1U5OA

Structure of the d23a mutant of the nuclear transport carrier ntf2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFANDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear transport factor 2
publication title Computational and biochemical identification of a nuclear pore complex binding site on the nuclear transport carrier NTF2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1u5oA00
4XBYA 1W02A 3DMCA 4HM4B 3D9RA 2RCDA 2F86B 5IG0A 3WMDA 2XSOB 5DRVA 2BNGA 3B4OA 3EC9A 3EN1B 3F8XA 3EN8A 3A76A 4J9AA 1GY7A 1OH0A 4HM5B 4ORLA 3GZRA 2F99A 1OUNA 2Z7AA 4WP5A 1DMQA 3OWUA 3VGNA 5IG3A 3FH1A 4OVMA 3ER7A 4X2HA 1NU3A 1O7PB 3NV0B 3HZPA 3JUOA 5G2GA 4XBTA 4HM3B 3KSPA 3Q90A 5CXOA 1IDPA 5AEUB 2BMOB 3EQQB 2HMNB 5EVHA 2YFLB 4CDLA 4K1UA 5D81A 2GXFA 1OHSA 2W2CA 3EHCA 1EA2A 3MKIA 3HK4A 1NDOB 4FCMA 3SOAA 5IF6A 3NXJA 5IEOA 3K7CA 5DREA 2HMMB 4HM7B 1Z1SA 1ULIB 4HM6B 2YFIB 3DZLA 4R1KA 4XM4A 3CNMA 3UNLA 1AR0A 4XB5A 1QMAA 2GBXB 2STDA 3DXOA 1OF5A 1C7HA 4WYKA 4K1VA 3K0ZA 2GEXA 3FZWA 3KE7A 1EG9B 5AI1A 1CQSA 3STDA 1W01A 4L7KA 5CF1A 3FLJA 7STDA 3F8HA 1OGXA 5IENA 5KP3A 5IG4A 3G0KA 4U13A 3T8NA 3EX9A 5D83A 2GEYA 2INXA 4XBXA 3OV4A 2Z77A 3B8LA 5TGNA 1TP6A 1TUHA 5AEWB 3B4PA 3JUPA 3M8CA 4OUQA 1O7GB 2XRXB 3GZXB 2B24B 3F40A 1O7NB 4XDWA 3G16A 1GY6A 1JKGB 3UJMA 3DUKA 3GWRA 3VSYA 2IMJA 3SOYA 3JUMA 4KVHA 5IEPA 4L8PA 2RFRA 1K41A 1E97A 4FCJA 1A2KA 2Z76A 2YFJB 4Q53A 3BLZA 3F9SA 5BVBA 4HZBB 2HMJB 3F14A 3E99A 3FKAA 3B7CA 4I4KA 1GY5A 3FGYA 4GB5A 1OPYA 1W00A 3KZTA 5FW5A 2A15A 1JB5A 3HX8A 5CK6A 5AIFA 1E3VA 1Q40B 3G8ZA 5IG5A 1O7WB 1JKGA 2XSHB 3NV0A 3EBTA 3I0YA 4J8TA 5CLKA 5HGRA 1W6YA 3RGRA 5BXQA 1DMNA 1QJGA 1O7MB 4LEHA 5AIHA 3GZBA 4LGQA 5KP1A 3ROBA 4R9LA 3MYTA 2OWPA 1GS3A 2BMRB 4R9KA 1SJWA 4RZMA 3NBRA 4LMIA 2QIYA 2RGQA 3DM8A 1UUWB 5D82A 2R4IA 1O7HB 1ZX2A 4X2OA 1OHOA 2CKFB 4HVNA 8CHOA 2HMLB 1Q40A 3IPTA 3OXAA 1S5AA 5STDA 2B1XB 1JN5B 3FF2A 1OHPA 4N3VA 4XDVA 6STDA 3OX9A 3EJVA 1JB2A 2F98A 1OCVA 3S5CA 3EBYA 3MG3A 3FF0A 4L8OA 4IIAA 5KP4A 1ASKA 2K54A 3MSOA 4HM1B 4HM8B 5JPUA 3NM2A 4HJLB 3SEDA 1E3RA 3OWYA 3LYGA 3GZYB 1GYBA 4HM2B 4WWUC 3CU3A 3T8UA 5AIIA 5IERA 3JUQA 3CNXA 1JB4A 3F7SA 5AIGA 3MG2A 1OF5B 4STDA 3GRDA 4WYKB 1ZO2A 1UUVB 3RGAA 3CPOA 2JQ5A 5CF2A 1JN5A 2BMQB 2UX0A 3NHXA 2XR8B 2HMKB 3H3HA 1OGZA 1ISKA 3OWSA 3FSDA 4H3UA 2PZVA 1DMMA 3NUVA 3ECFA 3MG1A 1WQLB 4HZ9B 3LZAA 1VZZA 4HKVB 5JPPA 3KKGA 1NWWA 1ULJB 3F7XA 2QGUA 3JUNA 4MJDA 1STDA 4PEJA 1U5OA 2HMOB 2I9WA 3H51A 3MHEA 2CHCA 3EF8A 4HM0B 1Q42A 2GBWB 1HKXA 1BUQA 3BB9A
chains in the Genus database with same CATH superfamily
3Q3FA 1FUSA 2F5WA 4XBYA 1W02A 1RGCA 3DMCA 4HM4B 3CCJ3 1MWRA 1BNJA 1YGWA 4LZIA 1BNIA 3BIRA 1SPUA 1W5ZA 5RNTA 2R41A 3D9RA 2RCDA 4RBNA 2XF3A 4BTYA 4O02B 1W4NA 1IQYA 2F86B 3TDGA 1YHQ3 5IG0A 4FMCA 3NQYA 1FA3A 1B2UA 3WMDA 1GD3A 1YIT3 2XSOB 1ROAA 3AMOA 5DRVA 1VQK3 1IVVA 2P0XA 1BNFA 1RGFA 2KAAA 2AAEA 3K63A 2BNGA 3B4OA 3EC9A 1QAKA 3EN1B 1C54A 1W6CA 4O8SA 3F8XA 5BIRA 2MC8A 3CC23 3CCM3 3LOYA 3EN8A 3A76A 3LT8A 3LXUX 4J9AA 1B2MA 1LOVA 4H61A 1GY7A 2RSXA 5IW9A 4EYCA 1HU9A 1VQ53 3S67A 1OH0A 4G1MB 1JV2B 4HM5B 4ORLA 3GZRA 4N6TA 3NQZA 2F99A 3HI7A 3LTDA 4NPBA 1VQ83 4MMZB 3N8BA 2RNTA 2CFGA 3CCR3 1US1A 3N9HA 1RHLA 4J5GA 2KXGA 1OUNA 3AHSA 2Z7AA 4WP5A 3N54B 1DMQA 2GU1A 3OWUA 3VGNA 5IG3A 3FH1A 1LOXA 4MEIA 4OVMA 3ER7A 1Q824 1QVG2 3J7Yd 2XFSA 1I8VA 1BNSA 1GSPA 4X2HA 1NU3A 1M904 3X3YA 1QVF2 1YJW3 1UDII 3ZG0A 1O7PB 1HZ1A 4R4KA 1MGRA 3NV0B 3HZPA 3JUOA 1BIRA 3ZG5A 1VQL3 3D79A 1DVDA 3D5IA 4N6LA 3WOEB 4O3VA 5LC6A 1RKYA 5G2GA 3HOHA 4XBTA 1JBTA 1LNIA 4HM3B 3KSPA 6GSPA 3Q90A 1R4CA 1GMRA 2J8XB 4AKZA 4GL6A 3QRDA 1B20A 2L1SA 1BRKA 1GMQA 1G0TA 5CXOA 1N9JA 1IDPA 1Y4KA 5AEUB 1I0XA 2SARA 3WA3A 2W03A 2BMOB 3EQQB 2HMNB 3LMLA 5EVHA 1W6GA 1I3FA 5AYRB 2H0IA 2YFLB 1RCKA 4CDLA 4K1UA 5D81A 4EC6A 3CCU3 1RGLA 1MWSA 2C4BA 2GXFA 1OHSA 1LXEA 1M9GA 1WNHA 2BIRA 1TFKA 2W2CA 1BUJA 5I97A 3CPW2 1QALA 3EHCA 1EA2A 3MKIA 3PXMA 1DYUA 3MWZA 4N6MA 2FXTA 4R80A 3HK4A 4HYZA 1NDOB 4FCMA 3SOAA 1STFI 3BU4A 3NXJA 5IEOA 5IF6A 4NREA 3CCS3 3K7CA 2AADA 1B27A 1K8A4 2CG1A 2ZDJA 5DREA 1RN7A 1TTOA 1J2BA 3T0UA 2UUGC 1X1XA 3MPHA 1UCIA 2IA7A 1YVBI 2Q07A 2CFLA 2HMMB 3S27A 1NB3I 2OQEA 4HM7B 3FG4A 1Z1SA 1ULIB 3DGMA 1AV4A 2E2UA 1YNVX 4HM6B 1BNRA 1BNEA 2YFIB 2CC3A 