3G4S3

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 4
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g4s300
1YIT3 3CCR3 3CME3 1JJ22 2QEX3 1K9M4 1VQM3 1VQL3 3CC43 1VQ43 3CCV3 1M904 1YIJ3 2OTL3 1QVF2 3CCL3 1VQ73 1KQS2 1KD14 1VQN3 3I553 3CCU3 1QVG2 3CD63 3CCQ3 1YJ93 3OW22 1VQO3 3G6E3 3I563 1YHQ3 1NJI4 1KC84 1N8R4 3CXC2 1Q7Y4 1M1K4 3CCM3 1S723 1VQK3 1VQP3 1YJN3 1K734 1VQ53 1W2B2 1VQ93 1Q864 3CC73 1VQ83 3CCJ3 3G4S3 1K8A4 3CCS3 1VQ63 3G713 3CMA3 2OTJ3 1YI23 3CC23 1Q824 1YJW3 2QA43 3CPW2 3CCE3 1Q814
chains in the Genus database with same CATH superfamily
3SYUA 1YIT3 3MKIA 1GMPA 7GSPA 2K54A 1MGWA 1LQGC 2PZVA 3EE1A 3RGAA 3CNXA 1MNLA 1T3BA 3QK9A 5AYSC 3ZG5A 2CWUA 2V1LA 2GBXB 2KF4A 4IT7A 4XM4A 2GU1A 3LT8A 1M1XB 3HK4A 3MPHA 3NM2A 1KD14 2BNGA 4O2HA 1ROAA 1JN5B 4H3UA 2OQEC 3FG4A 2W9PA 1I70A 1AVKA 1F8NA 2YX9A 2Z6BA 1TJDA 3F14A 1MWTA 3L0RA 2IYJA 2W56B 3FH1A 1OHSA 4KFFA 1W01A 4O3VA 3EBYA 4WYKB 1ISKA 1OGXA 1KWIA 3GRDA 3FKAA 4N6LA 1A2KA 1SARA 8RNTA 2F4YA 2FGTA 3OWUA 2R41A 1EG9B 4GSPA 2F86B 2JQ5A 3KSPA 3ZFZA 1U5OA 1IQXA 2RFRA 2XRXB 1PU4A 4WHAA 1GY6A 2D42A 5DREA 1UCJA 2CFWA 3JUOA 1OGZA 4WWUC 1C7HA 4L7KA 3G4S3 5RNTA 5G1KA 1M904 4IPBA 3S29A 1G96A 1GY5A 1VQN3 5IG5A 2CIUA 3ER7A 3S28A 2UUGC 5IERA 2F99A 1RKYA 1G0TA 3B4OA 5CXOA 1FUWA 1WTHA 1RDSA 3DXOA 3E99A 3JUNA 5JPPA 9RNTA 4K90B 1TRQA 1IDPA 1K28A 3BNDA 3LTAA 1VQ83 1NWWA 1AV4A 4N6MA 3B8LA 4WFOA 3F7XA 2FNQA 1E3VA 1BRHA 3MG3A 1ZS7A 4J9AA 5BXQA 3GAXA 1UDII 3F7SA 3WMDA 2GEYA 1C54A 1BOXA 1OPYA 2QIYA 3HOHA 2W6JH 3FCSB 3NM7A 3SXXA 4EV5A 2KF6A 4HM8B 1CEWI 1OHOA 4K1UA 3BNBA 4RNTA 2UGIA 3WOEB 5IG4A 3U97A 4HM0B 1W6YA 3DGYA 3MHEA 3S27A 1RCLA 1IQYA 1SIHA 4EV2A 4EYCA 1B3SA 2GSPA 4MMXB 1DVCA 1RGEA 1EQKA 1GOYA 1Q40B 3URPA 3GZRA 3DM8A 2BMRB 4RBNA 3HI7A 2RCDA 3PZWA 1BRSA 1QAKA 3GZYB 2WOHA 3F9SA 4R9KA 2KRTA 4FCZA 3CCE3 2ML5A 1CH0A 3LTCA 2SBLA 1JRQA 3OV4A 3EN8A 1B21A 1STFI 2RGQA 1NO3A 3FG3A 4J5GA 5D82A 1WMOA 1B2ZA 3S67A 3K9MC 1YGEA 3X3XA 4G1MB 3UB1A 1N9EA 4HZBB 5AI1A 1VQO3 2Z7AA 4LYLB 1BRKA 1JB4A 5IEOA 2BMQB 4HM6B 4KFEA 4OUQA 4EW5A 1Q7Y4 4FMAA 5AIHA 2K3DA 1K734 3NBJA 1UCKA 1M9GA 1O7MB 1WNHA 2KAAA 1LRAA 3DMCA 1V74A 2CHCA 1OHPA 1ZX2A 2YFJB 3D5GA 3F8HA 3OWSA 5AIIA 3MWZA 5LC6A 3T0UA 2RNTA 1YNVX 3MYTA 1LNIA 4GL6A 1N5HA 2XGLA 1RCKA 2KF3A 4HM4B 3EC9A 2H0IA 1IVXA 4BU4A 3NXJA 2Q07A 5HGRA 1JV2B 2ZHXB 3IJEB 1PYLA 3FZWA 6RNTA 1ROVA 1JN5A 4AKYA 1EKMA 3RDEA 1JZOA 2D1WA 1BRGA 2KCDA 3G8ZA 3K7CA 3I563 4BTXA 3BNEA 3N54B 2YFIB 3U1WA 2HMNB 1IQ8A 1TTOA 2O3OA 2W56A 1VQK3 3FG1A 1RGKA 4HM3B 3B4PA 4OVMA 1JZDA 2ZDJA 1W6CA 2KXGA 2C10A 1I2EA 3LYGA 3OWYA 1VQ93 1IYYA 3CC73 1IT7A 3CNMA 1VQ63 3V98A 1FGRA 1BUJA 4OK0A 2IUKA 1IVWA 4J5KA 3DZLA 1QJGA 1T2HA 3A76A 1B2MA 3BIRA 2A15A 4L8OA 1BANA 1RRHA 1JKGB 1OH0A 3SOYA 2ML6A 3D79A 1BSCA 2F5WA 1GMRA 1RGLA 2P05A 1QVG2 4HAAA 1K41A 1YHQ3 4AEQA 4CCVA 3BB9A 5D83A 1JB2A 4NREA 3UJMA 2LQVA 3DY5A 1RGFA 2W9QA 3KIIA 2XF3A 3LH4A 2B1XB 3JUQA 3KFQC 3CCS3 1E97A 3CMA3 1E3RA 1IVUA 5G1LA 3SVAA 1YJW3 2BHMA 1Q824 1LXEA 2INXA 4XDVA 5FW5A 3BNCA 3SX1A 3T8UA 6STDA 1O7HB 3KCHA 1RGHA 1UI8A 1MWSA 1O7PB 1W7CA 4HOHA 2KF5A 5LC7A 1L5GB 1W6GA 3G0KA 4I5QA 3KZTA 4CPKA 2XFSA 3GZBA 3D5IA 4JF8A 5KP3A 1STDA 1BSDA 1HYFA 4FMCA 1BSAA 1O7WB 1VQP3 1A90A 1MWUA 1BGSA 3BU4A 2MC8A 2YFLB 1Q864 1BNFA 1RHLA 2CK3H 4H61A 4QWTA 3DGOA 3X41A 1TU5A 3CCJ3 4FMDA 1N9JA 4MJDA 1X1XA 1GSPA 3D3LA 4KFDA 3ZG0A 1YVSA 3EJVA 2Y73A 1KSIA 3H3HA 1UUGB 3LTDA 5STDA 1OF5B 3HIGA 5EVHA 2OCTA 1ZGXA 2CFGA 2OOVA 2QEX3 1GOVA 1VQ43 2STDA 1BSEA 1I8VA 3EB8A 5BU4A 3CCV3 1N8QA 4LEHA 4U13A 4ORLA 5IW9A 1VQ73 1RN1A 3N9HA 4NHFA 1QMAA 1T5YA 1NB5I 3LTBA 1YVBI 3EQQB 1DMQA 3JVCA 5CLKA 3CXC2 1NB3I 3FGYA 1FGOA 3DH2A 4LZIA 1B2UA 