3CCS3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccs300
1KQS2 1Q7Y4 1YIT3 1VQ73 1QVG2 1NJI4 3I553 2QEX3 1JJ22 3CCQ3 1VQO3 1Q824 1K8A4 1YJW3 3CMA3 1Q864 1VQL3 1Q814 1VQ63 1VQ43 3CME3 3CPW2 1YJ93 3CXC2 3CCL3 3CCU3 1K9M4 3CC43 2OTJ3 3CC73 1YHQ3 3CCR3 1KC84 1VQ93 1K734 2OTL3 1VQN3 1KD14 3G6E3 3OW22 1YI23 3CCV3 2QA43 1M1K4 3CD63 3G713 3G4S3 1VQP3 1YJN3 1VQ53 1M904 3CCE3 3I563 3CCJ3 1QVF2 3CC23 1VQK3 1YIJ3 1S723 3CCS3 1VQ83 1VQM3 1N8R4 1W2B2 3CCM3
chains in the Genus database with same CATH superfamily
3G8ZA 3K5TA 1I2EA 2D1WA 2XR8B 4I5QA 4FMAA 2CG0A 1I3FA 2V1LA 1NU3A 3D4AA 4HZ9B 4RBNA 5D81A 1ZO2A 1BRSA 4FCZA 2B24B 3NUVA 1A67A 4MEIA 2HMLB 1YGWA 1W4NA 1I2FA 4XBXA 1AV4A 5BVBA 3D3LA 4CJNA 3CPW2 2OWPA 2CFWA 3FF0A 5AIIA 1JKGA 1EQKA 1STFI 3HOHA 4KVHA 3DGOA 1OUNA 4KZ1A 1AVKA 3MYTA 3G16A 3LTAA 3FCSB 2OOVC 4R9LA 1ASKA 1B27A 1IVVA 3PYJA 2R4IA 1JBTA 1STDA 1EA2A 2WOFA 2HMMB 4R9KA 1IT7A 2W9PA 1N8QA 1RGLA 1IU7A 2CHCA 2CX1A 2W6JH 3Q2PA 1X1WA 3DGNA 2F86B 3AHSA 1EG9B 1A2KA 1OGXA 5CXOA 6RNTA 3LMLA 2WGOA 1VQ73 4FCMA 3LOYA 4LSOA 5IEPA 3EC9A 4ORLA 4TX4A 4EC6A 2RFRA 4RZMA 1Z1SA 1BNFA 1TUHA 3ECFA 3GZXB 3OV4A 1FYSA 3K63A 1GOYA 2P38A 3IMAB 4EXRA 1JB4A 1NO3A 1Q40A 3DGMA 3CC43 2F5MA 4HM7B 3FG4A 5EQLA 3H51A 4K1VA 3EN1B 1BRHA 3MHEA 3F7SA 5IG5A 1BRIA 3SOYA 1GYBA 2CWUA 2KAAA 2CWTA 3DGLA 3DZLA 1E3RA 2FGTA 2CH9A 2W56A 1QVF2 1MGRA 1BOXA 1O7NB 4R80A 1RMSA 1G0TA 1WMOA 3MG1A 2P0XA 2SBLA 3EHCA 1BUJA 5D82A 2STDA 1NJI4 4NREA 3B7CA 1CEWI 1YJW3 1LOYA 1R4CA 3T8UA 1GMQA 1RRLA 5DRVA 3WA2X 2Z6BA 3LTBA 2F99A 2O3OA 5G2GA 3CU3A 3AHWA 3WHOA 4CCVA 3ZG5A 3D9RA 1O7MB 4O02B 2H0IA 1MWUA 4N3VA 2P0MA 2UGIA 4KFEA 3WOEB 5JPPA 4XM4A 1T3BA 3F9SA 1JN5A 4K61A 3NQZA 2QIYA 4J5KA 4R4KA 1W6YA 2AAEA 3T0UA 3IJEB 1W2B2 2ML6A 1TP6A 4OUQA 3V98A 3GAXA 1QVG2 3SVAA 1J2BA 2ZDJA 1QJGA 1G96A 5HOHA 1ROAA 3O8YA 4AKZA 4L8OA 1Q814 1T2IA 1RDSA 1F8NA 2GEYA 3FG1A 5CLKA 1US1A 3HIIA 1V57A 1BRNL 1TFOA 3WMDA 1AQZA 1M1XB 4RNTA 3T8NA 5IEOA 1E3VA 1W02A 3ROBA 5AYRB 4WWUC 1VZZA 1BIRA 4CPKA 1JB2A 2L4VA 2F5WA 3GRDA 5FW5A 1MWSA 3NXJA 1GY5A 2KF3A 4K90B 7RNTA 3MSOA 1RTUA 1N8R4 1KQS2 1TRPA 1RN7A 3MG3A 3GWRA 3UNLA 1RGAA 1UUVB 2GSPA 1I2GA 1PU4A 3X3XA 1K28A 1UW1A 4WP5A 3BU4A 4MMXB 2C11A 2K0MA 1BSBA 3F40A 3OX9A 5RNTA 3KKGA 1IV7A 4EV2A 8RNTA 3CXC2 1B21A 3WOFB 5IERA 5JBSA 1VQN3 5HGRA 1O7GB 