3BNEA 1VQN3 1S723 3SX1A 3DZLA 4R1KA 4XM4A 3CNMA 3UNLA 3L0RA 3HIGA 1Q7Y4 1BRHA 1AR0A 1RGKA 4XB5A 1QMAA 3CC73 3PS8A 2BHMA 2GBXB 2STDA 1NB5I 1LOWA 3DXOA 1IT7A 1OF5A 1C7HA 4WYKA 4AKYA 3CXC2 1LRAA 2XH9A 3RNTA 1YJ93 5GSPA 1FW7A 1TU5A 2H0HA 2Y74A 4K1VA 3K0ZA 2GEXA 5EQLA 1WMOA 3FZWA 1B2XA 3KE7A 2XGLA 4KFDA 1EG9B 1IQXA 1CEWI 5AI1A 3DY5A 1VQM3 1CQSA 3NBBA 3STDA 5HOHA 1W01A 2HOHA 4L7KA 3SYUA 4FMBA 5CF1A 3FLJA 7STDA 3PGBA 3F8HA 3PCRA 1OGXA 4GSPA 3U1WA 5IENA 5KP3A 5IG4A 2H0GA 1YGEA 3G0KA 4U13A 1N9EA 5BU4A 1DVCA 2ZL8A 1MOLA 1PY3A 3IMAB 3T8NA 3DGLA 3EX9A 3NM7A 5ELUA 2CH9A 1UW1A 4NHFA 4RNYA 2IUJA 5D83A 2GEYA 1OACA 1DETA 3PCSA 5G1LA 2INXA 4XBXA 1TFOA 3Q2PA 1VQ93 3OV4A 1B2SA 2Z77A 3CCL3 3B8LA 4K90B 1X1YA 5TGNA 2QEX3 1TP6A 1TUHA 5AEWB 3CCE3 2OTL3 2F4YA 6RNTA 1K28A 3B4PA 4N6NB 1FGOA 2GU3A 5ELJA 3BNDA 3A5EA 3JUPA 1UGHI 3M8CA 2ZA4A 4N6OB 4OUQA 1BANA 1RTUA 1O7GB 3KFQC 4EW5A 4GHOA 1IV9A 2XRXB 3WODG 3GZXB 2CWUA 1M1K4 1WMNA 1BSDA 2B24B 3X42A 2P09A 1RLSA 1RGGA 1LVNA 3F40A 1X1WA 1O7NB 1YI23 3K5TA 4XDWA 1LNHA 1Q9EA 1TJDA 1KQS2 3G16A 2ZHXB 1GY6A 4KFFA 4JRFA 1LQMB 1RDSA 1UGIA 1JKGB 2D42A 2IY2A 3AHWA 3X41A 3UJMA 1AVLA 1G96A 3DUKA 1BRGA 3GWRA 2IYJA 3VSYA 4BTWA 1UI8A 1BSCA 1RN1A 2IMJA 3NX0A 3SOYA 4KFEA 1EEJA 3JUMA 3X40A 3CME3 1JJ22 4HAAA 4KVHA 1B3SA 1RGEA 5IEPA 3LTAA 4L8PA 1W7CA 3FCSB 3V98A 1FGMA 2RFRA 3KN4A 3LH4A 1N8QA 1T5YA 1K41A 1E97A 3S28A 1DE3A 2KF5A 4FCJA 3S29A 1KD14 1BGSA 1A2KA 2Z76A 2LQVA 1G02A 2P05A 4I5QA 2YFJB 4CPKA 4BL3A 4Q53A 1BVIA 4RNZA 1YVSA 2CFWA 2E2VA 3BLZA 3F9SA 1LQGC 1CYUA 1HYFA 4K61A 5BVBA 3HIIA 5FGOA 4HZBB 1FZUA 2HMJB 2O9UX 1B2ZA 1AQZA 1JZOA 1RRLA 1UUGB 3F14A 4BTXA 1IV7A 1BRIA 3E99A 1SIHA 1FGTA 2M7OA 2W9PA 3FKAA 1X1UA 3B7CA 3GSPA 3O8YA 4I4KA 3I553 1N8R4 1GY5A 3FGYA 4GB5A 1JBRA 1OPYA 1RNTA 2KF3A 2WO0A 1W00A 3BNBA 2Z6BA 3KZTA 2JDIH 5FW5A 2YX9A 2A15A 1JB5A 2RBIA 3HX8A 1JZDA 3CD63 5CK6A 1RN4A 1BOXA 3WHOA 2W6JH 3WDGB 1SIIA 5AIFA 1E3VA 1TIJA 1TRQA 1VQP3 1MGWA 2CWTA 1IK3A 1IYYA 1Q40B 2XEPA 3G8ZA 4RNTA 5JBSA 2CFDA 4LYLB 5IG5A 1O7WB 3CMA3 1JKGA 3SVAA 3WOFB 2XSHB 2E2TA 3NV0A 3EBTA 3I0YA 4J8TA 5CLKA 3RDEA 3ZFZA 1VQ63 1NNVA 1BSEA 3X3ZA 5HGRA 1A90A 1KSIA 1W6YA 3RGRA 1LOYA 4FMDA 5BXQA 7GSPA 3KSED 1DMNA 1QJGA 1ZGXA 3UL5A 1O7MB 2F5MA 5M19A 1T2IA 1I70A 4LEHA 5AIHA 1BNGA 3GZBA 1YIJ3 3D5GA 1IVUA 1RSNA 4LGQA 5KP1A 2D1WA 3ROBA 4R9LA 4QWTA 3OW22 2P38A 3V99A 3MYTA 2CX0A 2KRTA 3EB8A 1FGRA 1BU4A 2IUKA 1IVXA 2OWPA 1T3BA 1W2ZA 1GS3A 2BMRB 1GOUA 2ML5A 4BU4A 4HBRA 4FMAA 4R9KA 1SJWA 3FG1A 3NBRA 4LMIA 4RZMA 2QIYA 2RGQA 1SQWA 2LYXA 2OOVC 3DM8A 1UUWB 5D82A 9RNTA 1JBSA 1Q814 1TRPA 2R4IA 3WR2A 1O7HB 3AGOA 2KF6A 1V57A 1ZX2A 4X2OA 1OHOA 2WGOA 1ROVA 1N5HA 2F56A 1N5PA 2BO9B 1MNLA 1M1XB 1V58A 2CKFB 4HVNA 4CJNA 3PYJA 1GD4A 2K3DA 3QK9A 2C11A 1Q864 1WTHA 8RNTA 5M18A 2CW9A 3UL6A 5A0OB 8CHOA 1R4YA 2HMLB 4DKIA 1Q40A 3IPTA 2OQEC 1RRHA 2CIUA 3OXAA 1B21A 3DGNA 1IVWA 1S5AA 2UGIA 5STDA 2B1XB 1JN5B 5AYSC 2QA43 3FF2A 3GAXA 2P0MA 1OHPA 4N3VA 4XDVA 1KC84 1ZS7A 1IU7A 1RCLA 3CC43 2CG0A 1Q7HA 6STDA 1EUIC 1QAFA 3CCQ3 3SXXA 1UCLA 2W56B 1BAOA 2WOFA 3OX9A 1NJI4 3NBJA 2FNQA 1PYLA 1YJN3 3EJVA 1JB2A 2F98A 3JVCA 2W04A 1OCVA 3S5CA 3EBYA 1T2HA 1NO3A 3MG3A 1W2B2 3FF0A 4L8OA 4IIAA 3Q1CA 5KP4A 1I0VA 1ASKA 2K54A 2CX1A 3MSOA 4HM1B 1RNBA 4HM8B 1AY7A 2L4VA 5JPUA 3NM2A 4HJLB 4KT3B 7RNTA 1JRQA 1V74A 2W0QA 3SEDA 2V1LA 2MF7A 1E3RA 1FUWA 1BSAA 1VQ43 3OWYA 3LYGA 2CFKA 3FG3A 4JF8A 3GZYB 3G6E3 1PU4A 1GYBA 3IJEB 2ML6A 1FUTA 4HM2B 4WWUC 3PZWA 2K0MA 4MMYB 1BSBA 1EKMA 2FGTA 1I2EA 1PFPA 3CU3A 3D3LA 4AEQA 1K9M4 3T8UA 1MWUA 2XGNA 3UB1A 5AIIA 5IERA 1I2FA 1RMSA 2W9QA 3CNXA 3JUQA 1JB4A 3F7SA 2BT3A 2PNCA 5AIGA 1EQKA 3G4S3 3MG2A 4BL2A 3K9MC 1OF5B 4STDA 3GRDA 4WYKB 1D6ZA 1ZO2A 2GSPA 1UUVB 1F8NA 1UI7A 3D4AA 1JNQA 3VF1A 3X3XA 1A2VA 3RGAA 3CPOA 4N6UA 3I563 2JQ5A 2XFTA 4EXRA 1RGHA 4ZM8A 2BU4A 4O2HA 5CF2A 1JN5A 2BMQB 1A2PA 2C10A 2UX0A 3NHXA 4OK0A 1D6UA 2OTJ3 2WOHA 4HOHA 4WFOA 2XR8B 2HMKB 3H3HA 3V92A 4ILFA 1I2GA 1CH0A 1OGZA 4EBGA 1UCKA 1ISKA 2W56A 2OOVA 1I3IA 1GMPA 1SARA 4FCZA 3OWSA 3FSDA 4FR9A 4N6V0 4H3UA 1RJOA 1VQQA 3AMOB 2PZVA 4EV2A 1GOVA 1AVKA 1DMMA 3NUVA 3G713 4CCVA 3WA2X 3ECFA 1WMPA 4TX4A 3MG1A 1WQLB 4WHAA 5G1KA 1L5GB 3EE1A 4BIRA 4EV5A 1RGAA 1VQ73 4HZ9B 3U97A 3LZAA 1VZZA 1K734 4HKVB 3LTBA 1BRSA 4IPBA 5JPPA 1FGQA 2CK3H 5M1AA 1IT8A 5LC7A 1BRNL 1D6YA 2OCTA 1NWWA 2O3OA 2WGQA 3KKGA 1MWTA 3KIIA 1IQ8A 5EEOA 1ULJB 1BRJA 3CCV3 2Y73A 1GOYA 3AGNA 1UCJA 2QGUA 3F7XA 3JUNA 4MJDA 1STDA 2CWVA 3LTCA 4PEJA 2KF4A 3ALAA 3SLUA 4MMXB 2KCDA 3DGYA 1U5OA 2HMOB 1CYVA 1U8CB 2I9WA 1VQO3 3H51A 3URPA 3MHEA 4J5KA 2SBLA 4KZ1A 3DGOA 2CHCA 3BNCA 3EF8A 1FYSA 3LT9A 4HM0B 4IT7A 1Q42A 2GBWB 1HKXA 4LSOA 3BB9A 3DH2A 1A67A 1BUQA 1KWIA 3KCHA
