1U5OA

Structure of the d23a mutant of the nuclear transport carrier ntf2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFANDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational and biochemical identification of a nuclear pore complex binding site on the nuclear transport carrier NTF2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords Nuclear transport factor 2
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1u5oA00
4I4KA 3DZLA 4HM1B 5STDA 1WQLB 1JB2A 1OCVA 3F7SA 3IPTA 3B4OA 1Q40B 3FKAA 3RGRA 1A2KA 3NV0A 4ORLA 1STDA 4IIAA 2F99A 3JUNA 1OGXA 3LZAA 3G16A 4RZMA 5IG0A 2PZVA 1S5AA 2HMJB 3E99A 1W00A 4LEHA 4CDLA 3NV0B 2GBXB 1W01A 3KE7A 3BB9A 3OV4A 5IEOA 3A76A 3SOAA 3GZRA 3NUVA 5IEPA 1ISKA 1OPYA 1TUHA 3EHCA 4WYKB 1TP6A 1OHSA 1E3VA 4HJLB 1JN5B 1JB5A 5CK6A 1Q42A 3LYGA 2W2CA 1C7HA 1ULJB 4HM4B 4MJDA 3EBYA 2XSOB 5BVBA 1EG9B 4XB5A 2XR8B 3JUQA 3F14A 3UJMA 1IDPA 5IENA 3H3HA 2JQ5A 4HM8B 2CHCA 5KP3A 2Z77A 3ER7A 2Z7AA 4J8TA 1NU3A 2IMJA 1K41A 3RGAA 5CF1A 5AIFA 4HM7B 4HVNA 5JPUA 1QMAA 1ULIB 3JUMA 5IF6A 3NBRA 3MKIA 4OUQA 5D83A 3FZWA 1GYBA 4L7KA 2RCDA 3EN1B 3OWUA 1O7PB 3K7CA 3EQQB 4HM0B 1Q40A 1OHOA 1OUNA 2YFIB 3GZYB 4WWUC 3FH1A 3FGYA 3CPOA 3EN8A 1NWWA 4K1VA 1GY7A 4XBTA 5AI1A 4FCMA 1AR0A 6STDA 3S5CA 7STDA 5AEUB 2RFRA 5KP1A 4R9LA 3MHEA 3B8LA 3SEDA 5BXQA 1Z1SA 3BLZA 4HM6B 4LMIA 3SOYA 4HKVB 1OF5B 3EBTA 2STDA 4FCJA 1UUVB 3OXAA 3OWSA 4LGQA 1UUWB 2HMKB 3OX9A 1GY6A 2F86B 4GB5A 5CXOA 5IERA 5KP4A 3DXOA 2GEXA 1JKGA 1CQSA 3GRDA 5IG4A 1VZZA 2A15A 2GBWB 3JUPA 4R9KA 4XM4A 5G2GA 5CLKA 3ROBA 4STDA 2B1XB 2HMLB 1DMMA 5IG5A 4HM2B 2B24B 2QGUA 2YFLB 3DUKA 3FF0A 3Q90A 3ECFA 3F8XA 2RGQA 1W6YA 4XDWA 3VSYA 3KZTA 1JB4A 3T8NA 1QJGA 3GWRA 2HMNB 8CHOA 3DM8A 1U5OA 3HX8A 3JUOA 2QIYA 1O7WB 3STDA 5JPPA 3FF2A 5AIIA 1GY5A 1HKXA 2HMMB 3F8HA 2I9WA 1O7MB 4PEJA 5HGRA 5IG3A 2CKFB 1ZX2A 3EX9A 3I0YA 4Q53A 1JKGB 3UNLA 3FLJA 1NDOB 3F9SA 5AIHA 1GS3A 3MG1A 3EF8A 2K54A 3F7XA 1SJWA 4R1KA 2BNGA 3K0ZA 3NM2A 5AEWB 2UX0A 1JN5A 4HZ9B 5D81A 5AIGA 1DMQA 2F98A 2Z76A 3HZPA 4J9AA 3T8UA 4X2HA 3CU3A 2BMOB 2OWPA 3NXJA 4WP5A 4X2OA 1O7HB 3CNMA 3FSDA 3VGNA 3HK4A 3WMDA 4WYKA 3OWYA 4XDVA 1W02A 4KVHA 4L8OA 1DMNA 2INXA 3DMCA 2BMQB 2XSHB 4HM5B 3F40A 4OVMA 1ZO2A 2BMRB 4N3VA 4U13A 3EJVA 2R4IA 5DREA 1E3RA 4HZBB 3B4PA 3G0KA 5CF2A 2HMOB 3MYTA 3GZBA 3KSPA 3M8CA 4XBYA 1OF5A 5EVHA 1O7GB 4K1UA 1OGZA 2XRXB 3H51A 1E97A 2YFJB 3B7CA 1O7NB 1ASKA 3KKGA 4L8PA 3MG3A 5TGNA 4H3UA 5FW5A 5D82A 2GEYA 3CNXA 1EA2A 3EC9A 3GZXB 2GXFA 3G8ZA 3MG2A 3MSOA 4XBXA 1OHPA 3D9RA 4HM3B 5DRVA 1BUQA 1OH0A 3NHXA
chains in the Genus database with same CATH superfamily
4HM1B 1WQLB 2WO0A 3F7SA 3CCL3 3B4OA 1Q40B 3X3ZA 1A2KA 1BSCA 1FA3A 4H61A 1STDA 1QAKA 1OGXA 3L0RA 4EW5A 2PZVA 2R41A 2GBXB 1PYLA 2RNTA 3SOAA 1DVCA 1Q9EA 1F8NA 1CEWI 1RMSA 1BNEA 1DETA 1OPYA 1VQ43 3CCM3 1EEJA 1TFKA 3U1WA 4HJLB 3CD63 1VQO3 1GOUA 1KD14 1Q42A 4CJNA 1D6YA 1ULJB 2GU3A 4EC6A 3EBYA 3VF1A 3GSPA 2XR8B 3JUQA 3F14A 4GL6A 1WMPA 3X40A 1J2BA 4EV2A 1NB3I 3MPHA 1RGLA 4IT7A 4WFOA 4J8TA 3RGAA 3WODG 4JF8A 5AIFA 4HVNA 1R4YA 3SVAA 1QMAA 5EQLA 1I8VA 2WOHA 1W4NA 3MKIA 1RRHA 2E2VA 4L7KA 3EN1B 1QVF2 1D6UA 1OHOA 1SARA 4WWUC 3CPOA 1HZ1A 4K1VA 3AGNA 3BNCA 4EXRA 2SARA 3DGMA 6STDA 7RNTA 2CFLA 4R9LA 3MHEA 3BLZA 4O3VA 3N54B 4HKVB 1RCKA 2F56A 2BIRA 2STDA 6RNTA 1B21A 1W7CA 2CWVA 1JBTA 1CQSA 3Q1CA 5IG4A 1VZZA 2A15A 1LOXA 2GBWB 2ML5A 3JUPA 3LT8A 1SIIA 3QRDA 4G1MB 2B1XB 2O3OA 1JBRA 2QGUA 1SPUA 3F8XA 4LSOA 2RGQA 3VSYA 1B3SA 3HI7A 4KFEA 4HBRA 3AMOA 3GWRA 3I563 2P09A 4JRFA 6GSPA 3LTCA 1AVLA 2IUKA 5JPPA 3FF2A 3HIGA 4TX4A 2HMMB 1B2UA 1I70A 2I9WA 1I2FA 4PEJA 3DY5A 2FGTA 1JRQA 1BRGA 2CKFB 4RNZA 4Q53A 1VQM3 3FLJA 1N9JA 4OK0A 1GS3A 1IU7A 2K54A 4R1KA 1M1XB 1SJWA 2MC8A 2AAEA 3DGLA 2XFTA 4EV5A 5D81A 3KCHA 1GD4A 1DMQA 2F98A 4J9AA 5AIGA 3RDEA 2CX1A 3T8UA 5JBSA 1S723 4LZIA 1KWIA 2OWPA 2M7OA 3NXJA 4X2OA 1O7HB 1A90A 1Q7Y4 4R4KA 4WYKA 3OWYA 1TFOA 4OVMA 1BRHA 1RLSA 3EJVA 3LXUX 1BANA 2CFKA 4BIRA 4CCVA 1GMRA 1LVNA 3M8CA 5IG5A 3H51A 1E97A 1NO3A 1BGSA 1GOYA 5M18A 4H3UA 2ZL8A 4AKYA 1RN1A 5IW9A 1FW7A 2GEYA 2W56B 3PCSA 4EBGA 5I97A 2W9QA 3EC9A 4NHFA 1BUQA 1M904 1IVWA 2RBIA 1B2MA 1OH0A 2XGLA 3EB8A 2OQEC 3DZLA 3QK9A 5M19A 8RNTA 5HOHA 1FUSA 4KFDA 3D4AA 3FG1A 3RGRA 2WGQA 4ORLA 3NV0A 3Q2PA 2F99A 3I553 