3CCS3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccs300
3CPW2 1K9M4 3CCE3 3CCL3 2QA43 1M1K4 1K8A4 1KQS2 3CC23 1QVF2 3OW22 1YJ93 1Q864 1N8R4 1Q824 1KD14 1NJI4 3I553 1Q7Y4 1KC84 3CC73 3CCQ3 1VQM3 3G4S3 1K734 1VQ93 3I563 3CXC2 1VQ73 1W2B2 1JJ22 3CD63 1YIJ3 3CMA3 2QEX3 2OTJ3 1QVG2 1YJN3 1VQN3 1Q814 1YIT3 3CCR3 1VQO3 1YHQ3 1VQ83 3G713 1VQ53 3CC43 3CCS3 1VQK3 3CME3 1M904 1VQ43 2OTL3 1VQ63 3CCM3 1VQL3 3CCV3 1VQP3 1YJW3 3G6E3 1S723 3CCJ3 3CCU3 1YI23
chains in the Genus database with same CATH superfamily
2HMNB 4G1MB 2A15A 2CK3H 2QA43 1DETA 3D5GA 2CX1A 2Z7AA 3CU3A 3QK9A 5EEOA 3FG3A 5DRVA 3NX0A 2OQEA 3B8LA 3FG4A 3K63A 1AY7A 4RNTA 2QGUA 1WMOA 3EQQB 1A2VA 2I9WA 3JUPA 1RLSA 1UI7A 2CX0A 3GZYB 4R1KA 1V57A 1B2MA 3M8CA 1GD4A 3UNLA 1BRNL 4L8PA 1ROVA 2W6JH 1BRIA 4TX4A 1E97A 1K41A 2CWUA 2P0XA 3PCSA 5AIFA 1VQ73 4KFFA 1FUTA 3K5TA 2GU3A 2RCDA 3KSED 1BNJA 1Q9EA 1ZGXA 1JN5B 2F98A 8CHOA 3J7Yd 1N9JA 3X41A 3LYGA 3BNDA 3FG1A 4O2HA 1Q824 2JQ5A 3RGAA 2QIYA 2KF5A 3VSYA 1W2B2 2SBLA 3FCSB 2XFSA 3U97A 1AR0A 1BSBA 1KSIA 2UGIA 4HZBB 2OTJ3 1MGRA 2RSXA 3UL6A 5IG5A 3DXOA 1TRQA 2F86B 5GSPA 2BMRB 2FNQA 4NREA 2STDA 4HAAA 5HOHA 2INXA 5BIRA 3CCM3 2OOVA 1BNFA 1IT8A 1FGMA 1MGWA 3OV4A 1IDPA 1S723 1FUSA 4FCMA 4EC6A 5AEUB 3CCU3 1BRGA 1CEWI 1JBRA 1QVF2 2W56B 5STDA 5EVHA 1LNHA 5IEOA 2CWVA 4MMYB 4EV5A 3LTDA 5AIGA 5AYSC 1JV2B 1WMPA 3D79A 1OGZA 3WA2X 4FR9A 1W6CA 1JJ22 2YFLB 2E2TA 4GL6A 4OK0A 1RNBA 5HGRA 1VQ83 3Q1CA 4HM3B 1VQ53 1O7MB 2OWPA 2XRXB 1ISKA 3ALAA 3B7CA 4WWUC 3D5IA 3PS8A 4MJDA 7GSPA 1V58A 1GY7A 2RGQA 3U1WA 3FGYA 1RRLA 1YGWA 3V98A 1I0XA 4KFEA 5JPUA 2WGQA 1O7GB 1AVLA 1LOYA 1A2KA 1JN5A 1SQWA 2GBWB 3ECFA 4QWTA 4EBGA 2OQEC 2ZDJA 4J8TA 3G4S3 1WQLB 3NXJA 2XGNA 3D4AA 2HMJB 1Z1SA 1RTUA 3JVCA 4HOHA 3SVAA 1UCLA 1U5OA 5CXOA 3CMA3 5ELUA 4N6UA 1RSNA 3NUVA 4RBNA 1AV4A 5DREA 2W2CA 5JBSA 1BRSA 4EXRA 4FMBA 1T2IA 1NB3I 3X40A 4K1UA 1UW1A 4R80A 3NV0B 4RNYA 1VQP3 1W6YA 1CYUA 1I2GA 1NU3A 3N9HA 1SPUA 1K9M4 4NHFA 1BRJA 1IK3A 1W2ZA 3PYJA 1O7HB 2P38A 3GAXA 2W56A 1KC84 1MWSA 3CC73 3MKIA 2R41A 2MC8A 1QALA 1G02A 1I8VA 2XEPA 2ZA4A 3S27A 3DZLA 3FZWA 1RN4A 3LT9A 1QVG2 6RNTA 3BNBA 1FGRA 3MG1A 5RNTA 5KP3A 1PY3A 4I5QA 1VQO3 1C54A 4CDLA 2C10A 4HM5B 3I0YA 1UCJA 3PGBA 3SEDA 1RN7A 1VQ43 2O3OA 3NHXA 1D6ZA 1YVSA 2ZL8A 1BRKA 2OOVC 4AEQA 3T8UA 3CCJ3 2LYXA 3JUNA 1YVBI 3KIIA 3AHWA 3Q2PA 4X2HA 3DUKA 5LC6A 1B21A 4RNZA 3GSPA 2KF6A 1RKYA 1N8R4 1UCKA 2CW9A 4J5GA 3DMCA 1JRQA 3GZBA 3MWZA 4N6OB 4PEJA 3VF1A 1Q7Y4 4BU4A 3Q90A 1A2PA 1GMRA 3I563 1IVXA 1TFOA 2CG1A 3URPA 2AAEA 3BU4A 1CYVA 1PU4A 3FSDA 1RNTA 4R9LA 1JKGB 1RMSA 1T5YA 3MG2A 3LTAA 2CKFB 1GY6A 1UCIA 5CLKA 2FXTA 3WHOA 2Y74A 3KZTA 2P0MA 3G8ZA 2GXFA 1RGFA 3Q3FA 4HVNA 5G1LA 1GOVA 1BSEA 3NV0A 2CFKA 2K54A 3NBJA 1X1WA 1LVNA 1GMPA 1BSDA 5BU4A 1AQZA 1BSCA 4MEIA 2PNCA 3KE7A 1IV7A 2BMOB 5IF6A 1CQSA 3CCQ3 2W04A 1GY5A 1W00A 4WP5A 2XGLA 3SOAA 1EKMA 2L4VA 1FYSA 1JZOA 2CFLA 3T0UA 5BVBA 1LOXA 2E2VA 3RDEA 2RFRA 3WODG 3EX9A 1RDSA 1US1A 2PZVA 3GZRA 1Q7HA 1UDII 4HM7B 3WR2A 1D6YA 5AEWB 1RN1A 1HYFA 1IU7A 3MPHA 5IG0A 1N5HA 1W01A 1Q42A 1I0VA 1T3BA 1GD3A 1OHOA 4EYCA 4EW5A 4MMZB 2K0MA 2YFJB 4FMCA 2WGOA 2XF3A 3NQZA 1A90A 1IV9A 3N54B 1RCLA 4Q53A 1OACA 1IVUA 3AHSA 3BB9A 3DGOA 4STDA 1R4CA 5AI1A 3S29A 2LQVA 2OCTA 3WOFB 2KXGA 4BTXA 2J8XB 4N6MA 2QEX3 2RNTA 2CIUA 1DVCA 1MWTA 1B2UA 4OVMA 3UL5A 3KKGA 2CG0A 1RGLA 2XR8B 3O8YA 3OWSA 1BVIA 3UB1A 1JKGA 1F8NA 1IT7A 1LNIA 1X1XA 2CH9A 2MF7A 3NQYA 4H3UA 1VQL3 2IY2A 1WMNA 3G0KA 2WO0A 4DKIA 3CPW2 3AMOB 3WDGB 2XH9A 2CHCA 3T8NA 5KP1A 3IPTA 1KD14 1ASKA 3I553 5IERA 2BU4A 3RNTA 1BUJA 5D82A 2W0QA 4K1VA 1N5PA 5D83A 4N6NB 1U8CB 4U13A 3EB8A 3OWUA 2K3DA 2GBXB 1YNVX 2Z76A 5AIIA 4BL3A 1SIHA 3SYUA 1OPYA 