chains in the Genus database with same CATH topology
4XBYA 1W02A 3DMCA 4HM4B 3CCJ3 4LZIA 1SPUA 1W5ZA 3D9RA 2RCDA 4RBNA 2XF3A 4BTYA 4O02B 1W4NA 1IQYA 2F86B 3TDGA 1YHQ3 5IG0A 4FMCA 3NQYA 3WMDA 1GD3A 1YIT3 2XSOB 1ROAA 3AMOA 5DRVA 1VQK3 1IVVA 2P0XA 3K63A 2BNGA 3B4OA 3EC9A 1QAKA 3EN1B 1W6CA 4O8SA 3F8XA 2MC8A 3CC23 3CCM3 3LOYA 3EN8A 3A76A 3LT8A 3LXUX 4J9AA 4H61A 1GY7A 2RSXA 5IW9A 4EYCA 1HU9A 1VQ53 3S67A 1OH0A 4G1MB 1JV2B 4HM5B 4ORLA 3GZRA 4N6TA 3NQZA 2F99A 3HI7A 3LTDA 1VQ83 4MMZB 3N8BA 2CFGA 3CCR3 1US1A 3N9HA 2KXGA 1OUNA 2Z7AA 4WP5A 3N54B 1DMQA 2GU1A 3OWUA 3VGNA 5IG3A 3FH1A 1LOXA 4MEIA 4OVMA 3ER7A 1Q824 1QVG2 3J7Yd 2XFSA 4X2HA 1NU3A 1M904 3X3YA 1QVF2 1YJW3 1O7PB 4R4KA 3NV0B 3HZPA 3JUOA 1VQL3 1DVDA 3WOEB 4N6LA 4O3VA 5LC6A 1RKYA 5G2GA 4XBTA 4HM3B 3KSPA 3Q90A 1R4CA 4AKZA 4GL6A 3QRDA 5CXOA 1N9JA 1IDPA 1Y4KA 5AEUB 3WA3A 2W03A 2BMOB 3EQQB 2HMNB 3LMLA 5EVHA 1W6GA 5AYRB 2YFLB 4CDLA 4EC6A 4K1UA 5D81A 3CCU3 1FA3A 1YJN3 2GXFA 1OHSA 1LXEA 1M9GA 1WNHA 2W2CA 1TFKA 5I97A 3CPW2 1QALA 3EHCA 1EA2A 3MKIA 3PXMA 1DYUA 3MWZA 4N6MA 2FXTA 4R80A 3HK4A 4HYZA 1NDOB 4FCMA 3SOAA 1STFI 3NXJA 5IEOA 5IF6A 4NREA 3CCS3 3K7CA 1K8A4 2CG1A 2ZDJA 5DREA 1RN7A 1J2BA 3T0UA 3MPHA 2IA7A 1YVBI 2Q07A 2CFLA 2HMMB 3S27A 1NB3I 2OQEA 4HM7B 3FG4A 1Z1SA 1ULIB 3DGMA 1AV4A 2E2UA 4HM6B 2YFIB 2CC3A 3BNEA 1VQN3 1S723 3SX1A 3DZLA 4R1KA 4XM4A 3CNMA 3UNLA 3L0RA 3HIGA 1Q7Y4 3CC73 1AR0A 4XB5A 1QMAA 1NB5I 3PS8A 2BHMA 2GBXB 2STDA 3DXOA 1IT7A 1OF5A 1C7HA 4WYKA 4AKYA 3CXC2 2XH9A 1YJ93 1TU5A 2Y74A 4K1VA 3K0ZA 2GEXA 5EQLA 1WMOA 3FZWA 3KE7A 2XGLA 4KFDA 1EG9B 1IQXA 1CEWI 5AI1A 3DY5A 1VQM3 1CQSA 3NBBA 3STDA 1W01A 4L7KA 4FMBA 5CF1A 3FLJA 7STDA 3PGBA 3F8HA 3PCRA 1OGXA 3U1WA 5IENA 5KP3A 5IG4A 1YGEA 3G0KA 4U13A 1N9EA 1DVCA 2ZL8A 1MOLA 3T8NA 3IMAB 3DGLA 3EX9A 3NM7A 5ELUA 2CH9A 1UW1A 4NHFA 4RNYA 2IUJA 5D83A 2GEYA 1OACA 3PCSA 2INXA 4XBXA 1TFOA 3Q2PA 1VQ93 3OV4A 2Z77A 3CCL3 3B8LA 4K90B 5TGNA 2QEX3 3CCE3 1TP6A 1TUHA 5AEWB 2OTL3 1K28A 3B4PA 4N6NB 1FGOA 2GU3A 5ELJA 3BNDA 3JUPA 4N6OB 3M8CA 4OUQA 1O7GB 3KFQC 1IV9A 2XRXB 3WODG 3GZXB 2CWUA 1M1K4 1WMNA 2B24B 3X42A 2P09A 1LVNA 3F40A 1O7NB 1YI23 3K5TA 4XDWA 1LNHA 1KQS2 3G16A 1GY6A 4KFFA 4JRFA 1JKGB 2D42A 3X41A 3UJMA 1AVLA 1G96A 3DUKA 3GWRA 4BTWA 3VSYA 1UI8A 2IMJA 3NX0A 3SOYA 4KFEA 3JUMA 3X40A 3CME3 1JJ22 4KVHA 5IEPA 3LTAA 4L8PA 1W7CA 3FCSB 3V98A 1FGMA 2RFRA 3KN4A 3LH4A 1N8QA 1T5YA 1K41A 1E97A 3S28A 4FCJA 3S29A 1KD14 1A2KA 2Z76A 2LQVA 2P05A 2YFJB 4Q53A 4RNZA 2E2VA 2CFWA 3BLZA 3F9SA 1CYUA 4K61A 5BVBA 3HIIA 5FGOA 4HZBB 2HMJB 2O9UX 3F14A 1RRLA 4BTXA 1IV7A 3E99A 1SIHA 1FGTA 2M7OA 2W9PA 3FKAA 3B7CA 3O8YA 3I553 1N8R4 4I4KA 1GY5A 3FGYA 4GB5A 1OPYA 2WO0A 1W00A 3BNBA 2Z6BA 3KZTA 2JDIH 5FW5A 2YX9A 2A15A 1JB5A 3HX8A 3CD63 5CK6A 2W6JH 3WDGB 1SIIA 5AIFA 1E3VA 1TIJA 1VQP3 1IK3A 2CWTA 1Q40B 2XEPA 3G8ZA 5JBSA 2CFDA 5IG5A 1O7WB 3CMA3 1JKGA 3SVAA 3WOFB 2XSHB 2E2TA 3NV0A 3EBTA 3I0YA 4J8TA 5CLKA 3RDEA 1VQ63 3X3ZA 5HGRA 1A90A 1KSIA 1W6YA 3RGRA 5BXQA 4FMDA 3KSED 1DMNA 1QJGA 3UL5A 1O7MB 4LEHA 5AIHA 1YIJ3 3GZBA 1IVUA 4LGQA 5KP1A 2D1WA 3ROBA 4R9LA 4QWTA 3OW22 2P38A 3V99A 3MYTA 2KRTA 3EB8A 1FGRA 2IUKA 1IVXA 2OWPA 1W2ZA 1GS3A 2BMRB 2ML5A 4HBRA 4FMAA 4R9KA 1SJWA 3FG1A 3NBRA 4LMIA 4RZMA 2QIYA 2RGQA 1SQWA 2LYXA 2OOVC 3DM8A 1UUWB 5D82A 1Q814 2R4IA 1O7HB 1ZX2A 4X2OA 1OHOA 2WGOA 1ROVA 1N5HA 1N5PA 2BO9B 1MNLA 1M1XB 2CKFB 4HVNA 3PYJA 1GD4A 3QK9A 2C11A 1Q864 1WTHA 2CW9A 3UL6A 5A0OB 8CHOA 2HMLB 1Q40A 3IPTA 2OQEC 1RRHA 2CIUA 3OXAA 3DGNA 1IVWA 1S5AA 5STDA 2B1XB 1JN5B 5AYSC 2QA43 3FF2A 3GAXA 2P0MA 1OHPA 4N3VA 4XDVA 1KC84 1IU7A 3CC43 2CG0A 6STDA 1QAFA 3CCQ3 3SXXA 2W56B 2WOFA 3OX9A 1NJI4 3NBJA 2FNQA 3EJVA 1JB2A 2F98A 3JVCA 2W04A 1OCVA 3S5CA 3EBYA 1NO3A 3MG3A 1W2B2 3FF0A 4L8OA 4IIAA 3Q1CA 5KP4A 1ASKA 2K54A 3MSOA 4HM1B 4HM8B 2L4VA 5JPUA 3NM2A 4HJLB 1JRQA 1V74A 2W0QA 3SEDA 2V1LA 2MF7A 