1S5AA 2HMJB 4CDLA 2OQEA 1FUTA 2AADA 1MWRA 2P0MA 3KE7A 1RN4A 4N6TA 3CPW2 5LC7A 3GZRA 3NUVA 5IEPA 2W6JH 1TUHA 1Q824 1TP6A 1M1K4 1E3VA 1JN5B 3CC23 1RDSA 1UGHI 1JB5A 1YNVX 1I2EA 2CX0A 2C10A 3LYGA 1YI23 1BRNL 1BU4A 2W2CA 4K90B 1VQN3 3NBJA 3UB1A 2CFWA 3FCSB 3CCJ3 5BVBA 1YJN3 2P05A 4N6MA 5IENA 1I3IA 1IDPA 4J5GA 4HM8B 5KP3A 2H0IA 2Z7AA 2IMJA 1VQK3 1IQYA 1BNSA 1W2B2 1FGOA 1KC84 1AY7A 1ULIB 3JUMA 1B2XA 3NBRA 3TDGA 1EQKA 1IVVA 4OUQA 3NM7A 3FZWA 1BNRA 3K9MC 1DVDA 1O7PB 1RJOA 1TU5A 1CYVA 3FG4A 3CCQ3 3GZYB 1SQWA 1BNIA 2CFDA 3SXXA 3K5TA 2OOVA 1NWWA 7GSPA 1EUIC 4XBTA 1BIRA 5ELJA 3S5CA 5AEUB 1T2HA 2RFRA 3KN4A 4CPKA 1L5GB 1K734 3SEDA 3X3XA 5FGOA 1RNBA 1BSEA 1KSIA 3K63A 4HM6B 3SOYA 2KCDA 3KFQC 3BU4A 1BSBA 1OF5B 3CC43 4KT3B 4GB5A 3OX9A 1LRAA 5CXOA 2OCTA 3DXOA 3GRDA 1MWUA 3X3YA 4R9KA 1VQL3 3WA2X 1BVIA 1WTHA 5CLKA 1FGRA 4STDA 1Q814 4HAAA 3WA3A 2RSXA 1LQGC 2B24B 3Q90A 4DKIA 1YVSA 2FXTA 1JB4A 2CW9A 3T8NA 1I0XA 3Q3FA 4MMXB 2BT3A 1WMOA 2QIYA 1O7WB 3STDA 3KIIA 1AQZA 1G96A 1GOVA 2W0QA 1HKXA 1RKYA 2CC3A 2D1WA 1AVKA 3I0YA 2P38A 2BU4A 2F4YA 3N9HA 4MEIA 3PS8A 2SBLA 3F9SA 3MG1A 1DE3A 4ILFA 5G1KA 2MF7A 2Q07A 4FMDA 1NB5I 1VQ53 3A5EA 4HZ9B 3S27A 2Z76A 2J8XB 3D5GA 4X2HA 3UL6A 2O9UX 3CU3A 1BUJA 1T5YA 3FSDA 3CNMA 3GAXA 1RSNA 2C4BA 2W03A 2XH9A 4KZ1A 1ROAA 3DH2A 3NX0A 1W6GA 4L8OA 1DMNA 9RNTA 3MWZA 2Z6BA 4R80A 1IV7A 1YJ93 1ZO2A 2BMRB 5DREA 1BRSA 4O8SA 1R4CA 1YGWA 4HZBB 4BU4A 3G0KA 3BNDA 3AGOA 3NQYA 5CF2A 3CCU3 5EVHA 4K1UA 1OGZA 2YFJB 1O7NB 3S67A 3MG3A 5FW5A 4N6LA 1MGWA 5BU4A 1HU9A 1UCIA 1HYFA 1EA2A 3CNXA 3D79A 3BNBA 3GZXB 4XBXA 2YX9A 1MOLA 3D9RA 1RGAA 1N5PA 1IT7A 4I4KA 1T3BA 1TRQA 4ZM8A 2KRTA 3IPTA 1UCLA 3FKAA 1VQ63 1RNTA 4IIAA 1RGKA 3LZAA 1M9GA 3G16A 3LTDA 1TRPA 1W00A 4LEHA 1WNHA 3OW22 3NV0B 1VQQA 2ZHXB 5IEOA 1UCKA 3O8YA 1GSPA 1JZDA 1UI8A 1B2SA 3EHCA 2F5MA 1I2GA 1C54A 1VQ73 5RNTA 2PNCA 3NBBA 5CK6A 1CH0A 1JZOA 1BRKA 2L1SA 1C7HA 1TJDA 5EEOA 3CCV3 1NJI4 1KQS2 2XSOB 1YGEA 4XB5A 1N8QA 2CH9A 2OOVC 3G6E3 3H3HA 3CME3 3ER7A 3JVCA 5CF1A 3PYJA 4HM7B 5JPUA 1K8A4 3D3LA 1N8R4 2C11A 3CXC2 3AMOB 5IF6A 2LYXA 5D83A 4BTXA 3OWUA 1TIJA 1B27A 4N6OB 3EQQB 3CCR3 1Q40A 1OUNA 5AI1A 2CFGA 2YFIB 1K28A 5GSPA 2CG0A 1BNJA 4AEQA 1MWSA 5G1LA 1LNHA 7STDA 3DGNA 4O02B 3U97A 1RRLA 2XGNA 3BIRA 3B8LA 1MGRA 1VQ93 1LOYA 1UDII 1Z1SA 2P0XA 3T0UA 2W04A 1US1A 1QVG2 1Q7HA 2D42A 2WGOA 1UUVB 3OXAA 2K3DA 1A2PA 2CWUA 5IERA 2HMKB 4RNYA 3DGYA 2GEXA 3S28A 3RNTA 2IA7A 4XM4A 3PXMA 5G2GA 1GD3A 2QA43 1PFPA 4HM2B 3DUKA 3D5IA 1FGQA 1IK3A 3ECFA 3IJEB 3ZFZA 1W6YA 1TTOA 2OTJ3 1RGCA 1QJGA 2GU1A 2K0MA 2HMNB 8CHOA 5KP1A 1JNQA 3PZWA 1X1WA 3JUOA 4HOHA 1IVXA 5AIIA 3G4S3 1AV4A 4IPBA 5HGRA 5IG3A 1MNLA 1ZX2A 3EX9A 1GMQA 1JKGB 3UNLA 1MWTA 3EF8A 1STFI 3F7XA 4BTYA 5AEWB 2BNGA 2UX0A 2KF3A 3N8BA 3SX1A 1W5ZA 3HZPA 3SYUA 4K61A 4O2HA 5M1AA 3V92A 1LNIA 3J7Yd 1VQP3 1IQXA 3VGNA 1D6ZA 4XDVA 2CWTA 1W02A 4KVHA 1BRIA 1V74A 2Y74A 3WDGB 1UI7A 2BMQB 2KF4A 1RGFA 2UGIA 3V99A 4N3VA 2R4IA 1E3RA 1RGEA 3LH4A 3PCRA 3MYTA 1I0VA 3GZBA 3SLUA 1OF5A 4GSPA 1X1YA 2XRXB 1RCLA 1QAFA 2XFSA 4N6V0 3CCS3 1CYUA 3WR2A 1DYUA 1W2ZA 1IVUA 3MG2A 1BNGA 2GXFA 3G8ZA 3MSOA 5DRVA 1JJ22 4HM3B 1YIJ3 2W56A 4RNTA 1ASKA 1IT8A 2IYJA 2L4VA 1RGHA 2XF3A 4WP5A 3ZG0A 3BNEA 3IMAB 5STDA 3X42A 1JB2A 1OCVA 3G713 1FGMA 3X41A 5BIRA 1A67A 4LYLB 3S29A 1RGGA 3WOFB 3JUNA 4RZMA 4FMAA 5IG0A 3E99A 2HOHA 3AHWA 3OV4A 1W01A 4AKZA 3BB9A 3A76A 4RBNA 2KF5A 1IV9A 1ZGXA 2F5WA 4FR9A 1ISKA 4WYKB 1OHSA 3URPA 1N5HA 1BAOA 4HM4B 1FYSA 2KAAA 4MJDA 1I3FA 1G02A 1EG9B 3WHOA 3UJMA 2WOFA 1V57A 2JQ5A 2CHCA 5ELUA 2XEPA 2Z77A 1VQ83 1UUGB 2V1LA 1NU3A 1K41A 1BNFA 2ML6A 1V58A 2ZDJA 2OTL3 3LTBA 1SIHA 1GYBA 1LQMB 2E2TA 3V98A 2RCDA 3LT9A 1G0TA 3CC73 3K7CA 4HM0B 1YIT3 3FH1A 3FGYA 1UCJA 3ZG5A 3AHSA 1N9EA 3EN8A 1Q864 1GY7A 2H0HA 1B20A 3HIIA 1AR0A 4FCMA 4FMCA 1X1UA 2H0GA 4KFFA 2BO9B 1FUWA 2JDIH 1LOWA 5BXQA 4LMIA 1T2IA 3EE1A 1JV2B 3EBTA 4FCJA 3OWSA 4LGQA 1UUWB 1RTUA 1GY6A 2F86B 1OACA 5KP4A 4MMZB 2ZA4A 2GSPA 2KXGA 1FGTA 1JKGA 3PGBA 1B2ZA 3ROBA 4BL2A 2QEX3 2HMLB 4FMBA 3HOHA 1DMMA 2YFLB 3FF0A 4XDWA 2E2UA 4GHOA 5LC6A 4NPBA 4HYZA 1UGIA 3KZTA 3UL5A 1RN7A 1WMNA 1UW1A 1LXEA 2KF6A 3DM8A 1U5OA 3HX8A 2IUJA 2CK3H 3KSED 4FCZA 3LMLA 1ROVA 2BHMA 3ALAA 1GY5A 3F8HA 4I5QA 1LOVA 1K9M4 1O7MB 3WOEB 5AYSC 3DGOA 1A2VA 4N6NB 3LOYA 1U8CB 2FNQA 3NQZA 1GMPA 1NDOB 4BL3A 1IQ8A 5AIHA 1JBSA 2IY2A 1NNVA 3K0ZA 1BSAA 3NM2A 1YJW3 1JN5A 2CG1A 4BTWA 2CIUA 1BOXA 2LQVA 3CCE3 2BMOB 3CMA3 3LTAA 2Y73A 3HK4A 3WMDA 1BSDA 1IYYA 2INXA 3DMCA 4HM5B 2XSHB 1W6CA 3F40A 4U13A 2W9PA 1YVBI 3B4PA 1EKMA 4NREA 1RHLA 2HMOB 1FZUA 1PY3A 1ZS7A 3KSPA 5AYRB 1PU4A 1O7GB 4XBYA 3KKGA 3B7CA 4L8PA 1Y4KA 1YHQ3 3FG3A 4J5KA 1QALA 5TGNA 2UUGC 5A0OB 5D82A 4WHAA 1X1XA 4EYCA 4QWTA 1OHPA 4N6UA 4MMYB 1BRJA 3NHXA
