 2IUJA 1IT8A 3DXOA 3SLUA 1RGGA 1YVSA 3SOYA 5AYRB 3NBBA 3U1WA 1BU4A 1PYLA 3F8XA 1IVXA 3MWZA 2QIYA 3LTDA 1WQLB 1QAFA 3CC73 4PEJA 1W01A 1QJGA 2YFJB 2CG1A 3X41A 2P09A 1N5HA 2BMRB 5JPPA 2XGLA 1I3IA 5ELUA 1Q814 3CD63 3LTCA 1LRAA 6GSPA 1E3VA 2XFTA 1M1K4 3EX9A 1TRQA 3M8CA 1BSDA 3S5CA 1Q864 1MOLA 1CQSA 1VQ93 3WDGB 2W56A 2BHMA 2IY2A 1HU9A 3AHSA 1EQKA 3FG4A 4CDLA 3HZPA 5FW5A 1CYUA 1JBRA 3WODG 4GL6A 3KE7A 3ZG0A 1YJ93 1DE3A 2HMMB 1CYVA 1FW7A 1HKXA 5IW9A 4HZ9B 1NNVA 1UI8A 3URPA 2ZDJA 1DETA 4G1MB 1GD3A 1FGQA 3GZXB 5M1AA 4EYCA 1ULJB 4N6LA 5LC7A 1ROAA 1CEWI 1GOYA 1V57A 5KP4A 3CCR3 1JKGA 4XB5A 2I9WA 1PFPA 1R4YA 2C10A 1B21A 5AEWB 1RN7A 3D79A 1MGRA 3BNBA 3T0UA 3S67A 1BNJA 3G713 1BRGA 4HM5B 2Z76A 3I553 5AEUB 3NV0B 1JV2B 4GHOA 1IV7A 3GSPA 3PGBA 1IK3A 1TU5A 2OCTA 3D5GA 3F14A 1A2VA 2K0MA 5AYSC 2CX0A 1B27A 1RLSA 4FCJA 1WNHA 2F4YA 4WWUC 4GB5A 2OOVA 4XBTA 2P38A 2UGIA 5DRVA 2FGTA 3A76A 3NXJA 5RNTA 4J5GA 1BNEA 1SIHA 1ROVA 3I0YA 4OK0A 3CCJ3 4LZIA 1TIJA 1GOUA 1YGWA 1T5YA 2P0MA 1ULIB 5IG0A 3EN1B 1ZO2A 1GMRA 4BL3A 3CCU3 4IIAA 4EV2A 2ML5A 3SX1A 2H0GA 1X1YA 3L0RA 2B24B 3FH1A 4IPBA 1VQL3 1N9JA 1O7HB 3FSDA 1AVKA 2YX9A 3LTAA 4HBRA 1JN5B 4DKIA 1M1XB 3HIIA 1SARA 1JZOA 1BRKA 2HMLB 1O7PB 2OWPA 2P05A 2YFIB 3CPW2 2W03A 3X40A 3WMDA 2GXFA 3PS8A 1JBSA 3S29A 4L8PA 1GSPA 4HM0B 1IV9A 1YNVX 3BLZA 1W6CA 4LEHA 4RZMA 1W2B2 1T2IA 6STDA 1TRPA 3LOYA 1K8A4 2OTJ3 2XF3A 1BVIA 1G02A 1RMSA 3OWYA 1GY7A 3X3ZA 2WOHA 2O9UX 3MPHA 5BXQA 1U8CB 3SVAA 3N9HA 3HK4A 3NBJA 4BTWA 2F5WA 2QEX3 4QWTA 3MSOA 5FGOA 3UNLA 1W6YA 3FCSB 3F7SA 2KCDA 4LSOA 1LQMB 1NWWA 5LC6A 2XFSA 2F98A 3DGOA 1A2KA 1UUGB 3U97A 1ASKA 3EE1A 1NB5I 3LTBA 2CFGA 3JUQA 3UB1A 9RNTA 3BB9A 5IG5A 4O2HA 1A67A 4J5KA 5M18A 3JUMA 3J7Yd 3B8LA 2STDA 2PNCA 2SARA 1D6YA 2XEPA 4K1UA 4KFEA 4EXRA 2CKFB 1W02A 1RN1A 3GZBA 4HM4B 1TP6A 4N6NB 4O3VA 2F5MA 4HAAA 1RCKA 4WYKB 2QA43 3D9RA 2PZVA 2W2CA 3F40A 3T8NA 4KVHA 3N54B 1YI23 1AQZA 3Q1CA 1NJI4 2KF6A 3NV0A 3Q3FA 3F7XA 3OXAA 1IT7A 3D4AA 3G6E3 2LQVA 2E2UA 1QAKA 4MJDA 4Q53A 1YJW3 4BIRA 1KD14 4FCMA 1PY3A 1X1WA 1KC84 3CC23 1VQK3 1DMNA 3SYUA 7STDA 4HYZA 4KZ1A 4AKZA 1AY7A 1B3SA 1IYYA 4HZBB 3CCM3 4RNZA 1NB3I 3GZRA 1DMMA 4L8OA 4WHAA 5ELJA 3WA3A 3CXC2 2GU1A 2KRTA 3JUNA 1JB4A 2XR8B 4HM2B 2Q07A 3K63A 4FMAA 2C11A 5KP1A 1BSEA 4MEIA 4BL2A 1VQQA 2HMOB 2KF5A 2CC3A 2CFDA 2ZL8A 2F99A 1I8VA 3F8HA 4KFDA 1YVBI 4I5QA 4O02B 4ORLA 2BIRA 4CCVA 2CWTA 1TTOA 2XSOB 1D6UA 4FCZA 5BVBA 1JN5A 2HMKB 2K54A 2M7OA 1BRNL 3SEDA 1STDA 1G96A 1ZS7A 3EHCA 5BIRA 4JRFA 1GD4A 1I3FA 1Q42A 2ZHXB 4STDA 5I97A 3OWSA 1DVCA 3DGNA 1RHLA 2GBXB 2Z7AA 1B2XA 1UGHI 4XBYA 3KIIA 5AIGA 3GZYB 2CH9A 3DGLA 3H51A 2JQ5A 3VSYA 3ZG5A 2CK3H 4EW5A 1BNIA 4LMIA 3QRDA 2W9QA 1DYUA 3LZAA 3G4S3 5AIIA 4X2OA 1QMAA 1W5ZA 3AMOB 4EV5A 2BO9B 1NU3A 3BNEA 3EB8A 1I0VA 2GBWB 1FUSA 1LVNA 2RFRA 3CMA3 2CIUA 4FMDA 2WO0A 1BSBA 1M9GA 5TGNA 2Z77A 1LOYA
chains in the Genus database with same CATH topology
1JRQA 1OF5B 3X3XA 1RRHA 3DGMA 1R4CA 2E2TA 1JB5A 3KFQC 2BMOB 3N8BA 2UX0A 3NM7A 4X2HA 2OQEC 1KD14 1U5OA 1NO3A 4HM6B 4N6V0 3TDGA 1GY6A 1IVVA 1S723 4O8SA 3QK9A 1UUWB 3GRDA 1EA2A 5AIFA 5CK6A 1V74A 3JUOA 1OACA 1N9EA 3KKGA 3OWUA 2W6JH 3GAXA 3B4PA 1A90A 1JB2A 3Q90A 4WYKA 4FMCA 1Q40B 2BNGA 4J9AA 1DMQA 4K90B 1AR0A 2CFWA 1US1A 3RDEA 1SJWA 1KQS2 5STDA 1JNQA 2IUKA 4MMXB 3LXUX 1IVUA 2LYXA 3MYTA 1UUVB 3CME3 3NQYA 2OTL3 5EEOA 2B1XB 1YHQ3 4IT7A 1VQO3 3H3HA 1NDOB 4XM4A 4AKYA 2BMQB 3EJVA 4HKVB 4LGQA 2MC8A 4N6MA 1YIT3 1VQ83 2INXA 1O7GB 5A0OB 2D1WA 2F86B 2WGOA 3UL6A 3WOFB 1N8QA 