1E3RA 1FUWA 1VQ43 3OWYA 3LYGA 2CFKA 3FG3A 4JF8A 3GZYB 3G6E3 1PU4A 1GYBA 3IJEB 2ML6A 4HM2B 4WWUC 3PZWA 2K0MA 4MMYB 1EKMA 2FGTA 3CU3A 1PFPA 3D3LA 4AEQA 1K9M4 3T8UA 2XGNA 3UB1A 5AIIA 5IERA 3JUQA 3CNXA 2W9QA 1JB4A 3F7SA 2BT3A 2PNCA 5AIGA 1EQKA 3G4S3 3MG2A 3K9MC 1OF5B 4STDA 3GRDA 4WYKB 1D6ZA 1ZO2A 1UUVB 1F8NA 1UI7A 1JNQA 3VF1A 3X3XA 1A2VA 3RGAA 3CPOA 4N6UA 3I563 2JQ5A 2XFTA 4EXRA 4ZM8A 4O2HA 5CF2A 1JN5A 2BMQB 2C10A 2UX0A 3NHXA 4OK0A 1D6UA 2OTJ3 2WOHA 4WFOA 2XR8B 2HMKB 3H3HA 3V92A 1OGZA 4EBGA 1ISKA 2W56A 2OOVA 4FCZA 3OWSA 3FSDA 4FR9A 4N6V0 4H3UA 1RJOA 3AMOB 4EV2A 2PZVA 1AVKA 1DMMA 3NUVA 3G713 4CCVA 3WA2X 3ECFA 1WMPA 4TX4A 3MG1A 1WQLB 4WHAA 4EV5A 1L5GB 3EE1A 1VQ73 4HZ9B 3U97A 3LZAA 1VZZA 1K734 4HKVB 3LTBA 4IPBA 5JPPA 1FGQA 2CK3H 1IT8A 5LC7A 1D6YA 2OCTA 1NWWA 2O3OA 2WGQA 3KKGA 3KIIA 1IQ8A 5EEOA 1ULJB 3CCV3 2Y73A 3F7XA 2QGUA 3JUNA 4MJDA 1STDA 2CWVA 3LTCA 4PEJA 3ALAA 3SLUA 4MMXB 2KCDA 1U5OA 2HMOB 1CYVA 1U8CB 2I9WA 1VQO3 3H51A 3MHEA 2SBLA 4KZ1A 3DGOA 2CHCA 3BNCA 3EF8A 3LT9A 4HM0B 4IT7A 1Q42A 2GBWB 1HKXA 4LSOA 3BB9A 1A67A 1BUQA 1KWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBY A;  1W02 A;  3DMC A;  4HM4 B;  3D9R A;  2RCD A;  2F86 B;  5IG0 A;  3WMD A;  2XSO B;  5DRV A;  2BNG A;  3B4O A;  3EC9 A;  3EN1 B;  3F8X A;  3EN8 A;  3A76 A;  4J9A A;  1GY7 A;  1OH0 A;  4HM5 B;  4ORL A;  3GZR A;  2F99 A;  1OUN A;  2Z7A A;  4WP5 A;  1DMQ A;  3OWU A;  3VGN A;  5IG3 A;  3FH1 A;  4OVM A;  3ER7 A;  4X2H A;  1NU3 A;  1O7P B;  3NV0 B;  3HZP A;  3JUO A;  5G2G A;  4XBT A;  4HM3 B;  3KSP A;  3Q90 A;  5CXO A;  1IDP A;  5AEU B;  2BMO B;  3EQQ B;  2HMN B;  5EVH A;  2YFL B;  4CDL A;  4K1U A;  5D81 A;  2GXF A;  1OHS A;  2W2C A;  3EHC A;  1EA2 A;  3MKI A;  3HK4 A;  1NDO B;  4FCM A;  3SOA A;  5IF6 A;  3NXJ A;  5IEO A;  3K7C A;  5DRE A;  2HMM B;  4HM7 B;  1Z1S A;  1ULI B;  4HM6 B;  2YFI B;  3DZL A;  4R1K A;  4XM4 A;  3CNM A;  3UNL A;  1AR0 A;  4XB5 A;  1QMA A;  2GBX B;  2STD A;  3DXO A;  1OF5 A;  1C7H A;  4WYK A;  4K1V A;  3K0Z A;  2GEX A;  3FZW A;  3KE7 A;  1EG9 B;  5AI1 A;  1CQS A;  3STD A;  1W01 A;  4L7K A;  5CF1 A;  3FLJ A;  7STD A;  3F8H A;  1OGX A;  5IEN A;  5KP3 A;  5IG4 A;  3G0K A;  4U13 A;  3T8N A;  3EX9 A;  5D83 A;  2GEY A;  2INX A;  4XBX A;  3OV4 A;  2Z77 A;  3B8L A;  5TGN A;  1TP6 A;  1TUH A;  5AEW B;  3B4P A;  3JUP A;  3M8C A;  4OUQ A;  1O7G B;  2XRX B;  3GZX B;  2B24 B;  3F40 A;  1O7N B;  4XDW A;  3G16 A;  1GY6 A;  1JKG B;  3UJM A;  3DUK A;  3GWR A;  3VSY A;  2IMJ A;  3SOY A;  3JUM A;  4KVH A;  5IEP A;  4L8P A;  2RFR A;  1K41 A;  1E97 A;  4FCJ A;  1A2K A;  2Z76 A;  2YFJ B;  4Q53 A;  3BLZ A;  3F9S A;  5BVB A;  4HZB B;  2HMJ B;  3F14 A;  3E99 A;  3FKA A;  3B7C A;  4I4K A;  1GY5 A;  3FGY A;  4GB5 A;  1OPY A;  1W00 A;  3KZT A;  5FW5 A;  2A15 A;  1JB5 A;  3HX8 A;  5CK6 A;  5AIF A;  1E3V A;  1Q40 B;  3G8Z A;  5IG5 A;  1O7W B;  1JKG A;  2XSH B;  3NV0 A;  3EBT A;  3I0Y A;  4J8T A;  5CLK A;  5HGR A;  1W6Y A;  3RGR A;  5BXQ A;  1DMN A;  1QJG A;  1O7M B;  4LEH A;  5AIH A;  3GZB A;  4LGQ A;  5KP1 A;  3ROB A;  4R9L A;  3MYT A;  2OWP A;  1GS3 A;  2BMR B;  4R9K A;  1SJW A;  4RZM A;  3NBR A;  4LMI A;  2QIY A;  2RGQ A;  3DM8 A;  1UUW B;  5D82 A;  2R4I A;  1O7H B;  1ZX2 A;  4X2O A;  1OHO A;  2CKF B;  4HVN A;  8CHO A;  2HML B;  1Q40 A;  3IPT A;  3OXA A;  1S5A A;  5STD A;  2B1X B;  1JN5 B;  3FF2 A;  1OHP A;  4N3V A;  4XDV A;  6STD A;  3OX9 A;  3EJV A;  1JB2 A;  2F98 A;  1OCV A;  3S5C A;  3EBY A;  3MG3 A;  3FF0 A;  4L8O A;  4IIA A;  5KP4 A;  1ASK A;  2K54 A;  3MSO A;  4HM1 B;  4HM8 B;  5JPU A;  3NM2 A;  4HJL B;  3SED A;  1E3R A;  3OWY A;  3LYG A;  3GZY B;  1GYB A;  4HM2 B;  4WWU C;  3CU3 A;  3T8U A;  5AII A;  5IER A;  3JUQ A;  3CNX A;  1JB4 A;  3F7S A;  5AIG A;  3MG2 A;  1OF5 B;  4STD A;  3GRD A;  4WYK B;  1ZO2 A;  1UUV B;  3RGA A;  3CPO A;  2JQ5 A;  5CF2 A;  1JN5 A;  2BMQ B;  2UX0 A;  3NHX A;  2XR8 B;  2HMK B;  3H3H A;  1OGZ A;  1ISK A;  3OWS A;  3FSD A;  4H3U A;  2PZV A;  1DMM A;  3NUV A;  3ECF A;  3MG1 A;  1WQL B;  4HZ9 B;  3LZA A;  1VZZ A;  4HKV B;  5JPP A;  3KKG A;  1NWW A;  1ULJ B;  3F7X A;  2QGU A;  3JUN A;  4MJD A;  1STD A;  4PEJ A;  1U5O A;  2HMO B;  2I9W A;  3H51 A;  3MHE A;  2CHC A;  3EF8 A;  4HM0 B;  1Q42 A;  2GBW B;  1HKX A;  1BUQ A;  3BB9 A; 