chains in the Genus database with same CATH topology
4HM1B 1WQLB 2WO0A 3F7SA 3CCL3 3B4OA 1Q40B 3X3ZA 1A2KA 1FA3A 4H61A 1STDA 1QAKA 1OGXA 3L0RA 2PZVA 2GBXB 3SOAA 1DVCA 1F8NA 1CEWI 1OPYA 1VQ43 3CCM3 1TFKA 3U1WA 4HJLB 3CD63 1VQO3 1KD14 1Q42A 1D6YA 1ULJB 2GU3A 4EC6A 3EBYA 3VF1A 4GL6A 2XR8B 3JUQA 3F14A 3X40A 1WMPA 1J2BA 4EV2A 1NB3I 3MPHA 4IT7A 4WFOA 4J8TA 3RGAA 3WODG 4JF8A 5AIFA 4HVNA 3SVAA 1QMAA 5EQLA 2WOHA 1W4NA 3MKIA 1RRHA 2E2VA 4L7KA 3EN1B 1QVF2 1D6UA 1OHOA 4WWUC 3CPOA 4K1VA 4EXRA 3BNCA 3DGMA 6STDA 2CFLA 4R9LA 3MHEA 3BLZA 4O3VA 3N54B 4HKVB 2STDA 1W7CA 2CWVA 1CQSA 3Q1CA 5IG4A 1VZZA 2A15A 1LOXA 2GBWB 2ML5A 3JUPA 3LT8A 1SIIA 3QRDA 4G1MB 2B1XB 2O3OA 2QGUA 1SPUA 3F8XA 4LSOA 2RGQA 3VSYA 3HI7A 4KFEA 4HBRA 3AMOA 3GWRA 3I563 2P09A 4JRFA 3LTCA 1AVLA 2IUKA 5JPPA 3FF2A 3HIGA 4TX4A 2HMMB 2I9WA 4PEJA 3DY5A 2FGTA 1JRQA 2CKFB 4RNZA 4Q53A 1VQM3 3FLJA 1N9JA 4OK0A 1GS3A 1IU7A 2K54A 4R1KA 1M1XB 1SJWA 2MC8A 3DGLA 2XFTA 4EV5A 5D81A 1GD4A 1DMQA 2F98A 4J9AA 5AIGA 3RDEA 3T8UA 5JBSA 1S723 4LZIA 1KWIA 2OWPA 2M7OA 3NXJA 4X2OA 1O7HB 1A90A 1Q7Y4 4R4KA 4WYKA 3OWYA 1TFOA 4OVMA 3EJVA 3LXUX 2CFKA 4CCVA 1LVNA 3M8CA 5IG5A 3H51A 1E97A 1NO3A 4H3UA 2ZL8A 4AKYA 5IW9A 2GEYA 2W56B 3PCSA 4EBGA 5I97A 2W9QA 3EC9A 4NHFA 1BUQA 1M904 1IVWA 1OH0A 2XGLA 3EB8A 2OQEC 3DZLA 3QK9A 4KFDA 3FG1A 3RGRA 2WGQA 4ORLA 3NV0A 3Q2PA 2F99A 3I553 1S5AA 2HMJB 4CDLA 2OQEA 3KE7A 2P0MA 4N6TA 3CPW2 5LC7A 3GZRA 3NUVA 5IEPA 2W6JH 1TUHA 1Q824 1TP6A 1M1K4 1E3VA 1JN5B 3CC23 1YI23 1JB5A 2C10A 3LYGA 2W2CA 4K90B 1VQN3 3NBJA 3UB1A 2CFWA 3FCSB 3CCJ3 5BVBA 1YJN3 2P05A 4N6MA 1IDPA 4HM8B 5KP3A 2Z7AA 2IMJA 1VQK3 1IQYA 1W2B2 1FGOA 1KC84 1ULIB 3JUMA 3NBRA 3TDGA 1EQKA 1IVVA 4OUQA 3NM7A 3FZWA 1DVDA 3K9MC 1O7PB 1RJOA 1TU5A 1CYVA 3FG4A 3CCQ3 3GZYB 1SQWA 2CFDA 3SXXA 3K5TA 2OOVA 1NWWA 4XBTA 5ELJA 3S5CA 5AEUB 2RFRA 3KN4A 1L5GB 1K734 3SEDA 3X3XA 5FGOA 1KSIA 3K63A 4HM6B 3SOYA 2KCDA 3KFQC 1OF5B 3CC43 4GB5A 3OX9A 5CXOA 2OCTA 3DXOA 3GRDA 3X3YA 4R9KA 1VQL3 3WA2X 1WTHA 5CLKA 1FGRA 4STDA 1Q814 3WA3A 2RSXA 2B24B 3Q90A 2FXTA 1JB4A 2CW9A 3T8NA 4MMXB 2BT3A 1WMOA 2QIYA 1O7WB 3STDA 3KIIA 1G96A 2W0QA 1HKXA 1RKYA 2CC3A 2D1WA 1AVKA 3I0YA 2P38A 3N9HA 4MEIA 3PS8A 2SBLA 3F9SA 3MG1A 2MF7A 2Q07A 4FMDA 1NB5I 1VQ53 4HZ9B 3S27A 2Z76A 3UL6A 4X2HA 2O9UX 3CU3A 1T5YA 3FSDA 3CNMA 3GAXA 2W03A 2XH9A 4KZ1A 1ROAA 3NX0A 4L8OA 1W6GA 1DMNA 3MWZA 2Z6BA 4R80A 1IV7A 1YJ93 1ZO2A 2BMRB 5DREA 4O8SA 5IENA 1R4CA 4HZBB 5CF2A 3G0KA 3BNDA 3NQYA 3CCU3 5EVHA 4K1UA 1OGZA 2YFJB 1O7NB 3S67A 3MG3A 5FW5A 4N6LA 1HU9A 3CNXA 1EA2A 4XBXA 3BNBA 3GZXB 2YX9A 1MOLA 3D9RA 1N5PA 1IT7A 4I4KA 4ZM8A 2KRTA 3IPTA 3FKAA 1VQ63 4IIAA 3LZAA 1M9GA 3G16A 3LTDA 1W00A 4LEHA 1WNHA 3OW22 3NV0B 5IEOA 3O8YA 1UI8A 3EHCA 1VQ73 2PNCA 3NBBA 5CK6A 1C7HA 5EEOA 3CCV3 1NJI4 1KQS2 2XSOB 1YGEA 4XB5A 1N8QA 2CH9A 2OOVC 3G6E3 3H3HA 3CME3 3ER7A 3JVCA 5CF1A 3PYJA 4HM7B 5JPUA 1K8A4 3D3LA 1N8R4 2C11A 3CXC2 3AMOB 5IF6A 2LYXA 5D83A 4BTXA 3OWUA 1TIJA 4N6OB 3EQQB 3CCR3 1Q40A 1OUNA 2CFGA 2YFIB 1K28A 2CG0A 4AEQA 1LNHA 7STDA 3DGNA 4O02B 3U97A 1RRLA 2XGNA 3B8LA 1VQ93 1Z1SA 2P0XA 3T0UA 2W04A 1US1A 1QVG2 2D42A 2WGOA 1UUVB 3OXAA 2CWUA 5IERA 2HMKB 4RNYA 2GEXA 3S28A 2IA7A 4XM4A 3PXMA 5G2GA 1GD3A 2QA43 1PFPA 4HM2B 3DUKA 1FGQA 1IK3A 3ECFA 3IJEB 2OTJ3 1W6YA 1QJGA 2GU1A 2K0MA 2HMNB 8CHOA 1JNQA 3PZWA 3JUOA 1IVXA 5AIIA 3G4S3 1AV4A 4IPBA 5HGRA 5IG3A 1MNLA 1ZX2A 3EX9A 1JKGB 3UNLA 3EF8A 1STFI 3F7XA 4BTYA 5AEWB 2BNGA 2UX0A 3N8BA 3SX1A 1W5ZA 3HZPA 4K61A 4O2HA 3J7Yd 1VQP3 1IQXA 3VGNA 1D6ZA 4XDVA 2CWTA 1W02A 4KVHA 2Y74A 1V74A 3WDGB 1UI7A 2BMQB 3V99A 4N3VA 2R4IA 1E3RA 3LH4A 3PCRA 3MYTA 3GZBA 3SLUA 1OF5A 2XRXB 1QAFA 2XFSA 4N6V0 3CCS3 1CYUA 1DYUA 1W2ZA 1IVUA 3MG2A 2GXFA 3G8ZA 3MSOA 5DRVA 1JJ22 4HM3B 1YIJ3 2W56A 1IT8A 1ASKA 2XF3A 2L4VA 4WP5A 3BNEA 3IMAB 5STDA 3X42A 1JB2A 1OCVA 3G713 1FGMA 3X41A 