3SLUA 3PXMA 5CF1A 4X2HA 1W00A 1GD3A 1GS3A 1JNQA 1JBTA 1SIIA 5M18A 1W02A 1WMNA 3WA2X 2GU3A 1UW1A 3STDA 1VZZA 2Y74A 1D6YA 2QGUA 2BT3A 2CC3A 3SOAA 4LSOA 1FW7A 2ZA4A 3JUPA 3Q90A 4XB5A 1BRJA 4HM2B 1K9M4 2FXTA 4STDA 4WP5A 1AY7A 2CH9A 1WQLB 2L4VA 3CCQ3 2P0MA 1ASKA 1I0XA 1NNVA 3FSDA 1DETA 1S723 1GMQA 1LOWA 1GY7A 4IIAA 2F56A 1EA2A 2W04A 3N8BA 3NV0A 4LGQA 2B24B 5FGOA 5JPUA 2XSOB 1EEJA 5TGNA 3LXUX 4HJLB 3PS8A 4TX4A 4HZ9B 3G713 2CFKA 3J7Yd 1BIRA 3LMLA 1FGQA 3NX0A 1UI7A 2Z77A 2L1SA 1DMNA 1T2IA 1Q7HA 1JKGA 1OACA 1TFOA 2CWTA 1Q814 3CME3 5JBSA 3AHWA 2PNCA 1X1WA 3Q3FA 5ELJA 1D6UA 3O8YA 3WDGB 3I553 3QRDA 2BU4A 4RZMA 1IT8A 1BNRA 2XGNA 3H51A 4KVHA 5AEWB 3HZPA 2GBWB 2H0HA 1BNJA 1U8CB 4I4KA 1IK3A 4WYKA 5GSPA 1I3FA 2P38A 3LOYA 3UL6A 1B2SA 1G02A 3V99A 3BLZA 2OOVC 1DMMA 4XBTA 4ILFA 5A0OB 4XBXA 2E2TA 5AIFA 1AR0A 1DVDA 1RGAA 4O8SA 3ROBA 3EBTA 1MGRA 2AAEA 3IPTA 1VQM3 1PFPA 4BL2A 3CC43 3F8XA 2Z76A 1TIJA 4N6NB 4HM1B 8CHOA 2W03A 4JRFA 1UCLA 2R4IA 2E2VA 5IG3A 5AYRB 3ALAA 3WA3A 4FCMA 1D6ZA 2XH9A 4NPBA 3PCRA 1UCIA 6GSPA 1CQSA 3DUKA 1MWRA 3PCSA 7RNTA 4HYZA 1B2XA 1N5PA 4CJNA 3HIIA 1BRNL 1LOYA 4RNZA 3M8CA 5AIGA 2IY2A 5M1AA 3UL5A 3AHSA 5DRVA 1I0VA 3NBBA 5CK6A 1BNSA 3NUVA 1FUTA 1WMPA 2C4BA 2K0MA 3EN1B 2IUJA 1OF5A 2CFLA 1VQQA 3WHOA 1HU9A 1A67A 1I2GA 2CX0A 3I0YA 1R4CA 3GWRA 2HMOB 3PYJA 1BU4A 4N3VA 4N6V0 1YIJ3 2OTL3 1PY3A 1I3IA 1TP6A 3KSED 3FLJA 2W2CA 4PEJA 1FA3A 2IMJA 3VF1A 3KE7A 1ZO2A 3X42A 3AMOB 1UUWB 3K63A 4FR9A 1BNEA 4R1KA 4FMBA 2CFDA 3PGBA 3F40A 4BTWA 5BIRA 3T8NA 3KN4A 1RJOA 3DGLA 1Q40A 1LQMB 2P0XA 3JUMA 4R4KA 1Z1SA 3LZAA 3EHCA 1YI23 1X1YA 1A2PA 2CG1A 4XBYA 2HMKB 2MF7A 4EC6A 4EXRA 1FZUA 3X3YA 2O9UX 1HZ1A 1AVLA 1Q42A 3FF2A 3OXAA 4R80A 1IU7A 3CCR3 1V58A 3NHXA 3FF0A 4HBRA 1TFKA 4HVNA 1QVF2 4N6UA 1TRPA 1SQWA 3CCU3 2WGQA 3KKGA 1GOUA 1M1K4 1UUVB 1RN4A 2RBIA 3SEDA 1B27A 1LVNA 4BL3A 4KT3B 2BO9B 7STDA 1VQ53 4MEIA 3TDGA 2XEPA 1S5AA 1BUQA 3NQYA 1W4NA 2J8XB 5EQLA 2QA43 1BNGA 5ELUA 3RGRA 1QAFA 1JBSA 2WGOA 5I97A 1LNHA 3NQZA 1Q9EA 1QALA 2BIRA 3CU3A 1JJ22 1LOXA 3AGOA 3MG2A 1CYVA 2P09A 4FCJA 3AGNA 4BTYA 1AQZA 3OX9A 2RSXA 2WO0A 4MMZB 3CCL3 1EUIC 1FGTA 4XDWA 3CD63 1B20A 1LOVA 1O7GB 4LMIA 1N8R4 1JBRA 2GXFA 3LT9A 2HOHA 3IMAB 4R9LA 5CF2A 2CWVA 5KP1A 1W2B2 1NU3A 2CG0A 2OQEA 1UGHI 3ECFA 3WODG 1BRIA 4Q53A 1W2ZA 1ULIB 2UX0A 2XR8B 1A2VA 4BIRA 1YGWA 2I9WA 4GB5A 3VSYA 4K1VA 1I2FA 1RN7A 1OUNA 5M19A 3Q2PA 1DYUA 2ZL8A 1Y4KA 2WOFA 3GZXB 2XFTA 1BAOA 3EX9A 2F98A 1KQS2 1RGCA 4HM7B 1NDOB 1J2BA 1RGGA 2C11A 1SJWA 3WR2A 3CPOA 3RNTA 3OW22 4X2OA 1KC84 1ULJB 1HKXA 1SPUA 3G16A 3V92A 1BNIA 1YJN3 3UNLA 4K61A 4CDLA 2CX1A 2LYXA 4N6OB 1CYUA 1FYSA 1BSBA 1UGIA 3D9RA 5AEUB 1FUSA 1FGMA 3A5EA 5EEOA 1V57A 4EBGA 2CW9A 2JDIH 3DGMA 3S5CA 1W5ZA 5HOHA 5IF6A 5KP4A 1RNBA 1R4YA 2H0GA 1GYBA 1RTUA 2F5MA 2OWPA 3CPW2 3B7CA 4AKZA 2E2UA 1JB5A 1OCVA 4J8TA 1RMSA 2AADA 1DE3A 1MOLA 1IV9A 2CKFB 1IV7A 2W0QA 4HM5B 4GHOA 4HKVB 4DKIA 3K0ZA 3HX8A 3MSOA 1IVVA 3D4AA 1BVIA 1GD4A 4RNYA 1X1UA 2BMOB 2GEXA 3VGNA 5IEPA 2HMLB 2HMJB 1YJ93 3AMOA 2XSHB 3K5TA 3G6E3 1RRLA 2SARA 1NJI4 5IG0A 4O02B 3CCM3 3DGNA 1RNTA 3NBRA 2HMMB 3NV0B 1TUHA 4ZM8A 5G2GA 3Q1CA 1VQL3 3X3ZA 4MMYB 2IA7A 3MG1A 1O7NB 1K8A4 3X40A 2OTJ3 4N6TA 1RSNA 5D81A 1RLSA 3GSPA 1US1A 4KZ1A 3CC23 5BVBA 5IENA 3EF8A 3WOFB 4L8PA 2M7OA
chains in the Genus database with same CATH topology