#chains in the Genus database with same CATH topology
 3Q3F A;  1FUS A;  2F5W A;  4XBY A;  1W02 A;  1RGC A;  3DMC A;  4HM4 B;  3CCJ 3;  1MWR A;  1BNJ A;  1YGW A;  4LZI A;  1BNI A;  3BIR A;  1SPU A;  1W5Z A;  5RNT A;  2R41 A;  3D9R A;  2RCD A;  4RBN A;  2XF3 A;  4BTY A;  4O02 B;  1W4N A;  1IQY A;  2F86 B;  3TDG A;  1YHQ 3;  5IG0 A;  4FMC A;  3NQY A;  1FA3 A;  1B2U A;  3WMD A;  1GD3 A;  1YIT 3;  2XSO B;  1ROA A;  3AMO A;  5DRV A;  1VQK 3;  1IVV A;  2P0X A;  1BNF A;  1RGF A;  2KAA A;  2AAE A;  3K63 A;  2BNG A;  3B4O A;  3EC9 A;  1QAK A;  3EN1 B;  1C54 A;  1W6C A;  4O8S A;  3F8X A;  5BIR A;  2MC8 A;  3CC2 3;  3CCM 3;  3LOY A;  3EN8 A;  3A76 A;  3LT8 A;  3LXU X;  4J9A A;  1B2M A;  1LOV A;  4H61 A;  1GY7 A;  2RSX A;  5IW9 A;  4EYC A;  1HU9 A;  1VQ5 3;  3S67 A;  1OH0 A;  4G1M B;  1JV2 B;  4HM5 B;  4ORL A;  3GZR A;  4N6T A;  3NQZ A;  2F99 A;  3HI7 A;  3LTD A;  4NPB A;  1VQ8 3;  4MMZ B;  3N8B A;  2RNT A;  2CFG A;  3CCR 3;  1US1 A;  3N9H A;  1RHL A;  4J5G A;  2KXG A;  1OUN A;  3AHS A;  2Z7A A;  4WP5 A;  3N54 B;  1DMQ A;  2GU1 A;  3OWU A;  3VGN A;  5IG3 A;  3FH1 A;  1LOX A;  4MEI A;  4OVM A;  3ER7 A;  1Q82 4;  1QVG 2;  3J7Y d;  2XFS A;  1I8V A;  1BNS A;  1GSP A;  4X2H A;  1NU3 A;  1M90 4;  3X3Y A;  1QVF 2;  1YJW 3;  1UDI I;  3ZG0 A;  1O7P B;  1HZ1 A;  4R4K A;  1MGR A;  3NV0 B;  3HZP A;  3JUO A;  1BIR A;  3ZG5 A;  1VQL 3;  3D79 A;  1DVD A;  3D5I A;  4N6L A;  3WOE B;  4O3V A;  5LC6 A;  1RKY A;  5G2G A;  3HOH A;  4XBT A;  1JBT A;  1LNI A;  4HM3 B;  3KSP A;  6GSP A;  3Q90 A;  1R4C A;  1GMR A;  2J8X B;  4AKZ A;  4GL6 A;  3QRD A;  1B20 A;  2L1S A;  1BRK A;  1GMQ A;  1G0T A;  5CXO A;  1N9J A;  1IDP A;  1Y4K A;  5AEU B;  1I0X A;  2SAR A;  3WA3 A;  2W03 A;  2BMO B;  3EQQ B;  2HMN B;  3LML A;  5EVH A;  1W6G A;  1I3F A;  5AYR B;  2H0I A;  2YFL B;  1RCK A;  4CDL A;  4K1U A;  5D81 A;  4EC6 A;  3CCU 3;  1RGL A;  1MWS A;  2C4B A;  2GXF A;  1OHS A;  1LXE A;  1M9G A;  1WNH A;  2BIR A;  1TFK A;  2W2C A;  1BUJ A;  5I97 A;  3CPW 2;  1QAL A;  3EHC A;  1EA2 A;  3MKI A;  3PXM A;  1DYU A;  3MWZ A;  4N6M A;  2FXT A;  4R80 A;  3HK4 A;  4HYZ A;  1NDO B;  4FCM A;  3SOA A;  1STF I;  3BU4 A;  3NXJ A;  5IEO A;  5IF6 A;  4NRE A;  3CCS 3;  3K7C A;  2AAD A;  1B27 A;  1K8A 4;  2CG1 A;  2ZDJ A;  5DRE A;  1RN7 A;  1TTO A;  1J2B A;  3T0U A;  2UUG C;  1X1X A;  3MPH A;  1UCI A;  2IA7 A;  1YVB I;  2Q07 A;  2CFL A;  2HMM B;  3S27 A;  1NB3 I;  2OQE A;  4HM7 B;  3FG4 A;  1Z1S A;  1ULI B;  3DGM A;  1AV4 A;  2E2U A;  1YNV X;  4HM6 B;  1BNR A;  1BNE A;  2YFI B;  2CC3 A;  3BNE A;  1VQN 3;  1S72 3;  3SX1 A;  3DZL A;  4R1K A;  4XM4 A;  3CNM A;  3UNL A;  3L0R A;  3HIG A;  1Q7Y 4;  1BRH A;  1AR0 A;  1RGK A;  4XB5 A;  1QMA A;  3CC7 3;  3PS8 A;  2BHM A;  2GBX B;  2STD A;  1NB5 I;  1LOW A;  3DXO A;  1IT7 A;  1OF5 A;  1C7H A;  4WYK A;  4AKY A;  3CXC 2;  1LRA A;  2XH9 A;  3RNT A;  1YJ9 3;  5GSP A;  1FW7 A;  1TU5 A;  2H0H A;  2Y74 A;  4K1V A;  3K0Z A;  2GEX A;  5EQL A;  1WMO A;  3FZW A;  1B2X A;  3KE7 A;  2XGL A;  4KFD A;  1EG9 B;  1IQX A;  1CEW I;  5AI1 A;  3DY5 A;  1VQM 3;  1CQS A;  3NBB A;  3STD A;  5HOH A;  1W01 A;  2HOH A;  4L7K A;  3SYU A;  4FMB A;  5CF1 A;  3FLJ A;  7STD A;  3PGB A;  3F8H A;  3PCR A;  1OGX A;  4GSP A;  3U1W A;  5IEN A;  5KP3 A;  5IG4 A;  2H0G A;  1YGE A;  3G0K A;  4U13 A;  1N9E A;  5BU4 A;  1DVC A;  2ZL8 A;  1MOL A;  1PY3 A;  3IMA B;  3T8N A;  3DGL A;  3EX9 A;  3NM7 A;  5ELU A;  2CH9 A;  1UW1 A;  4NHF A;  4RNY A;  2IUJ A;  5D83 A;  2GEY A;  1OAC A;  1DET A;  3PCS A;  5G1L A;  2INX A;  4XBX A;  1TFO A;  3Q2P A;  1VQ9 3;  3OV4 A;  1B2S A;  2Z77 A;  3CCL 3;  3B8L A;  4K90 B;  1X1Y A;  5TGN A;  2QEX 3;  1TP6 A;  1TUH A;  5AEW B;  3CCE 3;  2OTL 3;  2F4Y A;  6RNT A;  1K28 A;  3B4P A;  4N6N B;  1FGO A;  2GU3 A;  5ELJ A;  3BND A;  3A5E A;  3JUP A;  1UGH I;  3M8C A;  2ZA4 A;  4N6O B;  4OUQ A;  1BAN A;  1RTU A;  1O7G B;  3KFQ C;  4EW5 A;  4GHO A;  1IV9 A;  2XRX B;  3WOD G;  3GZX B;  2CWU A;  1M1K 4;  1WMN A;  1BSD A;  2B24 B;  3X42 A;  2P09 A;  1RLS A;  1RGG A;  1LVN A;  3F40 A;  1X1W A;  1O7N B;  1YI2 3;  3K5T A;  4XDW A;  1LNH A;  1Q9E A;  1TJD A;  1KQS 2;  3G16 A;  2ZHX B;  1GY6 A;  4KFF A;  4JRF A;  1LQM B;  1RDS A;  1UGI