1A67A 3S29A 3WOFB 3JUNA 4RZMA 4FMAA 5IG0A 3E99A 3OV4A 1W01A 4AKZA 3BB9A 3A76A 4RBNA 1IV9A 1ISKA 4FR9A 4WYKB 1OHSA 1N5HA 4HM4B 4MJDA 1EG9B 3UJMA 2WOFA 2JQ5A 2CHCA 5ELUA 2XEPA 2Z77A 1VQ83 2V1LA 1NU3A 1K41A 2ML6A 2ZDJA 2OTL3 3LTBA 1SIHA 1GYBA 2E2TA 3V98A 2RCDA 3LT9A 3CC73 3K7CA 4HM0B 1YIT3 3FH1A 3FGYA 3EN8A 1N9EA 1Q864 1GY7A 3HIIA 4FMCA 4FCMA 1AR0A 5AI1A 5KP1A 4KFFA 2BO9B 1FUWA 2JDIH 5BXQA 4LMIA 3EE1A 1JV2B 3EBTA 4FCJA 3OWSA 4LGQA 1UUWB 1GY6A 2F86B 1OACA 5KP4A 4MMZB 3PGBA 2KXGA 1FGTA 1JKGA 3ROBA 2QEX3 2HMLB 4FMBA 1DMMA 2YFLB 3FF0A 4XDWA 2E2UA 5LC6A 4HYZA 3KZTA 3UL5A 1RN7A 1WMNA 1UW1A 1LXEA 3DM8A 1U5OA 3HX8A 2IUJA 2CK3H 3KSED 4FCZA 3LMLA 1ROVA 2BHMA 3ALAA 1GY5A 3F8HA 1K9M4 1O7MB 3WOEB 5AYSC 3DGOA 1A2VA 4N6NB 3LOYA 1U8CB 2FNQA 3NQZA 1NDOB 1IQ8A 5AIHA 3K0ZA 3NM2A 1YJW3 1JN5A 2CG1A 4BTWA 2CIUA 2LQVA 3CCE3 2BMOB 3CMA3 3LTAA 2Y73A 3HK4A 3WMDA 2INXA 3DMCA 4HM5B 2XSHB 1W6CA 3F40A 4U13A 2W9PA 1YVBI 3B4PA 1EKMA 4NREA 2HMOB 5AYRB 3KSPA 1PU4A 1O7GB 4XBYA 3KKGA 3B7CA 4L8PA 1Y4KA 1YHQ3 3FG3A 1QALA 5TGNA 5A0OB 5D82A 4WHAA 4EYCA 4QWTA 1OHPA 4N6UA 4MMYB 3V92A 3NHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4K A;  3DZL A;  4HM1 B;  5STD A;  1WQL B;  1JB2 A;  1OCV A;  3F7S A;  3IPT A;  3B4O A;  1Q40 B;  3FKA A;  3RGR A;  1A2K A;  3NV0 A;  4ORL A;  1STD A;  4IIA A;  2F99 A;  3JUN A;  1OGX A;  3LZA A;  3G16 A;  4RZM A;  5IG0 A;  2PZV A;  1S5A A;  2HMJ B;  3E99 A;  1W00 A;  4LEH A;  4CDL A;  3NV0 B;  2GBX B;  1W01 A;  3KE7 A;  3BB9 A;  3OV4 A;  5IEO A;  3A76 A;  3SOA A;  3GZR A;  3NUV A;  5IEP A;  1ISK A;  1OPY A;  1TUH A;  3EHC A;  4WYK B;  1TP6 A;  1OHS A;  1E3V A;  4HJL B;  1JN5 B;  1JB5 A;  5CK6 A;  1Q42 A;  3LYG A;  2W2C A;  1C7H A;  1ULJ B;  4HM4 B;  4MJD A;  3EBY A;  2XSO B;  5BVB A;  1EG9 B;  4XB5 A;  2XR8 B;  3JUQ A;  3F14 A;  3UJM A;  1IDP A;  5IEN A;  3H3H A;  2JQ5 A;  4HM8 B;  2CHC A;  5KP3 A;  2Z77 A;  3ER7 A;  2Z7A A;  4J8T A;  1NU3 A;  2IMJ A;  1K41 A;  3RGA A;  5CF1 A;  5AIF A;  4HM7 B;  4HVN A;  5JPU A;  1QMA A;  1ULI B;  3JUM A;  5IF6 A;  3NBR A;  3MKI A;  4OUQ A;  5D83 A;  3FZW A;  1GYB A;  4L7K A;  2RCD A;  3EN1 B;  3OWU A;  1O7P B;  3K7C A;  3EQQ B;  4HM0 B;  1Q40 A;  1OHO A;  1OUN A;  2YFI B;  3GZY B;  4WWU C;  3FH1 A;  3FGY A;  3CPO A;  3EN8 A;  1NWW A;  4K1V A;  1GY7 A;  4XBT A;  5AI1 A;  4FCM A;  1AR0 A;  6STD A;  3S5C A;  7STD A;  5AEU B;  2RFR A;  5KP1 A;  4R9L A;  3MHE A;  3B8L A;  3SED A;  5BXQ A;  1Z1S A;  3BLZ A;  4HM6 B;  4LMI A;  3SOY A;  4HKV B;  1OF5 B;  3EBT A;  2STD A;  4FCJ A;  1UUV B;  3OXA A;  3OWS A;  4LGQ A;  1UUW B;  2HMK B;  3OX9 A;  1GY6 A;  2F86 B;  4GB5 A;  5CXO A;  5IER A;  5KP4 A;  3DXO A;  2GEX A;  1JKG A;  1CQS A;  3GRD A;  5IG4 A;  1VZZ A;  2A15 A;  2GBW B;  3JUP A;  4R9K A;  4XM4 A;  5G2G A;  5CLK A;  3ROB A;  4STD A;  2B1X B;  2HML B;  1DMM A;  5IG5 A;  4HM2 B;  2B24 B;  2QGU A;  2YFL B;  3DUK A;  3FF0 A;  3Q90 A;  3ECF A;  3F8X A;  2RGQ A;  1W6Y A;  4XDW A;  3VSY A;  3KZT A;  1JB4 A;  3T8N A;  1QJG A;  3GWR A;  2HMN B;  8CHO A;  3DM8 A;  1U5O A;  3HX8 A;  3JUO A;  2QIY A;  1O7W B;  3STD A;  5JPP A;  3FF2 A;  5AII A;  1GY5 A;  1HKX A;  2HMM B;  3F8H A;  2I9W A;  1O7M B;  4PEJ A;  5HGR A;  5IG3 A;  2CKF B;  1ZX2 A;  3EX9 A;  3I0Y A;  4Q53 A;  1JKG B;  3UNL A;  3FLJ A;  1NDO B;  3F9S A;  5AIH A;  1GS3 A;  3MG1 A;  3EF8 A;  2K54 A;  3F7X A;  1SJW A;  4R1K A;  2BNG A;  3K0Z A;  3NM2 A;  5AEW B;  2UX0 A;  1JN5 A;  4HZ9 B;  5D81 A;  5AIG A;  1DMQ A;  2F98 A;  2Z76 A;  3HZP A;  4J9A A;  3T8U A;  4X2H A;  3CU3 A;  2BMO B;  2OWP A;  3NXJ A;  4WP5 A;  4X2O A;  1O7H B;  3CNM A;  3FSD A;  3VGN A;  3HK4 A;  3WMD A;  4WYK A;  3OWY A;  4XDV A;  1W02 A;  4KVH A;  4L8O A;  1DMN A;  2INX A;  3DMC A;  2BMQ B;  2XSH B;  4HM5 B;  3F40 A;  4OVM A;  1ZO2 A;  2BMR B;  4N3V A;  4U13 A;  3EJV A;  2R4I A;  5DRE A;  1E3R A;  4HZB B;  3B4P A;  3G0K A;  5CF2 A;  2HMO B;  3MYT A;  3GZB A;  3KSP A;  3M8C A;  4XBY A;  1OF5 A;  5EVH A;  1O7G B;  4K1U A;  1OGZ A;  2XRX B;  3H51 A;  1E97 A;  2YFJ B;  3B7C A;  1O7N B;  1ASK A;  3KKG A;  4L8P A;  3MG3 A;  5TGN A;  4H3U A;  5FW5 A;  5D82 A;  2GEY A;  3CNX A;  1EA2 A;  3EC9 A;  3GZX B;  2GXF A;  3G8Z A;  3MG2 A;  3MSO A;  4XBX A;  1OHP A;  3D9R A;  4HM3 B;  5DRV A;  1BUQ A;  1OH0 A;  3NHX A; 