2F5WA 1I2FA 1IVWA 4CCVA 1B2SA 2SARA 1RJOA 5AYRB 3K9MC 3G713 1X1UA 2Z6BA 4ILFA 2ML6A 4HJLB 5LC7A 4AKYA 1M904 1OGXA 4LEHA 1YJW3 1QJGA 3G6E3 1DVDA 1UUGB 4OUQA 2D1WA 1L5GB 2H0HA 3MSOA 3RGRA 1B27A 4L7KA 4XDVA 1K28A 3CCE3 1M1K4 1BSAA 1J2BA 1OF5B 1OCVA 2IYJA 3E99A 3HIIA 3ROBA 1RHLA 3EE1A 2HMMB 1BU4A 2RBIA 2C11A 4BIRA 9RNTA 5M18A 1SIIA 1G96A 2GEYA 3EF8A 3EN8A 1ULIB 4HKVB 3LZAA 5IW9A 3KCHA 5BXQA 2IUKA 3BIRA 4FMDA 3NM2A 1W5ZA 3H51A 1YJN3 3X3XA 2XFTA 4J5KA 3X42A 3EHCA 3CC43 3CME3 1I70A 4H61A 2BT3A 1RGAA 1TIJA 3FLJA 1BUQA 5IENA 1MNLA 4IPBA 3H3HA 3LH4A 3X3ZA 7RNTA 4HM4B 3WMDA 5M1AA 8RNTA 2F5MA 1EUIC 1KWIA 1UUWB 3CNMA 3DGMA 3MHEA 3B4PA 4JRFA 1WNHA 2W9QA 3CCL3 4XM4A 3OWYA 1OH0A 3OW22 1SJWA 3CPOA 4CPKA 1DYUA 1ROAA 3AMOA 3HOHA 2HMKB 3F14A 4KVHA 5TGNA 1IQYA 1NJI4 1BAOA 1O7NB 4LSOA 1LQMB 2BO9B 3CD63 1STDA 3NM7A 2KF3A 1TJDA 2IMJA 1IQXA 4KZ1A 2L1SA 5D81A 4IIAA 1VQN3 3ER7A 1N8QA 1RGCA 1YHQ3 1LOVA 3DGYA 3BNCA 1ZO2A 2WOHA 3A5EA 1B2XA 4J9AA 1FW7A 1MWRA 1DMNA 1AVKA 1Y4KA 3FF0A 1M1XB 3K7CA 1YI23 2GU1A 3MG3A 3HZPA 2M7OA 3F9SA 2CC3A 1K8A4 5JPPA 1BANA 3CC23 2JDIH 3NBRA 2KAAA 3ZG5A 4K61A 4N6LA 1RRHA 4WFOA 1OF5A 1X1YA 1E3RA 2V1LA 2AADA 2W03A 1JB5A 3QRDA 2KCDA 5EQLA 5FGOA 1VZZA 2BIRA 1LQGC 1A67A 1WTHA 4HBRA 5IG4A 2F99A 1Q814 3ZG0A 4ZM8A 4GSPA 3D9RA 1BOXA 4O3VA 3AGOA 5CK6A 3STDA 3SLUA 1EA2A 1S5AA 3KFQC 1BIRA 4WHAA 4HYZA 1JB2A 1VQQA 1TU5A 2CFDA 1VQK3 4N3VA 1IVVA 4XBTA 1I3IA 5G2GA 1OHPA 3SXXA 5IG3A 1K734 1E3VA 1MWUA 2HMOB 3GWRA 4XB5A 2IUJA 4BTYA 1DE3A 1GMQA 1I3FA 3GRDA 2Q07A 1DMMA 1NNVA 2IA7A 3BNEA 4I4KA 3F7XA 2C4BA 3LTBA 1TRPA 3OXAA 2UX0A 1BNGA 1JNQA 4KT3B 5ELJA 1RCKA 1GOUA 1UGHI 3BLZA 4LYLB 3UJMA 1FGOA 2Y73A 3EBTA 2Z77A 2YFIB 1M9GA 3B4OA 3LOYA 2O9UX 1W6GA 3DH2A 3JUQA 2YX9A 4LZIA 1HZ1A 4N6TA 1C7HA 1FGQA 4HM0B 2P09A 1LRAA 3LXUX 3JUOA 3V92A 1VQ63 5FW5A 1QMAA 2F4YA 1OHSA 3F7SA 5CF1A 3F8XA 4JF8A 1UUVB 3DM8A 1G0TA 2R4IA 5KP4A 4GB5A 3WOEB 2H0GA 4HM8B 4WYKB 4GHOA 5A0OB 3DGLA 1GSPA 1IYYA 1YJ93 1Q40B 4O02B 1RGGA 1SARA 1FA3A 3TDGA 4XDWA 2XSHB 1IQ8A 4HM6B 2HMLB 4HZ9B 3FH1A 5CF2A 1B20A 3CXC2 3EN1B 2CFWA 5G1KA 5IEPA 1W4NA 1B2ZA 4ORLA 3IMAB 4HM1B 4K90B 4NPBA 1I2EA 4CJNA 3V99A 3AGNA 1YIT3 3CCR3 2P05A 1OUNA 1YGEA 3A76A 3SX1A 4BL2A 3EBYA 1GOYA 3LT8A 2KF4A 6GSPA 1RGHA 4R9KA 1EG9B 3L0RA 3CCV3 3MYTA 1TUHA 3EJVA 1QAFA 1JBTA 3HIGA 2KRTA 1O7PB 2E2UA 1RGKA 3PZWA 3D3LA 4X2OA 1KQS2 4XBXA 1NWWA 1EEJA 1NO3A 1Q864 3F40A 2B24B 3HI7A 3G16A 1JBSA 4HM2B 1HU9A 1R4YA 3DGNA 4FCZA 3DY5A 1DMQA 1V74A 2B1XB 1BNRA 1W7CA 1YIJ3 1BGSA 1O7WB 4XBYA 5AIHA 1MOLA 3HX8A 3FKAA 2XSOB 1D6UA 2HOHA 1W02A 3NBBA 3S28A 4FCJA 4O8SA 2ZHXB 4R4KA 1JZDA 1LOWA 1T2HA 4MMXB 2ML5A 3KN4A 3S5CA 1TTOA 2BHMA 3X3YA 3ZFZA 1NB5I 1EQKA 1TP6A 4IT7A 5I97A 3CNXA 3S67A 1VQM3 3FF2A 2OTL3 3KSPA 1B3SA 1FGTA 1NDOB 1BNSA 1GS3A 1RGEA 2WOFA 3HK4A 1JB4A 1PFPA 4AKZA 4BTWA 3K0ZA 4WYKA 3JUMA 2GSPA 3IJEB 4LMIA 1GYBA 2F56A 1BNIA 1ZS7A 2GEXA 1Q40A 3OX9A 2FGTA 3EC9A 1BRHA 1FZUA 1STFI 3PCRA 1N9EA 3VGNA 5M19A 1UI8A 4KFDA 1QAKA 3PXMA 4LGQA 3GZXB 1HKXA 1PYLA 4EV2A 1ZX2A 2UUGC 1FUWA 7STDA 1ULJB 2BMQB 3LMLA 1BNEA 3CCS3 3WA3A 2CWTA 2D42A 3F8HA 1CH0A 2CFGA 2H0IA 3SOYA 4FMAA 1UGIA 6STDA 2W9PA 2BNGA 4N6V0 4RZMA 1LXEA 4L8OA 3LTCA 3N8BA 1VQ93 1TFKA
chains in the Genus database with same CATH topology