4HM1B 5CF1A 1OPYA 3X3YA 3G16A 1OGXA 4WFOA 1EKMA 3S27A 1LXEA 1YIJ3 3KSED 2IMJA 2XRXB 3JVCA 3WOEB 1AVLA 3PCSA 4H3UA 5D82A 1OH0A 1FGTA 1K41A 5D81A 1VQP3 5DREA 4R80A 1VZZA 1RJOA 1C7HA 2GEXA 1O7NB 3V92A 3FZWA 3K0ZA 5IENA 1W4NA 1S5AA 1IQ8A 3K5TA 3AMOA 5JBSA 1QVG2 3DUKA 1WMNA 1IQXA 3UJMA 3LH4A 3IJEB 1M904 1E97A 1FUWA 4FMBA 1OF5A 1WMOA 4N6TA 1LOXA 1K28A 5IG3A 1BUQA 1SQWA 1E3RA 1N8R4 2ML6A 5IEOA 2RSXA 3MG2A 2RCDA 1Y4KA 3PXMA 3FG3A 4RBNA 1KWIA 3EBYA 4XDVA 2KXGA 3ECFA 3D3LA 3DM8A 2XSHB 4N3VA 3HX8A 3MG3A 1LNHA 3SOAA 2FNQA 1SIIA 1Z1SA 4K1VA 1UI7A 3KN4A 3GWRA 1VQ53 4EBGA 3G0KA 2Y74A 3B7CA 5JPUA 3RGRA 1AV4A 5G2GA 1SPUA 4U13A 1Q40A 3BNCA 1EG9B 3CU3A 3ER7A 5CXOA 5D83A 4EC6A 3FKAA 3NHXA 1DVDA 2QGUA 5AIHA 3S28A 1YJN3 1K9M4 2CHCA 2GU3A 3CCV3 3CNMA 1OCVA 3O8YA 3NUVA 2CWVA 2MF7A 2FXTA 4N6UA 1W6GA 1JJ22 3RGAA 3ROBA 1OUNA 3FGYA 3CC43 1OGZA 3MKIA 1FA3A 3PCRA 3NM2A 4N6OB 8CHOA 3STDA 1WMPA 2OQEA 2SBLA 1W00A 2RGQA 1RKYA 2WGQA 1KSIA 3BNDA 1IVWA 3DZLA 4I4KA 3OW22 4NREA 3HIGA 3EF8A 2W9PA 1UW1A 2Y73A 4AEQA 3OV4A 2YFLB 1STFI 2CFLA 1IU7A 4XBXA 1ZX2A 5KP3A 3UL5A 2XH9A 5AI1A 3DMCA 4NHFA 2L4VA 1MNLA 1QALA 4HJLB 4TX4A 1GY5A 3CCS3 3FLJA 2A15A 2R4IA 3SXXA 3JUPA 5CLKA 1PU4A 5CF2A 3CCQ3 4L7KA 2W0QA 1OHOA 4JF8A 3MG1A 3V99A 3NBRA 4R4KA 4J8TA 1Q824 2OOVC 2O3OA 3EN8A 3G8ZA 1FGOA 3IMAB 3LYGA 3Q2PA 4HM3B 4OUQA 1Q864 2CG0A 2IA7A 1GS3A 3WA2X 1K734 3PZWA 1O7MB 2BT3A 3EQQB 3V98A 1ISKA 2P0XA 3VGNA 3HI7A 1FGMA 2D42A 3FG1A 4KFFA 3CCL3 5IF6A 4HM7B 2W56B 1QVF2 3PYJA 5EQLA 3CCE3 5IEPA 1VQ73 4FR9A 4HVNA 2JDIH 3LT9A 1TUHA 3KSPA 3F9SA 3VF1A 1RRLA 4XDWA 3LMLA 5EVHA 3EC9A 3FF0A 4R1KA 1VQ43 3E99A 1JKGB 3MHEA 3T8UA 1F8NA 4BTYA 3LT8A 1OHPA 2HMJB 1VQ63 2GEYA 3X42A 1D6ZA 4MMZB 4WP5A 5IG4A 2XGNA 4R9KA 3IPTA 3I563 3CPOA 2CFKA 4K61A 1TFKA 2Z6BA 4HM8B 3B4OA 3DY5A 2WOFA 3K7CA 4MMYB 1GYBA 1L5GB 1O7WB 1TFOA 2E2VA 1YGEA 3K9MC 1FGRA 1IDPA 5IERA 3OX9A 1N5PA 2HMNB 4RNYA 2W04A 3NX0A 2CWUA 1W2ZA 2V1LA 3FF2A 1Q7Y4 4ZM8A 4BTXA 1OHSA 1W7CA 2CW9A 3NQZA 4R9LA 3EBTA 5HGRA 3KZTA 1VQN3 4OVMA 1VQM3 4H61A 3ALAA 1WTHA 3CNXA 1IQYA 2IUJA 1IT8A 3DXOA 3SLUA 3SOYA 5AYRB 3NBBA 3U1WA 3F8XA 1IVXA 3MWZA 2QIYA 3LTDA 1WQLB 1QAFA 3CC73 4PEJA 1W01A 1QJGA 2YFJB 2CG1A 3X41A 2P09A 1N5HA 2BMRB 5JPPA 2XGLA 5ELUA 1Q814 3CD63 3LTCA 1E3VA 2XFTA 1M1K4 3EX9A 3M8CA 3S5CA 1MOLA 1CQSA 1VQ93 3WDGB 2W56A 2BHMA 1HU9A 1EQKA 3FG4A 4CDLA 3HZPA 5FW5A 1CYUA 3WODG 4GL6A 3KE7A 1YJ93 2HMMB 1CYVA 1HKXA 5IW9A 4HZ9B 1UI8A 2ZDJA 4G1MB 1GD3A 1FGQA 3GZXB 4EYCA 1ULJB 4N6LA 5LC7A 1ROAA 1CEWI 5KP4A 3CCR3 1JKGA 4XB5A 2I9WA 1PFPA 2C10A 5AEWB 1RN7A 3T0UA 3BNBA 3G713 3S67A 4HM5B 2Z76A 3I553 5AEUB 3NV0B 1JV2B 1IV7A 3PGBA 1IK3A 1TU5A 2OCTA 3F14A 5AYSC 1A2VA 2K0MA 4FCJA 4WWUC 1WNHA 1J2BA 4GB5A 2OOVA 4XBTA 2P38A 5DRVA 2FGTA 3A76A 3NXJA 1SIHA 1ROVA 3I0YA 4OK0A 3CCJ3 4LZIA 1TIJA 1T5YA 2P0MA 1ULIB 5IG0A 3EN1B 1ZO2A 3CCU3 4IIAA 4EV2A 2ML5A 3SX1A 3L0RA 2B24B 3FH1A 4IPBA 1VQL3 1N9JA 1O7HB 3FSDA 1AVKA 2YX9A 3LTAA 4HBRA 1JN5B 1M1XB 3HIIA 2HMLB 2YFIB 1O7PB 2OWPA 2P05A 3CPW2 2W03A 3X40A 3WMDA 2GXFA 3PS8A 3S29A 4L8PA 4HM0B 1IV9A 3BLZA 4LEHA 1W6CA 4RZMA 1W2B2 6STDA 3LOYA 1K8A4 2OTJ3 2XF3A 3OWYA 3X3ZA 1GY7A 2WOHA 2O9UX 3MPHA 5BXQA 1U8CB 3SVAA 3N9HA 3HK4A 3NBJA 4BTWA 2QEX3 4QWTA 3MSOA 5FGOA 3UNLA 1W6YA 3FCSB 3F7SA 2KCDA 4LSOA 1NWWA 5LC6A 2XFSA 2F98A 3DGOA 1A2KA 3U97A 1ASKA 3EE1A 1NB5I 3LTBA 2CFGA 3JUQA 3UB1A 5IG5A 3BB9A 4O2HA 1A67A 3JUMA 3J7Yd 3B8LA 2STDA 2PNCA 1D6YA 2XEPA 4K1UA 4KFEA 4EXRA 2CKFB 1W02A 3GZBA 4HM4B 1TP6A 4N6NB 4O3VA 4WYKB 