#chains in the Genus database with same CATH topology
 4HM1 B;  1WQL B;  2WO0 A;  3F7S A;  3CCL 3;  3B4O A;  1Q40 B;  3X3Z A;  1A2K A;  1BSC A;  1FA3 A;  4H61 A;  1STD A;  1QAK A;  1OGX A;  3L0R A;  4EW5 A;  2PZV A;  2R41 A;  2GBX B;  1PYL A;  2RNT A;  3SOA A;  1DVC A;  1Q9E A;  1F8N A;  1CEW I;  1RMS A;  1BNE A;  1DET A;  1OPY A;  1VQ4 3;  3CCM 3;  1EEJ A;  1TFK A;  3U1W A;  4HJL B;  3CD6 3;  1VQO 3;  1GOU A;  1KD1 4;  1Q42 A;  4CJN A;  1D6Y A;  1ULJ B;  2GU3 A;  4EC6 A;  3EBY A;  3VF1 A;  3GSP A;  2XR8 B;  3JUQ A;  3F14 A;  4GL6 A;  1WMP A;  3X40 A;  1J2B A;  4EV2 A;  1NB3 I;  3MPH A;  1RGL A;  4IT7 A;  4WFO A;  4J8T A;  3RGA A;  3WOD G;  4JF8 A;  5AIF A;  4HVN A;  1R4Y A;  3SVA A;  1QMA A;  5EQL A;  1I8V A;  2WOH A;  1W4N A;  3MKI A;  1RRH A;  2E2V A;  4L7K A;  3EN1 B;  1QVF 2;  1D6U A;  1OHO A;  1SAR A;  4WWU C;  3CPO A;  1HZ1 A;  4K1V A;  3AGN A;  3BNC A;  4EXR A;  2SAR A;  3DGM A;  6STD A;  7RNT A;  2CFL A;  4R9L A;  3MHE A;  3BLZ A;  4O3V A;  3N54 B;  4HKV B;  1RCK A;  2F56 A;  2BIR A;  2STD A;  6RNT A;  1B21 A;  1W7C A;  2CWV A;  1JBT A;  1CQS A;  3Q1C A;  5IG4 A;  1VZZ A;  2A15 A;  1LOX A;  2GBW B;  2ML5 A;  3JUP A;  3LT8 A;  1SII A;  3QRD A;  4G1M B;  2B1X B;  2O3O A;  1JBR A;  2QGU A;  1SPU A;  3F8X A;  4LSO A;  2RGQ A;  3VSY A;  1B3S A;  3HI7 A;  4KFE A;  4HBR A;  3AMO A;  3GWR A;  3I56 3;  2P09 A;  4JRF A;  6GSP A;  3LTC A;  1AVL A;  2IUK A;  5JPP A;  3FF2 A;  3HIG A;  4TX4 A;  2HMM B;  1B2U A;  1I70 A;  2I9W A;  1I2F A;  4PEJ A;  3DY5 A;  2FGT A;  1JRQ A;  1BRG A;  2CKF B;  4RNZ A;  4Q53 A;  1VQM 3;  3FLJ A;  1N9J A;  4OK0 A;  1GS3 A;  1IU7 A;  2K54 A;  4R1K A;  1M1X B;  1SJW A;  2MC8 A;  2AAE A;  3DGL A;  2XFT A;  4EV5 A;  5D81 A;  3KCH A;  1GD4 A;  1DMQ A;  2F98 A;  4J9A A;  5AIG A;  3RDE A;  2CX1 A;  3T8U A;  5JBS A;  1S72 3;  4LZI A;  1KWI A;  2OWP A;  2M7O A;  3NXJ A;  4X2O A;  1O7H B;  1A90 A;  1Q7Y 4;  4R4K A;  4WYK A;  3OWY A;  1TFO A;  4OVM A;  1BRH A;  1RLS A;  3EJV A;  3LXU X;  1BAN A;  2CFK A;  4BIR A;  4CCV A;  1GMR A;  1LVN A;  3M8C A;  5IG5 A;  3H51 A;  1E97 A;  1NO3 A;  1BGS A;  1GOY A;  5M18 A;  4H3U A;  2ZL8 A;  4AKY A;  1RN1 A;  5IW9 A;  1FW7 A;  2GEY A;  2W56 B;  3PCS A;  4EBG A;  5I97 A;  2W9Q A;  3EC9 A;  4NHF A;  1BUQ A;  1M90 4;  1IVW A;  2RBI A;  1B2M A;  1OH0 A;  2XGL A;  3EB8 A;  2OQE C;  3DZL A;  3QK9 A;  5M19 A;  8RNT A;  5HOH A;  1FUS A;  4KFD A;  3D4A A;  3FG1 A;  3RGR A;  2WGQ A;  4ORL A;  3NV0 A;  3Q2P A;  2F99 A;  3I55 3;  1S5A A;  2HMJ B;  4CDL A;  2OQE A;  1FUT A;  2AAD A;  1MWR A;  2P0M A;  3KE7 A;  1RN4 A;  4N6T A;  3CPW 2;  5LC7 A;  3GZR A;  3NUV A;  5IEP A;  2W6J H;  1TUH A;  1Q82 4;  1TP6 A;  1M1K 4;  1E3V A;  1JN5 B;  3CC2 3;  1RDS A;  1UGH I;  1JB5 A;  1YNV X;  1I2E A;  2CX0 A;  2C10 A;  3LYG A;  1YI2 3;  1BRN L;  1BU4 A;  2W2C A;  4K90 B;  1VQN 3;  3NBJ A;  3UB1 A;  2CFW A;  3FCS B;  3CCJ 3;  5BVB A;  1YJN 3;  2P05 A;  4N6M A;  5IEN A;  1I3I A;  1IDP A;  4J5G A;  4HM8 B;  5KP3 A;  2H0I A;  2Z7A A;  2IMJ A;  1VQK 3;  1IQY A;  1BNS A;  1W2B 2;  1FGO A;  1KC8 4;  1AY7 A;  1ULI B;  3JUM A;  1B2X A;  3NBR A;  3TDG A;  1EQK A;  1IVV A;  4OUQ A;  3NM7 A;  3FZW A;  1BNR A;  3K9M C;  1DVD A;  1O7P B;  1RJO A;  1TU5 A;  1CYV A;  3FG4 A;  3CCQ 3;  3GZY B;  1SQW A;  1BNI A;  2CFD A;  3SXX A;  3K5T A;  2OOV A;  1NWW A;  7GSP A;  1EUI C;  4XBT A;  1BIR A;  5ELJ A;  3S5C A;  5AEU B;  1T2H A;  2RFR A;  3KN4 A;  4CPK A;  1L5G B;  1K73 4;  3SED A;  3X3X A;  5FGO A;  1RNB A;  1BSE A;  1KSI A;  3K63 A;  4HM6 B;  3SOY A;  2KCD A;  3KFQ C;  3BU4 A;  1BSB A;  1OF5 B;  3CC4 3;  4KT3 B;  4GB5 A;  3OX9 A;  1LRA A;  5CXO A;  2OCT A;  3DXO A;  3GRD A;  1MWU A;  3X3Y A;  4R9K A;  1VQL 3;  3WA2 X;  1BVI A;  1WTH A;  5CLK A;  1FGR A;  4STD A;  1Q81 4;  4HAA A;  3WA3 A;  2RSX A;  1LQG C;  2B24 B;  3Q90 A;  4DKI A;  1YVS A;  2FXT A;  1JB4 A;  2CW9 A;  3T8N A;  1I0X A;  3Q3F A;  4MMX B;  2BT3 A;  1WMO A;  2QIY A;  1O7W B;  3STD A;  3KII A;  1AQZ A;  1G96 A;  1GOV A;  2W0Q A;  1HKX A;  1RKY A;  2CC3 A;  2D1W A;  1AVK A;  3I0Y A;  2P38 A;  2BU4 A;  2F4Y A;  3N9H A;  4MEI A;  3PS8 A;  2SBL A;  3F9S A;  3MG1 A;  1DE3 A;  4ILF A;  5G1K