1YIT3 3MKIA 2K54A 2PZVA 3RGAA 3EE1A 3CNXA 1MNLA 3QK9A 5AYSC 2CWUA 2V1LA 2GBXB 4IT7A 4XM4A 2GU1A 3LT8A 1M1XB 3HK4A 3MPHA 3NM2A 1KD14 2BNGA 4O2HA 1ROAA 1JN5B 4H3UA 2OQEC 3FG4A 2W9PA 1AVKA 1F8NA 2YX9A 2Z6BA 3F14A 3L0RA 2W56B 4KFFA 3FH1A 1OHSA 4WYKB 1W01A 4O3VA 3EBYA 1ISKA 1OGXA 1KWIA 3GRDA 3FKAA 4N6LA 1A2KA 2FGTA 3OWUA 1EG9B 2F86B 2JQ5A 3KSPA 1U5OA 1IQXA 2RFRA 2XRXB 1PU4A 4WHAA 1GY6A 2D42A 5DREA 4WWUC 2CFWA 3JUOA 1OGZA 1VQL3 1C7HA 4L7KA 1M904 4IPBA 3S29A 1G96A 1GY5A 1VQN3 5IG5A 2CIUA 3ER7A 3S28A 5IERA 2F99A 1RKYA 5CXOA 3B4OA 1FUWA 1WTHA 3DXOA 3E99A 3JUNA 5JPPA 4K90B 1IDPA 1K28A 3BNDA 3LTAA 1VQ83 1NWWA 1AV4A 4N6MA 3B8LA 4WFOA 3F7XA 2FNQA 1E3VA 3MG3A 4J9AA 5BXQA 3GAXA 3F7SA 3WMDA 2GEYA 1OPYA 2QIYA 2W6JH 3FCSB 3NM7A 3SXXA 4EV5A 4HM8B 1CEWI 1OHOA 4K1UA 3BNBA 3WOEB 5IG4A 3U97A 4HM0B 1W6YA 3MHEA 3S27A 1IQYA 1SIHA 4EV2A 4EYCA 4MMXB 1EQKA 1DVCA 1Q40B 3GZRA 3DM8A 2BMRB 4RBNA 3HI7A 2RCDA 3PZWA 1QAKA 3GZYB 2WOHA 3F9SA 4R9KA 2KRTA 4FCZA 3CCE3 2ML5A 3LTCA 2SBLA 1JRQA 3OV4A 3EN8A 2RGQA 1STFI 1NO3A 3FG3A 5D82A 1WMOA 3S67A 3K9MC 1YGEA 3X3XA 4G1MB 3UB1A 1N9EA 4HZBB 5AI1A 1VQO3 2Z7AA 1JB4A 5IEOA 2BMQB 4HM6B 4KFEA 4OUQA 1Q7Y4 4FMAA 5AIHA 1K734 3NBJA 1M9GA 1O7MB 1WNHA 3DMCA 3OWSA 3T8NA 1V74A 2CHCA 1OHPA 1ZX2A 2YFJB 3F8HA 3G4S3 5AIIA 3MWZA 5LC6A 3MYTA 4GL6A 1N5HA 2XGLA 4HM4B 3EC9A 1IVXA 3NXJA 2Q07A 5HGRA 1JV2B 3IJEB 3FZWA 1ROVA 1JN5A 4AKYA 1EKMA 3RDEA 2D1WA 2KCDA 3G8ZA 3K7CA 3I563 4BTXA 3BNEA 3N54B 2YFIB 3U1WA 2HMNB 1IQ8A 2O3OA 2W56A 1VQK3 3FG1A 4HM3B 3B4PA 4OVMA 2ZDJA 1W6CA 2KXGA 2C10A 3LYGA 3OWYA 1VQ93 3CC73 1IT7A 3CNMA 1VQ63 3V98A 1FGRA 4OK0A 2IUKA 1IVWA 3DZLA 1QJGA 3A76A 2A15A 4L8OA 1RRHA 1JKGB 1OH0A 3SOYA 2ML6A 2P05A 1QVG2 1K41A 1YHQ3 4AEQA 4CCVA 3BB9A 5D83A 1JB2A 4NREA 3UJMA 2LQVA 3DY5A 2W9QA 3KIIA 2XF3A 3LH4A 2B1XB 3JUQA 3KFQC 3CCS3 1E97A 3CMA3 1E3RA 1IVUA 3SVAA 1Q824 1YJW3 2BHMA 1LXEA 2INXA 4XDVA 5FW5A 3BNCA 3SX1A 3T8UA 6STDA 1O7HB 1UI8A 1O7PB 1W7CA 5LC7A 1L5GB 1W6GA 3G0KA 3KZTA 2XFSA 3GZBA 5KP3A 4JF8A 1STDA 4FMCA 1O7WB 1VQP3 1A90A 2MC8A 2YFLB 1Q864 2CK3H 4H61A 1TU5A 4QWTA 3CCJ3 3DGOA 3X41A 4FMDA 1N9JA 4MJDA 3D3LA 4KFDA 3EJVA 2Y73A 1KSIA 3H3HA 3LTDA 5STDA 1OF5B 3HIGA 5EVHA 2OCTA 2CFGA 2OOVA 2QEX3 1VQ43 2STDA 3CCV3 3EB8A 1N8QA 4LEHA 4U13A 4ORLA 5IW9A 1VQ73 3N9HA 4NHFA 1QMAA 1T5YA 1NB5I 3LTBA 1YVBI 3EQQB 1DMQA 3JVCA 5CLKA 3CXC2 1NB3I 3FGYA 1FGOA 4LZIA 3SLUA 3PXMA 5CF1A 4X2HA 1W00A 1GD3A 1GS3A 1JNQA 1SIIA 1W02A 1WMNA 3WA2X 2GU3A 1UW1A 3STDA 1VZZA 2Y74A 1D6YA 2QGUA 2BT3A 2CC3A 3SOAA 4LSOA 3JUPA 3Q90A 4XB5A 4HM2B 1K9M4 2FXTA 4STDA 4WP5A 2CH9A 1WQLB 2L4VA 3CCQ3 2P0MA 1ASKA 3FSDA 1S723 1GY7A 4IIAA 3N8BA 1EA2A 2W04A 3NV0A 4LGQA 5FGOA 2B24B 3T0UA 5JPUA 2XSOB 5TGNA 3LXUX 4HJLB 3PS8A 4TX4A 4HZ9B 3G713 2CFKA 3J7Yd 3LMLA 1FGQA 3NX0A 1UI7A 2Z77A 1DMNA 1TFOA 2CWTA 1JKGA 1OACA 1Q814 3CME3 5JBSA 2PNCA 5ELJA 1D6UA 3O8YA 3WDGB 3I553 3QRDA 4RZMA 1IT8A 2XGNA 3H51A 4KVHA 5AEWB 3HZPA 2GBWB 1U8CB 4I4KA 1IK3A 4WYKA 2P38A 3LOYA 3UL6A 3V99A 3BLZA 2OOVC 1DMMA 4XBTA 5A0OB 4XBXA 2E2TA 5AIFA 1AR0A 1DVDA 4O8SA 3ROBA 3EBTA 3IPTA 1VQM3 1PFPA 3CC43 3F8XA 2Z76A 1TIJA 4N6NB 4HM1B 8CHOA 2W03A 4JRFA 2R4IA 2E2VA 5IG3A 5AYRB 3ALAA 3WA3A 4FCMA 1D6ZA 2XH9A 3PCRA 1CQSA 3DUKA 3PCSA 4HYZA 1N5PA 3HIIA 4RNZA 3M8CA 5AIGA 3UL5A 5DRVA 3NBBA 5CK6A 3NUVA 2K0MA 1WMPA 3EN1B 2IUJA 1OF5A 2CFLA 1A67A 1HU9A 3I0YA 1R4CA 3GWRA 2HMOB 3PYJA 4N3VA 4N6V0 1YIJ3 2OTL3 1TP6A 3KSED 3FLJA 2W2CA 4PEJA 1FA3A 2IMJA 3VF1A 3KE7A 1ZO2A 3X42A 3AMOB 1UUWB 3K63A 4FR9A 4R1KA 4FMBA 2CFDA 3PGBA 3F40A 4BTWA 3KN4A 1RJOA 3DGLA 1Q40A 2P0XA 3JUMA 4R4KA 1Z1SA 3LZAA 3EHCA 1YI23 2CG1A 4XBYA 2HMKB 2MF7A 4EC6A 4EXRA 3X3YA 2O9UX 3CCR3 1AVLA 1Q42A 3FF2A 3OXAA 4R80A 1IU7A 3NHXA 3FF0A 4HBRA 1TFKA 4HVNA 1QVF2 4N6UA 1SQWA 3CCU3 2WGQA 3KKGA 1M1K4 1UUVB 3SEDA 1LVNA 2BO9B 7STDA 1VQ53 4MEIA 3TDGA 2XEPA 1S5AA 1BUQA 3NQYA 1W4NA 5EQLA 2QA43 5ELUA 3RGRA 1QAFA 2WGOA 5I97A 1LNHA 3NQZA 1QALA 3CU3A 1JJ22 1LOXA 3MG2A 1CYVA 2P09A 4FCJA 4BTYA 3OX9A 2RSXA 2WO0A 4MMZB 3CCL3 1FGTA 4XDWA 3CD63 1O7GB 4LMIA 1N8R4 2GXFA 3LT9A 3IMAB 4R9LA 5CF2A 2CWVA 