2QA43 3D9RA 2PZVA 2W2CA 3F40A 3T8NA 4KVHA 3N54B 1YI23 3Q1CA 1NJI4 3NV0A 3F7XA 3OXAA 1IT7A 3G6E3 2LQVA 2E2UA 1QAKA 4MJDA 4Q53A 1YJW3 4FCMA 1KC84 3CC23 1VQK3 1DMNA 7STDA 4HYZA 4KZ1A 4AKZA 4HZBB 3CCM3 4RNZA 1NB3I 3GZRA 1DMMA 4L8OA 4WHAA 5ELJA 3WA3A 3CXC2 2GU1A 2KRTA 3JUNA 1JB4A 2XR8B 4HM2B 2Q07A 3K63A 4FMAA 2C11A 5KP1A 4MEIA 2HMOB 2ZL8A 2CC3A 2CFDA 2F99A 3F8HA 4KFDA 4O02B 1YVBI 4ORLA 4CCVA 2CWTA 2XSOB 4FCZA 1D6UA 5BVBA 1JN5A 2HMKB 2K54A 2M7OA 3SEDA 1STDA 1G96A 3EHCA 4JRFA 1GD4A 1Q42A 4STDA 5I97A 3OWSA 1DVCA 3DGNA 2GBXB 2Z7AA 4XBYA 3KIIA 5AIGA 3GZYB 2CH9A 3DGLA 3H51A 2JQ5A 3VSYA 2CK3H 4LMIA 3QRDA 2W9QA 1DYUA 3LZAA 3G4S3 5AIIA 4X2OA 1QMAA 1W5ZA 3AMOB 4EV5A 2BO9B 1NU3A 3BNEA 3EB8A 2GBWB 3CMA3 1LVNA 2RFRA 2CIUA 4FMDA 2WO0A 1M9GA 5TGNA 2Z77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OF5 B;  4CDL A;  1JB5 A;  2BMO B;  2UX0 A;  4X2H A;  1U5O A;  4HM6 B;  1GY6 A;  1UUW B;  3GRD A;  1EA2 A;  5AIF A;  5CK6 A;  3JUO A;  3KKG A;  3OWU A;  3B4P A;  1JB2 A;  3Q90 A;  4WYK A;  1Q40 B;  2BNG A;  4J9A A;  1DMQ A;  1AR0 A;  1SJW A;  5STD A;  3MYT A;  1UUV B;  2B1X B;  3H3H A;  1NDO B;  4XM4 A;  2BMQ B;  3EJV A;  4HKV B;  4LGQ A;  2INX A;  1O7G B;  2F86 B;  5CF1 A;  4HM1 B;  1OPY A;  3G16 A;  1OGX A;  2IMJ A;  2XRX B;  4H3U A;  5D82 A;  1OH0 A;  1K41 A;  5D81 A;  5DRE A;  1VZZ A;  1C7H A;  2GEX A;  1O7N B;  3FZW A;  3K0Z A;  5IEN A;  1S5A A;  3DUK A;  3UJM A;  1E97 A;  1OF5 A;  5IG3 A;  1BUQ A;  1E3R A;  5IEO A;  3MG2 A;  2RCD A;  3EBY A;  4XDV A;  3ECF A;  3DM8 A;  2XSH B;  4N3V A;  3HX8 A;  3SOA A;  3MG3 A;  1Z1S A;  4K1V A;  3GWR A;  3G0K A;  3B7C A;  5JPU A;  3RGR A;  5G2G A;  4U13 A;  1Q40 A;  1EG9 B;  3CU3 A;  3ER7 A;  5CXO A;  5D83 A;  3FKA A;  3NHX A;  2QGU A;  5AIH A;  2CHC A;  3CNM A;  1OCV A;  3NUV A;  3RGA A;  3ROB A;  1OUN A;  3FGY A;  1OGZ A;  3MKI A;  3NM2 A;  8CHO A;  3STD A;  1W00 A;  2RGQ A;  3DZL A;  4I4K A;  3EF8 A;  3OV4 A;  2YFL B;  4XBX A;  1ZX2 A;  5KP3 A;  5AI1 A;  3DMC A;  4HJL B;  1GY5 A;  3FLJ A;  2A15 A;  2R4I A;  3JUP A;  5CLK A;  5CF2 A;  4L7K A;  1OHO A;  3MG1 A;  3NBR A;  4J8T A;  3EN8 A;  3G8Z A;  4HM3 B;  3LYG A;  4OUQ A;  1GS3 A;  1ISK A;  1O7M B;  3EQQ B;  3VGN A;  5IF6 A;  4HM7 B;  5IEP A;  4HVN A;  1TUH A;  3KSP A;  3F9S A;  4XDW A;  5EVH A;  3EC9 A;  3FF0 A;  4R1K A;  3E99 A;  1JKG B;  3MHE A;  3T8U A;  1OHP A;  2HMJ B;  2GEY A;  4WP5 A;  5IG4 A;  4R9K A;  3IPT A;  3CPO A;  4HM8 B;  3B4O A;  3K7C A;  1GYB A;  1O7W B;  1IDP A;  5IER A;  3OX9 A;  2HMN B;  3FF2 A;  1OHS A;  4R9L A;  3EBT A;  5HGR A;  3KZT A;  4OVM A;  3CNX A;  3DXO A;  3SOY A;  3F8X A;  2QIY A;  1WQL B;  4PEJ A;  1W01 A;  1QJG A;  2YFJ B;  2BMR B;  5JPP A;  1E3V A;  3EX9 A;  3M8C A;  3S5C A;  1CQS A;  3HZP A;  5FW5 A;  3KE7 A;  2HMM B;  1HKX A;  4HZ9 B;  3GZX B;  1ULJ B;  5KP4 A;  1JKG A;  4XB5 A;  2I9W A;  5AEW B;  4HM5 B;  2Z76 A;  5AEU B;  3NV0 B;  3F14 A;  4FCJ A;  4WWU C;  4GB5 A;  4XBT A;  5DRV A;  3A76 A;  3NXJ A;  3I0Y A;  1ULI B;  5IG0 A;  3EN1 B;  1ZO2 A;  4IIA A;  2B24 B;  3FH1 A;  1O7H B;  3FSD A;  1JN5 B;  2HML B;  2YFI B;  1O7P B;  2OWP A;  3WMD A;  2GXF A;  4L8P A;  4HM0 B;  4LEH A;  3BLZ A;  4RZM A;  6STD A;  3OWY A;  1GY7 A;  5BXQ A;  3HK4 A;  3UNL A;  3MSO A;  1W6Y A;  3F7S A;  1NWW A;  2F98 A;  1A2K A;  1ASK A;  5IG5 A;  3JUQ A;  3BB9 A;  3JUM A;  3B8L A;  2STD A;  4K1U A;  2CKF B;  1W02 A;  3GZB A;  4HM4 B;  1TP6 A;  4WYK B;  3D9R A;  2PZV A;  2W2C A;  3F40 A;  3T8N A;  4KVH A;  3NV0 A;  3F7X A;  3OXA A;  4MJD A;  4Q53 A;  4FCM A;  1DMN A;  7STD A;  4HZB B;  3GZR A;  1DMM A;  4L8O A;  3JUN A;  1JB4 A;  2XR8 B;  4HM2 B;  5KP1 A;  2HMO B;  2F99 A;  3F8H A;  4ORL A;  2XSO B;  5BVB A;  1JN5 A;  2HMK B;  2K54 A;  3SED A;  1STD A;  3EHC A;  1Q42 A;  4STD A;  3OWS A;  2GBX B;  2Z7A A;  4XBY A;  5AIG A;  3GZY B;  3H51 A;  2JQ5 A;  3VSY A;  4LMI A;  3LZA A;  5AII A;  4X2O A;  1QMA A;  1NU3 A;  2GBW B;  2RFR A;  5TGN A;  2Z77 A; 