A;  2MF7 A;  2Q07 A;  4FMD A;  1NB5 I;  1VQ5 3;  3A5E A;  4HZ9 B;  3S27 A;  2Z76 A;  2J8X B;  3D5G A;  4X2H A;  3UL6 A;  2O9U X;  3CU3 A;  1BUJ A;  1T5Y A;  3FSD A;  3CNM A;  3GAX A;  1RSN A;  2C4B A;  2W03 A;  2XH9 A;  4KZ1 A;  1ROA A;  3DH2 A;  3NX0 A;  1W6G A;  4L8O A;  1DMN A;  9RNT A;  3MWZ A;  2Z6B A;  4R80 A;  1IV7 A;  1YJ9 3;  1ZO2 A;  2BMR B;  5DRE A;  1BRS A;  4O8S A;  1R4C A;  1YGW A;  4HZB B;  4BU4 A;  3G0K A;  3BND A;  3AGO A;  3NQY A;  5CF2 A;  3CCU 3;  5EVH A;  4K1U A;  1OGZ A;  2YFJ B;  1O7N B;  3S67 A;  3MG3 A;  5FW5 A;  4N6L A;  1MGW A;  5BU4 A;  1HU9 A;  1UCI A;  1HYF A;  1EA2 A;  3CNX A;  3D79 A;  3BNB A;  3GZX B;  4XBX A;  2YX9 A;  1MOL A;  3D9R A;  1RGA A;  1N5P A;  1IT7 A;  4I4K A;  1T3B A;  1TRQ A;  4ZM8 A;  2KRT A;  3IPT A;  1UCL A;  3FKA A;  1VQ6 3;  1RNT A;  4IIA A;  1RGK A;  3LZA A;  1M9G A;  3G16 A;  3LTD A;  1TRP A;  1W00 A;  4LEH A;  1WNH A;  3OW2 2;  3NV0 B;  1VQQ A;  2ZHX B;  5IEO A;  1UCK A;  3O8Y A;  1GSP A;  1JZD A;  1UI8 A;  1B2S A;  3EHC A;  2F5M A;  1I2G A;  1C54 A;  1VQ7 3;  5RNT A;  2PNC A;  3NBB A;  5CK6 A;  1CH0 A;  1JZO A;  1BRK A;  2L1S A;  1C7H A;  1TJD A;  5EEO A;  3CCV 3;  1NJI 4;  1KQS 2;  2XSO B;  1YGE A;  4XB5 A;  1N8Q A;  2CH9 A;  2OOV C;  3G6E 3;  3H3H A;  3CME 3;  3ER7 A;  3JVC A;  5CF1 A;  3PYJ A;  4HM7 B;  5JPU A;  1K8A 4;  3D3L A;  1N8R 4;  2C11 A;  3CXC 2;  3AMO B;  5IF6 A;  2LYX A;  5D83 A;  4BTX A;  3OWU A;  1TIJ A;  1B27 A;  4N6O B;  3EQQ B;  3CCR 3;  1Q40 A;  1OUN A;  5AI1 A;  2CFG A;  2YFI B;  1K28 A;  5GSP A;  2CG0 A;  1BNJ A;  4AEQ A;  1MWS A;  5G1L A;  1LNH A;  7STD A;  3DGN A;  4O02 B;  3U97 A;  1RRL A;  2XGN A;  3BIR A;  3B8L A;  1MGR A;  1VQ9 3;  1LOY A;  1UDI I;  1Z1S A;  2P0X A;  3T0U A;  2W04 A;  1US1 A;  1QVG 2;  1Q7H A;  2D42 A;  2WGO A;  1UUV B;  3OXA A;  2K3D A;  1A2P A;  2CWU A;  5IER A;  2HMK B;  4RNY A;  3DGY A;  2GEX A;  3S28 A;  3RNT A;  2IA7 A;  4XM4 A;  3PXM A;  5G2G A;  1GD3 A;  2QA4 3;  1PFP A;  4HM2 B;  3DUK A;  3D5I A;  1FGQ A;  1IK3 A;  3ECF A;  3IJE B;  3ZFZ A;  1W6Y A;  1TTO A;  2OTJ 3;  1RGC A;  1QJG A;  2GU1 A;  2K0M A;  2HMN B;  8CHO A;  5KP1 A;  1JNQ A;  3PZW A;  1X1W A;  3JUO A;  4HOH A;  1IVX A;  5AII A;  3G4S 3;  1AV4 A;  4IPB A;  5HGR A;  5IG3 A;  1MNL A;  1ZX2 A;  3EX9 A;  1GMQ A;  1JKG B;  3UNL A;  1MWT A;  3EF8 A;  1STF I;  3F7X A;  4BTY A;  5AEW B;  2BNG A;  2UX0 A;  2KF3 A;  3N8B A;  3SX1 A;  1W5Z A;  3HZP A;  3SYU A;  4K61 A;  4O2H A;  5M1A A;  3V92 A;  1LNI A;  3J7Y d;  1VQP 3;  1IQX A;  3VGN A;  1D6Z A;  4XDV A;  2CWT A;  1W02 A;  4KVH A;  1BRI A;  1V74 A;  2Y74 A;  3WDG B;  1UI7 A;  2BMQ B;  2KF4 A;  1RGF A;  2UGI A;  3V99 A;  4N3V A;  2R4I A;  1E3R A;  1RGE A;  3LH4 A;  3PCR A;  3MYT A;  1I0V A;  3GZB A;  3SLU A;  1OF5 A;  4GSP A;  1X1Y A;  2XRX B;  1RCL A;  1QAF A;  2XFS A;  4N6V 0;  3CCS 3;  1CYU A;  3WR2 A;  1DYU A;  1W2Z A;  1IVU A;  3MG2 A;  1BNG A;  2GXF A;  3G8Z A;  3MSO A;  5DRV A;  1JJ2 2;  4HM3 B;  1YIJ 3;  2W56 A;  4RNT A;  1ASK A;  1IT8 A;  2IYJ A;  2L4V A;  1RGH A;  2XF3 A;  4WP5 A;  3ZG0 A;  3BNE A;  3IMA B;  5STD A;  3X42 A;  1JB2 A;  1OCV A;  3G71 3;  1FGM A;  3X41 A;  5BIR A;  1A67 A;  4LYL B;  3S29 A;  1RGG A;  3WOF B;  3JUN A;  4RZM A;  4FMA A;  5IG0 A;  3E99 A;  2HOH A;  3AHW A;  3OV4 A;  1W01 A;  4AKZ A;  3BB9 A;  3A76 A;  4RBN A;  2KF5 A;  1IV9 A;  1ZGX A;  2F5W A;  4FR9 A;  1ISK A;  4WYK B;  1OHS A;  3URP A;  1N5H A;  1BAO A;  4HM4 B;  1FYS A;  2KAA A;  4MJD A;  1I3F A;  1G02 A;  1EG9 B;  3WHO A;  3UJM A;  2WOF A;  1V57 A;  2JQ5 A;  2CHC A;  5ELU A;  2XEP A;  2Z77 A;  1VQ8 3;  1UUG B;  2V1L A;  1NU3 A;  1K41 A;  1BNF A;  2ML6 A;  1V58 A;  2ZDJ A;  2OTL 3;  3LTB A;  1SIH A;  1GYB A;  1LQM B;  2E2T A;  3V98 A;  2RCD A;  3LT9 A;  1G0T A;  3CC7 3;  3K7C A;  4HM0 B;  1YIT 3;  3FH1 A;  3FGY A;  1UCJ A;  3ZG5 A;  3AHS A;  1N9E A;  3EN8 A;  1Q86 4;  1GY7 A;  2H0H A;  1B20 A;  3HII A;  1AR0 A;  4FCM A;  4FMC A;  1X1U A;  2H0G A;  4KFF A;  2BO9 B;  1FUW A;  2JDI H;  1LOW A;  5BXQ A;  4LMI A;  1T2I A;  3EE1 A;  1JV2 B;  3EBT A;  4FCJ A;  3OWS A;  4LGQ A;  1UUW B;  1RTU A;  1GY6 A;  2F86 B;  1OAC A;  5KP4 A;  4MMZ B;  2ZA4 A;  2GSP A;  2KXG A;  1FGT A;  1JKG A;  3PGB A;  1B2Z A;  3ROB