5KP1A 1W2B2 1NU3A 2CG0A 2OQEA 3ECFA 3WODG 4Q53A 1W2ZA 1ULIB 2UX0A 2XR8B 1A2VA 2I9WA 4GB5A 3VSYA 4K1VA 1RN7A 1OUNA 3Q2PA 1DYUA 2ZL8A 1Y4KA 2WOFA 3GZXB 2XFTA 3EX9A 2F98A 1KQS2 4HM7B 1NDOB 1J2BA 2C11A 1SJWA 3CPOA 3OW22 4X2OA 1KC84 1ULJB 1HKXA 1SPUA 3G16A 3V92A 1YJN3 3UNLA 4K61A 4CDLA 2LYXA 4N6OB 1CYUA 3D9RA 5AEUB 1FGMA 5EEOA 4EBGA 2CW9A 2JDIH 3DGMA 3S5CA 1W5ZA 5KP4A 5IF6A 1GYBA 2OWPA 3CPW2 3B7CA 4AKZA 2E2UA 1JB5A 1OCVA 4J8TA 1MOLA 1IV9A 2CKFB 1IV7A 2W0QA 4HM5B 4HKVB 3K0ZA 3HX8A 3MSOA 1IVVA 1GD4A 4RNYA 2BMOB 2GEXA 3VGNA 5IEPA 2HMLB 2HMJB 1YJ93 3AMOA 2XSHB 3K5TA 3G6E3 1RRLA 1NJI4 5IG0A 4O02B 3CCM3 3DGNA 3NBRA 2HMMB 3NV0B 1TUHA 4ZM8A 5G2GA 3Q1CA 3X3ZA 4MMYB 2IA7A 3MG1A 1O7NB 1K8A4 3X40A 2OTJ3 4N6TA 5D81A 3CC23 4KZ1A 1US1A 5BVBA 5IENA 3EF8A 3WOFB 4L8PA 2M7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT 3;  3CCR 3;  3CME 3;  1JJ2 2;  2QEX 3;  1K9M 4;  1VQM 3;  1VQL 3;  3CC4 3;  1VQ4 3;  3CCV 3;  1M90 4;  1YIJ 3;  2OTL 3;  1QVF 2;  3CCL 3;  1VQ7 3;  1KQS 2;  1KD1 4;  1VQN 3;  3I55 3;  3CCU 3;  1QVG 2;  3CD6 3;  3CCQ 3;  1YJ9 3;  3OW2 2;  1VQO 3;  3G6E 3;  3I56 3;  1YHQ 3;  1NJI 4;  1KC8 4;  1N8R 4;  3CXC 2;  1Q7Y 4;  1M1K 4;  3CCM 3;  1S72 3;  1VQK 3;  1VQP 3;  1YJN 3;  1K73 4;  1VQ5 3;  1W2B 2;  1VQ9 3;  1Q86 4;  3CC7 3;  1VQ8 3;  3CCJ 3;  3G4S 3;  1K8A 4;  3CCS 3;  1VQ6 3;  3G71 3;  3CMA 3;  2OTJ 3;  1YI2 3;  3CC2 3;  1Q82 4;  1YJW 3;  2QA4 3;  3CPW 2;  3CCE 3;  1Q81 4; 
#chains in the Genus database with same CATH topology
 3SYU A;  1YIT 3;  3MKI A;  1GMP A;  7GSP A;  2K54 A;  1MGW A;  1LQG C;  2PZV A;  3EE1 A;  3RGA A;  3CNX A;  1MNL A;  1T3B A;  3QK9 A;  5AYS C;  3ZG5 A;  2CWU A;  2V1L A;  2GBX B;  2KF4 A;  4IT7 A;  4XM4 A;  2GU1 A;  3LT8 A;  1M1X B;  3HK4 A;  3MPH A;  3NM2 A;  1KD1 4;  2BNG A;  4O2H A;  1ROA A;  1JN5 B;  4H3U A;  2OQE C;  3FG4 A;  2W9P A;  1I70 A;  1AVK A;  1F8N A;  2YX9 A;  2Z6B A;  1TJD A;  3F14 A;  1MWT A;  3L0R A;  2IYJ A;  2W56 B;  3FH1 A;  1OHS A;  4KFF A;  1W01 A;  4O3V A;  3EBY A;  4WYK B;  1ISK A;  1OGX A;  1KWI A;  3GRD A;  3FKA A;  4N6L A;  1A2K A;  1SAR A;  8RNT A;  2F4Y A;  2FGT A;  3OWU A;  2R41 A;  1EG9 B;  4GSP A;  2F86 B;  2JQ5 A;  3KSP A;  3ZFZ A;  1U5O A;  1IQX A;  2RFR A;  2XRX B;  1PU4 A;  4WHA A;  1GY6 A;  2D42 A;  5DRE A;  1UCJ A;  2CFW A;  3JUO A;  1OGZ A;  4WWU C;  1C7H A;  4L7K A;  3G4S 3;  5RNT A;  5G1K A;  1M90 4;  4IPB A;  3S29 A;  1G96 A;  1GY5 A;  1VQN 3;  5IG5 A;  2CIU A;  3ER7 A;  3S28 A;  2UUG C;  5IER A;  2F99 A;  1RKY A;  1G0T A;  3B4O A;  5CXO A;  1FUW A;  1WTH A;  1RDS A;  3DXO A;  3E99 A;  3JUN A;  5JPP A;  9RNT A;  4K90 B;  1TRQ A;  1IDP A;  1K28 A;  3BND A;  3LTA A;  1VQ8 3;  1NWW A;  1AV4 A;  4N6M A;  3B8L A;  4WFO A;  3F7X A;  2FNQ A;  1E3V A;  1BRH A;  3MG3 A;  1ZS7 A;  4J9A A;  5BXQ A;  3GAX A;  1UDI I;  3F7S A;  3WMD A;  2GEY A;  1C54 A;  1BOX A;  1OPY A;  2QIY A;  3HOH A;  2W6J H;  3FCS B;  3NM7 A;  3SXX A;  4EV5 A;  2KF6 A;  4HM8 B;  1CEW I;  1OHO A;  4K1U A;  3BNB A;  4RNT A;  2UGI A;  3WOE B;  5IG4 A;  3U97 A;  4HM0 B;  1W6Y A;  3DGY A;  3MHE A;  3S27 A;  1RCL A;  1IQY A;  1SIH A;  4EV2 A;  4EYC A;  1B3S A;  2GSP A;  4MMX B;  1DVC A;  1RGE A;  1EQK A;  1GOY A;  1Q40 B;  3URP A;  3GZR A;  3DM8 A;  2BMR B;  4RBN A;  3HI7 A;  2RCD A;  3PZW A;  1BRS A;  1QAK A;  3GZY B;  2WOH A;  3F9S A;  4R9K A;  2KRT A;  4FCZ A;  3CCE 3;  2ML5 A;  1CH0 A;  3LTC A;  2SBL A;  1JRQ A;  3OV4 A;  3EN8 A;  1B21 A;  1STF I;  2RGQ A;  1NO3 A;  3FG3 A;  4J5G A;  5D82 A;  1WMO A;  1B2Z A;  3S67 A;  3K9M C;  1YGE A;  3X3X A;  4G1M B;  3UB1 A;  1N9E A;  4HZB B;  5AI1 A;  1VQO 3;  2Z7A A;  4LYL B;  1BRK A;  1JB4 A;  5IEO A;  