A;  1JKG B;  2D42 A;  2IY2 A;  3AHW A;  3X41 A;  3UJM A;  1AVL A;  1G96 A;  3DUK A;  1BRG A;  3GWR A;  2IYJ A;  3VSY A;  4BTW A;  1UI8 A;  1BSC A;  1RN1 A;  2IMJ A;  3NX0 A;  3SOY A;  4KFE A;  1EEJ A;  3JUM A;  3X40 A;  3CME 3;  1JJ2 2;  4HAA A;  4KVH A;  1B3S A;  1RGE A;  5IEP A;  3LTA A;  4L8P A;  1W7C A;  3FCS B;  3V98 A;  1FGM A;  2RFR A;  3KN4 A;  3LH4 A;  1N8Q A;  1T5Y A;  1K41 A;  1E97 A;  3S28 A;  1DE3 A;  2KF5 A;  4FCJ A;  3S29 A;  1KD1 4;  1BGS A;  1A2K A;  2Z76 A;  2LQV A;  1G02 A;  2P05 A;  4I5Q A;  2YFJ B;  4CPK A;  4BL3 A;  4Q53 A;  1BVI A;  4RNZ A;  1YVS A;  2CFW A;  2E2V A;  3BLZ A;  3F9S A;  1LQG C;  1CYU A;  1HYF A;  4K61 A;  5BVB A;  3HII A;  5FGO A;  4HZB B;  1FZU A;  2HMJ B;  2O9U X;  1B2Z A;  1AQZ A;  1JZO A;  1RRL A;  1UUG B;  3F14 A;  4BTX A;  1IV7 A;  1BRI A;  3E99 A;  1SIH A;  1FGT A;  2M7O A;  2W9P A;  3FKA A;  1X1U A;  3B7C A;  3GSP A;  3O8Y A;  4I4K A;  3I55 3;  1N8R 4;  1GY5 A;  3FGY A;  4GB5 A;  1JBR A;  1OPY A;  1RNT A;  2KF3 A;  2WO0 A;  1W00 A;  3BNB A;  2Z6B A;  3KZT A;  2JDI H;  5FW5 A;  2YX9 A;  2A15 A;  1JB5 A;  2RBI A;  3HX8 A;  1JZD A;  3CD6 3;  5CK6 A;  1RN4 A;  1BOX A;  3WHO A;  2W6J H;  3WDG B;  1SII A;  5AIF A;  1E3V A;  1TIJ A;  1TRQ A;  1VQP 3;  1MGW A;  2CWT A;  1IK3 A;  1IYY A;  1Q40 B;  2XEP A;  3G8Z A;  4RNT A;  5JBS A;  2CFD A;  4LYL B;  5IG5 A;  1O7W B;  3CMA 3;  1JKG A;  3SVA A;  3WOF B;  2XSH B;  2E2T A;  3NV0 A;  3EBT A;  3I0Y A;  4J8T A;  5CLK A;  3RDE A;  3ZFZ A;  1VQ6 3;  1NNV A;  1BSE A;  3X3Z A;  5HGR A;  1A90 A;  1KSI A;  1W6Y A;  3RGR A;  1LOY A;  4FMD A;  5BXQ A;  7GSP A;  3KSE D;  1DMN A;  1QJG A;  1ZGX A;  3UL5 A;  1O7M B;  2F5M A;  5M19 A;  1T2I A;  1I70 A;  4LEH A;  5AIH A;  1BNG A;  3GZB A;  1YIJ 3;  3D5G A;  1IVU A;  1RSN A;  4LGQ A;  5KP1 A;  2D1W A;  3ROB A;  4R9L A;  4QWT A;  3OW2 2;  2P38 A;  3V99 A;  3MYT A;  2CX0 A;  2KRT A;  3EB8 A;  1FGR A;  1BU4 A;  2IUK A;  1IVX A;  2OWP A;  1T3B A;  1W2Z A;  1GS3 A;  2BMR B;  1GOU A;  2ML5 A;  4BU4 A;  4HBR A;  4FMA A;  4R9K A;  1SJW A;  3FG1 A;  3NBR A;  4LMI A;  4RZM A;  2QIY A;  2RGQ A;  1SQW A;  2LYX A;  2OOV C;  3DM8 A;  1UUW B;  5D82 A;  9RNT A;  1JBS A;  1Q81 4;  1TRP A;  2R4I A;  3WR2 A;  1O7H B;  3AGO A;  2KF6 A;  1V57 A;  1ZX2 A;  4X2O A;  1OHO A;  2WGO A;  1ROV A;  1N5H A;  2F56 A;  1N5P A;  2BO9 B;  1MNL A;  1M1X B;  1V58 A;  2CKF B;  4HVN A;  4CJN A;  3PYJ A;  1GD4 A;  2K3D A;  3QK9 A;  2C11 A;  1Q86 4;  1WTH A;  8RNT A;  5M18 A;  2CW9 A;  3UL6 A;  5A0O B;  8CHO A;  1R4Y A;  2HML B;  4DKI A;  1Q40 A;  3IPT A;  2OQE C;  1RRH A;  2CIU A;  3OXA A;  1B21 A;  3DGN A;  1IVW A;  1S5A A;  2UGI A;  5STD A;  2B1X B;  1JN5 B;  5AYS C;  2QA4 3;  3FF2 A;  3GAX A;  2P0M A;  1OHP A;  4N3V A;  4XDV A;  1KC8 4;  1ZS7 A;  1IU7 A;  1RCL A;  3CC4 3;  2CG0 A;  1Q7H A;  6STD A;  1EUI C;  1QAF A;  3CCQ 3;  3SXX A;  1UCL A;  2W56 B;  1BAO A;  2WOF A;  3OX9 A;  1NJI 4;  3NBJ A;  2FNQ A;  1PYL A;  1YJN 3;  3EJV A;  1JB2 A;  2F98 A;  3JVC A;  2W04 A;  1OCV A;  3S5C A;  3EBY A;  1T2H A;  1NO3 A;  3MG3 A;  1W2B 2;  3FF0 A;  4L8O A;  4IIA A;  3Q1C A;  5KP4 A;  1I0V A;  1ASK A;  2K54 A;  2CX1 A;  3MSO A;  4HM1 B;  1RNB A;  4HM8 B;  1AY7 A;  2L4V A;  5JPU A;  3NM2 A;  4HJL B;  4KT3 B;  7RNT A;  1JRQ A;  1V74 A;  2W0Q A;  3SED A;  2V1L A;  2MF7 A;  1E3R A;  1FUW A;  1BSA A;  1VQ4 3;  3OWY A;  3LYG A;  2CFK A;  3FG3 A;  4JF8 A;  3GZY B;  3G6E 3;  1PU4 A;  1GYB A;  3IJE B;  2ML6 A;  1FUT A;  4HM2 B;  4WWU C;  3PZW A;  2K0M A;  4MMY B;  1BSB A;  1EKM A;  2FGT A;  1I2E A;  1PFP A;  3CU3 A;  3D3L A;  4AEQ A;  1K9M 4;  3T8U A;  1MWU A;  2XGN A;  3UB1 A;  5AII A;  5IER A;  1I2F A;  1RMS A;  2W9Q A;  3CNX A;  3JUQ A;  1JB4 A;  3F7S A;  2BT3 A;  2PNC A;  5AIG A;  1EQK A;  3G4S 3;  3MG2 A;  4BL2 A;  3K9M C;  1OF5 B;  4STD A;  3GRD A;  4WYK B;  1D6Z A;  1ZO2 A;  2GSP A;  1UUV B;  1F8N A;  1UI7 A;  3D4A A;  1JNQ A;  3VF1 A;  3X3X A;  1A2V A;  3RGA A;  3CPO A;  4N6U A;  3I56 3;  2JQ5 A;  2XFT A;  4EXR A;  1RGH A;  4ZM8 A;  2BU4 A;  4O2H A;  5CF2 A;  1JN5 A;  2BMQ B;  1A2P A;  2C10 A;  2UX0 A;  3NHX A;  4OK0 A;  1D6U A;  2OTJ 3;  2WOH A;  4HOH A;  4WFO A;  2XR8 B;  2HMK B;  3H3H A;  3V92 A;  4ILF A;  1I2G A;  1CH0 