1U5OA

Structure of the d23a mutant of the nuclear transport carrier ntf2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
b'GDKPIWEQIGSSFIQHYYQLFANDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear transport factor 2
molecule tags Protein transport
source organism Rattus norvegicus
publication title Computational and biochemical identification of a nuclear pore complex binding site on the nuclear transport carrier NTF2.
pubmed doi rcsb
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1u5oA00
3B4OA 3DMCA 8CHOA 1JB2A 2GBXB 2R4IA 1Q42A 1DMNA 1Q40A 3EX9A 3OX9A 1GY6A 2GXFA 3OWYA 1O7WB 4PEJA 1W00A 3BLZA 2HMKB 3NM2A 3OXAA 4HZBB 5CF1A 5AIHA 3A76A 3NXJA 3CPOA 4J9AA 2B1XB 5D81A 1O7PB 3HX8A 3JUNA 2F99A 3B7CA 2GBWB 2RFRA 3BB9A 2YFIB 3EC9A 3FF0A 3G0KA 3K0ZA 1Q40B 3NUVA 4LEHA 4WP5A 5BVBA 5JPPA 1OCVA 5AIFA 5KP3A 5BXQA 5G2GA 1TUHA 4LMIA 1A2KA 5DREA 4XM4A 3CNXA 1QJGA 1ZX2A 1UUVB 1S5AA 4X2OA 5JPUA 7STDA 1JB4A 3GZXB 3F7SA 4L8PA 4J8TA 2K54A 1ZO2A 4Q53A 3KE7A 3E99A 5IG4A 1TP6A 3GRDA 3F7XA 3MG2A 1K41A 1EA2A 3RGAA 1OF5A 2HMJB 3JUQA 3LZAA 4R1KA 2BMRB 2BMQB 2I9WA 1GYBA 3JUPA 4FCMA 5D82A 3KSPA 3ER7A 5CF2A 2HMOB 1JKGB 3G8ZA 1ASKA 5CLKA 3UNLA 3HZPA 3VGNA 2UX0A 3T8UA 4RZMA 2HMMB 3NHXA 4XB5A 5AEUB 4HVNA 3HK4A 1U5OA 4HM7B 3FGYA 3K7CA 1E3VA 3NV0B 4X2HA 1O7GB 4WWUC 3VSYA 1IDPA 3B8LA 1AR0A 1STDA 2IMJA 4HM5B 3OWUA 4HM8B 4OUQA 3MHEA 4H3UA 5AIIA 4R9KA 3EN1B 1GS3A 3GZBA 1E97A 2HMLB 2Z76A 3FF2A 3KZTA 4KVHA 2GEYA 3JUMA 5AEWB 1O7HB 3IPTA 1OPYA 5IG5A 5KP4A 4OVMA 2F86B 4MJDA 4K1UA 3MYTA 3H3HA 4U13A 1QMAA 4I4KA 1GY5A 1ULJB 2OWPA 3F40A 1Z1SA 2PZVA 3D9RA 4HM0B 3EQQB 3F8XA 4K1VA 5D83A 2BNGA 5IG0A 3UJMA 4R9LA 2RCDA 3Q90A 1EG9B 5IEOA 3S5CA 3ROBA 3EN8A 4HZ9B 4HM3B 5STDA 2F98A 4STDA 2A15A 4WYKA 4IIAA 4LGQA 3OV4A 3FLJA 1OF5B 2Z77A 3MG3A 5FW5A 4L7KA 1WQLB 5CXOA 4XDWA 4FCJA 1UUWB 3FH1A 4HM2B 4HM6B 3WMDA 4ORLA 4WYKB 2Z7AA 5IERA 1GY7A 3SOYA 4XBYA 2XR8B 1SJWA 3F8HA 5TGNA 3EHCA 3CU3A 1HKXA 3ECFA 2XSHB 1VZZA 3KKGA 3MG1A 2QIYA 5HGRA 3T8NA 4HKVB 3JUOA 4CDLA 1OGZA 2HMNB 2INXA 4HJLB 3B4PA 3EF8A 5KP1A 1JN5A 3GZRA 3NBRA 1JB5A 3M8CA 3MKIA 3F14A 1C7HA 1OHSA 2STDA 4GB5A 3I0YA 2W2CA 3NV0A 4HM4B 3RGRA 3LYGA 3EBTA 3DM8A 4XDVA 1BUQA 1NU3A 2JQ5A 5AIGA 5EVHA 4XBXA 5CK6A 5IG3A 1NDOB 2RGQA 3FKAA 2YFLB 2YFJB 1CQSA 3EBYA 1DMMA 2CKFB 1JKGA 2GEXA 1ISKA 5IENA 1JN5B 1DMQA 1W02A 1E3RA 2XRXB 3F9SA 3GZYB 6STDA 5IF6A 1O7NB 3DUKA 3EJVA 4L8OA 4HM1B 2XSOB 3DXOA 1W01A 3CNMA 1OHPA 3H51A 3MSOA 2B24B 4XBTA 5IEPA 3FSDA 5AI1A 5DRVA 1W6YA 1OHOA 3DZLA 3FZWA 1NWWA 3OWSA 2BMOB 2QGUA 3SEDA 1OUNA 2CHCA 3G16A 1O7MB 1OGXA 1OH0A 3GWRA 4N3VA 3SOAA 3STDA 1ULIB
chains in the Genus database with same CATH superfamily
1FGMA 1KSIA 1D6YA 5HOHA 3GAXA 5BIRA 3G6E3 1DMNA 1Q40A 2CFLA 2YX9A 3OXAA 4HZBB 5AIHA 1IU7A 3NXJA 3CPOA 4J9AA 5G1LA 1W2B2 1O7PB 2WGOA 2OCTA 3JUNA 2OTL3 2F99A 2GBWB 3L0RA 3NBJA 3K0ZA 4HBRA 3NUVA 3WODG 4FR9A 4LZIA 5BVBA 4FCZA 5KP3A 5DREA 1A2KA 2CX1A 1QJGA 1UUVB 1BAOA 1N5HA 1AVKA 1ZGXA 3GZXB 4L8PA 1LNHA 3BNCA 3O8YA 1RGHA 1TP6A 3X3XA 3F7XA 3MG2A 1LXEA 1K41A 1U8CB 4KT3B 3UL5A 4FMCA 1R4YA 1OF5A 3LZAA 1LVNA 1A67A 2I9WA 1GYBA 3KSPA 5CF2A 1UGIA 3LT9A 1JKGB 3SYUA 3UNLA 3HZPA 3VGNA 5M1AA 3BIRA 1VQ43 2HMMB 1VQ53 1W2ZA 3CCL3 3HK4A 3G713 1BNSA 2CC3A 2IYJA 1O7GB 3LH4A 3FG1A 1STFI 1V57A 4HM5B 2RNTA 5M19A 1UCIA 1PYLA 1KQS2 3MHEA 1T3BA 3ZG0A 1TRQA 1K28A 4R9KA 3GZBA 1E97A 2CFGA 5IG5A 3OW22 1IV9A 3IPTA 2AADA 3KN4A 2F86B 1K734 3H3HA 1GD3A 1GY5A 2OWPA 1RGAA 3T0UA 1WTHA 1Z1SA 3D9RA 5D83A 1VQQA 3F8XA 1EG9B 2GU3A 5IEOA 4NHFA 1YJN3 1BGSA 1WNHA 1FUWA 1UCLA 1RTUA 1BSBA 4WYKA 4BL3A 3WOFB 1LOWA 2OOVC 2XEPA 1JNQA 4QWTA 1YGWA 4FCJA 4RNTA 4HM6B 4N6NB 4HM2B 4EW5A 2XFSA 1GY7A 1EUIC 4XBYA 4DKIA 3KKGA 5HGRA 4HKVB 2Y73A 3HOHA 2INXA 1B3SA 2W9PA 3B4PA 3Q2PA 1K9M4 2V1LA 1NB3I 3F14A 1GMPA 2BHMA 3D5GA 3MKIA 1FZUA 1M1XB 2OQEA 2STDA 4EBGA 3NV0A 3D79A 2CFDA 3RGRA 3AGOA 5AIGA 5ELUA 3V92A 5CK6A 1NDOB 4JF8A 2YFJB 1VQO3 1EKMA 3EBYA 3Q1CA 1DMMA 1VQ73 1YIT3 1JN5B 4BU4A 3CCJ3 3HI7A 1E3RA 5G1KA 3S27A 4BTXA 1FUTA 3G4S3 3DUKA 2W9QA 1B27A 3KIIA 4L8OA 4WFOA 4EC6A 1I2EA 3DXOA 2AAEA 1AQZA 3DGMA 3DGLA 3CD63 1OHOA 1UDII 3NQZA 2GSPA 3OWSA 1BSDA 2BT3A 2QGUA 3KSED 2CHCA 1VQP3 1KC84 2CW9A 3PCSA 4HOHA 1VQM3 3LTCA 3STDA 3BNEA 2E2TA 1JB2A 2R4IA 4ORLA 3PGBA 