2BMQ B;  4HM6 B;  4KFE A;  4OUQ A;  4EW5 A;  1Q7Y 4;  4FMA A;  5AIH A;  2K3D A;  1K73 4;  3NBJ A;  1UCK A;  1M9G A;  1O7M B;  1WNH A;  2KAA A;  1LRA A;  3DMC A;  1V74 A;  2CHC A;  1OHP A;  1ZX2 A;  2YFJ B;  3D5G A;  3F8H A;  3OWS A;  5AII A;  3MWZ A;  5LC6 A;  3T0U A;  2RNT A;  1YNV X;  3MYT A;  1LNI A;  4GL6 A;  1N5H A;  2XGL A;  1RCK A;  2KF3 A;  4HM4 B;  3EC9 A;  2H0I A;  1IVX A;  4BU4 A;  3NXJ A;  2Q07 A;  5HGR A;  1JV2 B;  2ZHX B;  3IJE B;  1PYL A;  3FZW A;  6RNT A;  1ROV A;  1JN5 A;  4AKY A;  1EKM A;  3RDE A;  1JZO A;  2D1W A;  1BRG A;  2KCD A;  3G8Z A;  3K7C A;  3I56 3;  4BTX A;  3BNE A;  3N54 B;  2YFI B;  3U1W A;  2HMN B;  1IQ8 A;  1TTO A;  2O3O A;  2W56 A;  1VQK 3;  3FG1 A;  1RGK A;  4HM3 B;  3B4P A;  4OVM A;  1JZD A;  2ZDJ A;  1W6C A;  2KXG A;  2C10 A;  1I2E A;  3LYG A;  3OWY A;  1VQ9 3;  1IYY A;  3CC7 3;  1IT7 A;  3CNM A;  1VQ6 3;  3V98 A;  1FGR A;  1BUJ A;  4OK0 A;  2IUK A;  1IVW A;  4J5K A;  3DZL A;  1QJG A;  1T2H A;  3A76 A;  1B2M A;  3BIR A;  2A15 A;  4L8O A;  1BAN A;  1RRH A;  1JKG B;  1OH0 A;  3SOY A;  2ML6 A;  3D79 A;  1BSC A;  2F5W A;  1GMR A;  1RGL A;  2P05 A;  1QVG 2;  4HAA A;  1K41 A;  1YHQ 3;  4AEQ A;  4CCV A;  3BB9 A;  5D83 A;  1JB2 A;  4NRE A;  3UJM A;  2LQV A;  3DY5 A;  1RGF A;  2W9Q A;  3KII A;  2XF3 A;  3LH4 A;  2B1X B;  3JUQ A;  3KFQ C;  3CCS 3;  1E97 A;  3CMA 3;  1E3R A;  1IVU A;  5G1L A;  3SVA A;  1YJW 3;  2BHM A;  1Q82 4;  1LXE A;  2INX A;  4XDV A;  5FW5 A;  3BNC A;  3SX1 A;  3T8U A;  6STD A;  1O7H B;  3KCH A;  1RGH A;  1UI8 A;  1MWS A;  1O7P B;  1W7C A;  4HOH A;  2KF5 A;  5LC7 A;  1L5G B;  1W6G A;  3G0K A;  4I5Q A;  3KZT A;  4CPK A;  2XFS A;  3GZB A;  3D5I A;  4JF8 A;  5KP3 A;  1STD A;  1BSD A;  1HYF A;  4FMC A;  1BSA A;  1O7W B;  1VQP 3;  1A90 A;  1MWU A;  1BGS A;  3BU4 A;  2MC8 A;  2YFL B;  1Q86 4;  1BNF A;  1RHL A;  2CK3 H;  4H61 A;  4QWT A;  3DGO A;  3X41 A;  1TU5 A;  3CCJ 3;  4FMD A;  1N9J A;  4MJD A;  1X1X A;  1GSP A;  3D3L A;  4KFD A;  3ZG0 A;  1YVS A;  3EJV A;  2Y73 A;  1KSI A;  3H3H A;  1UUG B;  3LTD A;  5STD A;  1OF5 B;  3HIG A;  5EVH A;  2OCT A;  1ZGX A;  2CFG A;  2OOV A;  2QEX 3;  1GOV A;  1VQ4 3;  2STD A;  1BSE A;  1I8V A;  3EB8 A;  5BU4 A;  3CCV 3;  1N8Q A;  4LEH A;  4U13 A;  4ORL A;  5IW9 A;  1VQ7 3;  1RN1 A;  3N9H A;  4NHF A;  1QMA A;  1T5Y A;  1NB5 I;  3LTB A;  1YVB I;  3EQQ B;  1DMQ A;  3JVC A;  5CLK A;  3CXC 2;  1NB3 I;  3FGY A;  1FGO A;  3DH2 A;  4LZI A;  1B2U A;  3SLU A;  3PXM A;  5CF1 A;  4X2H A;  1W00 A;  1GD3 A;  1GS3 A;  1JNQ A;  1JBT A;  1SII A;  5M18 A;  1W02 A;  1WMN A;  3WA2 X;  2GU3 A;  1UW1 A;  3STD A;  1VZZ A;  2Y74 A;  1D6Y A;  2QGU A;  2BT3 A;  2CC3 A;  3SOA A;  4LSO A;  1FW7 A;  2ZA4 A;  3JUP A;  3Q90 A;  4XB5 A;  1BRJ A;  4HM2 B;  1K9M 4;  2FXT A;  4STD A;  4WP5 A;  1AY7 A;  2CH9 A;  1WQL B;  2L4V A;  3CCQ 3;  2P0M A;  1ASK A;  1I0X A;  1NNV A;  3FSD A;  1DET A;  1S72 3;  1GMQ A;  1LOW A;  1GY7 A;  4IIA A;  2F56 A;  1EA2 A;  2W04 A;  3N8B A;  3NV0 A;  4LGQ A;  2B24 B;  5FGO A;  5JPU A;  2XSO B;  1EEJ A;  5TGN A;  3LXU X;  4HJL B;  3PS8 A;  4TX4 A;  4HZ9 B;  3G71 3;  2CFK A;  3J7Y d;  1BIR A;  3LML A;  1FGQ A;  3NX0 A;  1UI7 A;  2Z77 A;  2L1S A;  1DMN A;  1T2I A;  1Q7H A;  1JKG A;  1OAC A;  1TFO A;  2CWT A;  1Q81 4;  3CME 3;  5JBS A;  3AHW A;  2PNC A;  1X1W A;  3Q3F A;  5ELJ A;  1D6U A;  3O8Y A;  3WDG B;  3I55 3;  3QRD A;  2BU4 A;  4RZM A;  1IT8 A;  1BNR A;  2XGN A;  3H51 A;  4KVH A;  5AEW B;  3HZP A;  2GBW B;  2H0H A;  1BNJ A;  1U8C B;  4I4K A;  1IK3 A;  4WYK A;  5GSP A;  1I3F A;  2P38 A;  3LOY A;  3UL6 A;  1B2S A;  1G02 A;  3V99 A;  3BLZ A;  2OOV C;  1DMM A;  4XBT A;  4ILF A;  5A0O B;  4XBX A;  