2HMNB 4G1MB 2A15A 2CK3H 2QA43 2Z7AA 3CU3A 3QK9A 5EEOA 3FG3A 5DRVA 3NX0A 2OQEA 3B8LA 3FG4A 3K63A 2QGUA 1WMOA 3EQQB 1A2VA 2I9WA 3JUPA 1UI7A 3GZYB 4R1KA 3M8CA 1GD4A 3UNLA 4L8PA 1ROVA 2W6JH 4TX4A 1E97A 1K41A 2CWUA 2P0XA 3PCSA 5AIFA 1VQ73 4KFFA 3K5TA 2GU3A 2RCDA 3KSED 3J7Yd 2F98A 1JN5B 8CHOA 1N9JA 3X41A 3LYGA 3BNDA 3FG1A 4O2HA 1Q824 2JQ5A 3RGAA 2QIYA 3VSYA 1W2B2 2SBLA 3FCSB 2XFSA 3U97A 1AR0A 1KSIA 4HZBB 2OTJ3 3UL6A 2RSXA 5IG5A 3DXOA 2F86B 2BMRB 2FNQA 4NREA 2STDA 2INXA 3CCM3 2OOVA 1IT8A 1FGMA 3OV4A 1IDPA 4FCMA 4EC6A 5AEUB 3CCU3 1CEWI 1QVF2 2W56B 5STDA 5EVHA 1LNHA 5IEOA 2CWVA 4MMYB 4EV5A 3LTDA 5AIGA 5AYSC 1JV2B 1WMPA 3WA2X 1OGZA 4FR9A 1W6CA 1JJ22 2YFLB 2E2TA 4GL6A 4OK0A 5HGRA 1VQ83 3Q1CA 4HM3B 1VQ53 1O7MB 2OWPA 2XRXB 1ISKA 3ALAA 3B7CA 4WWUC 3PS8A 4MJDA 1GY7A 2RGQA 3U1WA 3FGYA 1RRLA 3V98A 4KFEA 5JPUA 2WGQA 1O7GB 1AVLA 1A2KA 1JN5A 1SQWA 2GBWB 3ECFA 4QWTA 4EBGA 2OQEC 2ZDJA 4J8TA 3G4S3 1WQLB 3NXJA 2XGNA 3SVAA 2HMJB 1Z1SA 3JVCA 5CXOA 1U5OA 3CMA3 5ELUA 4N6UA 3NUVA 4RBNA 1AV4A 5DREA 2W2CA 5JBSA 4EXRA 4FMBA 1NB3I 3X40A 4K1UA 1UW1A 4R80A 3NV0B 4RNYA 1VQP3 1W6YA 1CYUA 1NU3A 3N9HA 1SPUA 1K9M4 4NHFA 1IK3A 1W2ZA 3PYJA 1O7HB 2P38A 3GAXA 2W56A 1KC84 3CC73 3MKIA 2MC8A 1QALA 2XEPA 3S27A 3DZLA 3FZWA 3LT9A 1QVG2 3BNBA 1FGRA 3MG1A 5KP3A 1VQO3 4CDLA 2C10A 4HM5B 3I0YA 3PGBA 3SEDA 1RN7A 1VQ43 2O3OA 3NHXA 1D6ZA 2ZL8A 2OOVC 4AEQA 3T8UA 3CCJ3 2LYXA 3JUNA 1YVBI 3KIIA 3Q2PA 4X2HA 3DUKA 5LC6A 4RNZA 1RKYA 1N8R4 2CW9A 3VF1A 3DMCA 1JRQA 3GZBA 3MWZA 4N6OB 4PEJA 1Q7Y4 3Q90A 3I563 1IVXA 1TFOA 2CG1A 1CYVA 1PU4A 3FSDA 4R9LA 1JKGB 1T5YA 3MG2A 3LTAA 2CKFB 1GY6A 5CLKA 2FXTA 2Y74A 3KZTA 2P0MA 3G8ZA 2GXFA 4HVNA 3NV0A 2CFKA 2K54A 3NBJA 1LVNA 4MEIA 2PNCA 3KE7A 1IV7A 2BMOB 5IF6A 1CQSA 2W04A 1GY5A 1W00A 4WP5A 2XGLA 3SOAA 1EKMA 2L4VA 2CFLA 3T0UA 5BVBA 1LOXA 2E2VA 3RDEA 2RFRA 3WODG 3EX9A 1US1A 2PZVA 3GZRA 4HM7B 5AEWB 1D6YA 1IU7A 3MPHA 5IG0A 1N5HA 1W01A 1Q42A 4EYCA 1S723 1GD3A 1OHOA 4MMZB 2K0MA 2YFJB 4FMCA 2WGOA 2XF3A 3NQZA 1A90A 1IV9A 3N54B 4Q53A 1OACA 1IVUA 3BB9A 3DGOA 4STDA 1R4CA 5AI1A 3S29A 2LQVA 2OCTA 3WOFB 2KXGA 4BTXA 4N6MA 2QEX3 2CIUA 1DVCA 4OVMA 3UL5A 3KKGA 2CG0A 3O8YA 2XR8B 3OWSA 3UB1A 1JKGA 1F8NA 1IT7A 3NQYA 2CH9A 2MF7A 4H3UA 1VQL3 1WMNA 3G0KA 2WO0A 3CPW2 3AMOB 3WDGB 2XH9A 2CHCA 3T8NA 5KP1A 3IPTA 1KD14 1ASKA 3I553 5IERA 5D82A 2W0QA 4K1VA 1N5PA 5D83A 4N6NB 1U8CB 4U13A 3EB8A 3OWUA 2GBXB 5AIIA 2Z76A 1SIHA 1OPYA 4CCVA 1IVWA 3G713 1RJOA 5AYRB 3K9MC 2Z6BA 5LC7A 2ML6A 4HJLB 1M904 4AKYA 1OGXA 4LEHA 1YJW3 1QJGA 3G6E3 1DVDA 4OUQA 2D1WA 1L5GB 3MSOA 3RGRA 4L7KA 4XDVA 1K28A 3CCE3 1M1K4 1J2BA 1OF5B 1OCVA 3E99A 3ROBA 3HIIA 3EE1A 2HMMB 2C11A 1SIIA 1G96A 2GEYA 3EF8A 3EN8A 1ULIB 4HKVB 3LZAA 5IW9A 5BXQA 2IUKA 4FMDA 3NM2A 1W5ZA 3H51A 1YJN3 3X3XA 2XFTA 3X42A 3EHCA 3CC43 3CME3 4H61A 2BT3A 3FLJA 1TIJA 1BUQA 5IENA 1MNLA 4IPBA 3H3HA 3LH4A 3X3ZA 4HM4B 3WMDA 1UUWB 1KWIA 4JRFA 3CNMA 3DGMA 3MHEA 3B4PA 1WNHA 2W9QA 3CCL3 4XM4A 3OWYA 1OH0A 3OW22 1SJWA 3CPOA 1DYUA 1ROAA 3AMOA 4KVHA 2HMKB 3F14A 5TGNA 1NJI4 1IQYA 1O7NB 4LSOA 2BO9B 3CD63 1STDA 3NM7A 2IMJA 1IQXA 4KZ1A 5D81A 4IIAA 1VQN3 3ER7A 1N8QA 1YHQ3 3BNCA 1ZO2A 2WOHA 4J9AA 1DMNA 1AVKA 1Y4KA 3FF0A 1M1XB 3K7CA 1YI23 2GU1A 3MG3A 3HZPA 2M7OA 3F9SA 2CC3A 1K8A4 5JPPA 3CC23 2JDIH 3NBRA 4K61A 4N6LA 1RRHA 4WFOA 1OF5A 1E3RA 2V1LA 2W03A 1JB5A 3QRDA 2KCDA 5EQLA 5FGOA 1VZZA 1A67A 1WTHA 4HBRA 5IG4A 2F99A 1Q814 4ZM8A 3D9RA 4O3VA 5CK6A 3STDA 3SLUA 1EA2A 1S5AA 3KFQC 4WHAA 4HYZA 1JB2A 1TU5A 2CFDA 1VQK3 4N3VA 1IVVA 4XBTA 5G2GA 1K734 1OHPA 3SXXA 5IG3A 1E3VA 2HMOB 3GWRA 4XB5A 2IUJA 4BTYA 3GRDA 2Q07A 1DMMA 2IA7A 3BNEA 4I4KA 3F7XA 3LTBA 3OXAA 2UX0A 1JNQA 5ELJA 3BLZA 3UJMA 1FGOA 2Y73A 3EBTA 2Z77A 2YFIB 1M9GA 3B4OA 3LOYA 2O9UX 1W6GA 3JUQA 4LZIA 2YX9A 4N6TA 1C7HA 1FGQA 4HM0B 2P09A 3LXUX 3JUOA 3V92A 1VQ63 5FW5A 1QMAA 1OHSA 3F7SA 5CF1A 3F8XA 4JF8A 1UUVB 3DM8A 2R4IA 5KP4A 4GB5A 3WOEB 4HM8B 4WYKB 5A0OB 3DGLA 1YJ93 1Q40B 4O02B 1FA3A 3TDGA 4XDWA 2XSHB 1IQ8A 4HM6B 2HMLB 4HZ9B 3FH1A 5CF2A 3CXC2 3EN1B 2CFWA 5IEPA 1W4NA 4ORLA 3IMAB 4HM1B 4K90B 3V99A 1YIT3 3CCR3 2P05A 1OUNA 1YGEA 3A76A 3SX1A 3EBYA 3LT8A 4R9KA 1EG9B 