2WGQA 2P05A 2KRTA 1RJOA 5D81A 1VQ83 3FCSB 1JJ22 1BRKA 3EC9A 2YFIB 3G0KA 3FF0A 4LEHA 1A90A 2F5WA 1OCVA 5BXQA 2WOHA 1RMSA 4LMIA 1FUSA 2D1WA 1RSNA 1TRPA 4O8SA 1S5AA 1CH0A 2D42A 3X3YA 3F7SA 4I5QA 4FMAA 1BOXA 1JBSA 3A5EA 1TJDA 3KE7A 3GRDA 3WA2X 1NB5I 3V99A 1EA2A 3QK9A 4CCVA 1YGEA 2CG0A 4O2HA 1MWTA 3CCE3 1A2VA 1LOVA 4K61A 2BMQB 1RN7A 2PNCA 1SIIA 3JUPA 4FCMA 4EXRA 1DE3A 4N6OB 1BNGA 1RN4A 3T8UA 2W03A 4RZMA 5AEUB 1Q7Y4 1U5OA 3PXMA 4HM7B 4RBNA 1YJ93 4WWUC 2C10A 1IDPA 2ZL8A 3PCRA 1AR0A 1BNFA 1X1WA 2BU4A 1BANA 1GOVA 3OWUA 1NJI4 2LQVA 1FGRA 4OUQA 5BU4A 3WA3A 4H3UA 3ALAA 1GS3A 2F4YA 3FF2A 4KFFA 2Z76A 2GEYA 3JUMA 1O7HB 2WO0A 3PZWA 1W5ZA 3DY5A 1MGRA 4OVMA 1RGKA 1SQWA 4K1UA 4U13A 2FGTA 1K8A4 1TFOA 1QMAA 1X1UA 2CWTA 4I4KA 1EQKA 3CCQ3 4WHAA 3EQQB 1FGOA 3X42A 1LOYA 1TIJA 2RCDA 1V58A 2CG1A 3AMOA 3K5TA 1JZDA 2F98A 4HM3B 1YJW3 1Q864 1UGHI 4LGQA 3CCR3 3FLJA 1OF5B 1W7CA 3MG3A 1RNBA 2XGLA 5FW5A 5CXOA 1WQLB 1IK3A 4XDWA 1IT7A 1LOXA 4EV5A 1MGWA 1BNJA 4WYKB 1W6CA 1IV7A 1QVG2 2O3OA 4CPKA 1JBTA 3ECFA 1QAFA 1M904 1PFPA 1DVDA 3T8NA 1QVF2 3LXUX 1Q814 1NNVA 1I2GA 1OGZA 1AY7A 2HMNB 1IYYA 1JN5A 3NBRA 1BSAA 1HU9A 1N8R4 2CK3H 1OACA 1OHSA 2F56A 4GB5A 4HM4B 1M9GA 3LYGA 2J8XB 3NM7A 4HAAA 8RNTA 5IG3A 4XBXA 3CCV3 4N6V0 4GSPA 3I563 2RGQA 2KCDA 1VQL3 1WMOA 1JKGA 2GEXA 1MWUA 6GSPA 1B2MA 5IENA 1BRNL 3NQYA 1MOLA 1YIJ3 4HM1B 3BNDA 1BRSA 3BNBA 1B2ZA 1W01A 3H51A 1QALA 3MSOA 4XBTA 3UB1A 2UGIA 1S723 5AI1A 1B2XA 5DRVA 5AYRB 1IQXA 2KXGA 4LYLB 2BMOB 3SEDA 4GL6A 1PY3A 3G16A 3SOAA 4FMBA 1Q9EA 4MJDA 2P0MA 1ISKA 3ROBA 1I8VA 1B2UA 2HOHA 2GBXB 4H61A 1Q42A 4N6LA 1TFKA 1QAKA 1GY6A 2GXFA 4PEJA 1W00A 3NM2A 1B20A 3TDGA 4IT7A 1D6ZA 2JDIH 5AYSC 1VQK3 3CME3 3CMA3 2B1XB 3B7CA 4K90B 4AKZA 4BTWA 2BIRA 2RFRA 4J5GA 1D6UA 4KFEA 1GSPA 1UCJA 3SXXA 4MEIA 5AIFA 4AEQA 1T2HA 1TUHA 4EV2A 4XM4A 4GHOA 1ZX2A 1BNEA 3FG4A 1RDSA 2BO9B 3QRDA 1FYSA 3AMOB 1WMPA 4O02B 1ZO2A 4Q53A 5IG4A 3E99A 3K63A 2FXTA 3MWZA 1I0VA 4R1KA 1BRHA 3DGYA 2RSXA 1PU4A 1RCLA 5D82A 1VQN3 1RRLA 3ER7A 1T5YA 2CFWA 2HMOB 4LSOA 3G8ZA 2IA7A 5EEOA 1MWRA 1T2IA 2UX0A 1BNIA 1KWIA 2ZA4A 5EQLA 2CIUA 3NHXA 4XB5A 1Y4KA 4HVNA 3K7CA 4X2HA 1E3VA 3NV0B 3S29A 3WOEB 5JBSA 3S67A 3B8LA 2L4VA 3IJEB 1B21A 2XF3A 4OK0A 2OOVA 1KD14 2H0GA 3EN1B 3N54B 4BL2A 3UJMA 1FGQA 3D5IA 2HMLB 3KZTA 2M7OA 3URPA 3U97A 6RNTA 1F8NA 2C4BA 3BU4A 3MYTA 3LT8A 1YHQ3 2FNQA 4ILFA 1L5GB 3SX1A 1RGGA 4ZM8A 1BRIA 1DYUA 5IG0A 2GU1A 3LTAA 1I3IA 3S5CA 1IQ8A 1VQ93 2MC8A 4FMDA 1X1YA 4HZ9B 1N5PA 5STDA 2XFTA 3WR2A 4CJNA 1JV2B 1CEWI 3HIIA 4IIAA 1AVLA 1N9JA 2KF4A 3FG3A 2Z77A 3OV4A 1GMRA 1RGLA 4NPBA 3FH1A 5IERA 3WDGB 1TU5A 3X41A 2IY2A 1YNVX 2XR8B 4R4KA 2W0QA 1GOYA 3EHCA 5GSPA 1HKXA 3SOYA 2XSHB 1RRHA 1VZZA 2E2VA 2KAAA 3MG1A 4RNZA 1US1A 2UUGC 3JUOA 1MNLA 4JRFA 4HJLB 3CC43 3EF8A 4G1MB 3GZRA 1JB5A 1LNIA 3M8CA 3UL6A 7RNTA 3DGNA 3I0YA 2W2CA 3CCS3 3GSPA 3X40A 4BTYA 1BUQA 1FW7A 1NU3A 2C11A 5EVHA 2YFLB 1YI23 1YVSA 1CQSA 4HYZA 3AHWA 1UI8A 5ELJA 3PYJA 1UI7A 1RGEA 3N8BA 3NBBA 1DVCA 2H0HA 3U1WA 1DMQA 1W02A 2XRXB 1I70A 1SARA 1JRQA 3AGNA 3F9SA 3N9HA 1O7NB 3EJVA 5FGOA 2IUJA 4AKYA 6STDA 2R41A 5IF6A 3ZFZA 5IEPA 4KFDA 2B24B 1FA3A 1Q7HA 3FSDA 2QEX3 1W6YA 3FZWA 1NWWA 3DGOA 7GSPA 3I553 1UUGB 4N6MA 1BIRA 1OUNA 2KF6A 2P09A 1OH0A 2CH9A 1UUWB 1OGXA 2OQEC 3GWRA 3SVAA 1ULIB 3B4OA 3DMCA 2XH9A 3CPW2 2SARA 8CHOA 1MWSA 2W6JH 3EX9A 1VQ63 3OX9A 3OWYA 1O7WB 5CF1A 1SIHA 2HMKB 3BLZA 1UW1A 3A76A 1W6GA 3DH2A 3HX8A 5A0OB 3CC23 2E2UA 3WHOA 2W56B 1G0TA 3BB9A 1Q40B 1RHLA 3EE1A 4WP5A 1RLSA 2L1SA 3CC73 3LTBA 5G2GA 1IVVA 2Z6BA 3CNXA 4X2OA 5JPUA 2Y74A 1SPUA 7STDA 1JB4A 1M1K4 3EB8A 1ROAA 4J8TA 2K54A 2SBLA 1IT8A 1HYFA 2XGNA 3K9MC 1N8QA 3ZG5A 1RGCA 1LQGC 1UCKA 1BU4A 2HMJB 2RBIA 3JUQA 1TTOA 3Q3FA 4NREA 3RGAA 1HZ1A 4O3VA 1R4CA 2BMRB 5JPPA 1BUJA 1RKYA 1CYVA 2ML6A 3RNTA 1G96A 2OTJ3 1ASKA 1I0XA 4BIRA 1NO3A 1DETA 4TX4A 1G02A 1AV4A 5LC7A 3FGYA 2WOFA 3D4AA 3RDEA 3VSYA 1STDA 2KF3A 2IMJA 4R80A 5LC6A 4HM8B 1LQMB 4RNYA 1V74A 1RCKA 3CXC2 3HIGA 5AIIA 2CFKA 5I97A 1RNTA 3IMAB 4KVHA 5AEWB 5KP4A 1OPYA 1IQYA 2LYXA 3PS8A 1BRJA 1GD4A 1ULJB 2W56A 2PZVA 3F40A 4HM0B 1A2PA 2O9UX 4K1VA 2BNGA 1IVUA 1EEJA 2KF5A 3Q90A 4R9LA 2P38A 3JVCA 1I2FA 3EN8A 1Q824 1ZS7A 1X1XA 1BRGA 3X3ZA 4STDA 5RNTA 2A15A 2F5MA 3S28A 2ZDJA 3NX0A 4L7KA 4KZ1A 3MPHA 3D3LA 1N9EA 1RN1A 4J5KA 4MMXB 3WMDA 2K3DA 2IUKA 2Z7AA 2W04A 3KFQC 1C54A 2ML5A 4EYCA 2QA43 1SJWA 3F8HA 1W4NA 1ROVA 3CU3A 2QIYA 3LMLA 2P0XA 4CDLA 4IPBA 2CWVA 3J7Yd 5M18A 2K0MA 3V98A 2CWUA 1GMQA 1BSCA 1RGFA 1C7HA 2ZHXB 1BNRA 5IW9A 1BSEA 3EBTA 3DM8A 1IVWA 4XDVA 1JZOA 2JQ5A 1J2BA 1GOUA 3FKAA 1JBRA 2CKFB 4MMZB 3SLUA 4N6UA 3CCM3 1CYUA 1WMNA 9RNTA 3GZYB 3KCHA 1IVXA 3LTDA 2Q07A 2H0IA 2XSOB 3CNMA 1YVBI 1OHPA 4N6TA 1BVIA 3LOYA 3VF1A 2MF7A 1I3FA 1B2SA 1FGTA 4MMYB 3DZLA 3CCU3 3AHSA 1LRAA 4N3VA 1O7MB 5TGNA 5CLKA 2CX0A 5KP1A