A;  1OGZ A;  4EBG A;  1UCK A;  1ISK A;  2W56 A;  2OOV A;  1I3I A;  1GMP A;  1SAR A;  4FCZ A;  3OWS A;  3FSD A;  4FR9 A;  4N6V 0;  4H3U A;  1RJO A;  1VQQ A;  3AMO B;  2PZV A;  4EV2 A;  1GOV A;  1AVK A;  1DMM A;  3NUV A;  3G71 3;  4CCV A;  3WA2 X;  3ECF A;  1WMP A;  4TX4 A;  3MG1 A;  1WQL B;  4WHA A;  5G1K A;  1L5G B;  3EE1 A;  4BIR A;  4EV5 A;  1RGA A;  1VQ7 3;  4HZ9 B;  3U97 A;  3LZA A;  1VZZ A;  1K73 4;  4HKV B;  3LTB A;  1BRS A;  4IPB A;  5JPP A;  1FGQ A;  2CK3 H;  5M1A A;  1IT8 A;  5LC7 A;  1BRN L;  1D6Y A;  2OCT A;  1NWW A;  2O3O A;  2WGQ A;  3KKG A;  1MWT A;  3KII A;  1IQ8 A;  5EEO A;  1ULJ B;  1BRJ A;  3CCV 3;  2Y73 A;  1GOY A;  3AGN A;  1UCJ A;  2QGU A;  3F7X A;  3JUN A;  4MJD A;  1STD A;  2CWV A;  3LTC A;  4PEJ A;  2KF4 A;  3ALA A;  3SLU A;  4MMX B;  2KCD A;  3DGY A;  1U5O A;  2HMO B;  1CYV A;  1U8C B;  2I9W A;  1VQO 3;  3H51 A;  3URP A;  3MHE A;  4J5K A;  2SBL A;  4KZ1 A;  3DGO A;  2CHC A;  3BNC A;  3EF8 A;  1FYS A;  3LT9 A;  4HM0 B;  4IT7 A;  1Q42 A;  2GBW B;  1HKX A;  4LSO A;  3BB9 A;  3DH2 A;  1A67 A;  1BUQ A;  1KWI A;  3KCH A; 
#chains in the Genus database with same CATH homology
 4XBY A;  1W02 A;  3DMC A;  4HM4 B;  3CCJ 3;  4LZI A;  1SPU A;  1W5Z A;  3D9R A;  2RCD A;  4RBN A;  2XF3 A;  4BTY A;  4O02 B;  1W4N A;  1IQY A;  2F86 B;  3TDG A;  1YHQ 3;  5IG0 A;  4FMC A;  3NQY A;  3WMD A;  1GD3 A;  1YIT 3;  2XSO B;  1ROA A;  3AMO A;  5DRV A;  1VQK 3;  1IVV A;  2P0X A;  3K63 A;  2BNG A;  3B4O A;  3EC9 A;  1QAK A;  3EN1 B;  1W6C A;  4O8S A;  3F8X A;  2MC8 A;  3CC2 3;  3CCM 3;  3LOY A;  3EN8 A;  3A76 A;  3LT8 A;  3LXU X;  4J9A A;  4H61 A;  1GY7 A;  2RSX A;  5IW9 A;  4EYC A;  1HU9 A;  1VQ5 3;  3S67 A;  1OH0 A;  4G1M B;  1JV2 B;  4HM5 B;  4ORL A;  3GZR A;  4N6T A;  3NQZ A;  2F99 A;  3HI7 A;  3LTD A;  1VQ8 3;  4MMZ B;  3N8B A;  2CFG A;  3CCR 3;  1US1 A;  3N9H A;  2KXG A;  1OUN A;  2Z7A A;  4WP5 A;  3N54 B;  1DMQ A;  2GU1 A;  3OWU A;  3VGN A;  5IG3 A;  3FH1 A;  1LOX A;  4MEI A;  4OVM A;  3ER7 A;  1Q82 4;  1QVG 2;  3J7Y d;  2XFS A;  4X2H A;  1NU3 A;  1M90 4;  3X3Y A;  1QVF 2;  1YJW 3;  1O7P B;  4R4K A;  3NV0 B;  3HZP A;  3JUO A;  1VQL 3;  1DVD A;  3WOE B;  4N6L A;  4O3V A;  5LC6 A;  1RKY A;  5G2G A;  4XBT A;  4HM3 B;  3KSP A;  3Q90 A;  1R4C A;  4AKZ A;  4GL6 A;  3QRD A;  5CXO A;  1N9J A;  1IDP A;  1Y4K A;  5AEU B;  3WA3 A;  2W03 A;  2BMO B;  3EQQ B;  2HMN B;  3LML A;  5EVH A;  1W6G A;  5AYR B;  2YFL B;  4CDL A;  4EC6 A;  4K1U A;  5D81 A;  3CCU 3;  1FA3 A;  1YJN 3;  2GXF A;  1OHS A;  1LXE A;  1M9G A;  1WNH A;  2W2C A;  1TFK A;  5I97 A;  3CPW 2;  1QAL A;  3EHC A;  1EA2 A;  3MKI A;  3PXM A;  1DYU A;  3MWZ A;  4N6M A;  2FXT A;  4R80 A;  3HK4 A;  4HYZ A;  1NDO B;  4FCM A;  3SOA A;  1STF I;  3NXJ A;  5IEO A;  5IF6 A;  4NRE A;  3CCS 3;  3K7C A;  1K8A 4;  2CG1 A;  2ZDJ A;  5DRE A;  1RN7 A;  1J2B A;  3T0U A;  3MPH A;  2IA7 A;  1YVB I;  2Q07 A;  2CFL A;  2HMM B;  3S27 A;  1NB3 I;  2OQE A;  4HM7 B;  3FG4 A;  1Z1S A;  1ULI B;  3DGM A;  1AV4 A;  2E2U A;  4HM6 B;  2YFI B;  2CC3 A;  3BNE A;  1VQN 3;  1S72 3;  3SX1 A;  3DZL A;  4R1K A;  4XM4 A;  3CNM A;  3UNL A;  3L0R A;  3HIG A;  1Q7Y 4;  3CC7 3;  1AR0 A;  4XB5 A;  1QMA A;  1NB5 I;  3PS8 A;  2BHM A;  2GBX B;  2STD A;  3DXO A;  1IT7 A;  1OF5 A;  1C7H A;  4WYK A;  4AKY A;  3CXC 2;  2XH9 A;  1YJ9 3;  1TU5 A;  2Y74 A;  4K1V A;  3K0Z A;  2GEX A;  5EQL A;  1WMO A;  3FZW A;  3KE7 A;  2XGL A;  4KFD A;  1EG9 B;  1IQX A;  1CEW I;  5AI1 A;  3DY5 A;  1VQM 3;  1CQS A;  3NBB A;  3STD A;  1W01 A;  4L7K A;  4FMB A;  5CF1 A;  3FLJ A;  7STD A;  3PGB A;  3F8H A;  3PCR A;  1OGX A;  3U1W A;  5IEN A;  5KP3 A;  5IG4 A;  1YGE A;  3G0K A;  4U13 A;  1N9E A;  1DVC A;  2ZL8 A;  1MOL A;  3T8N A;  3IMA B;  3DGL A;  3EX9 A;  3NM7 A;  5ELU A;  2CH9 A;  1UW1 A;  4NHF A;  4RNY A;  2IUJ A;  5D83 A;  2GEY A;  1OAC A;  3PCS A;  2INX A;  4XBX A;  1TFO A;  3Q2P A;  1VQ9 3;  3OV4 A;  2Z77 A;  3CCL 3;  3B8L A;  4K90 B;  5TGN A;  2QEX 3;  3CCE 3;  1TP6 A;  1TUH A;  5AEW B;  2OTL 3;  1K28 A;  3B4P A;  4N6N B;  1FGO A;  2GU3 A;  5ELJ A;  3BND A;  3JUP A;  4N6O B;  3M8C A;  4OUQ A;  1O7G B;  3KFQ C;  1IV9 A;  2XRX B;  3WOD G;  3GZX B;  2CWU A;  1M1K 4;  1WMN A;  2B24 B;  3X42 A;  2P09 A;  1LVN A;  3F40 