3L0RA 3CCV3 3MYTA 1TUHA 3EJVA 1QAFA 3HIGA 2KRTA 1O7PB 2E2UA 1KQS2 3PZWA 3D3LA 4X2OA 4XBXA 1NWWA 1NO3A 1Q864 3F40A 2B24B 3HI7A 3G16A 4HM2B 1HU9A 3DGNA 4FCZA 3DY5A 1DMQA 1V74A 2B1XB 1W7CA 1YIJ3 1O7WB 4XBYA 5AIHA 1MOLA 3HX8A 3FKAA 2XSOB 1D6UA 1W02A 3NBBA 3S28A 4FCJA 4O8SA 4R4KA 4MMXB 2ML5A 3KN4A 3S5CA 1NB5I 2BHMA 3X3YA 1EQKA 1TP6A 4IT7A 5I97A 3CNXA 3S67A 1VQM3 3FF2A 2OTL3 3KSPA 1FGTA 1NDOB 1GS3A 2WOFA 3HK4A 1JB4A 1PFPA 4AKZA 4BTWA 3K0ZA 4WYKA 3JUMA 4LMIA 3IJEB 1GYBA 2GEXA 3CCQ3 1Q40A 3OX9A 2FGTA 3EC9A 3PCRA 1STFI 3VGNA 1N9EA 1UI8A 4KFDA 1QAKA 3PXMA 4LGQA 3GZXB 1HKXA 4EV2A 1ZX2A 1FUWA 7STDA 1ULJB 2BMQB 3LMLA 3CCS3 3WA3A 2CWTA 2D42A 3F8HA 3SOYA 2CFGA 4FMAA 6STDA 2W9PA 2BNGA 4N6V0 4RZMA 1LXEA 4L8OA 3LTCA 3N8BA 1VQ93 1TFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW 2;  1K9M 4;  3CCE 3;  3CCL 3;  2QA4 3;  1M1K 4;  1K8A 4;  1KQS 2;  3CC2 3;  1QVF 2;  3OW2 2;  1YJ9 3;  1Q86 4;  1N8R 4;  1Q82 4;  1KD1 4;  1NJI 4;  3I55 3;  1Q7Y 4;  1KC8 4;  3CC7 3;  3CCQ 3;  1VQM 3;  3G4S 3;  1K73 4;  1VQ9 3;  3I56 3;  3CXC 2;  1VQ7 3;  1W2B 2;  1JJ2 2;  3CD6 3;  1YIJ 3;  3CMA 3;  2QEX 3;  2OTJ 3;  1QVG 2;  1YJN 3;  1VQN 3;  1Q81 4;  1YIT 3;  3CCR 3;  1VQO 3;  1YHQ 3;  1VQ8 3;  3G71 3;  1VQ5 3;  3CC4 3;  3CCS 3;  1VQK 3;  3CME 3;  1M90 4;  1VQ4 3;  2OTL 3;  1VQ6 3;  3CCM 3;  1VQL 3;  3CCV 3;  1VQP 3;  1YJW 3;  3G6E 3;  1S72 3;  3CCJ 3;  3CCU 3;  1YI2 3; 
#chains in the Genus database with same CATH topology
 2HMN B;  4G1M B;  2A15 A;  2CK3 H;  2QA4 3;  1DET A;  3D5G A;  2CX1 A;  2Z7A A;  3CU3 A;  3QK9 A;  5EEO A;  3FG3 A;  5DRV A;  3NX0 A;  2OQE A;  3B8L A;  3FG4 A;  3K63 A;  1AY7 A;  4RNT A;  2QGU A;  1WMO A;  3EQQ B;  1A2V A;  2I9W A;  3JUP A;  1RLS A;  1UI7 A;  2CX0 A;  3GZY B;  4R1K A;  1V57 A;  1B2M A;  3M8C A;  1GD4 A;  3UNL A;  1BRN L;  4L8P A;  1ROV A;  2W6J H;  1BRI A;  4TX4 A;  1E97 A;  1K41 A;  2CWU A;  2P0X A;  3PCS A;  5AIF A;  1VQ7 3;  4KFF A;  1FUT A;  3K5T A;  2GU3 A;  2RCD A;  3KSE D;  1BNJ A;  1Q9E A;  1ZGX A;  1JN5 B;  2F98 A;  8CHO A;  3J7Y d;  1N9J A;  3X41 A;  3LYG A;  3BND A;  3FG1 A;  4O2H A;  1Q82 4;  2JQ5 A;  3RGA A;  2QIY A;  2KF5 A;  3VSY A;  1W2B 2;  2SBL A;  3FCS B;  2XFS A;  3U97 A;  1AR0 A;  1BSB A;  1KSI A;  2UGI A;  4HZB B;  2OTJ 3;  1MGR A;  2RSX A;  3UL6 A;  5IG5 A;  3DXO A;  1TRQ A;  2F86 B;  5GSP A;  2BMR B;  2FNQ A;  4NRE A;  2STD A;  4HAA A;  5HOH A;  2INX A;  5BIR A;  3CCM 3;  2OOV A;  1BNF A;  1IT8 A;  1FGM A;  1MGW A;  3OV4 A;  1IDP A;  1S72 3;  1FUS A;  4FCM A;  4EC6 A;  5AEU B;  3CCU 3;  1BRG A;  1CEW I;  1JBR A;  1QVF 2;  2W56 B;  5STD A;  5EVH A;  1LNH A;  5IEO A;  2CWV A;  4MMY B;  4EV5 A;  3LTD A;  5AIG A;  5AYS C;  1JV2 B;  1WMP A;  3D79 A;  1OGZ A;  3WA2 X;  4FR9 A;  1W6C A;  1JJ2 2;  2YFL B;  2E2T A;  4GL6 A;  4OK0 A;  1RNB A;  5HGR A;  1VQ8 3;  3Q1C A;  4HM3 B;  1VQ5 3;  1O7M B;  2OWP A;  2XRX B;  1ISK A;  3ALA A;  3B7C A;  4WWU C;  3D5I A;  3PS8 A;  4MJD A;  7GSP A;  1V58 A;  1GY7 A;  2RGQ A;  3U1W A;  3FGY A;  1RRL A;  1YGW A;  3V98 A;  1I0X A;  4KFE A;  5JPU A;  2WGQ A;  1O7G B;  1AVL A;  1LOY A;  1A2K A;  1JN5 A;  1SQW A;  2GBW B;  3ECF A;  4QWT A;  4EBG A;  2OQE C;  2ZDJ A;  4J8T A;  3G4S 3;  1WQL B;  3NXJ A;  2XGN A;  3D4A A;  2HMJ B;  1Z1S A;  1RTU A;  3JVC A;  4HOH A;  3SVA A;  1UCL A;  1U5O A;  5CXO A;  3CMA 3;  5ELU A;  4N6U A;  1RSN A;  3NUV A;  4RBN A;  1AV4 A;  5DRE A;  2W2C A;  5JBS A;  1BRS A;  4EXR A;  4FMB A;  1T2I A;  1NB3 I;  3X40 A;  4K1U A;  1UW1 A;  4R80 A;  3NV0 B;  4RNY A;  1VQP 3;  1W6Y A;  1CYU A;  1I2G A;  1NU3 A;  3N9H A;  1SPU A;  1K9M 4;  4NHF A;  1BRJ A;  1IK3 A;  1W2Z A;  3PYJ A;  1O7H B;  2P38 