chains in the Genus database with same CATH topology
1FGMA 1KSIA 1D6YA 3GAXA 3G6E3 1DMNA 1Q40A 2CFLA 2YX9A 3OXAA 4HZBB 5AIHA 1IU7A 3NXJA 3CPOA 4J9AA 1W2B2 2OTL3 1O7PB 2WGOA 2OCTA 3JUNA 2F99A 2GBWB 3L0RA 3NBJA 3K0ZA 4HBRA 3NUVA 3WODG 4FR9A 4LZIA 5BVBA 4FCZA 5KP3A 5DREA 1A2KA 1QJGA 1UUVB 1N5HA 1AVKA 3GZXB 4L8PA 1LNHA 3BNCA 3O8YA 1TP6A 3X3XA 3F7XA 3MG2A 1LXEA 1K41A 1U8CB 3UL5A 4FMCA 1OF5A 3LZAA 1LVNA 1A67A 2I9WA 1GYBA 3KSPA 5CF2A 3LT9A 1JKGB 3UNLA 3HZPA 3VGNA 1VQ53 1VQ43 2HMMB 1W2ZA 3CCL3 3HK4A 3G713 2CC3A 1O7GB 3LH4A 3FG1A 1STFI 4HM5B 1KQS2 3MHEA 4R9KA 1K28A 3GZBA 1E97A 2CFGA 3OW22 1IV9A 3IPTA 3KN4A 2F86B 1K734 3H3HA 1GD3A 1GY5A 2OWPA 3T0UA 1WTHA 1Z1SA 3D9RA 5D83A 3F8XA 1EG9B 2GU3A 5IEOA 4NHFA 1YJN3 1WNHA 1FUWA 4WYKA 3WOFB 2OOVC 2XEPA 1JNQA 4QWTA 4FCJA 4HM6B 4N6NB 4HM2B 2XFSA 1GY7A 4XBYA 3KKGA 5HGRA 4HKVB 2Y73A 2INXA 2W9PA 3B4PA 3Q2PA 1K9M4 2V1LA 1NB3I 3F14A 3MKIA 2BHMA 1M1XB 2OQEA 2STDA 4EBGA 3NV0A 2CFDA 3RGRA 5AIGA 5ELUA 3V92A 5CK6A 1NDOB 4JF8A 2YFJB 1VQO3 1EKMA 3EBYA 3Q1CA 1DMMA 1VQ73 1YIT3 1JN5B 3CCJ3 3HI7A 1E3RA 3S27A 4BTXA 3G4S3 3DUKA 2W9QA 3KIIA 4L8OA 4WFOA 4EC6A 3DXOA 3DGMA 3DGLA 3CD63 1OHOA 3NQZA 3OWSA 2BT3A 2QGUA 3KSED 2CHCA 1VQP3 1KC84 2CW9A 3PCSA 1VQM3 3LTCA 3STDA 3BNEA 2E2TA 1JB2A 2R4IA 4ORLA 3PGBA 2WGQA 2P05A 2KRTA 1RJOA 5D81A 1VQ83 3FCSB 1JJ22 3EC9A 2YFIB 3G0KA 3FF0A 4LEHA 1A90A 1OCVA 5BXQA 2WOHA 4LMIA 4O8SA 2D1WA 1S5AA 3X3YA 2D42A 3F7SA 4FMAA 3KE7A 3GRDA 3WA2X 1NB5I 3V99A 1EA2A 3QK9A 4CCVA 1YGEA 2CG0A 4O2HA 3CCE3 1A2VA 4K61A 2BMQB 1RN7A 2PNCA 1SIIA 3JUPA 4FCMA 4EXRA 4N6OB 3T8UA 2W03A 4RZMA 5AEUB 1Q7Y4 1U5OA 3PXMA 4HM7B 4RBNA 1YJ93 4WWUC 2C10A 1IDPA 2ZL8A 3PCRA 1AR0A 3OWUA 1NJI4 2LQVA 1FGRA 4OUQA 3WA3A 4H3UA 3ALAA 1GS3A 4KFFA 3FF2A 2Z76A 2GEYA 3JUMA 1O7HB 2WO0A 3PZWA 1W5ZA 3DY5A 4OVMA 1K8A4 1SQWA 4K1UA 4U13A 2FGTA 1TFOA 1QMAA 2CWTA 4I4KA 1EQKA 3CCQ3 4WHAA 3EQQB 1FGOA 3X42A 1TIJA 2RCDA 2CG1A 3AMOA 3K5TA 4HM3B 2F98A 1YJW3 1Q864 4LGQA 3CCR3 3FLJA 1OF5B 1W7CA 3MG3A 2XGLA 5FW5A 5CXOA 1WQLB 1IK3A 4XDWA 1IT7A 1LOXA 4EV5A 4WYKB 1W6CA 1IV7A 1QVG2 2O3OA 3ECFA 1QAFA 1M904 1PFPA 1DVDA 3T8NA 1QVF2 3LXUX 1Q814 1OGZA 2HMNB 1JN5A 3NBRA 1HU9A 1N8R4 2CK3H 1OACA 1OHSA 4GB5A 4HM4B 1M9GA 3LYGA 3NM7A 5IG3A 4XBXA 3CCV3 4N6V0 3I563 2RGQA 2KCDA 1VQL3 1WMOA 1JKGA 2GEXA 5IENA 3NQYA 1MOLA 1YIJ3 4HM1B 3BNDA 3BNBA 1S723 1W01A 3H51A 1QALA 3MSOA 4XBTA 3UB1A 5AI1A 5DRVA 5AYRB 1IQXA 2KXGA 2BMOB 3SEDA 4GL6A 3G16A 3SOAA 4FMBA 4MJDA 1ISKA 2P0MA 3ROBA 2GBXB 4H61A 1Q42A 4N6LA 1TFKA 1QAKA 1GY6A 2GXFA 4PEJA 1W00A 3NM2A 3TDGA 4IT7A 1D6ZA 2JDIH 5AYSC 1VQK3 3CME3 3CMA3 2B1XB 3B7CA 4K90B 4AKZA 4BTWA 2RFRA 1D6UA 4KFEA 3SXXA 4MEIA 5AIFA 4AEQA 4EV2A 1TUHA 4XM4A 1ZX2A 3FG4A 2BO9B 3QRDA 3AMOB 1WMPA 4O02B 1ZO2A 4Q53A 5IG4A 3E99A 3K63A 2FXTA 3MWZA 4R1KA 2RSXA 1PU4A 5D82A 1VQN3 1RRLA 3ER7A 1T5YA 2CFWA 2HMOB 4LSOA 3G8ZA 2IA7A 5EEOA 2UX0A 5EQLA 1KWIA 2CIUA 3NHXA 4XB5A 1Y4KA 4HVNA 3K7CA 4X2HA 1E3VA 3NV0B 3S29A 3WOEB 5JBSA 3S67A 3B8LA 2L4VA 3IJEB 2XF3A 4OK0A 2OOVA 1KD14 3EN1B 3N54B 3UJMA 1FGQA 3KZTA 2HMLB 2M7OA 3U97A 1F8NA 3MYTA 1YHQ3 3LT8A 2FNQA 1L5GB 3SX1A 4ZM8A 1DYUA 5IG0A 2GU1A 3LTAA 3S5CA 1IQ8A 1VQ93 2MC8A 4FMDA 4HZ9B 1N5PA 5STDA 2XFTA 1JV2B 1CEWI 3HIIA 4IIAA 1AVLA 1N9JA 3FG3A 3OV4A 2Z77A 3FH1A 5IERA 3WDGB 1TU5A 3X41A 3SOYA 2XR8B 4R4KA 2W0QA 3EHCA 1HKXA 2XSHB 1RRHA 1VZZA 2E2VA 3MG1A 4RNZA 1US1A 3JUOA 1MNLA 4JRFA 4HJLB 3CC43 3EF8A 4G1MB 3GZRA 1JB5A 3M8CA 3UL6A 3DGNA 3I0YA 2W2CA 3CCS3 3X40A 4BTYA 1BUQA 1NU3A 2C11A 5EVHA 2YFLB 1YI23 1CQSA 4HYZA 1UI8A 5ELJA 3PYJA 1UI7A 3N8BA 3NBBA 1DVCA 3U1WA 1DMQA 1W02A 2XRXB 3N9HA 5FGOA 1JRQA 3F9SA 4AKYA 2IUJA 1O7NB 3EJVA 6STDA 5IF6A 5IEPA 4KFDA 2B24B 1FA3A 3FSDA 2QEX3 1W6YA 3FZWA 1NWWA 3DGOA 3I553 4N6MA 1OUNA 2P09A 3GWRA 1OH0A 2CH9A 1UUWB 