#chains in the Genus database with same CATH topology
 1JRQ A;  1OF5 B;  3X3X A;  1Q7H A;  1RRH A;  3DGM A;  1I2E A;  1R4C A;  2E2T A;  1JB5 A;  2H0H A;  2BMO B;  3KFQ C;  2UX0 A;  3N8B A;  3NM7 A;  2OQE C;  4X2H A;  1U5O A;  1NO3 A;  4HM6 B;  4N6V 0;  3TDG A;  1GY6 A;  1B20 A;  1IVV A;  6RNT A;  1S72 3;  1BNG A;  4O8S A;  1B2U A;  3QK9 A;  1UUW B;  3GRD A;  1EA2 A;  3A5E A;  5AIF A;  1I2G A;  1RCL A;  1J2B A;  5CK6 A;  1BRJ A;  1TJD A;  1V74 A;  5G1K A;  3JUO A;  1OAC A;  1N9E A;  1RGL A;  3ZFZ A;  3KKG A;  3OWU A;  3AGO A;  1UCK A;  2W6J H;  1FZU A;  3GAX A;  3AHW A;  3B4P A;  1JB2 A;  1A90 A;  3Q90 A;  4WYK A;  4FMC A;  1Q40 B;  1RN4 A;  2BNG A;  4J9A A;  1DMQ A;  2KAA A;  4K90 B;  1AR0 A;  2ZA4 A;  1LOV A;  1BNS A;  2CFW A;  1US1 A;  2RBI A;  3RDE A;  2R41 A;  1SJW A;  1KQS 2;  5STD A;  1JNQ A;  2IUK A;  4MMX B;  3LXU X;  1IVU A;  2LYX A;  3MYT A;  1X1U A;  1UUV B;  3RNT A;  3CME 3;  3NQY A;  2OTL 3;  5EEO A;  2B1X B;  1YHQ 3;  4IT7 A;  1VQO 3;  3H3H A;  4CPK A;  1NDO B;  5BU4 A;  4GSP A;  4XM4 A;  1HYF A;  4AKY A;  2BMQ B;  3EJV A;  4HKV B;  4LGQ A;  2MC8 A;  1ZGX A;  4N6M A;  1YIT 3;  1VQ8 3;  1GMQ A;  2INX A;  1O7G B;  5A0O B;  1RGF A;  2D1W A;  2F86 B;  2WGO A;  3UL6 A;  3WOF B;  1N8Q A;  4HM1 B;  5CF1 A;  1OPY A;  3X3Y A;  3G16 A;  1OGX A;  4WFO A;  1EKM A;  3S27 A;  1LXE A;  1YIJ 3;  3KSE D;  2IMJ A;  2XRX B;  3JVC A;  3WOE B;  1AVL A;  3PCS A;  4HOH A;  4H3U A;  3HOH A;  5D82 A;  1OH0 A;  1FGT A;  1K41 A;  5D81 A;  1VQP 3;  5DRE A;  4R80 A;  1VZZ A;  5M19 A;  1RJO A;  1C7H A;  2GEX A;  1EUI C;  1O7N B;  3KCH A;  3V92 A;  3FZW A;  3K0Z A;  1UGI A;  5IEN A;  1W4N A;  1S5A A;  1IQ8 A;  3K5T A;  3AMO A;  5JBS A;  1QVG 2;  3DUK A;  1WMN A;  1IQX A;  3UJM A;  3LH4 A;  3IJE B;  1M90 4;  1E97 A;  3DH2 A;  1FUW A;  4FMB A;  1OF5 A;  1WMO A;  4N6T A;  1LOX A;  1K28 A;  1BSA A;  5IG3 A;  1BUQ A;  1SQW A;  1E3R A;  1I2F A;  1N8R 4;  2ML6 A;  5IEO A;  2RSX A;  3MG2 A;  2RCD A;  8RNT A;  1Y4K A;  3PXM A;  3FG3 A;  4RNT A;  4RBN A;  1KWI A;  3EBY A;  1BAO A;  4XDV A;  2KXG A;  3ECF A;  1T2H A;  3D3L A;  1B2Z A;  1GOV A;  1LOW A;  1UCI A;  1RSN A;  1UDI I;  1RGC A;  2XSH B;  3DM8 A;  3HX8 A;  4N3V A;  7GSP A;  1GMP A;  1LNH A;  3MG3 A;  3SOA A;  2FNQ A;  1SII A;  1Z1S A;  4K1V A;  1CH0 A;  2C4B A;  2H0I A;  1UCL A;  1UI7 A;  3KN4 A;  3GWR A;  1VQ5 3;  4EBG A;  2L1S A;  3G0K A;  2Y74 A;  3B7C A;  5JPU A;  3RGR A;  1AV4 A;  5G2G A;  1SPU A;  2GSP A;  1Q40 A;  4U13 A;  3BNC A;  1EG9 B;  3CU3 A;  3ER7 A;  3D5I A;  2AAE A;  5CXO A;  5D83 A;  4EC6 A;  3FKA A;  3NHX A;  1DVD A;  1I0X A;  2QGU A;  1MWR A;  5AIH A;  3S28 A;  1YJN 3;  1K9M 4;  1A2P A;  2CHC A;  2GU3 A;  3CCV 3;  3CNM A;  1OCV A;  3O8Y A;  3NUV A;  2CWV A;  2MF7 A;  2FXT A;  4N6U A;  1W6G A;  3BU4 A;  4ILF A;  3Q2P A;  3RGA A;  1JJ2 2;  3ROB A;  1OUN A;  3FGY A;  1RGK A;  1OGZ A;  3MKI A;  3CC4 3;  1FA3 A;  1BRI A;  3PCR A;  3NM2 A;  4N6O B;  8CHO A;  1BNR A;  3STD A;  1WMP A;  2CX1 