A;  3GAX A;  2W56 A;  1KC8 4;  1MWS A;  3CC7 3;  3MKI A;  2R41 A;  2MC8 A;  1QAL A;  1G02 A;  1I8V A;  2XEP A;  2ZA4 A;  3S27 A;  3DZL A;  3FZW A;  1RN4 A;  3LT9 A;  1QVG 2;  6RNT A;  3BNB A;  1FGR A;  3MG1 A;  5RNT A;  5KP3 A;  1PY3 A;  4I5Q A;  1VQO 3;  1C54 A;  4CDL A;  2C10 A;  4HM5 B;  3I0Y A;  1UCJ A;  3PGB A;  3SED A;  1RN7 A;  1VQ4 3;  2O3O A;  3NHX A;  1D6Z A;  1YVS A;  2ZL8 A;  1BRK A;  2OOV C;  4AEQ A;  3T8U A;  3CCJ 3;  2LYX A;  3JUN A;  1YVB I;  3KII A;  3AHW A;  3Q2P A;  4X2H A;  3DUK A;  5LC6 A;  1B21 A;  4RNZ A;  3GSP A;  2KF6 A;  1RKY A;  1N8R 4;  1UCK A;  2CW9 A;  4J5G A;  3DMC A;  1JRQ A;  3GZB A;  3MWZ A;  4N6O B;  4PEJ A;  3VF1 A;  1Q7Y 4;  4BU4 A;  3Q90 A;  1A2P A;  1GMR A;  3I56 3;  1IVX A;  1TFO A;  2CG1 A;  3URP A;  2AAE A;  3BU4 A;  1CYV A;  1PU4 A;  3FSD A;  1RNT A;  4R9L A;  1JKG B;  1RMS A;  1T5Y A;  3MG2 A;  3LTA A;  2CKF B;  1GY6 A;  1UCI A;  5CLK A;  2FXT A;  3WHO A;  2Y74 A;  3KZT A;  2P0M A;  3G8Z A;  2GXF A;  1RGF A;  3Q3F A;  4HVN A;  5G1L A;  1GOV A;  1BSE A;  3NV0 A;  2CFK A;  2K54 A;  3NBJ A;  1X1W A;  1LVN A;  1GMP A;  1BSD A;  5BU4 A;  1AQZ A;  1BSC A;  4MEI A;  2PNC A;  3KE7 A;  1IV7 A;  2BMO B;  5IF6 A;  1CQS A;  3CCQ 3;  2W04 A;  1GY5 A;  1W00 A;  4WP5 A;  2XGL A;  3SOA A;  1EKM A;  2L4V A;  1FYS A;  1JZO A;  2CFL A;  3T0U A;  5BVB A;  1LOX A;  2E2V A;  3RDE A;  2RFR A;  3WOD G;  3EX9 A;  1RDS A;  1US1 A;  2PZV A;  3GZR A;  1Q7H A;  1UDI I;  4HM7 B;  3WR2 A;  1D6Y A;  5AEW B;  1RN1 A;  1HYF A;  1IU7 A;  3MPH A;  5IG0 A;  1N5H A;  1W01 A;  1Q42 A;  1I0V A;  1T3B A;  1GD3 A;  1OHO A;  4EYC A;  4EW5 A;  4MMZ B;  2K0M A;  2YFJ B;  4FMC A;  2WGO A;  2XF3 A;  3NQZ A;  1A90 A;  1IV9 A;  3N54 B;  1RCL A;  4Q53 A;  1OAC A;  1IVU A;  3AHS A;  3BB9 A;  3DGO A;  4STD A;  1R4C A;  5AI1 A;  3S29 A;  2LQV A;  2OCT A;  3WOF B;  2KXG A;  4BTX A;  2J8X B;  4N6M A;  2QEX 3;  2RNT A;  2CIU A;  1DVC A;  1MWT A;  1B2U A;  4OVM A;  3UL5 A;  3KKG A;  2CG0 A;  1RGL A;  2XR8 B;  3O8Y A;  3OWS A;  1BVI A;  3UB1 A;  1JKG A;  1F8N A;  1IT7 A;  1LNI A;  1X1X A;  2CH9 A;  2MF7 A;  3NQY A;  4H3U A;  1VQL 3;  2IY2 A;  1WMN A;  3G0K A;  2WO0 A;  4DKI A;  3CPW 2;  3AMO B;  3WDG B;  2XH9 A;  2CHC A;  3T8N A;  5KP1 A;  3IPT A;  1KD1 4;  1ASK A;  3I55 3;  5IER A;  2BU4 A;  3RNT A;  1BUJ A;  5D82 A;  2W0Q A;  4K1V A;  1N5P A;  5D83 A;  4N6N B;  1U8C B;  4U13 A;  3EB8 A;  3OWU A;  2K3D A;  2GBX B;  1YNV X;  2Z76 A;  5AII A;  4BL3 A;  1SIH A;  3SYU A;  1OPY A;  2F5W A;  1I2F A;  1IVW A;  4CCV A;  1B2S A;  2SAR A;  1RJO A;  5AYR B;  3K9M C;  3G71 3;  1X1U A;  2Z6B A;  4ILF A;  2ML6 A;  4HJL B;  5LC7 A;  4AKY A;  1M90 4;  1OGX A;  4LEH A;  1YJW 3;  1QJG A;  3G6E 3;  1DVD A;  1UUG B;  4OUQ A;  2D1W A;  1L5G B;  2H0H A;  3MSO A;  3RGR A;  1B27 A;  4L7K A;  4XDV A;  1K28 A;  3CCE 3;  1M1K 4;  1BSA A;  1J2B A;  1OF5 B;  1OCV A;  2IYJ A;  3E99 A;  3HII A;  3ROB A;  1RHL A;  3EE1 A;  2HMM B;  1BU4 A;  2RBI A;  2C11 A;  4BIR A;  9RNT A;  5M18 A;  1SII A;  1G96 A;  2GEY A;  3EF8 A;  3EN8 A;  1ULI B;  4HKV B;  3LZA A;  5IW9 A;  3KCH A;  5BXQ A;  2IUK A;  3BIR A;  4FMD A;  3NM2 A;  1W5Z A;  3H51 A;  1YJN 3;  3X3X A;  2XFT A;  4J5K A;  3X42 A;  3EHC A;  3CC4 3;  3CME 3;  1I70 A;  4H61 A;  2BT3 A;  1RGA A;  1TIJ A;  3FLJ A;  1BUQ A;  5IEN A;  1MNL A;  4IPB A;  3H3H A;  3LH4 A;  3X3Z A;  7RNT A;  4HM4 B;  3WMD A;  5M1A A;  8RNT A;  2F5M A;  1EUI C;  1KWI A;  1UUW B;  3CNM A;  3DGM A;  3MHE A;  3B4P A;  4JRF A;  1WNH A;  2W9Q A;  3CCL 3;  4XM4 A;  3OWY A;  1OH0 A;  3OW2 2;  1SJW A;  3CPO A;  4CPK A;  1DYU A;  1ROA A;  3AMO A;  3HOH A;  2HMK B;  3F14 A;  4KVH A;  5TGN