A;  4BL2 A;  2QEX 3;  2HML B;  4FMB A;  3HOH A;  1DMM A;  2YFL B;  3FF0 A;  4XDW A;  2E2U A;  4GHO A;  5LC6 A;  4NPB A;  4HYZ A;  1UGI A;  3KZT A;  3UL5 A;  1RN7 A;  1WMN A;  1UW1 A;  1LXE A;  2KF6 A;  3DM8 A;  1U5O A;  3HX8 A;  2IUJ A;  2CK3 H;  3KSE D;  4FCZ A;  3LML A;  1ROV A;  2BHM A;  3ALA A;  1GY5 A;  3F8H A;  4I5Q A;  1LOV A;  1K9M 4;  1O7M B;  3WOE B;  5AYS C;  3DGO A;  1A2V A;  4N6N B;  3LOY A;  1U8C B;  2FNQ A;  3NQZ A;  1GMP A;  1NDO B;  4BL3 A;  1IQ8 A;  5AIH A;  1JBS A;  2IY2 A;  1NNV A;  3K0Z A;  1BSA A;  3NM2 A;  1YJW 3;  1JN5 A;  2CG1 A;  4BTW A;  2CIU A;  1BOX A;  2LQV A;  3CCE 3;  2BMO B;  3CMA 3;  3LTA A;  2Y73 A;  3HK4 A;  3WMD A;  1BSD A;  1IYY A;  2INX A;  3DMC A;  4HM5 B;  2XSH B;  1W6C A;  3F40 A;  4U13 A;  2W9P A;  1YVB I;  3B4P A;  1EKM A;  4NRE A;  1RHL A;  2HMO B;  1FZU A;  1PY3 A;  1ZS7 A;  3KSP A;  5AYR B;  1PU4 A;  1O7G B;  4XBY A;  3KKG A;  3B7C A;  4L8P A;  1Y4K A;  1YHQ 3;  3FG3 A;  4J5K A;  1QAL A;  5TGN A;  2UUG C;  5A0O B;  5D82 A;  4WHA A;  1X1X A;  4EYC A;  4QWT A;  1OHP A;  4N6U A;  4MMY B;  1BRJ A;  3NHX A; 
#chains in the Genus database with same CATH homology
 4HM1 B;  1WQL B;  2WO0 A;  3F7S A;  3CCL 3;  3B4O A;  1Q40 B;  3X3Z A;  1A2K A;  1FA3 A;  4H61 A;  1STD A;  1QAK A;  1OGX A;  3L0R A;  2PZV A;  2GBX B;  3SOA A;  1DVC A;  1F8N A;  1CEW I;  1OPY A;  1VQ4 3;  3CCM 3;  1TFK A;  3U1W A;  4HJL B;  3CD6 3;  1VQO 3;  1KD1 4;  1Q42 A;  1D6Y A;  1ULJ B;  2GU3 A;  4EC6 A;  3EBY A;  3VF1 A;  4GL6 A;  2XR8 B;  3JUQ A;  3F14 A;  3X40 A;  1WMP A;  1J2B A;  4EV2 A;  1NB3 I;  3MPH A;  4IT7 A;  4WFO A;  4J8T A;  3RGA A;  3WOD G;  4JF8 A;  5AIF A;  4HVN A;  3SVA A;  1QMA A;  5EQL A;  2WOH A;  1W4N A;  3MKI A;  1RRH A;  2E2V A;  4L7K A;  3EN1 B;  1QVF 2;  1D6U A;  1OHO A;  4WWU C;  3CPO A;  4K1V A;  4EXR A;  3BNC A;  3DGM A;  6STD A;  2CFL A;  4R9L A;  3MHE A;  3BLZ A;  4O3V A;  3N54 B;  4HKV B;  2STD A;  1W7C A;  2CWV A;  1CQS A;  3Q1C A;  5IG4 A;  1VZZ A;  2A15 A;  1LOX A;  2GBW B;  2ML5 A;  3JUP A;  3LT8 A;  1SII A;  3QRD A;  4G1M B;  2B1X B;  2O3O A;  2QGU A;  1SPU A;  3F8X A;  4LSO A;  2RGQ A;  3VSY A;  3HI7 A;  4KFE A;  4HBR A;  3AMO A;  3GWR A;  3I56 3;  2P09 A;  4JRF A;  3LTC A;  1AVL A;  2IUK A;  5JPP A;  3FF2 A;  3HIG A;  4TX4 A;  2HMM B;  2I9W A;  4PEJ A;  3DY5 A;  2FGT A;  1JRQ A;  2CKF B;  4RNZ A;  4Q53 A;  1VQM 3;  3FLJ A;  1N9J A;  4OK0 A;  1GS3 A;  1IU7 A;  2K54 A;  4R1K A;  1M1X B;  1SJW A;  2MC8 A;  3DGL A;  2XFT A;  4EV5 A;  5D81 A;  1GD4 A;  1DMQ A;  2F98 A;  4J9A A;  5AIG A;  3RDE A;  3T8U A;  5JBS A;  1S72 3;  4LZI A;  1KWI A;  2OWP A;  2M7O A;  3NXJ A;  4X2O A;  1O7H B;  1A90 A;  1Q7Y 4;  4R4K A;  4WYK A;  3OWY A;  1TFO A;  4OVM A;  3EJV A;  3LXU X;  2CFK A;  4CCV A;  1LVN A;  3M8C A;  5IG5 A;  3H51 A;  1E97 A;  1NO3 A;  4H3U A;  2ZL8 A;  4AKY A;  5IW9 A;  2GEY A;  2W56 B;  3PCS A;  4EBG A;  5I97 A;  2W9Q A;  3EC9 A;  4NHF A;  1BUQ A;  1M90 4;  1IVW A;  1OH0 A;  2XGL A;  3EB8 A;  2OQE C;  3DZL A;  3QK9 A;  4KFD A;  3FG1 A;  3RGR A;  2WGQ A;  4ORL A;  3NV0 A;  3Q2P A;  2F99 A;  3I55 3;  1S5A A;  2HMJ B;  4CDL A;  2OQE A;  3KE7 A;  2P0M A;  4N6T A;  3CPW 2;  5LC7 A;  3GZR A;  3NUV A;  5IEP A;  2W6J H;  1TUH A;  1Q82 4;  1TP6 A;  1M1K 4;  1E3V A;  1JN5 B;  3CC2 3;  1YI2 3;  1JB5 A;  2C10 A;  3LYG A;  2W2C A;  4K90 B;  1VQN 3;  3NBJ A;  3UB1 A;  2CFW A;  3FCS B;  3CCJ 3;  5BVB A;  1YJN 3;  2P05 A;  4N6M A;  1IDP A;  4HM8 B;  5KP3 A;  2Z7A A;  2IMJ A;  1VQK 3;  1IQY A;  1W2B 2;  1FGO A;  1KC8 4;  1ULI B;  3JUM A;  3NBR A;  3TDG A;  1EQK A;  1IVV A;  4OUQ A;  3NM7 A;  3FZW A;  1DVD A;  3K9M C;  1O7P B;  1RJO A;  1TU5 A;  1CYV A;  3FG4 A;  3CCQ 3;  3GZY B;  1SQW A;  2CFD A;  3SXX A;  3K5T A;  2OOV A;  1NWW A;  4XBT A;  5ELJ A;  3S5C A;  5AEU B;  2RFR A;  3KN4 A;  1L5G B;  1K73 4;  3SED A;  3X3X A;  5FGO A;  1KSI A;  3K63 A;  4HM6 B;  3SOY A;  2KCD A;  3KFQ C;  1OF5 B;  3CC4 3;  4GB5 A;  3OX9 A;  5CXO A;  2OCT A;  3DXO A;  3GRD A;  3X3Y A;  4R9K A;  1VQL 3;  3WA2 X;  1WTH A;  5CLK A;  1FGR A;  4STD A;  1Q81 4;  3WA3 A;  2RSX A;  2B24 B;  3Q90 A;  2FXT A;  1JB4 A;  2CW9 A;  3T8N A;  4MMX B;  2BT3 A;  1WMO A;  2QIY A;  1O7W B;  3STD A;  3KII A;  1G96 A;  