A;  2OQE A;  2SBL A;  1W00 A;  2RGQ A;  1RKY A;  2WGQ A;  1KSI A;  1BSC A;  3BND A;  1IVW A;  2K3D A;  3DZL A;  4I4K A;  3OW2 2;  4NRE A;  3HIG A;  3EF8 A;  1B2M A;  2W9P A;  1MWU A;  1UW1 A;  2Y73 A;  3OV4 A;  4AEQ A;  1MWS A;  1JZD A;  2YFL B;  1STF I;  2CFL A;  1BAN A;  1IU7 A;  1ZX2 A;  4XBX A;  1EEJ A;  5KP3 A;  3UL5 A;  2XH9 A;  5AI1 A;  4LYL B;  3DMC A;  4NHF A;  2L4V A;  1BOX A;  1MNL A;  1FUT A;  1Q9E A;  1HZ1 A;  1QAL A;  1GY5 A;  4HJL B;  4TX4 A;  3WR2 A;  3CCS 3;  1RTU A;  5GSP A;  1C54 A;  1BRS A;  3FLJ A;  2A15 A;  2R4I A;  1FYS A;  3SXX A;  1LQG C;  3JUP A;  1RGE A;  5CLK A;  1PU4 A;  3BIR A;  5CF2 A;  3CCQ 3;  4L7K A;  2W0Q A;  1OHO A;  4JF8 A;  3MG1 A;  3V99 A;  2UUG C;  3NBR A;  4J8T A;  4R4K A;  1Q82 4;  2OOV C;  2O3O A;  2KF3 A;  3EN8 A;  1FGO A;  2KF4 A;  3G8Z A;  1G0T A;  3IMA B;  3LYG A;  4HM3 B;  4OUQ A;  2CG0 A;  1JBT A;  2IA7 A;  1GS3 A;  3WA2 X;  1K73 4;  3PZW A;  1O7M B;  2BT3 A;  3EQQ B;  3V98 A;  1ISK A;  2P0X A;  3VGN A;  1I70 A;  3HI7 A;  1FGM A;  2D42 A;  3FG1 A;  4KFF A;  3CCL 3;  5IF6 A;  4HM7 B;  3DGY A;  2W56 B;  1QVF 2;  3PYJ A;  2F56 A;  5EQL A;  3CCE 3;  5IEP A;  1VQ7 3;  1V58 A;  1X1X A;  4FR9 A;  4HVN A;  2JDI H;  3LT9 A;  1RGH A;  1TUH A;  3KSP A;  3F9S A;  4BU4 A;  3VF1 A;  4KT3 B;  1RRL A;  4NPB A;  4XDW A;  3LML A;  5EVH A;  1MWT A;  3EC9 A;  3FF0 A;  4R1K A;  1VQ4 3;  3E99 A;  1RNT A;  1JKG B;  1MGW A;  1UCJ A;  3AGN A;  1T3B A;  3MHE A;  1BUJ A;  3T8U A;  2BU4 A;  1F8N A;  4BTY A;  3LT8 A;  1BGS A;  4CJN A;  1OHP A;  2HMJ B;  1VQ6 3;  2GEY A;  3X42 A;  1D6Z A;  1LNI A;  4MMZ B;  4WP5 A;  5IG4 A;  2XGN A;  7RNT A;  4R9K A;  3IPT A;  3I56 3;  3CPO A;  1BIR A;  2CFK A;  4K61 A;  2AAD A;  1TFK A;  5G1L A;  3WHO A;  1RNB A;  1B2S A;  2Z6B A;  4HM8 B;  3B4O A;  3DY5 A;  2WOF A;  3K7C A;  4MMY B;  2HOH A;  1GYB A;  1L5G B;  1O7W B;  1TFO A;  1BNF A;  2E2V A;  1YGE A;  3K9M C;  1FGR A;  1IDP A;  5IER A;  1BRH A;  3OX9 A;  1N5P A;  2HMN B;  4RNY A;  5HOH A;  2W04 A;  3NX0 A;  2CWU A;  1W2Z A;  2V1L A;  3FF2 A;  1Q7Y 4;  2RNT A;  4ZM8 A;  4BTX A;  1RGA A;  1OHS A;  1W7C A;  2CW9 A;  3NQZ A;  4R9L A;  3EBT A;  5HGR A;  3KZT A;  1VQN 3;  4OVM A;  1VQM 3;  4H61 A;  3ALA A;  1RDS A;  1WTH A;  2IYJ A;  3CNX A;  1IQY A;  2J8X B;  2IUJ A;  1IT8 A;  3DXO A;  3SLU A;  1RGG A;  1YVS A;  3SOY A;  5AYR B;  3NBB A;  3U1W A;  1BU4 A;  1PYL A;  3F8X A;  1IVX A;  3MWZ A;  2QIY A;  3LTD A;  1WQL B;  1QAF A;  3CC7 3;  4PEJ A;  1W01 A;  1QJG A;  2YFJ B;  2CG1 A;  3X41 A;  2P09 A;  1N5H A;  2BMR B;  5JPP A;  2XGL A;  1I3I A;  5ELU A;  1Q81 4;  3CD6 3;  3LTC A;  1LRA A;  6GSP A;  1E3V A;  2XFT A;  1M1K 4;  3EX9 A;  1TRQ A;  3M8C A;  1BSD A;  3S5C A;  1Q86 4;  1MOL A;  1CQS A;  1VQ9 3;  3WDG B;  2W56 A;  2BHM A;  2IY2 A;  1HU9 A;  3AHS A;  1EQK A;  3FG4 A;  4CDL A;  3HZP A;  5FW5 A;  1CYU A;  1JBR A;  3WOD G;  4GL6 A;  3KE7 A;  3ZG0 A;  1YJ9 3;  1DE3 A;  2HMM B;  1CYV A;  1FW7 A;  1HKX A;  5IW9 A;  4HZ9 B;  1NNV A;  1UI8 A;  3URP A;  2ZDJ A;  1DET A;  4G1M B;  1GD3 A;  1FGQ A;  3GZX B;  5M1A A;  4EYC A;  1ULJ B;  4N6L A;  5LC7 A;  1ROA A;  1CEW I;  1GOY A;  1V57 A;  5KP4 A;  3CCR 3;  1JKG A;  4XB5 A;  2I9W A;  1PFP A;  1R4Y A;  2C10 A;  1B21 A;  5AEW B;  1RN7 A;  3D79 A;  1MGR A;  3BNB A;  3T0U A;  3S67 A;  1BNJ A;  3G71 3;  1BRG A;  4HM5 B;  2Z76 A;  3I55 3;  5AEU B;  3NV0 B;  1JV2 B;  4GHO A;  1IV7 A;  3GSP A;  3PGB A;  1IK3 A;  1TU5 A;  2OCT A;  3D5G A;  3F14 