1OGXA 2OQEC 3SVAA 1ULIB 3B4OA 3DMCA 2XH9A 3CPW2 8CHOA 2W6JH 3EX9A 1VQ63 3OX9A 3OWYA 1O7WB 5CF1A 1SIHA 2HMKB 3BLZA 1UW1A 3A76A 1W6GA 3HX8A 5A0OB 3CC23 2E2UA 2W56B 3BB9A 1Q40B 3EE1A 4WP5A 3CC73 3LTBA 5G2GA 1IVVA 2Z6BA 3CNXA 4X2OA 5JPUA 2Y74A 1SPUA 7STDA 1JB4A 1M1K4 3EB8A 1ROAA 4J8TA 2K54A 2SBLA 1IT8A 2XGNA 3K9MC 1N8QA 3RGAA 2HMJB 3JUQA 4NREA 4O3VA 1R4CA 2BMRB 5JPPA 1RKYA 1CYVA 2ML6A 1G96A 2OTJ3 1ASKA 1NO3A 4TX4A 1AV4A 5LC7A 3FGYA 2WOFA 3VSYA 3RDEA 1STDA 2IMJA 4R80A 5LC6A 4HM8B 4RNYA 1V74A 3CXC2 3HIGA 5AIIA 2CFKA 5I97A 3IMAB 4KVHA 5AEWB 5KP4A 1OPYA 1IQYA 2LYXA 3PS8A 1GD4A 1ULJB 2W56A 2PZVA 3F40A 4HM0B 2O9UX 4K1VA 2BNGA 1IVUA 4R9LA 3Q90A 2P38A 3JVCA 3EN8A 1Q824 3X3ZA 4STDA 2A15A 3S28A 2ZDJA 3NX0A 4L7KA 4KZ1A 3MPHA 3D3LA 1N9EA 4MMXB 3WMDA 2Z7AA 2IUKA 3KFQC 2W04A 2ML5A 4EYCA 2QA43 1SJWA 3F8HA 1W4NA 1ROVA 3CU3A 2QIYA 3LMLA 2P0XA 4CDLA 4IPBA 2CWVA 3J7Yd 2K0MA 3V98A 2CWUA 1C7HA 5IW9A 3EBTA 3DM8A 1IVWA 4XDVA 2JQ5A 1J2BA 3FKAA 2CKFB 4MMZB 3SLUA 4N6UA 3CCM3 1CYUA 1WMNA 3GZYB 1IVXA 3LTDA 2Q07A 2XSOB 3CNMA 1YVBI 1OHPA 4N6TA 3LOYA 3VF1A 2MF7A 1FGTA 4MMYB 3DZLA 3CCU3 4N3VA 1O7MB 5TGNA 5CLKA 5IG5A 5KP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4O A;  3DMC A;  8CHO A;  1JB2 A;  2GBX B;  2R4I A;  1Q42 A;  1DMN A;  1Q40 A;  3EX9 A;  3OX9 A;  1GY6 A;  2GXF A;  3OWY A;  1O7W B;  4PEJ A;  1W00 A;  3BLZ A;  2HMK B;  3NM2 A;  3OXA A;  4HZB B;  5CF1 A;  5AIH A;  3A76 A;  3NXJ A;  3CPO A;  4J9A A;  2B1X B;  5D81 A;  1O7P B;  3HX8 A;  3JUN A;  2F99 A;  3B7C A;  2GBW B;  2RFR A;  3BB9 A;  2YFI B;  3EC9 A;  3FF0 A;  3G0K A;  3K0Z A;  1Q40 B;  3NUV A;  4LEH A;  4WP5 A;  5BVB A;  5JPP A;  1OCV A;  5AIF A;  5KP3 A;  5BXQ A;  5G2G A;  1TUH A;  4LMI A;  1A2K A;  5DRE A;  4XM4 A;  3CNX A;  1QJG A;  1ZX2 A;  1UUV B;  1S5A A;  4X2O A;  5JPU A;  7STD A;  1JB4 A;  3GZX B;  3F7S A;  4L8P A;  4J8T A;  2K54 A;  1ZO2 A;  4Q53 A;  3KE7 A;  3E99 A;  5IG4 A;  1TP6 A;  3GRD A;  3F7X A;  3MG2 A;  1K41 A;  1EA2 A;  3RGA A;  1OF5 A;  2HMJ B;  3JUQ A;  3LZA A;  4R1K A;  2BMR B;  2BMQ B;  2I9W A;  1GYB A;  3JUP A;  4FCM A;  5D82 A;  3KSP A;  3ER7 A;  5CF2 A;  2HMO B;  1JKG B;  3G8Z A;  1ASK A;  5CLK A;  3UNL A;  3HZP A;  3VGN A;  2UX0 A;  3T8U A;  4RZM A;  2HMM B;  3NHX A;  4XB5 A;  5AEU B;  4HVN A;  3HK4 A;  1U5O A;  4HM7 B;  3FGY A;  3K7C A;  1E3V A;  3NV0 B;  4X2H A;  1O7G B;  4WWU C;  3VSY A;  1IDP A;  3B8L A;  1AR0 A;  1STD A;  2IMJ A;  4HM5 B;  3OWU A;  4HM8 B;  4OUQ A;  3MHE A;  4H3U A;  5AII A;  4R9K A;  3EN1 B;  1GS3 A;  3GZB A;  1E97 A;  2HML B;  2Z76 A;  3FF2 A;  3KZT A;  4KVH A;  2GEY A;  3JUM A;  5AEW B;  1O7H B;  3IPT A;  1OPY A;  5IG5 A;  5KP4 A;  4OVM A;  2F86 B;  4MJD A;  4K1U A;  3MYT A;  3H3H A;  4U13 A;  1QMA A;  4I4K A;  1GY5 A;  1ULJ B;  2OWP A;  3F40 A;  1Z1S A;  2PZV A;  3D9R A;  4HM0 B;  3EQQ B;  3F8X A;  4K1V A;  5D83 A;  2BNG A;  5IG0 A;  3UJM A;  4R9L A;  2RCD A;  3Q90 A;  1EG9 B;  5IEO A;  3S5C A;  3ROB A;  3EN8 A;  4HZ9 B;  4HM3 B;  5STD A;  2F98 A;  4STD A;  2A15 A;  4WYK A;  4IIA A;  4LGQ A;  3OV4 A;  3FLJ A;  1OF5 B;  2Z77 A;  3MG3 A;  5FW5 A;  4L7K A;  1WQL B;  5CXO A;  4XDW A;  4FCJ A;  1UUW B;  3FH1 A;  4HM2 B;  4HM6 B;  3WMD A;  4ORL A;  4WYK B;  2Z7A A;  5IER A;  1GY7 A;  3SOY A;  4XBY A;  2XR8 B;  1SJW A;  3F8H A;  5TGN A;  3EHC A;  3CU3 A;  1HKX A;  3ECF A;  2XSH B;  1VZZ A;  3KKG A;  3MG1 A;  2QIY A;  5HGR A;  3T8N A;  4HKV B;  3JUO A;  4CDL A;  1OGZ A;  2HMN B;  2INX A;  4HJL B;  3B4P A;  3EF8 A;  5KP1 A;  1JN5 A;  3GZR A;  3NBR A;  1JB5 A;  3M8C A;  3MKI A;  3F14 A;  1C7H A;  1OHS A;  2STD A;  4GB5 A;  3I0Y A;  2W2C A;  3NV0 A;  4HM4 B;  3RGR A;  3LYG A;  3EBT A;  3DM8 A;  4XDV A;  1BUQ A;  1NU3 A;  2JQ5 A;  5AIG A;  5EVH A;  4XBX A;  5CK6 A;  5IG3 A;  1NDO B;  2RGQ A;  3FKA A;  2YFL B;  2YFJ B;  1CQS A;  3EBY A;  1DMM A;  2CKF B;  1JKG A;  2GEX A;  1ISK A;  5IEN A;  1JN5 B;  1DMQ A;  1W02 A;  1E3R A;  2XRX B;  3F9S A;  3GZY B;  6STD A;  5IF6 A;  1O7N B;  3DUK A;  3EJV A;  4L8O A;  4HM1 B;  2XSO B;  3DXO A;  1W01 A;  3CNM A;  1OHP A;  3H51 A;  3MSO A;  2B24 B;  4XBT A;  5IEP A;  3FSD A;  5AI1 A;  5DRV A;  1W6Y A;  1OHO A;  3DZL A;  3FZW A;  1NWW A;  3OWS A;  2BMO B;  2QGU A;  3SED A;  1OUN A;  2CHC A;  3G16 A;  1O7M B;  1OGX A;  1OH0 A;  3GWR A;  4N3V A;  3SOA A;  3STD A;  1ULI B; 