2E2T A;  5AIF A;  1AR0 A;  1DVD A;  1RGA A;  4O8S A;  3ROB A;  3EBT A;  1MGR A;  2AAE A;  3IPT A;  1VQM 3;  1PFP A;  4BL2 A;  3CC4 3;  3F8X A;  2Z76 A;  1TIJ A;  4N6N B;  4HM1 B;  8CHO A;  2W03 A;  4JRF A;  1UCL A;  2R4I A;  2E2V A;  5IG3 A;  5AYR B;  3ALA A;  3WA3 A;  4FCM A;  1D6Z A;  2XH9 A;  4NPB A;  3PCR A;  1UCI A;  6GSP A;  1CQS A;  3DUK A;  1MWR A;  3PCS A;  7RNT A;  4HYZ A;  1B2X A;  1N5P A;  4CJN A;  3HII A;  1BRN L;  1LOY A;  4RNZ A;  3M8C A;  5AIG A;  2IY2 A;  5M1A A;  3UL5 A;  3AHS A;  5DRV A;  1I0V A;  3NBB A;  5CK6 A;  1BNS A;  3NUV A;  1FUT A;  1WMP A;  2C4B A;  2K0M A;  3EN1 B;  2IUJ A;  1OF5 A;  2CFL A;  1VQQ A;  3WHO A;  1HU9 A;  1A67 A;  1I2G A;  2CX0 A;  3I0Y A;  1R4C A;  3GWR A;  2HMO B;  3PYJ A;  1BU4 A;  4N3V A;  4N6V 0;  1YIJ 3;  2OTL 3;  1PY3 A;  1I3I A;  1TP6 A;  3KSE D;  3FLJ A;  2W2C A;  4PEJ A;  1FA3 A;  2IMJ A;  3VF1 A;  3KE7 A;  1ZO2 A;  3X42 A;  3AMO B;  1UUW B;  3K63 A;  4FR9 A;  1BNE A;  4R1K A;  4FMB A;  2CFD A;  3PGB A;  3F40 A;  4BTW A;  5BIR A;  3T8N A;  3KN4 A;  1RJO A;  3DGL A;  1Q40 A;  1LQM B;  2P0X A;  3JUM A;  4R4K A;  1Z1S A;  3LZA A;  3EHC A;  1YI2 3;  1X1Y A;  1A2P A;  2CG1 A;  4XBY A;  2HMK B;  2MF7 A;  4EC6 A;  4EXR A;  1FZU A;  3X3Y A;  2O9U X;  1HZ1 A;  1AVL A;  1Q42 A;  3FF2 A;  3OXA A;  4R80 A;  1IU7 A;  3CCR 3;  1V58 A;  3NHX A;  3FF0 A;  4HBR A;  1TFK A;  4HVN A;  1QVF 2;  4N6U A;  1TRP A;  1SQW A;  3CCU 3;  2WGQ A;  3KKG A;  1GOU A;  1M1K 4;  1UUV B;  1RN4 A;  2RBI A;  3SED A;  1B27 A;  1LVN A;  4BL3 A;  4KT3 B;  2BO9 B;  7STD A;  1VQ5 3;  4MEI A;  3TDG A;  2XEP A;  1S5A A;  1BUQ A;  3NQY A;  1W4N A;  2J8X B;  5EQL A;  2QA4 3;  1BNG A;  5ELU A;  3RGR A;  1QAF A;  1JBS A;  2WGO A;  5I97 A;  1LNH A;  3NQZ A;  1Q9E A;  1QAL A;  2BIR A;  3CU3 A;  1JJ2 2;  1LOX A;  3AGO A;  3MG2 A;  1CYV A;  2P09 A;  4FCJ A;  3AGN A;  4BTY A;  1AQZ A;  3OX9 A;  2RSX A;  2WO0 A;  4MMZ B;  3CCL 3;  1EUI C;  1FGT A;  4XDW A;  3CD6 3;  1B20 A;  1LOV A;  1O7G B;  4LMI A;  1N8R 4;  1JBR A;  2GXF A;  3LT9 A;  2HOH A;  3IMA B;  4R9L A;  5CF2 A;  2CWV A;  5KP1 A;  1W2B 2;  1NU3 A;  2CG0 A;  2OQE A;  1UGH I;  3ECF A;  3WOD G;  1BRI A;  4Q53 A;  1W2Z A;  1ULI B;  2UX0 A;  2XR8 B;  1A2V A;  4BIR A;  1YGW A;  2I9W A;  4GB5 A;  3VSY A;  4K1V A;  1I2F A;  1RN7 A;  1OUN A;  5M19 A;  3Q2P A;  1DYU A;  2ZL8 A;  1Y4K A;  2WOF A;  3GZX B;  2XFT A;  1BAO A;  3EX9 A;  2F98 A;  1KQS 2;  1RGC A;  4HM7 B;  1NDO B;  1J2B A;  1RGG A;  2C11 A;  1SJW A;  3WR2 A;  3CPO A;  3RNT A;  3OW2 2;  4X2O A;  1KC8 4;  1ULJ B;  1HKX A;  1SPU A;  3G16 A;  3V92 A;  1BNI A;  1YJN 3;  3UNL A;  4K61 A;  4CDL A;  2CX1 A;  2LYX A;  4N6O B;  1CYU A;  1FYS A;  1BSB A;  1UGI A;  3D9R A;  5AEU B;  1FUS A;  1FGM A;  3A5E A;  5EEO A;  1V57 A;  4EBG A;  2CW9 A;  2JDI H;  3DGM A;  3S5C A;  1W5Z A;  5HOH A;  5IF6 A;  5KP4 A;  1RNB A;  1R4Y A;  2H0G A;  1GYB A;  1RTU A;  2F5M A;  2OWP A;  3CPW 2;  3B7C A;  4AKZ A;  2E2U A;  1JB5 A;  1OCV A;  4J8T A;  1RMS A;  2AAD A;  1DE3 A;  1MOL A;  1IV9 A;  2CKF B;  1IV7 A;  2W0Q A;  4HM5 B;  4GHO A;  4HKV B;  4DKI A;  3K0Z A;  3HX8 A;  3MSO A;  1IVV A;  3D4A A;  1BVI A;  1GD4 A;  4RNY A;  1X1U A;  2BMO B;  2GEX A;  3VGN A;  5IEP A;  2HML B;  2HMJ B;  1YJ9 3;  3AMO A;  2XSH B;  3K5T A;  3G6E 3;  1RRL A;  2SAR A;  1NJI 4;  5IG0 A;  4O02 B;  3CCM 3;  3DGN A;  1RNT A;  3NBR A;  2HMM B;  3NV0 B;  1TUH A;  4ZM8 A;  5G2G A;  3Q1C A;  1VQL 3;  3X3Z A;  4MMY B;  2IA7 A;  3MG1 A;  1O7N B;  1K8A 4;  3X40 A;  2OTJ 3;  4N6T A;  1RSN A;  5D81 A;  1RLS A;  3GSP A;  1US1 A;  4KZ1 A;  3CC2 3;  5BVB A;  5IEN A;  3EF8 A;  3WOF B;  4L8P A;  2M7O A; 