A;  1A2V A;  2K0M A;  5AYS C;  2CX0 A;  1B27 A;  1RLS A;  4FCJ A;  1WNH A;  2F4Y A;  4WWU C;  4GB5 A;  2OOV A;  4XBT A;  2P38 A;  2UGI A;  5DRV A;  2FGT A;  3A76 A;  3NXJ A;  5RNT A;  4J5G A;  1BNE A;  1SIH A;  1ROV A;  3I0Y A;  4OK0 A;  3CCJ 3;  4LZI A;  1TIJ A;  1GOU A;  1YGW A;  1T5Y A;  2P0M A;  1ULI B;  5IG0 A;  3EN1 B;  1ZO2 A;  1GMR A;  4BL3 A;  3CCU 3;  4IIA A;  4EV2 A;  2ML5 A;  3SX1 A;  2H0G A;  1X1Y A;  3L0R A;  2B24 B;  3FH1 A;  4IPB A;  1VQL 3;  1N9J A;  1O7H B;  3FSD A;  1AVK A;  2YX9 A;  3LTA A;  4HBR A;  1JN5 B;  4DKI A;  1M1X B;  3HII A;  1SAR A;  1JZO A;  1BRK A;  2HML B;  1O7P B;  2OWP A;  2P05 A;  2YFI B;  3CPW 2;  2W03 A;  3X40 A;  3WMD A;  2GXF A;  3PS8 A;  1JBS A;  3S29 A;  4L8P A;  1GSP A;  4HM0 B;  1IV9 A;  1YNV X;  3BLZ A;  1W6C A;  4LEH A;  4RZM A;  1W2B 2;  1T2I A;  6STD A;  1TRP A;  3LOY A;  1K8A 4;  2OTJ 3;  2XF3 A;  1BVI A;  1G02 A;  1RMS A;  3OWY A;  1GY7 A;  3X3Z A;  2WOH A;  2O9U X;  3MPH A;  5BXQ A;  1U8C B;  3SVA A;  3N9H A;  3HK4 A;  3NBJ A;  4BTW A;  2F5W A;  2QEX 3;  4QWT A;  3MSO A;  5FGO A;  3UNL A;  1W6Y A;  3FCS B;  3F7S A;  2KCD A;  4LSO A;  1LQM B;  1NWW A;  5LC6 A;  2XFS A;  2F98 A;  3DGO A;  1A2K A;  1UUG B;  3U97 A;  1ASK A;  3EE1 A;  1NB5 I;  3LTB A;  2CFG A;  3JUQ A;  3UB1 A;  9RNT A;  3BB9 A;  5IG5 A;  4O2H A;  1A67 A;  4J5K A;  5M18 A;  3JUM A;  3J7Y d;  3B8L A;  2STD A;  2PNC A;  2SAR A;  1D6Y A;  2XEP A;  4K1U A;  4KFE A;  4EXR A;  2CKF B;  1W02 A;  1RN1 A;  3GZB A;  4HM4 B;  1TP6 A;  4N6N B;  4O3V A;  2F5M A;  4HAA A;  1RCK A;  4WYK B;  2QA4 3;  3D9R A;  2PZV A;  2W2C A;  3F40 A;  3T8N A;  4KVH A;  3N54 B;  1YI2 3;  1AQZ A;  3Q1C A;  1NJI 4;  2KF6 A;  3NV0 A;  3Q3F A;  3F7X A;  3OXA A;  1IT7 A;  3D4A A;  3G6E 3;  2LQV A;  2E2U A;  1QAK A;  4MJD A;  4Q53 A;  1YJW 3;  4BIR A;  1KD1 4;  4FCM A;  1PY3 A;  1X1W A;  1KC8 4;  3CC2 3;  1VQK 3;  1DMN A;  3SYU A;  7STD A;  4HYZ A;  4KZ1 A;  4AKZ A;  1AY7 A;  1B3S A;  1IYY A;  4HZB B;  3CCM 3;  4RNZ A;  1NB3 I;  3GZR A;  1DMM A;  4L8O A;  4WHA A;  5ELJ A;  3WA3 A;  3CXC 2;  2GU1 A;  2KRT A;  3JUN A;  1JB4 A;  2XR8 B;  4HM2 B;  2Q07 A;  3K63 A;  4FMA A;  2C11 A;  5KP1 A;  1BSE A;  4MEI A;  4BL2 A;  1VQQ A;  2HMO B;  2KF5 A;  2CC3 A;  2CFD A;  2ZL8 A;  2F99 A;  1I8V A;  3F8H A;  4KFD A;  1YVB I;  4I5Q A;  4O02 B;  4ORL A;  2BIR A;  4CCV A;  2CWT A;  1TTO A;  2XSO B;  1D6U A;  4FCZ A;  5BVB A;  1JN5 A;  2HMK B;  2K54 A;  2M7O A;  1BRN L;  3SED A;  1STD A;  1G96 A;  1ZS7 A;  3EHC A;  5BIR A;  4JRF A;  1GD4 A;  1I3F A;  1Q42 A;  2ZHX B;  4STD A;  5I97 A;  3OWS A;  1DVC A;  3DGN A;  1RHL A;  2GBX B;  2Z7A A;  1B2X A;  1UGH I;  4XBY A;  3KII A;  5AIG A;  3GZY B;  2CH9 A;  3DGL A;  3H51 A;  2JQ5 A;  3VSY A;  3ZG5 A;  2CK3 H;  4EW5 A;  1BNI A;  4LMI A;  3QRD A;  2W9Q A;  1DYU A;  3LZA A;  3G4S 3;  5AII A;  4X2O A;  1QMA A;  1W5Z A;  3AMO B;  4EV5 A;  2BO9 B;  1NU3 A;  3BNE A;  3EB8 A;  1I0V A;  2GBW B;  1FUS A;  1LVN A;  2RFR A;  3CMA 3;  2CIU A;  4FMD A;  2WO0 A;  1BSB A;  1M9G A;  5TGN A;  2Z77 A;  1LOY A; 
#chains in the Genus database with same CATH homology