#chains in the Genus database with same CATH topology
 1FGM A;  1KSI A;  1D6Y A;  5HOH A;  3GAX A;  5BIR A;  3G6E 3;  1DMN A;  1Q40 A;  2CFL A;  2YX9 A;  3OXA A;  4HZB B;  5AIH A;  1IU7 A;  3NXJ A;  3CPO A;  4J9A A;  5G1L A;  1W2B 2;  1O7P B;  2WGO A;  2OCT A;  3JUN A;  2OTL 3;  2F99 A;  2GBW B;  3L0R A;  3NBJ A;  3K0Z A;  4HBR A;  3NUV A;  3WOD G;  4FR9 A;  4LZI A;  5BVB A;  4FCZ A;  5KP3 A;  5DRE A;  1A2K A;  2CX1 A;  1QJG A;  1UUV B;  1BAO A;  1N5H A;  1AVK A;  1ZGX A;  3GZX B;  4L8P A;  1LNH A;  3BNC A;  3O8Y A;  1RGH A;  1TP6 A;  3X3X A;  3F7X A;  3MG2 A;  1LXE A;  1K41 A;  1U8C B;  4KT3 B;  3UL5 A;  4FMC A;  1R4Y A;  1OF5 A;  3LZA A;  1LVN A;  1A67 A;  2I9W A;  1GYB A;  3KSP A;  5CF2 A;  1UGI A;  3LT9 A;  1JKG B;  3SYU A;  3UNL A;  3HZP A;  3VGN A;  5M1A A;  3BIR A;  1VQ4 3;  2HMM B;  1VQ5 3;  1W2Z A;  3CCL 3;  3HK4 A;  3G71 3;  1BNS A;  2CC3 A;  2IYJ A;  1O7G B;  3LH4 A;  3FG1 A;  1STF I;  1V57 A;  4HM5 B;  2RNT A;  5M19 A;  1UCI A;  1PYL A;  1KQS 2;  3MHE A;  1T3B A;  3ZG0 A;  1TRQ A;  1K28 A;  4R9K A;  3GZB A;  1E97 A;  2CFG A;  5IG5 A;  3OW2 2;  1IV9 A;  3IPT A;  2AAD A;  3KN4 A;  2F86 B;  1K73 4;  3H3H A;  1GD3 A;  1GY5 A;  2OWP A;  1RGA A;  3T0U A;  1WTH A;  1Z1S A;  3D9R A;  5D83 A;  1VQQ A;  3F8X A;  1EG9 B;  2GU3 A;  5IEO A;  4NHF A;  1YJN 3;  1BGS A;  1WNH A;  1FUW A;  1UCL A;  1RTU A;  1BSB A;  4WYK A;  4BL3 A;  3WOF B;  1LOW A;  2OOV C;  2XEP A;  1JNQ A;  4QWT A;  1YGW A;  4FCJ A;  4RNT A;  4HM6 B;  4N6N B;  4HM2 B;  4EW5 A;  2XFS A;  1GY7 A;  1EUI C;  4XBY A;  4DKI A;  3KKG A;  5HGR A;  4HKV B;  2Y73 A;  3HOH A;  2INX A;  1B3S A;  2W9P A;  3B4P A;  3Q2P A;  1K9M 4;  2V1L A;  1NB3 I;  3F14 A;  1GMP A;  2BHM A;  3D5G A;  3MKI A;  1FZU A;  1M1X B;  2OQE A;  2STD A;  4EBG A;  3NV0 A;  3D79 A;  2CFD A;  3RGR A;  3AGO A;  5AIG A;  5ELU A;  3V92 A;  5CK6 A;  1NDO B;  4JF8 A;  2YFJ B;  1VQO 3;  1EKM A;  3EBY A;  3Q1C A;  1DMM A;  1VQ7 3;  1YIT 3;  1JN5 B;  4BU4 A;  3CCJ 3;  3HI7 A;  1E3R A;  5G1K A;  3S27 A;  4BTX A;  1FUT A;  3G4S 3;  3DUK A;  2W9Q A;  1B27 A;  3KII A;  4L8O A;  4WFO A;  4EC6 A;  1I2E A;  3DXO A;  2AAE A;  1AQZ A;  3DGM A;  3DGL A;  3CD6 3;  1OHO A;  1UDI I;  3NQZ A;  2GSP A;  3OWS A;  1BSD A;  2BT3 A;  2QGU A;  3KSE D;  2CHC A;  1VQP 3;  1KC8 4;  2CW9 A;  3PCS A;  4HOH A;  1VQM 3;  3LTC A;  3STD A;  3BNE A;  2E2T A;  1JB2 A;  2R4I A;  4ORL A;  3PGB A;  2WGQ A;  2P05 A;  2KRT A;  1RJO A;  5D81 A;  1VQ8 3;  3FCS B;  1JJ2 2;  1BRK A;  3EC9 A;  2YFI B;  3G0K A;  3FF0 A;  4LEH A;  1A90 A;  2F5W A;  1OCV A;  5BXQ A;  2WOH A;  1RMS A;  4LMI A;  1FUS A;  2D1W A;  1RSN A;  1TRP A;  4O8S A;  1S5A A;  1CH0 A;  2D42 A;  3X3Y A;  3F7S A;  4I5Q A;  4FMA A;  1BOX A;  1JBS A;  3A5E A;  1TJD A;  3KE7 A;  3GRD A;  3WA2 X;  1NB5 I;  3V99 A;  1EA2 A;  3QK9 A;  4CCV A;  1YGE A;  2CG0 A;  4O2H A;  1MWT A;  3CCE 3;  1A2V A;  1LOV A;  4K61 A;  2BMQ B;  1RN7 A;  2PNC A;  1SII A;  3JUP A;  4FCM A;  4EXR A;  1DE3 A;  4N6O B;  1BNG A;  1RN4 A;  3T8U A;  2W03 A;  4RZM A;  5AEU B;  1Q7Y 4;  1U5O A;  3PXM A;  4HM7 B;  4RBN A;  1YJ9 3;  4WWU C;  2C10 A;  1IDP A;  2ZL8 A;  3PCR A;  1AR0 A;  1BNF A;  1X1W A;  2BU4 A;  1BAN A;  1GOV A;  3OWU A;  1NJI 4;  2LQV A;  1FGR A;  4OUQ A;  5BU4 A;  3WA3 A;  4H3U A;  3ALA A;  1GS3 A;  2F4Y A;  3FF2 A;  4KFF A;  2Z76 A;  2GEY A;  3JUM A;  1O7H B;  2WO0 A;  3PZW A;  1W5Z A;  3DY5 A;  1MGR A;  4OVM A;  1RGK A;  1SQW A;  4K1U A;  4U13 A;  2FGT A;  1K8A 4;  1TFO A;  1QMA A;  1X1U A;  2CWT A;  4I4K A;  1EQK A;  3CCQ 3;  4WHA A;  3EQQ B;  1FGO A;  3X42 A;  1LOY A;  1TIJ A;  2RCD A;  1V58 A;  2CG1 A;  3AMO A;  3K5T A;  1JZD A;  2F98 A;  4HM3 B;  1YJW 3;  1Q86 4;  1UGH I;  4LGQ A;  3CCR 3;  3FLJ A;  1OF5 B;  1W7C A;  3MG3 A;  1RNB A;  2XGL A;  5FW5 A;  5CXO A;  1WQL B;  1IK3 A;  4XDW A;  1IT7 A;  1LOX A;  4EV5 A;  1MGW A;  1BNJ A;  4WYK B;  1W6C A;  1IV7 A;  1QVG 2;  2O3O A;  4CPK A;  1JBT A;  3ECF A;  1QAF A;  1M90 4;  1PFP A;  1DVD A;  3T8N A;  1QVF 2;  3LXU X;  1Q81 4;  1NNV A;  1I2G A;  1OGZ A;  1AY7 A;  2HMN B;  1IYY A;  1JN5 A;  3NBR A;  1BSA A;  1HU9 A;  1N8R 4;  2CK3 H;  1OAC A;  1OHS A;  2F56 A;  