A;  1IQY A;  1NJI 4;  1BAO A;  1O7N B;  4LSO A;  1LQM B;  2BO9 B;  3CD6 3;  1STD A;  3NM7 A;  2KF3 A;  1TJD A;  2IMJ A;  1IQX A;  4KZ1 A;  2L1S A;  5D81 A;  4IIA A;  1VQN 3;  3ER7 A;  1N8Q A;  1RGC A;  1YHQ 3;  1LOV A;  3DGY A;  3BNC A;  1ZO2 A;  2WOH A;  3A5E A;  1B2X A;  4J9A A;  1FW7 A;  1MWR A;  1DMN A;  1AVK A;  1Y4K A;  3FF0 A;  1M1X B;  3K7C A;  1YI2 3;  2GU1 A;  3MG3 A;  3HZP A;  2M7O A;  3F9S A;  2CC3 A;  1K8A 4;  5JPP A;  1BAN A;  3CC2 3;  2JDI H;  3NBR A;  2KAA A;  3ZG5 A;  4K61 A;  4N6L A;  1RRH A;  4WFO A;  1OF5 A;  1X1Y A;  1E3R A;  2V1L A;  2AAD A;  2W03 A;  1JB5 A;  3QRD A;  2KCD A;  5EQL A;  5FGO A;  1VZZ A;  2BIR A;  1LQG C;  1A67 A;  1WTH A;  4HBR A;  5IG4 A;  2F99 A;  1Q81 4;  3ZG0 A;  4ZM8 A;  4GSP A;  3D9R A;  1BOX A;  4O3V A;  3AGO A;  5CK6 A;  3STD A;  3SLU A;  1EA2 A;  1S5A A;  3KFQ C;  1BIR A;  4WHA A;  4HYZ A;  1JB2 A;  1VQQ A;  1TU5 A;  2CFD A;  1VQK 3;  4N3V A;  1IVV A;  4XBT A;  1I3I A;  5G2G A;  1OHP A;  3SXX A;  5IG3 A;  1K73 4;  1E3V A;  1MWU A;  2HMO B;  3GWR A;  4XB5 A;  2IUJ A;  4BTY A;  1DE3 A;  1GMQ A;  1I3F A;  3GRD A;  2Q07 A;  1DMM A;  1NNV A;  2IA7 A;  3BNE A;  4I4K A;  3F7X A;  2C4B A;  3LTB A;  1TRP A;  3OXA A;  2UX0 A;  1BNG A;  1JNQ A;  4KT3 B;  5ELJ A;  1RCK A;  1GOU A;  1UGH I;  3BLZ A;  4LYL B;  3UJM A;  1FGO A;  2Y73 A;  3EBT A;  2Z77 A;  2YFI B;  1M9G A;  3B4O A;  3LOY A;  2O9U X;  1W6G A;  3DH2 A;  3JUQ A;  2YX9 A;  4LZI A;  1HZ1 A;  4N6T A;  1C7H A;  1FGQ A;  4HM0 B;  2P09 A;  1LRA A;  3LXU X;  3JUO A;  3V92 A;  1VQ6 3;  5FW5 A;  1QMA A;  2F4Y A;  1OHS A;  3F7S A;  5CF1 A;  3F8X A;  4JF8 A;  1UUV B;  3DM8 A;  1G0T A;  2R4I A;  5KP4 A;  4GB5 A;  3WOE B;  2H0G A;  4HM8 B;  4WYK B;  4GHO A;  5A0O B;  3DGL A;  1GSP A;  1IYY A;  1YJ9 3;  1Q40 B;  4O02 B;  1RGG A;  1SAR A;  1FA3 A;  3TDG A;  4XDW A;  2XSH B;  1IQ8 A;  4HM6 B;  2HML B;  4HZ9 B;  3FH1 A;  5CF2 A;  1B20 A;  3CXC 2;  3EN1 B;  2CFW A;  5G1K A;  5IEP A;  1W4N A;  1B2Z A;  4ORL A;  3IMA B;  4HM1 B;  4K90 B;  4NPB A;  1I2E A;  4CJN A;  3V99 A;  3AGN A;  1YIT 3;  3CCR 3;  2P05 A;  1OUN A;  1YGE A;  3A76 A;  3SX1 A;  4BL2 A;  3EBY A;  1GOY A;  3LT8 A;  2KF4 A;  6GSP A;  1RGH A;  4R9K A;  1EG9 B;  3L0R A;  3CCV 3;  3MYT A;  1TUH A;  3EJV A;  1QAF A;  1JBT A;  3HIG A;  2KRT A;  1O7P B;  2E2U A;  1RGK A;  3PZW A;  3D3L A;  4X2O A;  1KQS 2;  4XBX A;  1NWW A;  1EEJ A;  1NO3 A;  1Q86 4;  3F40 A;  2B24 B;  3HI7 A;  3G16 A;  1JBS A;  4HM2 B;  1HU9 A;  1R4Y A;  3DGN A;  4FCZ A;  3DY5 A;  1DMQ A;  1V74 A;  2B1X B;  1BNR A;  1W7C A;  1YIJ 3;  1BGS A;  1O7W B;  4XBY A;  5AIH A;  1MOL A;  3HX8 A;  3FKA A;  2XSO B;  1D6U A;  2HOH A;  1W02 A;  3NBB A;  3S28 A;  4FCJ A;  4O8S A;  2ZHX B;  4R4K A;  1JZD A;  1LOW A;  1T2H A;  4MMX B;  2ML5 A;  3KN4 A;  3S5C A;  1TTO A;  2BHM A;  3X3Y A;  3ZFZ A;  1NB5 I;  1EQK A;  1TP6 A;  4IT7 A;  5I97 A;  3CNX A;  3S67 A;  1VQM 3;  3FF2 A;  2OTL 3;  3KSP A;  1B3S A;  1FGT A;  1NDO B;  1BNS A;  1GS3 A;  1RGE A;  2WOF A;  3HK4 A;  1JB4 A;  1PFP A;  4AKZ A;  4BTW A;  3K0Z A;  4WYK A;  3JUM A;  2GSP A;  3IJE B;  4LMI A;  1GYB A;  2F56 A;  1BNI A;  1ZS7 A;  2GEX A;  1Q40 A;  3OX9 A;  2FGT A;  3EC9 A;  1BRH A;  1FZU A;  1STF I;  3PCR A;  1N9E A;  3VGN A;  5M19 A;  1UI8 A;  4KFD A;  1QAK A;  3PXM A;  4LGQ A;  3GZX B;  1HKX A;  1PYL A;  4EV2 A;  1ZX2 A;  2UUG C;  1FUW A;  7STD A;  1ULJ B;  2BMQ B;  3LML A;  1BNE A;  3CCS 3;  3WA3 A;  2CWT A;  2D42 A;  3F8H A;  1CH0 A;  2CFG A;  2H0I A;  3SOY A;  4FMA A;  1UGI A;  6STD A;  2W9P A;  2BNG A;  4N6V 0;  4RZM A;  1LXE A;  4L8O A;  3LTC A;  3N8B A;  1VQ9 3;  1TFK A; 
#chains in the Genus database with same CATH homology
 2HMN B;  4G1M B;  2A15 A;  2CK3 H;  2QA4 3;  2Z7A A;  3CU3 A;  3QK9 A;  5EEO A;  3FG3 A;  5DRV A;  3NX0 A;  2OQE A;  3B8L A;  3FG4 A;  3K63 A;  2QGU A;  1WMO A;  3EQQ B;  1A2V A;  2I9W A;  3JUP A;  1UI7 A;  3GZY B;  4R1K A;  3M8C A;  1GD4 A;  3UNL A;  4L8P A;  1ROV A;  2W6J H;  4TX4 A;  1E97 A;  1K41 A;  2CWU A;  2P0X A;  3PCS A;  5AIF A;  1VQ7 3;  4KFF A;  3K5T A;  2GU3 A;  2RCD A;  3KSE D;  3J7Y d;  2F98 A;  1JN5 B;  8CHO A;  1N9J A;  3X41 A;  3LYG A;  3BND A;  3FG1 A;  4O2H A;  1Q82 4;  2JQ5 A;  3RGA A;  2QIY A;  3VSY A;  1W2B 2;  2SBL A;  3FCS B;  2XFS A;  3U97 A;  1AR0 A;  1KSI A;  4HZB B;  2OTJ 3;  3UL6 A;  2RSX A;  5IG5 A;  3DXO A;  2F86 B;  2BMR B;  2FNQ A;  4NRE A;  2STD A;  2INX A;  3CCM 3;  2OOV A;  1IT8 A;  1FGM A;  3OV4 A;  1IDP A;  4FCM A;  4EC6 A;  5AEU B;  3CCU 3;  1CEW I;  1QVF 2;  2W56 B;  5STD A;  5EVH A;  1LNH A;  5IEO A;  2CWV A;  4MMY B;  4EV5 A;  3LTD A;  5AIG A;  5AYS C;  1JV2 B;  1WMP A;  3WA2 X;  1OGZ A;  4FR9 A;  1W6C A;  1JJ2 2;  2YFL B;  2E2T A;  4GL6 A;  4OK0 A;  5HGR A;  1VQ8 3;  3Q1C A;  4HM3 B;  1VQ5 3;  1O7M B;  2OWP A;  2XRX B;  1ISK A;  3ALA A;  3B7C A;  4WWU C;  3PS8 A;  4MJD A;  1GY7 A;  2RGQ A;  3U1W A;  3FGY A;  1RRL A;  3V98 A;  4KFE A;  5JPU A;  2WGQ A;  1O7G B;  1AVL A;  1A2K A;  1JN5 A;  1SQW A;  2GBW B;  3ECF A;  4QWT A;  4EBG A;  2OQE C;  2ZDJ A;  4J8T A;  3G4S 3;  1WQL B;  3NXJ A;  2XGN A;  3SVA A;  2HMJ B;  1Z1S A;  3JVC A;  5CXO A;  1U5O A;  3CMA 3;  5ELU A;  4N6U A;  3NUV A;  4RBN A;  1AV4 A;  5DRE A;  2W2C A;  5JBS A;  4EXR A;  4FMB A;  1NB3 I;  3X40 A;  4K1U A;  1UW1 A;  4R80 A;  3NV0 B;  4RNY A;  1VQP 3;  1W6Y A;  1CYU A;  1NU3 A;  3N9H A;  1SPU A;  1K9M 4;  4NHF A;  1IK3 A;  1W2Z A;  3PYJ A;  1O7H B;  2P38 A;  3GAX A;  2W56 A;  1KC8 4;  3CC7 3;  3MKI A;  2MC8 A;  1QAL A;  2XEP A;  3S27 A;  3DZL A;  3FZW A;  3LT9 A;  1QVG 2;  3BNB A;  1FGR A;  3MG1 A;  5KP3 A;  1VQO 3;  4CDL A;  2C10 A;  4HM5 B;  3I0Y A;  3PGB A;  3SED A;  1RN7 A;  1VQ4 3;  2O3O A;  3NHX A;  1D6Z A;  2ZL8 A;  2OOV C;  4AEQ A;  3T8U A;  3CCJ 3;  2LYX A;  3JUN A;  1YVB I;  3KII A;  3Q2P A;  4X2H A;  3DUK A;  5LC6 A;  4RNZ A;  1RKY A;  1N8R 4;  2CW9 A;  3VF1 A;  3DMC A;  1JRQ A;  3GZB A;  3MWZ A;  4N6O B;  4PEJ A;  1Q7Y 4;  3Q90 A;  3I56 3;  1IVX A;  1TFO A;  2CG1 A;  1CYV A;  1PU4 A;  3FSD A;  4R9L A;  1JKG B;  1T5Y A;  3MG2 A;  3LTA A;  2CKF B;  1GY6 A;  5CLK A;  2FXT A;  2Y74 A;  3KZT A;  2P0M A;  3G8Z A;  2GXF A;  4HVN A;  3NV0 A;  2CFK A;  2K54 A;  3NBJ A;  1LVN A;  4MEI A;  2PNC A;  3KE7 A;  1IV7 A;  2BMO B;  5IF6 A;  1CQS A;  2W04 A;  1GY5 A;  1W00 A;  4WP5 A;  2XGL A;  3SOA A;  1EKM A;  2L4V A;  2CFL A;  3T0U A;  5BVB A;  1LOX A;  2E2V A;  3RDE A;  2RFR A;  3WOD G;  3EX9 A;  1US1 A;  2PZV A;  3GZR A;  4HM7 B;  5AEW B;  1D6Y A;  1IU7 A;  3MPH A;  5IG0 A;  1N5H A;  1W01 A;  1Q42 A;  4EYC A;  1S72 3;  1GD3 A;  1OHO A;  4MMZ B;  2K0M A;  2YFJ B;  4FMC A;  2WGO A;  2XF3 A;  3NQZ A;  1A90 A;  1IV9 A;  3N54 B;  4Q53 A;  1OAC A;  1IVU A;  3BB9 A;  3DGO A;  4STD A;  1R4C A;  5AI1 A;  3S29 A;  2LQV A;  2OCT A;  3WOF B;  2KXG A;  4BTX A;  4N6M A;  2QEX 3;  2CIU A;  1DVC A;  4OVM A;  3UL5 A;  3KKG A;  2CG0 A;  3O8Y A;  2XR8 B;  3OWS A;  3UB1 A;  1JKG A;  1F8N A;  1IT7 A;  3NQY A;  2CH9 A;  2MF7 A;  4H3U A;  1VQL 3;  1WMN A;  3G0K A;  2WO0 A;  3CPW 2;  3AMO B;  3WDG B;  2XH9 A;  2CHC A;  3T8N A;  5KP1 A;  3IPT A;  1KD1 4;  1ASK A;  3I55 3;  5IER A;  5D82 A;  2W0Q A;  4K1V A;  1N5P A;  5D83 A;  4N6N B;  1U8C B;  4U13 A;  3EB8 A;  3OWU A;  2GBX B;  5AII A;  2Z76 A;  1SIH A;  1OPY A;  4CCV A;  1IVW A;  3G71 3;  1RJO A;  5AYR B;  