 1JRQ A;  1OF5 B;  3X3X A;  1RRH A;  3DGM A;  1R4C A;  2E2T A;  1JB5 A;  3KFQ C;  2BMO B;  3N8B A;  2UX0 A;  3NM7 A;  4X2H A;  2OQE C;  1KD1 4;  1U5O A;  1NO3 A;  4HM6 B;  4N6V 0;  3TDG A;  1GY6 A;  1IVV A;  1S72 3;  4O8S A;  3QK9 A;  1UUW B;  3GRD A;  1EA2 A;  5AIF A;  5CK6 A;  1V74 A;  3JUO A;  1OAC A;  1N9E A;  3KKG A;  3OWU A;  2W6J H;  3GAX A;  3B4P A;  1A90 A;  1JB2 A;  3Q90 A;  4WYK A;  4FMC A;  1Q40 B;  2BNG A;  4J9A A;  1DMQ A;  4K90 B;  1AR0 A;  2CFW A;  1US1 A;  3RDE A;  1SJW A;  1KQS 2;  5STD A;  1JNQ A;  2IUK A;  4MMX B;  3LXU X;  1IVU A;  2LYX A;  3MYT A;  1UUV B;  3CME 3;  3NQY A;  2OTL 3;  5EEO A;  2B1X B;  1YHQ 3;  4IT7 A;  1VQO 3;  3H3H A;  1NDO B;  4XM4 A;  4AKY A;  2BMQ B;  3EJV A;  4HKV B;  4LGQ A;  2MC8 A;  4N6M A;  1YIT 3;  1VQ8 3;  2INX A;  1O7G B;  5A0O B;  2D1W A;  2F86 B;  2WGO A;  3UL6 A;  3WOF B;  1N8Q A;  4HM1 B;  5CF1 A;  1OPY A;  3X3Y A;  3G16 A;  1OGX A;  4WFO A;  1EKM A;  3S27 A;  1LXE A;  1YIJ 3;  3KSE D;  2IMJ A;  2XRX B;  3JVC A;  3WOE B;  1AVL A;  3PCS A;  4H3U A;  5D82 A;  1OH0 A;  1FGT A;  1K41 A;  5D81 A;  1VQP 3;  5DRE A;  4R80 A;  1VZZ A;  1RJO A;  1C7H A;  2GEX A;  1O7N B;  3V92 A;  3FZW A;  3K0Z A;  5IEN A;  1W4N A;  1S5A A;  1IQ8 A;  3K5T A;  3AMO A;  5JBS A;  1QVG 2;  3DUK A;  1WMN A;  1IQX A;  3UJM A;  3LH4 A;  3IJE B;  1M90 4;  1E97 A;  1FUW A;  4FMB A;  1OF5 A;  1WMO A;  4N6T A;  1LOX A;  1K28 A;  5IG3 A;  1BUQ A;  1SQW A;  1E3R A;  1N8R 4;  2ML6 A;  5IEO A;  2RSX A;  3MG2 A;  2RCD A;  1Y4K A;  3PXM A;  3FG3 A;  4RBN A;  1KWI A;  3EBY A;  4XDV A;  2KXG A;  3ECF A;  3D3L A;  3DM8 A;  2XSH B;  4N3V A;  3HX8 A;  3MG3 A;  1LNH A;  3SOA A;  2FNQ A;  1SII A;  1Z1S A;  4K1V A;  1UI7 A;  3KN4 A;  3GWR A;  1VQ5 3;  4EBG A;  3G0K A;  2Y74 A;  3B7C A;  5JPU A;  3RGR A;  1AV4 A;  5G2G A;  1SPU A;  4U13 A;  1Q40 A;  3BNC A;  1EG9 B;  3CU3 A;  3ER7 A;  5CXO A;  5D83 A;  4EC6 A;  3FKA A;  3NHX A;  1DVD A;  2QGU A;  5AIH A;  3S28 A;  1YJN 3;  1K9M 4;  2CHC A;  2GU3 A;  3CCV 3;  3CNM A;  1OCV A;  3O8Y A;  3NUV A;  2CWV A;  2MF7 A;  2FXT A;  4N6U A;  1W6G A;  1JJ2 2;  3RGA A;  3ROB A;  1OUN A;  3FGY A;  3CC4 3;  1OGZ A;  3MKI A;  1FA3 A;  3PCR A;  3NM2 A;  4N6O B;  8CHO A;  3STD A;  1WMP A;  2OQE A;  2SBL A;  1W00 A;  2RGQ A;  1RKY A;  2WGQ A;  1KSI A;  3BND A;  1IVW A;  3DZL A;  4I4K A;  3OW2 2;  4NRE A;  3HIG A;  3EF8 A;  2W9P A;  1UW1 A;  2Y73 A;  4AEQ A;  3OV4 A;  2YFL B;  1STF I;  2CFL A;  1IU7 A;  4XBX A;  1ZX2 A;  5KP3 A;  3UL5 A;  2XH9 A;  5AI1 A;  3DMC A;  4NHF A;  2L4V A;  1MNL A;  1QAL A;  4HJL B;  4TX4 A;  1GY5 A;  3CCS 3;  3FLJ A;  2A15 A;  2R4I A;  3SXX A;  3JUP A;  5CLK A;  1PU4 A;  5CF2 A;  3CCQ 3;  4L7K A;  2W0Q A;  1OHO A;  4JF8 A;  3MG1 A;  3V99 A;  3NBR A;  4R4K A;  4J8T A;  1Q82 4;  2OOV C;  2O3O A;  3EN8 A;  3G8Z A;  1FGO A;  3IMA B;  3LYG A;  3Q2P A;  4HM3 B;  4OUQ A;  1Q86 4;  2CG0 A;  2IA7 A;  1GS3 A;  3WA2 X;  1K73 4;  3PZW A;  1O7M B;  2BT3 A;  3EQQ B;  3V98 A;  1ISK A;  2P0X A;  3VGN A;  3HI7 A;  1FGM A;  2D42 A;  3FG1 A;  4KFF A;  3CCL 3;  5IF6 A;  4HM7 B;  2W56 B;  1QVF 2;  3PYJ A;  5EQL A;  3CCE 3;  5IEP A;  1VQ7 3;  4FR9 A;  4HVN A;  2JDI H;  3LT9 A;  1TUH A;  3KSP A;  3F9S A;  3VF1 A;  1RRL A;  4XDW A;  3LML A;  5EVH A;  3EC9 A;  3FF0 A;  4R1K A;  1VQ4 3;  3E99 A;  1JKG B;  3MHE A;  3T8U A;  1F8N A;  4BTY A;  3LT8 A;  1OHP A;  2HMJ B;  1VQ6 3;  2GEY A;  3X42 A;  1D6Z A;  4MMZ B;  4WP5 A;  5IG4 A;  2XGN A;  4R9K A;  3IPT A;  3I56 3;  3CPO A;  2CFK A;  4K61 A;  1TFK A;  2Z6B A;  4HM8 B;  3B4O A;  3DY5 A;  2WOF A;  3K7C A;  4MMY B;  1GYB A;  1L5G B;  1O7W B;  1TFO A;  2E2V A;  1YGE A;  3K9M C;  1FGR A;  1IDP A;  5IER A;  3OX9 A;  1N5P A;  2HMN B;  4RNY A;  2W04 A;  3NX0 A;  2CWU A;  1W2Z A;  2V1L A;  3FF2 A;  1Q7Y 4;  4ZM8 A;  4BTX A;  1OHS A;  1W7C A;  2CW9 