A;  1O7N B;  1YI2 3;  3K5T A;  4XDW A;  1LNH A;  1KQS 2;  3G16 A;  1GY6 A;  4KFF A;  4JRF A;  1JKG B;  2D42 A;  3X41 A;  3UJM A;  1AVL A;  1G96 A;  3DUK A;  3GWR A;  4BTW A;  3VSY A;  1UI8 A;  2IMJ A;  3NX0 A;  3SOY A;  4KFE A;  3JUM A;  3X40 A;  3CME 3;  1JJ2 2;  4KVH A;  5IEP A;  3LTA A;  4L8P A;  1W7C A;  3FCS B;  3V98 A;  1FGM A;  2RFR A;  3KN4 A;  3LH4 A;  1N8Q A;  1T5Y A;  1K41 A;  1E97 A;  3S28 A;  4FCJ A;  3S29 A;  1KD1 4;  1A2K A;  2Z76 A;  2LQV A;  2P05 A;  2YFJ B;  4Q53 A;  4RNZ A;  2E2V A;  2CFW A;  3BLZ A;  3F9S A;  1CYU A;  4K61 A;  5BVB A;  3HII A;  5FGO A;  4HZB B;  2HMJ B;  2O9U X;  3F14 A;  1RRL A;  4BTX A;  1IV7 A;  3E99 A;  1SIH A;  1FGT A;  2M7O A;  2W9P A;  3FKA A;  3B7C A;  3O8Y A;  3I55 3;  1N8R 4;  4I4K A;  1GY5 A;  3FGY A;  4GB5 A;  1OPY A;  2WO0 A;  1W00 A;  3BNB A;  2Z6B A;  3KZT A;  2JDI H;  5FW5 A;  2YX9 A;  2A15 A;  1JB5 A;  3HX8 A;  3CD6 3;  5CK6 A;  2W6J H;  3WDG B;  1SII A;  5AIF A;  1E3V A;  1TIJ A;  1VQP 3;  1IK3 A;  2CWT A;  1Q40 B;  2XEP A;  3G8Z A;  5JBS A;  2CFD A;  5IG5 A;  1O7W B;  3CMA 3;  1JKG A;  3SVA A;  3WOF B;  2XSH B;  2E2T A;  3NV0 A;  3EBT A;  3I0Y A;  4J8T A;  5CLK A;  3RDE A;  1VQ6 3;  3X3Z A;  5HGR A;  1A90 A;  1KSI A;  1W6Y A;  3RGR A;  5BXQ A;  4FMD A;  3KSE D;  1DMN A;  1QJG A;  3UL5 A;  1O7M B;  4LEH A;  5AIH A;  1YIJ 3;  3GZB A;  1IVU A;  4LGQ A;  5KP1 A;  2D1W A;  3ROB A;  4R9L A;  4QWT A;  3OW2 2;  2P38 A;  3V99 A;  3MYT A;  2KRT A;  3EB8 A;  1FGR A;  2IUK A;  1IVX A;  2OWP A;  1W2Z A;  1GS3 A;  2BMR B;  2ML5 A;  4HBR A;  4FMA A;  4R9K A;  1SJW A;  3FG1 A;  3NBR A;  4LMI A;  4RZM A;  2QIY A;  2RGQ A;  1SQW A;  2LYX A;  2OOV C;  3DM8 A;  1UUW B;  5D82 A;  1Q81 4;  2R4I A;  1O7H B;  1ZX2 A;  4X2O A;  1OHO A;  2WGO A;  1ROV A;  1N5H A;  1N5P A;  2BO9 B;  1MNL A;  1M1X B;  2CKF B;  4HVN A;  3PYJ A;  1GD4 A;  3QK9 A;  2C11 A;  1Q86 4;  1WTH A;  2CW9 A;  3UL6 A;  5A0O B;  8CHO A;  2HML B;  1Q40 A;  3IPT A;  2OQE C;  1RRH A;  2CIU A;  3OXA A;  3DGN A;  1IVW A;  1S5A A;  5STD A;  2B1X B;  1JN5 B;  5AYS C;  2QA4 3;  3FF2 A;  3GAX A;  2P0M A;  1OHP A;  4N3V A;  4XDV A;  1KC8 4;  1IU7 A;  3CC4 3;  2CG0 A;  6STD A;  1QAF A;  3CCQ 3;  3SXX A;  2W56 B;  2WOF A;  3OX9 A;  1NJI 4;  3NBJ A;  2FNQ A;  3EJV A;  1JB2 A;  2F98 A;  3JVC A;  2W04 A;  1OCV A;  3S5C A;  3EBY A;  1NO3 A;  3MG3 A;  1W2B 2;  3FF0 A;  4L8O A;  4IIA A;  3Q1C A;  5KP4 A;  1ASK A;  2K54 A;  3MSO A;  4HM1 B;  4HM8 B;  2L4V A;  5JPU A;  3NM2 A;  4HJL B;  1JRQ A;  1V74 A;  2W0Q A;  3SED A;  2V1L A;  2MF7 A;  1E3R A;  1FUW A;  1VQ4 3;  3OWY A;  3LYG A;  2CFK A;  3FG3 A;  4JF8 A;  3GZY B;  3G6E 3;  1PU4 A;  1GYB A;  3IJE B;  2ML6 A;  4HM2 B;  4WWU C;  3PZW A;  2K0M A;  4MMY B;  1EKM A;  2FGT A;  3CU3 A;  1PFP A;  3D3L A;  4AEQ A;  1K9M 4;  3T8U A;  2XGN A;  3UB1 A;  5AII A;  5IER A;  3JUQ A;  3CNX A;  2W9Q A;  1JB4 A;  3F7S A;  2BT3 A;  2PNC A;  5AIG A;  1EQK A;  3G4S 3;  3MG2 A;  3K9M C;  1OF5 B;  4STD A;  3GRD A;  4WYK B;  1D6Z A;  1ZO2 A;  1UUV B;  1F8N A;  1UI7 A;  1JNQ A;  3VF1 A;  3X3X A;  1A2V A;  3RGA A;  3CPO A;  4N6U A;  3I56 3;  2JQ5 A;  2XFT A;  4EXR A;  4ZM8 A;  4O2H A;  5CF2 A;  1JN5 A;  2BMQ B;  2C10 A;  2UX0 A;  3NHX A;  4OK0 A;  1D6U A;  2OTJ 3;  2WOH A;  4WFO A;  2XR8 B;  2HMK B;  3H3H A;  3V92 A;  1OGZ A;  4EBG A;  1ISK A;  2W56 A;  2OOV A;  4FCZ A;  3OWS A;  3FSD A;  4FR9 A;  4N6V 0;  4H3U A;  1RJO A;  3AMO B;  4EV2 A;  2PZV A;  1AVK A;  1DMM A;  3NUV A;  3G71 3;  4CCV A;  3WA2 X;  3ECF A;  1WMP A;  4TX4 A;  3MG1 A;  1WQL B;  4WHA A;  4EV5 A;  1L5G B;  3EE1 A;  1VQ7 3;  4HZ9 B;  3U97 A;  3LZA A;  1VZZ A;  1K73 4;  4HKV B;  3LTB A;  4IPB A;  5JPP A;  1FGQ A;  2CK3 H;  1IT8 A;  5LC7 A;  1D6Y A;  2OCT A;  1NWW A;  2O3O A;  2WGQ A;  3KKG A;  3KII A;  1IQ8 A;  5EEO A;  1ULJ B;  3CCV 3;  2Y73 A;  3F7X A;  2QGU A;  3JUN A;  4MJD A;  1STD A;  2CWV A;  3LTC A;  4PEJ A;  3ALA A;  3SLU A;  4MMX B;  2KCD A;  1U5O A;  2HMO B;  1CYV A;  1U8C B;  2I9W A;  1VQO 3;  3H51 A;  3MHE A;  2SBL A;  4KZ1 A;  3DGO A;  2CHC A;  3BNC A;  3EF8 A;  3LT9 A;  4HM0 B;  4IT7 A;  1Q42 A;  2GBW B;  1HKX A;  4LSO A;  3BB9 A;  1A67 A;  1BUQ A;  1KWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...