3K9M C;  2Z6B A;  5LC7 A;  2ML6 A;  4HJL B;  1M90 4;  4AKY A;  1OGX A;  4LEH A;  1YJW 3;  1QJG A;  3G6E 3;  1DVD A;  4OUQ A;  2D1W A;  1L5G B;  3MSO A;  3RGR A;  4L7K A;  4XDV A;  1K28 A;  3CCE 3;  1M1K 4;  1J2B A;  1OF5 B;  1OCV A;  3E99 A;  3ROB A;  3HII A;  3EE1 A;  2HMM B;  2C11 A;  1SII A;  1G96 A;  2GEY A;  3EF8 A;  3EN8 A;  1ULI B;  4HKV B;  3LZA A;  5IW9 A;  5BXQ A;  2IUK A;  4FMD A;  3NM2 A;  1W5Z A;  3H51 A;  1YJN 3;  3X3X A;  2XFT A;  3X42 A;  3EHC A;  3CC4 3;  3CME 3;  4H61 A;  2BT3 A;  3FLJ A;  1TIJ A;  1BUQ A;  5IEN A;  1MNL A;  4IPB A;  3H3H A;  3LH4 A;  3X3Z A;  4HM4 B;  3WMD A;  1UUW B;  1KWI A;  4JRF A;  3CNM A;  3DGM A;  3MHE A;  3B4P A;  1WNH A;  2W9Q A;  3CCL 3;  4XM4 A;  3OWY A;  1OH0 A;  3OW2 2;  1SJW A;  3CPO A;  1DYU A;  1ROA A;  3AMO A;  4KVH A;  2HMK B;  3F14 A;  5TGN A;  1NJI 4;  1IQY A;  1O7N B;  4LSO A;  2BO9 B;  3CD6 3;  1STD A;  3NM7 A;  2IMJ A;  1IQX A;  4KZ1 A;  5D81 A;  4IIA A;  1VQN 3;  3ER7 A;  1N8Q A;  1YHQ 3;  3BNC A;  1ZO2 A;  2WOH A;  4J9A A;  1DMN A;  1AVK A;  1Y4K A;  3FF0 A;  1M1X B;  3K7C A;  1YI2 3;  2GU1 A;  3MG3 A;  3HZP A;  2M7O A;  3F9S A;  2CC3 A;  1K8A 4;  5JPP A;  3CC2 3;  2JDI H;  3NBR A;  4K61 A;  4N6L A;  1RRH A;  4WFO A;  1OF5 A;  1E3R A;  2V1L A;  2W03 A;  1JB5 A;  3QRD A;  2KCD A;  5EQL A;  5FGO A;  1VZZ A;  1A67 A;  1WTH A;  4HBR A;  5IG4 A;  2F99 A;  1Q81 4;  4ZM8 A;  3D9R A;  4O3V A;  5CK6 A;  3STD A;  3SLU A;  1EA2 A;  1S5A A;  3KFQ C;  4WHA A;  4HYZ A;  1JB2 A;  1TU5 A;  2CFD A;  1VQK 3;  4N3V A;  1IVV A;  4XBT A;  5G2G A;  1K73 4;  1OHP A;  3SXX A;  5IG3 A;  1E3V A;  2HMO B;  3GWR A;  4XB5 A;  2IUJ A;  4BTY A;  3GRD A;  2Q07 A;  1DMM A;  2IA7 A;  3BNE A;  4I4K A;  3F7X A;  3LTB A;  3OXA A;  2UX0 A;  1JNQ A;  5ELJ A;  3BLZ A;  3UJM A;  1FGO A;  2Y73 A;  3EBT A;  2Z77 A;  2YFI B;  1M9G A;  3B4O A;  3LOY A;  2O9U X;  1W6G A;  3JUQ A;  4LZI A;  2YX9 A;  4N6T A;  1C7H A;  1FGQ A;  4HM0 B;  2P09 A;  3LXU X;  3JUO A;  3V92 A;  1VQ6 3;  5FW5 A;  1QMA A;  1OHS A;  3F7S A;  5CF1 A;  3F8X A;  4JF8 A;  1UUV B;  3DM8 A;  2R4I A;  5KP4 A;  4GB5 A;  3WOE B;  4HM8 B;  4WYK B;  5A0O B;  3DGL A;  1YJ9 3;  1Q40 B;  4O02 B;  1FA3 A;  3TDG A;  4XDW A;  2XSH B;  1IQ8 A;  4HM6 B;  2HML B;  4HZ9 B;  3FH1 A;  5CF2 A;  3CXC 2;  3EN1 B;  2CFW A;  5IEP A;  1W4N A;  4ORL A;  3IMA B;  4HM1 B;  4K90 B;  3V99 A;  1YIT 3;  3CCR 3;  2P05 A;  1OUN A;  1YGE A;  3A76 A;  3SX1 A;  3EBY A;  3LT8 A;  4R9K A;  1EG9 B;  3L0R A;  3CCV 3;  3MYT A;  1TUH A;  3EJV A;  1QAF A;  3HIG A;  2KRT A;  1O7P B;  2E2U A;  1KQS 2;  3PZW A;  3D3L A;  4X2O A;  4XBX A;  1NWW A;  1NO3 A;  1Q86 4;  3F40 A;  2B24 B;  3HI7 A;  3G16 A;  4HM2 B;  1HU9 A;  3DGN A;  4FCZ A;  3DY5 A;  1DMQ A;  1V74 A;  2B1X B;  1W7C A;  1YIJ 3;  1O7W B;  4XBY A;  5AIH A;  1MOL A;  3HX8 A;  3FKA A;  2XSO B;  1D6U A;  1W02 A;  3NBB A;  3S28 A;  4FCJ A;  4O8S A;  4R4K A;  4MMX B;  2ML5 A;  3KN4 A;  3S5C A;  1NB5 I;  2BHM A;  3X3Y A;  1EQK A;  1TP6 A;  4IT7 A;  5I97 A;  3CNX A;  3S67 A;  1VQM 3;  3FF2 A;  2OTL 3;  3KSP A;  1FGT A;  1NDO B;  1GS3 A;  2WOF A;  3HK4 A;  1JB4 A;  1PFP A;  4AKZ A;  4BTW A;  3K0Z A;  4WYK A;  3JUM A;  4LMI A;  3IJE B;  1GYB A;  2GEX A;  3CCQ 3;  1Q40 A;  3OX9 A;  2FGT A;  3EC9 A;  3PCR A;  1STF I;  3VGN A;  1N9E A;  1UI8 A;  4KFD A;  1QAK A;  3PXM A;  4LGQ A;  3GZX B;  1HKX A;  4EV2 A;  1ZX2 A;  1FUW A;  7STD A;  1ULJ B;  2BMQ B;  3LML A;  3CCS 3;  3WA3 A;  2CWT A;  2D42 A;  3F8H A;  3SOY A;  2CFG A;  4FMA A;  6STD A;  2W9P A;  2BNG A;  4N6V 0;  4RZM A;  1LXE A;  4L8O A;  3LTC A;  3N8B A;  1VQ9 3;  1TFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...