4GB5 A;  4HM4 B;  1M9G A;  3LYG A;  2J8X B;  3NM7 A;  4HAA A;  8RNT A;  5IG3 A;  4XBX A;  3CCV 3;  4N6V 0;  4GSP A;  3I56 3;  2RGQ A;  2KCD A;  1VQL 3;  1WMO A;  1JKG A;  2GEX A;  1MWU A;  6GSP A;  1B2M A;  5IEN A;  1BRN L;  3NQY A;  1MOL A;  1YIJ 3;  4HM1 B;  3BND A;  1BRS A;  3BNB A;  1B2Z A;  1W01 A;  3H51 A;  1QAL A;  3MSO A;  4XBT A;  3UB1 A;  2UGI A;  1S72 3;  5AI1 A;  1B2X A;  5DRV A;  5AYR B;  1IQX A;  2KXG A;  4LYL B;  2BMO B;  3SED A;  4GL6 A;  1PY3 A;  3G16 A;  3SOA A;  4FMB A;  1Q9E A;  4MJD A;  2P0M A;  1ISK A;  3ROB A;  1I8V A;  1B2U A;  2HOH A;  2GBX B;  4H61 A;  1Q42 A;  4N6L A;  1TFK A;  1QAK A;  1GY6 A;  2GXF A;  4PEJ A;  1W00 A;  3NM2 A;  1B20 A;  3TDG A;  4IT7 A;  1D6Z A;  2JDI H;  5AYS C;  1VQK 3;  3CME 3;  3CMA 3;  2B1X B;  3B7C A;  4K90 B;  4AKZ A;  4BTW A;  2BIR A;  2RFR A;  4J5G A;  1D6U A;  4KFE A;  1GSP A;  1UCJ A;  3SXX A;  4MEI A;  5AIF A;  4AEQ A;  1T2H A;  1TUH A;  4EV2 A;  4XM4 A;  4GHO A;  1ZX2 A;  1BNE A;  3FG4 A;  1RDS A;  2BO9 B;  3QRD A;  1FYS A;  3AMO B;  1WMP A;  4O02 B;  1ZO2 A;  4Q53 A;  5IG4 A;  3E99 A;  3K63 A;  2FXT A;  3MWZ A;  1I0V A;  4R1K A;  1BRH A;  3DGY A;  2RSX A;  1PU4 A;  1RCL A;  5D82 A;  1VQN 3;  1RRL A;  3ER7 A;  1T5Y A;  2CFW A;  2HMO B;  4LSO A;  3G8Z A;  2IA7 A;  5EEO A;  1MWR A;  1T2I A;  2UX0 A;  1BNI A;  1KWI A;  2ZA4 A;  5EQL A;  2CIU A;  3NHX A;  4XB5 A;  1Y4K A;  4HVN A;  3K7C A;  4X2H A;  1E3V A;  3NV0 B;  3S29 A;  3WOE B;  5JBS A;  3S67 A;  3B8L A;  2L4V A;  3IJE B;  1B21 A;  2XF3 A;  4OK0 A;  2OOV A;  1KD1 4;  2H0G A;  3EN1 B;  3N54 B;  4BL2 A;  3UJM A;  1FGQ A;  3D5I A;  2HML B;  3KZT A;  2M7O A;  3URP A;  3U97 A;  6RNT A;  1F8N A;  2C4B A;  3BU4 A;  3MYT A;  3LT8 A;  1YHQ 3;  2FNQ A;  4ILF A;  1L5G B;  3SX1 A;  1RGG A;  4ZM8 A;  1BRI A;  1DYU A;  5IG0 A;  2GU1 A;  3LTA A;  1I3I A;  3S5C A;  1IQ8 A;  1VQ9 3;  2MC8 A;  4FMD A;  1X1Y A;  4HZ9 B;  1N5P A;  5STD A;  2XFT A;  3WR2 A;  4CJN A;  1JV2 B;  1CEW I;  3HII A;  4IIA A;  1AVL A;  1N9J A;  2KF4 A;  3FG3 A;  2Z77 A;  3OV4 A;  1GMR A;  1RGL A;  4NPB A;  3FH1 A;  5IER A;  3WDG B;  1TU5 A;  3X41 A;  2IY2 A;  1YNV X;  2XR8 B;  4R4K A;  2W0Q A;  1GOY A;  3EHC A;  5GSP A;  1HKX A;  3SOY A;  2XSH B;  1RRH A;  1VZZ A;  2E2V A;  2KAA A;  3MG1 A;  4RNZ A;  1US1 A;  2UUG C;  3JUO A;  1MNL A;  4JRF A;  4HJL B;  3CC4 3;  3EF8 A;  4G1M B;  3GZR A;  1JB5 A;  1LNI A;  3M8C A;  3UL6 A;  7RNT A;  3DGN A;  3I0Y A;  2W2C A;  3CCS 3;  3GSP A;  3X40 A;  4BTY A;  1BUQ A;  1FW7 A;  1NU3 A;  2C11 A;  5EVH A;  2YFL B;  1YI2 3;  1YVS A;  1CQS A;  4HYZ A;  3AHW A;  1UI8 A;  5ELJ A;  3PYJ A;  1UI7 A;  1RGE A;  3N8B A;  3NBB A;  1DVC A;  2H0H A;  3U1W A;  1DMQ A;  1W02 A;  2XRX B;  1I70 A;  1SAR A;  1JRQ A;  3AGN A;  3F9S A;  3N9H A;  1O7N B;  3EJV A;  5FGO A;  2IUJ A;  4AKY A;  6STD A;  2R41 A;  5IF6 A;  3ZFZ A;  5IEP A;  4KFD A;  2B24 B;  1FA3 A;  1Q7H A;  3FSD A;  2QEX 3;  1W6Y A;  3FZW A;  1NWW A;  3DGO A;  7GSP A;  3I55 3;  1UUG B;  4N6M A;  1BIR A;  1OUN A;  2KF6 A;  2P09 A;  1OH0 A;  2CH9 A;  1UUW B;  1OGX A;  2OQE C;  3GWR A;  3SVA A;  1ULI B;  3B4O A;  3DMC A;  2XH9 A;  3CPW 2;  2SAR A;  8CHO A;  1MWS A;  2W6J H;  3EX9 A;  1VQ6 3;  3OX9 A;  3OWY A;  1O7W B;  5CF1 A;  1SIH A;  2HMK B;  3BLZ A;  1UW1 A;  3A76 A;  1W6G A;  3DH2 A;  3HX8 A;  5A0O B;  3CC2 3;  2E2U A;  3WHO A;  2W56 B;  1G0T A;  3BB9 A;  1Q40 B;  1RHL A;  3EE1 A;  4WP5 A;  1RLS A;  2L1S A;  3CC7 3;  3LTB A;  5G2G A;  1IVV A;  2Z6B A;  3CNX A;  4X2O A;  5JPU A;  2Y74 A;  1SPU A;  7STD A;  1JB4 A;  1M1K 4;  3EB8 A;  1ROA A;  4J8T A;  2K54 A;  2SBL A;  1IT8 A;  1HYF A;  2XGN A;  3K9M C;  1N8Q A;  3ZG5 A;  1RGC A;  1LQG C;  1UCK A;  1BU4 A;  2HMJ B;  2RBI A;  3JUQ A;  1TTO A;  3Q3F A;  4NRE A;  3RGA A;  1HZ1 A;  4O3V A;  1R4C A;  2BMR B;  5JPP A;  1BUJ A;  1RKY A;  1CYV A;  2ML6 A;  3RNT A;  1G96 A;  2OTJ 3;  1ASK A;  1I0X A;  4BIR A;  1NO3 A;  1DET A;  4TX4 A;  1G02 A;  1AV4 A;  5LC7 A;  3FGY A;  2WOF A;  3D4A A;  3RDE A;  3VSY A;  1STD A;  2KF3 A;  2IMJ A;  4R80 A;  5LC6 A;  4HM8 B;  1LQM B;  4RNY A;  1V74 A;  1RCK A;  3CXC 2;  3HIG A;  5AII A;  2CFK A;  5I97 A;  1RNT A;  3IMA B;  4KVH A;  5AEW B;  5KP4 A;  1OPY A;  1IQY A;  2LYX A;  3PS8 A;  1BRJ A;  1GD4 A;  1ULJ B;  2W56 A;  2PZV A;  3F40 A;  4HM0 B;  1A2P A;  2O9U X;  4K1V A;  2BNG A;  1IVU A;  1EEJ A;  2KF5 A;  3Q90 A;  4R9L A;  2P38 A;  3JVC A;  1I2F A;  3EN8 A;  1Q82 4;  1ZS7 A;  1X1X A;  1BRG A;  3X3Z A;  4STD A;  5RNT A;  2A15 A;  2F5M A;  3S28 A;  2ZDJ A;  3NX0 A;  4L7K A;  4KZ1 A;  3MPH A;  3D3L A;  1N9E A;  1RN1 A;  4J5K A;  4MMX B;  3WMD A;  2K3D A;  2IUK A;  2Z7A A;  2W04 A;  3KFQ C;  1C54 A;  2ML5 A;  4EYC A;  2QA4 3;  1SJW A;  3F8H A;  1W4N A;  1ROV A;  3CU3 A;  2QIY A;  3LML A;  2P0X A;  4CDL A;  4IPB A;  2CWV A;  3J7Y d;  5M18 A;  2K0M A;  3V98 A;  2CWU A;  1GMQ A;  1BSC A;  1RGF A;  1C7H A;  2ZHX B;  1BNR A;  5IW9 A;  1BSE A;  3EBT A;  3DM8 A;  1IVW A;  4XDV A;  1JZO A;  2JQ5 A;  1J2B A;  1GOU A;  3FKA A;  1JBR A;  2CKF B;  4MMZ B;  3SLU A;  4N6U A;  3CCM 3;  1CYU A;  1WMN A;  9RNT A;  3GZY B;  3KCH A;  1IVX A;  3LTD A;  2Q07 A;  2H0I A;  2XSO B;  3CNM A;  1YVB I;  1OHP A;  4N6T A;  1BVI A;  3LOY A;  3VF1 A;  2MF7 A;  1I3F A;  1B2S A;  1FGT A;  4MMY B;  3DZL A;  3CCU 3;  3AHS A;  1LRA A;  4N3V A;  1O7M B;  5TGN A;  5CLK A;  2CX0 A;  5KP1 A; 
#chains in the Genus database with same CATH homology
 1FGM A;  1KSI A;  1D6Y A;  3GAX A;  3G6E 3;  1DMN A;  1Q40 A;  2CFL A;  2YX9 A;  3OXA A;  4HZB B;  5AIH A;  1IU7 A;  3NXJ A;  3CPO A;  4J9A A;  1W2B 2;  2OTL 3;  1O7P B;  2WGO A;  2OCT A;  3JUN A;  2F99 A;  2GBW B;  3L0R A;  3NBJ A;  3K0Z A;  4HBR A;  3NUV A;  3WOD G;  4FR9 A;  4LZI A;  5BVB A;  4FCZ A;  5KP3 A;  5DRE A;  1A2K A;  1QJG A;  1UUV B;  1N5H A;  1AVK A;  3GZX B;  4L8P A;  1LNH A;  3BNC A;  3O8Y A;  1TP6 A;  3X3X A;  3F7X A;  3MG2 A;  1LXE A;  1K41 A;  1U8C B;  3UL5 A;  4FMC A;  1OF5 A;  3LZA A;  1LVN A;  1A67 A;  2I9W A;  1GYB A;  3KSP A;  5CF2 A;  3LT9 A;  1JKG B;  3UNL A;  3HZP A;  3VGN A;  1VQ5 3;  1VQ4 3;  2HMM B;  1W2Z A;  3CCL 3;  3HK4 A;  3G71 3;  2CC3 A;  1O7G B;  3LH4 A;  3FG1 A;  1STF I;  4HM5 B;  1KQS 2;  3MHE A;  4R9K A;  1K28 A;  3GZB A;  1E97 A;  2CFG A;  3OW2 2;  1IV9 A;  3IPT A;  3KN4 A;  2F86 B;  1K73 4;  3H3H A;  1GD3 A;  1GY5 A;  2OWP A;  3T0U A;  1WTH A;  1Z1S A;  3D9R A;  5D83 A;  3F8X A;  1EG9 B;  2GU3 A;  5IEO A;  4NHF A;  1YJN 3;  1WNH A;  1FUW A;  4WYK A;  3WOF B;  2OOV C;  2XEP A;  1JNQ A;  4QWT A;  4FCJ A;  4HM6 B;  4N6N B;  4HM2 B;  2XFS A;  1GY7 A;  4XBY A;  3KKG A;  5HGR A;  4HKV B;  2Y73 A;  2INX A;  2W9P A;  3B4P A;  3Q2P A;  1K9M 4;  2V1L A;  1NB3 I;  3F14 A;  3MKI A;  2BHM A;  1M1X B;  2OQE A;  2STD A;  4EBG A;  3NV0 A;  2CFD A;  3RGR A;  5AIG A;  5ELU A;  3V92 A;  5CK6 A;  1NDO B;  4JF8 A;  2YFJ B;  1VQO 3;  1EKM A;  3EBY A;  3Q1C A;  1DMM A;  1VQ7 3;  1YIT 3;  1JN5 B;  3CCJ 3;  3HI7 A;  1E3R A;  3S27 A;  4BTX A;  3G4S 3;  3DUK A;  2W9Q A;  3KII A;  4L8O A;  4WFO A;  4EC6 A;  3DXO A;  3DGM A;  3DGL A;  3CD6 3;  1OHO A;  3NQZ A;  3OWS A;  2BT3 A;  2QGU A;  3KSE D;  2CHC A;  1VQP 3;  1KC8 4;  2CW9 A;  3PCS A;  1VQM 3;  3LTC A;  3STD A;  3BNE A;  2E2T A;  1JB2 A;  2R4I A;  4ORL A;  3PGB A;  2WGQ A;  2P05 A;  2KRT A;  1RJO A;  5D81 A;  1VQ8 3;  3FCS B;  1JJ2 2;  3EC9 A;  2YFI B;  3G0K A;  3FF0 A;  4LEH A;  1A90 A;  1OCV A;  5BXQ A;  2WOH A;  4LMI A;  4O8S A;  2D1W A;  1S5A A;  3X3Y A;  2D42 A;  3F7S A;  4FMA A;  3KE7 A;  3GRD A;  3WA2 X;  1NB5 I;  3V99 A;  1EA2 A;  3QK9 A;  4CCV A;  1YGE A;  2CG0 A;  4O2H A;  3CCE 3;  1A2V A;  4K61 A;  2BMQ B;  1RN7 A;  2PNC A;  1SII A;  3JUP A;  4FCM A;  4EXR A;  4N6O B;  3T8U A;  2W03 A;  4RZM A;  5AEU B;  1Q7Y 4;  1U5O A;  3PXM A;  4HM7 B;  4RBN A;  1YJ9 3;  4WWU C;  2C10 A;  1IDP A;  2ZL8 A;  3PCR A;  1AR0 A;  3OWU A;  1NJI 4;  2LQV A;  1FGR A;  4OUQ A;  3WA3 A;  4H3U A;  3ALA A;  1GS3 A;  4KFF A;  3FF2 A;  2Z76 A;  2GEY A;  3JUM A;  1O7H B;  2WO0 A;  3PZW A;  1W5Z A;  3DY5 A;  4OVM A;  1K8A 4;  1SQW A;  4K1U A;  4U13 A;  2FGT A;  1TFO A;  1QMA A;  2CWT A;  4I4K A;  1EQK A;  3CCQ 3;  4WHA A;  3EQQ B;  1FGO A;  3X42 A;  1TIJ A;  2RCD A;  2CG1 A;  3AMO A;  3K5T A;  4HM3 B;  2F98 A;  1YJW 3;  1Q86 4;  4LGQ A;  3CCR 3;  3FLJ A;  1OF5 B;  1W7C A;  3MG3 A;  2XGL A;  5FW5 A;  5CXO A;  1WQL B;  1IK3 A;  4XDW A;  1IT7 A;  1LOX A;  4EV5 A;  4WYK B;  1W6C A;  1IV7 A;  1QVG 2;  2O3O A;  3ECF A;  1QAF A;  1M90 4;  1PFP A;  