#chains in the Genus database with same CATH homology
 1YIT 3;  3MKI A;  2K54 A;  2PZV A;  3RGA A;  3EE1 A;  3CNX A;  1MNL A;  3QK9 A;  5AYS C;  2CWU A;  2V1L A;  2GBX B;  4IT7 A;  4XM4 A;  2GU1 A;  3LT8 A;  1M1X B;  3HK4 A;  3MPH A;  3NM2 A;  1KD1 4;  2BNG A;  4O2H A;  1ROA A;  1JN5 B;  4H3U A;  2OQE C;  3FG4 A;  2W9P A;  1AVK A;  1F8N A;  2YX9 A;  2Z6B A;  3F14 A;  3L0R A;  2W56 B;  4KFF A;  3FH1 A;  1OHS A;  4WYK B;  1W01 A;  4O3V A;  3EBY A;  1ISK A;  1OGX A;  1KWI A;  3GRD A;  3FKA A;  4N6L A;  1A2K A;  2FGT A;  3OWU A;  1EG9 B;  2F86 B;  2JQ5 A;  3KSP A;  1U5O A;  1IQX A;  2RFR A;  2XRX B;  1PU4 A;  4WHA A;  1GY6 A;  2D42 A;  5DRE A;  4WWU C;  2CFW A;  3JUO A;  1OGZ A;  1VQL 3;  1C7H A;  4L7K A;  1M90 4;  4IPB A;  3S29 A;  1G96 A;  1GY5 A;  1VQN 3;  5IG5 A;  2CIU A;  3ER7 A;  3S28 A;  5IER A;  2F99 A;  1RKY A;  5CXO A;  3B4O A;  1FUW A;  1WTH A;  3DXO A;  3E99 A;  3JUN A;  5JPP A;  4K90 B;  1IDP A;  1K28 A;  3BND A;  3LTA A;  1VQ8 3;  1NWW A;  1AV4 A;  4N6M A;  3B8L A;  4WFO A;  3F7X A;  2FNQ A;  1E3V A;  3MG3 A;  4J9A A;  5BXQ A;  3GAX A;  3F7S A;  3WMD A;  2GEY A;  1OPY A;  2QIY A;  2W6J H;  3FCS B;  3NM7 A;  3SXX A;  4EV5 A;  4HM8 B;  1CEW I;  1OHO A;  4K1U A;  3BNB A;  3WOE B;  5IG4 A;  3U97 A;  4HM0 B;  1W6Y A;  3MHE A;  3S27 A;  1IQY A;  1SIH A;  4EV2 A;  4EYC A;  4MMX B;  1EQK A;  1DVC A;  1Q40 B;  3GZR A;  3DM8 A;  2BMR B;  4RBN A;  3HI7 A;  2RCD A;  3PZW A;  1QAK A;  3GZY B;  2WOH A;  3F9S A;  4R9K A;  2KRT A;  4FCZ A;  3CCE 3;  2ML5 A;  3LTC A;  2SBL A;  1JRQ A;  3OV4 A;  3EN8 A;  2RGQ A;  1STF I;  1NO3 A;  3FG3 A;  5D82 A;  1WMO A;  3S67 A;  3K9M C;  1YGE A;  3X3X A;  4G1M B;  3UB1 A;  1N9E A;  4HZB B;  5AI1 A;  1VQO 3;  2Z7A A;  1JB4 A;  5IEO A;  2BMQ B;  4HM6 B;  4KFE A;  4OUQ A;  1Q7Y 4;  4FMA A;  5AIH A;  1K73 4;  3NBJ A;  1M9G A;  1O7M B;  1WNH A;  3DMC A;  3OWS A;  3T8N A;  1V74 A;  2CHC A;  1OHP A;  1ZX2 A;  2YFJ B;  3F8H A;  3G4S 3;  5AII A;  3MWZ A;  5LC6 A;  3MYT A;  4GL6 A;  1N5H A;  2XGL A;  4HM4 B;  3EC9 A;  1IVX A;  3NXJ A;  2Q07 A;  5HGR A;  1JV2 B;  3IJE B;  3FZW A;  1ROV A;  1JN5 A;  4AKY A;  1EKM A;  3RDE A;  2D1W A;  2KCD A;  3G8Z A;  3K7C A;  3I56 3;  4BTX A;  3BNE A;  3N54 B;  2YFI B;  3U1W A;  2HMN B;  1IQ8 A;  2O3O A;  2W56 A;  1VQK 3;  3FG1 A;  4HM3 B;  3B4P A;  4OVM A;  2ZDJ A;  1W6C A;  2KXG A;  2C10 A;  3LYG A;  3OWY A;  1VQ9 3;  3CC7 3;  1IT7 A;  3CNM A;  1VQ6 3;  3V98 A;  1FGR A;  4OK0 A;  2IUK A;  1IVW A;  3DZL A;  1QJG A;  3A76 A;  2A15 A;  4L8O A;  1RRH A;  1JKG B;  1OH0 A;  3SOY A;  2ML6 A;  2P05 A;  1QVG 2;  1K41 A;  1YHQ 3;  4AEQ A;  4CCV A;  3BB9 A;  5D83 A;  1JB2 A;  4NRE A;  3UJM A;  2LQV A;  3DY5 A;  2W9Q A;  3KII A;  2XF3 A;  3LH4 A;  2B1X B;  3JUQ A;  3KFQ C;  3CCS 3;  1E97 A;  3CMA 3;  1E3R A;  1IVU A;  3SVA A;  1Q82 4;  1YJW 3;  2BHM A;  1LXE A;  2INX A;  4XDV A;  5FW5 A;  3BNC A;  3SX1 A;  3T8U A;  6STD A;  1O7H B;  1UI8 A;  1O7P B;  1W7C A;  5LC7 A;  1L5G B;  1W6G A;  3G0K A;  3KZT A;  2XFS A;  3GZB A;  5KP3 A;  4JF8 A;  1STD A;  4FMC A;  1O7W B;  1VQP 3;  1A90 A;  2MC8 A;  2YFL B;  1Q86 4;  2CK3 H;  4H61 A;  1TU5 A;  4QWT A;  3CCJ 3;  3DGO A;  3X41 A;  4FMD A;  1N9J A;  4MJD A;  3D3L A;  4KFD A;  3EJV A;  2Y73 A;  1KSI A;  3H3H A;  3LTD A;  5STD A;  1OF5 B;  3HIG A;  5EVH A;  2OCT A;  2CFG A;  2OOV A;  2QEX 3;  1VQ4 3;  2STD A;  3CCV 3;  3EB8 A;  1N8Q A;  4LEH A;  4U13 A;  4ORL A;  5IW9 A;  1VQ7 3;  3N9H A;  4NHF A;  1QMA A;  1T5Y A;  1NB5 I;  3LTB A;  1YVB I;  3EQQ B;  1DMQ A;  3JVC A;  5CLK A;  3CXC 2;  1NB3 I;  3FGY A;  1FGO A;  4LZI A;  3SLU A;  3PXM A;  5CF1 A;  4X2H A;  1W00 A;  1GD3 A;  1GS3 A;  1JNQ A;  1SII A;  1W02 