2W0Q A;  1HKX A;  1RKY A;  2CC3 A;  2D1W A;  1AVK A;  3I0Y A;  2P38 A;  3N9H A;  4MEI A;  3PS8 A;  2SBL A;  3F9S A;  3MG1 A;  2MF7 A;  2Q07 A;  4FMD A;  1NB5 I;  1VQ5 3;  4HZ9 B;  3S27 A;  2Z76 A;  3UL6 A;  4X2H A;  2O9U X;  3CU3 A;  1T5Y A;  3FSD A;  3CNM A;  3GAX A;  2W03 A;  2XH9 A;  4KZ1 A;  1ROA A;  3NX0 A;  4L8O A;  1W6G A;  1DMN A;  3MWZ A;  2Z6B A;  4R80 A;  1IV7 A;  1YJ9 3;  1ZO2 A;  2BMR B;  5DRE A;  4O8S A;  5IEN A;  1R4C A;  4HZB B;  5CF2 A;  3G0K A;  3BND A;  3NQY A;  3CCU 3;  5EVH A;  4K1U A;  1OGZ A;  2YFJ B;  1O7N B;  3S67 A;  3MG3 A;  5FW5 A;  4N6L A;  1HU9 A;  3CNX A;  1EA2 A;  4XBX A;  3BNB A;  3GZX B;  2YX9 A;  1MOL A;  3D9R A;  1N5P A;  1IT7 A;  4I4K A;  4ZM8 A;  2KRT A;  3IPT A;  3FKA A;  1VQ6 3;  4IIA A;  3LZA A;  1M9G A;  3G16 A;  3LTD A;  1W00 A;  4LEH A;  1WNH A;  3OW2 2;  3NV0 B;  5IEO A;  3O8Y A;  1UI8 A;  3EHC A;  1VQ7 3;  2PNC A;  3NBB A;  5CK6 A;  1C7H A;  5EEO A;  3CCV 3;  1NJI 4;  1KQS 2;  2XSO B;  1YGE A;  4XB5 A;  1N8Q A;  2CH9 A;  2OOV C;  3G6E 3;  3H3H A;  3CME 3;  3ER7 A;  3JVC A;  5CF1 A;  3PYJ A;  4HM7 B;  5JPU A;  1K8A 4;  3D3L A;  1N8R 4;  2C11 A;  3CXC 2;  3AMO B;  5IF6 A;  2LYX A;  5D83 A;  4BTX A;  3OWU A;  1TIJ A;  4N6O B;  3EQQ B;  3CCR 3;  1Q40 A;  1OUN A;  2CFG A;  2YFI B;  1K28 A;  2CG0 A;  4AEQ A;  1LNH A;  7STD A;  3DGN A;  4O02 B;  3U97 A;  1RRL A;  2XGN A;  3B8L A;  1VQ9 3;  1Z1S A;  2P0X A;  3T0U A;  2W04 A;  1US1 A;  1QVG 2;  2D42 A;  2WGO A;  1UUV B;  3OXA A;  2CWU A;  5IER A;  2HMK B;  4RNY A;  2GEX A;  3S28 A;  2IA7 A;  4XM4 A;  3PXM A;  5G2G A;  1GD3 A;  2QA4 3;  1PFP A;  4HM2 B;  3DUK A;  1FGQ A;  1IK3 A;  3ECF A;  3IJE B;  2OTJ 3;  1W6Y A;  1QJG A;  2GU1 A;  2K0M A;  2HMN B;  8CHO A;  1JNQ A;  3PZW A;  3JUO A;  1IVX A;  5AII A;  3G4S 3;  1AV4 A;  4IPB A;  5HGR A;  5IG3 A;  1MNL A;  1ZX2 A;  3EX9 A;  1JKG B;  3UNL A;  3EF8 A;  1STF I;  3F7X A;  4BTY A;  5AEW B;  2BNG A;  2UX0 A;  3N8B A;  3SX1 A;  1W5Z A;  3HZP A;  4K61 A;  4O2H A;  3J7Y d;  1VQP 3;  1IQX A;  3VGN A;  1D6Z A;  4XDV A;  2CWT A;  1W02 A;  4KVH A;  2Y74 A;  1V74 A;  3WDG B;  1UI7 A;  2BMQ B;  3V99 A;  4N3V A;  2R4I A;  1E3R A;  3LH4 A;  3PCR A;  3MYT A;  3GZB A;  3SLU A;  1OF5 A;  2XRX B;  1QAF A;  2XFS A;  4N6V 0;  3CCS 3;  1CYU A;  1DYU A;  1W2Z A;  1IVU A;  3MG2 A;  2GXF A;  3G8Z A;  3MSO A;  5DRV A;  1JJ2 2;  4HM3 B;  1YIJ 3;  2W56 A;  1IT8 A;  1ASK A;  2XF3 A;  2L4V A;  4WP5 A;  3BNE A;  3IMA B;  5STD A;  3X42 A;  1JB2 A;  1OCV A;  3G71 3;  1FGM A;  3X41 A;  1A67 A;  3S29 A;  3WOF B;  3JUN A;  4RZM A;  4FMA A;  5IG0 A;  3E99 A;  3OV4 A;  1W01 A;  4AKZ A;  3BB9 A;  3A76 A;  4RBN A;  1IV9 A;  1ISK A;  4FR9 A;  4WYK B;  1OHS A;  1N5H A;  4HM4 B;  4MJD A;  1EG9 B;  3UJM A;  2WOF A;  2JQ5 A;  2CHC A;  5ELU A;  2XEP A;  2Z77 A;  1VQ8 3;  2V1L A;  1NU3 A;  1K41 A;  2ML6 A;  2ZDJ A;  2OTL 3;  3LTB A;  1SIH A;  1GYB A;  2E2T A;  3V98 A;  2RCD A;  3LT9 A;  3CC7 3;  3K7C A;  4HM0 B;  1YIT 3;  3FH1 A;  3FGY A;  3EN8 A;  1N9E A;  1Q86 4;  1GY7 A;  3HII A;  4FMC A;  4FCM A;  1AR0 A;  5AI1 A;  5KP1 A;  4KFF A;  2BO9 B;  1FUW A;  2JDI H;  5BXQ A;  4LMI A;  3EE1 A;  1JV2 B;  3EBT A;  4FCJ A;  3OWS A;  4LGQ A;  1UUW B;  1GY6 A;  2F86 B;  1OAC A;  5KP4 A;  4MMZ B;  3PGB A;  2KXG A;  1FGT A;  1JKG A;  3ROB A;  2QEX 3;  2HML B;  4FMB A;  1DMM A;  2YFL B;  3FF0 A;  4XDW A;  2E2U A;  5LC6 A;  4HYZ A;  3KZT A;  3UL5 A;  1RN7 A;  1WMN A;  1UW1 A;  1LXE A;  3DM8 A;  1U5O A;  3HX8 A;  2IUJ A;  2CK3 H;  3KSE D;  4FCZ A;  3LML A;  1ROV A;  2BHM A;  3ALA A;  1GY5 A;  3F8H A;  1K9M 4;  1O7M B;  3WOE B;  5AYS C;  3DGO A;  1A2V A;  4N6N B;  3LOY A;  1U8C B;  2FNQ A;  3NQZ A;  1NDO B;  1IQ8 A;  5AIH A;  3K0Z A;  3NM2 A;  1YJW 3;  1JN5 A;  2CG1 A;  4BTW A;  2CIU A;  2LQV A;  3CCE 3;  2BMO B;  3CMA 3;  3LTA A;  2Y73 A;  3HK4 A;  3WMD A;  2INX A;  3DMC A;  4HM5 B;  2XSH B;  1W6C A;  3F40 A;  4U13 A;  2W9P A;  1YVB I;  3B4P A;  1EKM A;  4NRE A;  2HMO B;  5AYR B;  3KSP A;  1PU4 A;  1O7G B;  4XBY A;  3KKG A;  3B7C A;  4L8P A;  1Y4K A;  1YHQ 3;  3FG3 A;  1QAL A;  5TGN A;  5A0O B;  5D82 A;  4WHA A;  4EYC A;  4QWT A;  1OHP A;  4N6U A;  4MMY B;  3V92 A;  3NHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...