1DVD A;  3T8N A;  1QVF 2;  3LXU X;  1Q81 4;  1OGZ A;  2HMN B;  1JN5 A;  3NBR A;  1HU9 A;  1N8R 4;  2CK3 H;  1OAC A;  1OHS A;  4GB5 A;  4HM4 B;  1M9G A;  3LYG A;  3NM7 A;  5IG3 A;  4XBX A;  3CCV 3;  4N6V 0;  3I56 3;  2RGQ A;  2KCD A;  1VQL 3;  1WMO A;  1JKG A;  2GEX A;  5IEN A;  3NQY A;  1MOL A;  1YIJ 3;  4HM1 B;  3BND A;  3BNB A;  1S72 3;  1W01 A;  3H51 A;  1QAL A;  3MSO A;  4XBT A;  3UB1 A;  5AI1 A;  5DRV A;  5AYR B;  1IQX A;  2KXG A;  2BMO B;  3SED A;  4GL6 A;  3G16 A;  3SOA A;  4FMB A;  4MJD A;  1ISK A;  2P0M A;  3ROB A;  2GBX B;  4H61 A;  1Q42 A;  4N6L A;  1TFK A;  1QAK A;  1GY6 A;  2GXF A;  4PEJ A;  1W00 A;  3NM2 A;  3TDG A;  4IT7 A;  1D6Z A;  2JDI H;  5AYS C;  1VQK 3;  3CME 3;  3CMA 3;  2B1X B;  3B7C A;  4K90 B;  4AKZ A;  4BTW A;  2RFR A;  1D6U A;  4KFE A;  3SXX A;  4MEI A;  5AIF A;  4AEQ A;  4EV2 A;  1TUH A;  4XM4 A;  1ZX2 A;  3FG4 A;  2BO9 B;  3QRD A;  3AMO B;  1WMP A;  4O02 B;  1ZO2 A;  4Q53 A;  5IG4 A;  3E99 A;  3K63 A;  2FXT A;  3MWZ A;  4R1K A;  2RSX A;  1PU4 A;  5D82 A;  1VQN 3;  1RRL A;  3ER7 A;  1T5Y A;  2CFW A;  2HMO B;  4LSO A;  3G8Z A;  2IA7 A;  5EEO A;  2UX0 A;  5EQL A;  1KWI A;  2CIU A;  3NHX A;  4XB5 A;  1Y4K A;  4HVN A;  3K7C A;  4X2H A;  1E3V A;  3NV0 B;  3S29 A;  3WOE B;  5JBS A;  3S67 A;  3B8L A;  2L4V A;  3IJE B;  2XF3 A;  4OK0 A;  2OOV A;  1KD1 4;  3EN1 B;  3N54 B;  3UJM A;  1FGQ A;  3KZT A;  2HML B;  2M7O A;  3U97 A;  1F8N A;  3MYT A;  1YHQ 3;  3LT8 A;  2FNQ A;  1L5G B;  3SX1 A;  4ZM8 A;  1DYU A;  5IG0 A;  2GU1 A;  3LTA A;  3S5C A;  1IQ8 A;  1VQ9 3;  2MC8 A;  4FMD A;  4HZ9 B;  1N5P A;  5STD A;  2XFT A;  1JV2 B;  1CEW I;  3HII A;  4IIA A;  1AVL A;  1N9J A;  3FG3 A;  3OV4 A;  2Z77 A;  3FH1 A;  5IER A;  3WDG B;  1TU5 A;  3X41 A;  3SOY A;  2XR8 B;  4R4K A;  2W0Q A;  3EHC A;  1HKX A;  2XSH B;  1RRH A;  1VZZ A;  2E2V A;  3MG1 A;  4RNZ A;  1US1 A;  3JUO A;  1MNL A;  4JRF A;  4HJL B;  3CC4 3;  3EF8 A;  4G1M B;  3GZR A;  1JB5 A;  3M8C A;  3UL6 A;  3DGN A;  3I0Y A;  2W2C A;  3CCS 3;  3X40 A;  4BTY A;  1BUQ A;  1NU3 A;  2C11 A;  5EVH A;  2YFL B;  1YI2 3;  1CQS A;  4HYZ A;  1UI8 A;  5ELJ A;  3PYJ A;  1UI7 A;  3N8B A;  3NBB A;  1DVC A;  3U1W A;  1DMQ A;  1W02 A;  2XRX B;  3N9H A;  5FGO A;  1JRQ A;  3F9S A;  4AKY A;  2IUJ A;  1O7N B;  3EJV A;  6STD A;  5IF6 A;  5IEP A;  4KFD A;  2B24 B;  1FA3 A;  3FSD A;  2QEX 3;  1W6Y A;  3FZW A;  1NWW A;  3DGO A;  3I55 3;  4N6M A;  1OUN A;  2P09 A;  3GWR A;  1OH0 A;  2CH9 A;  1UUW B;  1OGX A;  2OQE C;  3SVA A;  1ULI B;  3B4O A;  3DMC A;  2XH9 A;  3CPW 2;  8CHO A;  2W6J H;  3EX9 A;  1VQ6 3;  3OX9 A;  3OWY A;  1O7W B;  5CF1 A;  1SIH A;  2HMK B;  3BLZ A;  1UW1 A;  3A76 A;  1W6G A;  3HX8 A;  5A0O B;  3CC2 3;  2E2U A;  2W56 B;  3BB9 A;  1Q40 B;  3EE1 A;  4WP5 A;  3CC7 3;  3LTB A;  5G2G A;  1IVV A;  2Z6B A;  3CNX A;  4X2O A;  5JPU A;  2Y74 A;  1SPU A;  7STD A;  1JB4 A;  1M1K 4;  3EB8 A;  1ROA A;  4J8T A;  2K54 A;  2SBL A;  1IT8 A;  2XGN A;  3K9M C;  1N8Q A;  3RGA A;  2HMJ B;  3JUQ A;  4NRE A;  4O3V A;  1R4C A;  2BMR B;  5JPP A;  1RKY A;  1CYV A;  2ML6 A;  1G96 A;  2OTJ 3;  1ASK A;  1NO3 A;  4TX4 A;  1AV4 A;  5LC7 A;  3FGY A;  2WOF A;  3VSY A;  3RDE A;  1STD A;  2IMJ A;  4R80 A;  5LC6 A;  4HM8 B;  4RNY A;  1V74 A;  3CXC 2;  3HIG A;  5AII A;  2CFK A;  5I97 A;  3IMA B;  4KVH A;  5AEW B;  5KP4 A;  1OPY A;  1IQY A;  2LYX A;  3PS8 A;  1GD4 A;  1ULJ B;  2W56 A;  2PZV A;  3F40 A;  4HM0 B;  2O9U X;  4K1V A;  2BNG A;  1IVU A;  4R9L A;  3Q90 A;  2P38 A;  3JVC A;  3EN8 A;  1Q82 4;  3X3Z A;  4STD A;  2A15 A;  3S28 A;  2ZDJ A;  3NX0 A;  4L7K A;  4KZ1 A;  3MPH A;  3D3L A;  1N9E A;  4MMX B;  3WMD A;  2Z7A A;  2IUK A;  3KFQ C;  2W04 A;  2ML5 A;  4EYC A;  2QA4 3;  1SJW A;  3F8H A;  1W4N A;  1ROV A;  3CU3 A;  2QIY A;  3LML A;  2P0X A;  4CDL A;  4IPB A;  2CWV A;  3J7Y d;  2K0M A;  3V98 A;  2CWU A;  1C7H A;  5IW9 A;  3EBT A;  3DM8 A;  1IVW A;  4XDV A;  2JQ5 A;  1J2B A;  3FKA A;  2CKF B;  4MMZ B;  3SLU A;  4N6U A;  3CCM 3;  1CYU A;  1WMN A;  3GZY B;  1IVX A;  3LTD A;  2Q07 A;  2XSO B;  3CNM A;  1YVB I;  1OHP A;  4N6T A;  3LOY A;  3VF1 A;  2MF7 A;  1FGT A;  4MMY B;  3DZL A;  3CCU 3;  4N3V A;  1O7M B;  5TGN A;  5CLK A;  5IG5 A;  5KP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...