A;  1WMN A;  3WA2 X;  2GU3 A;  1UW1 A;  3STD A;  1VZZ A;  2Y74 A;  1D6Y A;  2QGU A;  2BT3 A;  2CC3 A;  3SOA A;  4LSO A;  3JUP A;  3Q90 A;  4XB5 A;  4HM2 B;  1K9M 4;  2FXT A;  4STD A;  4WP5 A;  2CH9 A;  1WQL B;  2L4V A;  3CCQ 3;  2P0M A;  1ASK A;  3FSD A;  1S72 3;  1GY7 A;  4IIA A;  3N8B A;  1EA2 A;  2W04 A;  3NV0 A;  4LGQ A;  5FGO A;  2B24 B;  3T0U A;  5JPU A;  2XSO B;  5TGN A;  3LXU X;  4HJL B;  3PS8 A;  4TX4 A;  4HZ9 B;  3G71 3;  2CFK A;  3J7Y d;  3LML A;  1FGQ A;  3NX0 A;  1UI7 A;  2Z77 A;  1DMN A;  1TFO A;  2CWT A;  1JKG A;  1OAC A;  1Q81 4;  3CME 3;  5JBS A;  2PNC A;  5ELJ A;  1D6U A;  3O8Y A;  3WDG B;  3I55 3;  3QRD A;  4RZM A;  1IT8 A;  2XGN A;  3H51 A;  4KVH A;  5AEW B;  3HZP A;  2GBW B;  1U8C B;  4I4K A;  1IK3 A;  4WYK A;  2P38 A;  3LOY A;  3UL6 A;  3V99 A;  3BLZ A;  2OOV C;  1DMM A;  4XBT A;  5A0O B;  4XBX A;  2E2T A;  5AIF A;  1AR0 A;  1DVD A;  4O8S A;  3ROB A;  3EBT A;  3IPT A;  1VQM 3;  1PFP A;  3CC4 3;  3F8X A;  2Z76 A;  1TIJ A;  4N6N B;  4HM1 B;  8CHO A;  2W03 A;  4JRF A;  2R4I A;  2E2V A;  5IG3 A;  5AYR B;  3ALA A;  3WA3 A;  4FCM A;  1D6Z A;  2XH9 A;  3PCR A;  1CQS A;  3DUK A;  3PCS A;  4HYZ A;  1N5P A;  3HII A;  4RNZ A;  3M8C A;  5AIG A;  3UL5 A;  5DRV A;  3NBB A;  5CK6 A;  3NUV A;  2K0M A;  1WMP A;  3EN1 B;  2IUJ A;  1OF5 A;  2CFL A;  1A67 A;  1HU9 A;  3I0Y A;  1R4C A;  3GWR A;  2HMO B;  3PYJ A;  4N3V A;  4N6V 0;  1YIJ 3;  2OTL 3;  1TP6 A;  3KSE D;  3FLJ A;  2W2C A;  4PEJ A;  1FA3 A;  2IMJ A;  3VF1 A;  3KE7 A;  1ZO2 A;  3X42 A;  3AMO B;  1UUW B;  3K63 A;  4FR9 A;  4R1K A;  4FMB A;  2CFD A;  3PGB A;  3F40 A;  4BTW A;  3KN4 A;  1RJO A;  3DGL A;  1Q40 A;  2P0X A;  3JUM A;  4R4K A;  1Z1S A;  3LZA A;  3EHC A;  1YI2 3;  2CG1 A;  4XBY A;  2HMK B;  2MF7 A;  4EC6 A;  4EXR A;  3X3Y A;  2O9U X;  3CCR 3;  1AVL A;  1Q42 A;  3FF2 A;  3OXA A;  4R80 A;  1IU7 A;  3NHX A;  3FF0 A;  4HBR A;  1TFK A;  4HVN A;  1QVF 2;  4N6U A;  1SQW A;  3CCU 3;  2WGQ A;  3KKG A;  1M1K 4;  1UUV B;  3SED A;  1LVN A;  2BO9 B;  7STD A;  1VQ5 3;  4MEI A;  3TDG A;  2XEP A;  1S5A A;  1BUQ A;  3NQY A;  1W4N A;  5EQL A;  2QA4 3;  5ELU A;  3RGR A;  1QAF A;  2WGO A;  5I97 A;  1LNH A;  3NQZ A;  1QAL A;  3CU3 A;  1JJ2 2;  1LOX A;  3MG2 A;  1CYV A;  2P09 A;  4FCJ A;  4BTY A;  3OX9 A;  2RSX A;  2WO0 A;  4MMZ B;  3CCL 3;  1FGT A;  4XDW A;  3CD6 3;  1O7G B;  4LMI A;  1N8R 4;  2GXF A;  3LT9 A;  3IMA B;  4R9L A;  5CF2 A;  2CWV A;  5KP1 A;  1W2B 2;  1NU3 A;  2CG0 A;  2OQE A;  3ECF A;  3WOD G;  4Q53 A;  1W2Z A;  1ULI B;  2UX0 A;  2XR8 B;  1A2V A;  2I9W A;  4GB5 A;  3VSY A;  4K1V A;  1RN7 A;  1OUN A;  3Q2P A;  1DYU A;  2ZL8 A;  1Y4K A;  2WOF A;  3GZX B;  2XFT A;  3EX9 A;  2F98 A;  1KQS 2;  4HM7 B;  1NDO B;  1J2B A;  2C11 A;  1SJW A;  3CPO A;  3OW2 2;  4X2O A;  1KC8 4;  1ULJ B;  1HKX A;  1SPU A;  3G16 A;  3V92 A;  1YJN 3;  3UNL A;  4K61 A;  4CDL A;  2LYX A;  4N6O B;  1CYU A;  3D9R A;  5AEU B;  1FGM A;  5EEO A;  4EBG A;  2CW9 A;  2JDI H;  3DGM A;  3S5C A;  1W5Z A;  5KP4 A;  5IF6 A;  1GYB A;  2OWP A;  3CPW 2;  3B7C A;  4AKZ A;  2E2U A;  1JB5 A;  1OCV A;  4J8T A;  1MOL A;  1IV9 A;  2CKF B;  1IV7 A;  2W0Q A;  4HM5 B;  4HKV B;  3K0Z A;  3HX8 A;  3MSO A;  1IVV A;  1GD4 A;  4RNY A;  2BMO B;  2GEX A;  3VGN A;  5IEP A;  2HML B;  2HMJ B;  1YJ9 3;  3AMO A;  2XSH B;  3K5T A;  3G6E 3;  1RRL A;  1NJI 4;  5IG0 A;  4O02 B;  3CCM 3;  3DGN A;  3NBR A;  2HMM B;  3NV0 B;  1TUH A;  4ZM8 A;  5G2G A;  3Q1C A;  3X3Z A;  4MMY B;  2IA7 A;  3MG1 A;  1O7N B;  1K8A 4;  3X40 A;  2OTJ 3;  4N6T A;  5D81 A;  3CC2 3;  4KZ1 A;  1US1 A;  5BVB A;  5IEN A;  3EF8 A;  3WOF B;  4L8P A;  2M7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...