A;  3NQZ A;  4R9L A;  3EBT A;  5HGR A;  3KZT A;  1VQN 3;  4OVM A;  1VQM 3;  4H61 A;  3ALA A;  1WTH A;  3CNX A;  1IQY A;  2IUJ A;  1IT8 A;  3DXO A;  3SLU A;  3SOY A;  5AYR B;  3NBB A;  3U1W A;  3F8X A;  1IVX A;  3MWZ A;  2QIY A;  3LTD A;  1WQL B;  1QAF A;  3CC7 3;  4PEJ A;  1W01 A;  1QJG A;  2YFJ B;  2CG1 A;  3X41 A;  2P09 A;  1N5H A;  2BMR B;  5JPP A;  2XGL A;  5ELU A;  1Q81 4;  3CD6 3;  3LTC A;  1E3V A;  2XFT A;  1M1K 4;  3EX9 A;  3M8C A;  3S5C A;  1MOL A;  1CQS A;  1VQ9 3;  3WDG B;  2W56 A;  2BHM A;  1HU9 A;  1EQK A;  3FG4 A;  4CDL A;  3HZP A;  5FW5 A;  1CYU A;  3WOD G;  4GL6 A;  3KE7 A;  1YJ9 3;  2HMM B;  1CYV A;  1HKX A;  5IW9 A;  4HZ9 B;  1UI8 A;  2ZDJ A;  4G1M B;  1GD3 A;  1FGQ A;  3GZX B;  4EYC A;  1ULJ B;  4N6L A;  5LC7 A;  1ROA A;  1CEW I;  5KP4 A;  3CCR 3;  1JKG A;  4XB5 A;  2I9W A;  1PFP A;  2C10 A;  5AEW B;  1RN7 A;  3T0U A;  3BNB A;  3G71 3;  3S67 A;  4HM5 B;  2Z76 A;  3I55 3;  5AEU B;  3NV0 B;  1JV2 B;  1IV7 A;  3PGB A;  1IK3 A;  1TU5 A;  2OCT A;  3F14 A;  5AYS C;  1A2V A;  2K0M A;  4FCJ A;  4WWU C;  1WNH A;  1J2B A;  4GB5 A;  2OOV A;  4XBT A;  2P38 A;  5DRV A;  2FGT A;  3A76 A;  3NXJ A;  1SIH A;  1ROV A;  3I0Y A;  4OK0 A;  3CCJ 3;  4LZI A;  1TIJ A;  1T5Y A;  2P0M A;  1ULI B;  5IG0 A;  3EN1 B;  1ZO2 A;  3CCU 3;  4IIA A;  4EV2 A;  2ML5 A;  3SX1 A;  3L0R A;  2B24 B;  3FH1 A;  4IPB A;  1VQL 3;  1N9J A;  1O7H B;  3FSD A;  1AVK A;  2YX9 A;  3LTA A;  4HBR A;  1JN5 B;  1M1X B;  3HII A;  2HML B;  2YFI B;  1O7P B;  2OWP A;  2P05 A;  3CPW 2;  2W03 A;  3X40 A;  3WMD A;  2GXF A;  3PS8 A;  3S29 A;  4L8P A;  4HM0 B;  1IV9 A;  3BLZ A;  4LEH A;  1W6C A;  4RZM A;  1W2B 2;  6STD A;  3LOY A;  1K8A 4;  2OTJ 3;  2XF3 A;  3OWY A;  3X3Z A;  1GY7 A;  2WOH A;  2O9U X;  3MPH A;  5BXQ A;  1U8C B;  3SVA A;  3N9H A;  3HK4 A;  3NBJ A;  4BTW A;  2QEX 3;  4QWT A;  3MSO A;  5FGO A;  3UNL A;  1W6Y A;  3FCS B;  3F7S A;  2KCD A;  4LSO A;  1NWW A;  5LC6 A;  2XFS A;  2F98 A;  3DGO A;  1A2K A;  3U97 A;  1ASK A;  3EE1 A;  1NB5 I;  3LTB A;  2CFG A;  3JUQ A;  3UB1 A;  5IG5 A;  3BB9 A;  4O2H A;  1A67 A;  3JUM A;  3J7Y d;  3B8L A;  2STD A;  2PNC A;  1D6Y A;  2XEP A;  4K1U A;  4KFE A;  4EXR A;  2CKF B;  1W02 A;  3GZB A;  4HM4 B;  1TP6 A;  4N6N B;  4O3V A;  4WYK B;  2QA4 3;  3D9R A;  2PZV A;  2W2C A;  3F40 A;  3T8N A;  4KVH A;  3N54 B;  1YI2 3;  3Q1C A;  1NJI 4;  3NV0 A;  3F7X A;  3OXA A;  1IT7 A;  3G6E 3;  2LQV A;  2E2U A;  1QAK A;  4MJD A;  4Q53 A;  1YJW 3;  4FCM A;  1KC8 4;  3CC2 3;  1VQK 3;  1DMN A;  7STD A;  4HYZ A;  4KZ1 A;  4AKZ A;  4HZB B;  3CCM 3;  4RNZ A;  1NB3 I;  3GZR A;  1DMM A;  4L8O A;  4WHA A;  5ELJ A;  3WA3 A;  3CXC 2;  2GU1 A;  2KRT A;  3JUN A;  1JB4 A;  2XR8 B;  4HM2 B;  2Q07 A;  3K63 A;  4FMA A;  2C11 A;  5KP1 A;  4MEI A;  2HMO B;  2ZL8 A;  2CC3 A;  2CFD A;  2F99 A;  3F8H A;  4KFD A;  4O02 B;  1YVB I;  4ORL A;  4CCV A;  2CWT A;  2XSO B;  4FCZ A;  1D6U A;  5BVB A;  1JN5 A;  2HMK B;  2K54 A;  2M7O A;  3SED A;  1STD A;  1G96 A;  3EHC A;  4JRF A;  1GD4 A;  1Q42 A;  4STD A;  5I97 A;  3OWS A;  1DVC A;  3DGN A;  2GBX B;  2Z7A A;  4XBY A;  3KII A;  5AIG A;  3GZY B;  2CH9 A;  3DGL A;  3H51 A;  2JQ5 A;  3VSY A;  2CK3 H;  4LMI A;  3QRD A;  2W9Q A;  1DYU A;  3LZA A;  3G4S 3;  5AII A;  4X2O A;  1QMA A;  1W5Z A;  3AMO B;  4EV5 A;  2BO9 B;  1NU3 A;  3BNE A;  3EB8 A;  2GBW B;  3CMA 3;  1LVN A;  2RFR A;  2CIU A;  4FMD A;  2WO0 A;  1M9G A;  5TGN A;  2Z77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...