1BNIA 1QAKA 2CX0A 2JQ5A 2IA7A 4FCJA 5AEWB 1NB5I 2CG1A 3S5CA 2A15A 3EBTA 3N9HA 3G4S3 1PY3A 4BL3A 4N6OB 2WGQA 3FF2A 3JUMA 3CPOA 1N5PA 1WNHA 3OXAA 4H61A 3HIGA 3CC23 4WYKB 3Q3FA 4FMCA 3CNXA 2BMQB 4HM6B 1FGMA 1OACA 1OF5A 4N6UA 3MWZA 1S5AA 3VSYA 1UDII 3DXOA 3CCQ3 1I0VA 5A0OB 4BL2A 3PS8A 4BTXA 1A2PA 1A90A 2YFLB 3NM7A 3TDGA 2OQEC 1CYUA 1YJ93 1OHPA 2XEPA 2OTJ3 4KFFA 2W03A 3CCR3 1HKXA 4N6NB 2H0GA 3MPHA 2K3DA 1GMPA 2OOVA 1W5ZA 2GBXB 3Q90A 5CF1A 3EQQB 4N6V0 3L0RA 2W04A 3JVCA 3X3YA 3NV0B 1CH0A 1DETA 3HK4A 1JBSA 4WFOA 2SARA 1Q9EA 4HZBB 1BU4A 3NQYA 5AIFA 3ALAA 3FKAA 4N6TA 1I70A 1V58A 1WQLB 2ML5A 3AMOA 6STDA 1TU5A 1RNBA 2OCTA 1VQ63 1BNSA 2E2VA 3B8LA 3HX8A 3PCRA 1N5HA 4GL6A 3F14A 4XBTA 2I9WA 3KIIA 4HBRA 2HOHA 5BXQA 3KSED 1FUTA 3EF8A 4I4KA 1BRGA 1KC84 1JRQA 1FGRA 2KRTA 1KD14 3X40A 3CCV3 1IVWA 2BIRA 3EB8A 2C10A 2RSXA 1M1K4 5ELJA 3F8XA 4NHFA 2BMRB 1MWRA 1AR0A 1UUGB 1W7CA 1W6CA 3KE7A 4HM3B 2W2CA 4OK0A 3ER7A 1DVCA 3MKIA 4XBYA 3RDEA 4IPBA 4L8PA 4HAAA 2L1SA 2MF7A 4N6MA 5IG0A 1D6ZA 4EBGA 1N9JA 1D6YA 1GY7A 2ZHXB 3K0ZA 5ELUA 2KF4A 4RNYA 1VQQA 1JKGB 3B4OA 1VQO3 1TFKA 1B20A 2RNTA 2KF6A 5JPUA 1T5YA 4LGQA 4HOHA 3QK9A 5DREA 3S28A 1Q42A 3D79A 4LYLB 2BO9B 3CCL3 3CC73 2C4BA 4GB5A 2XF3A 1K734 3LXUX 2IMJA 7GSPA 4RNZA 1W6GA 4GHOA 4WHAA 5D83A 3SEDA 1BNJA 2IY2A 2XGLA 2XFTA 3PCSA 2BU4A 5LC6A 4GSPA 1WMPA 3BNEA 3NBRA 4HM5B 5IG4A 4LZIA 3LYGA 2P09A 1VQK3 2UX0A 3VGNA 1SJWA 3H3HA 1VQM3 1YVBI 3NX0A 2Z76A 4HJLB 4JF8A 1QAFA 2H0HA 3VF1A 1UI7A 6GSPA 1YIT3 3JUPA 1LOWA 1Q40B 4EV5A 3CMA3 1T2HA 3EE1A 3X42A 1Q864 4HM8B 3EN8A 4HM4B 1UGIA 4O2HA 5IENA 4HVNA 2Z77A 3BNDA 4IT7A 3CCU3 1IT8A 4HKVB 2B1XB 4N6LA 4ILFA 2F4YA 2W56B 1YI23 1EEJA 2MC8A 1BSDA 1UCLA 3V92A 1DYUA 1FW7A 1O7HB 1ROVA 1Y4KA 1NB3I 2RGQA 3UJMA 2KXGA 3G0KA 1RKYA 1JZOA 1VQP3 5G1KA 1JNQA 1YIJ3 2JDIH 1LOVA 5CK6A 1AVLA 4ZM8A 4J5GA 1GY6A 3JUQA 3WA3A 1RCKA 3SOAA 3X41A 1IV9A 1JJ22 2WOHA 3SXXA 1I0XA 4J8TA 3J7Yd 4QWTA 1PFPA 1SIIA 1ULIB 2Z7AA 3DM8A 3K9MC 4X2OA 3RGRA 2YFIB 1LQMB 5M18A 1LQGC 5EEOA 1RGCA 1JN5B 3LTDA 5IG3A 1OHSA 3OW22 1BVIA 2BMOB 2KF5A 1IQ8A 2CK3H 3S27A 1YJN3 1HYFA 3E99A 5AIHA 3CCE3 1KSIA 1RLSA 3CCJ3 1R4YA 3AGNA 1LVNA 1RGHA 3S67A 3SLUA 1GMRA 4KFDA 3NBBA 3MG2A 1DMNA 1YVSA 3WDGB 1Q7Y4 1UGHI 1O7WB 1QMAA 1SARA 1GS3A 1K41A 3X3ZA 1BSEA 4AEQA 1IQXA 4BTYA 3I553 2QEX3 4BTWA 3A5EA 2PNCA 1OCVA 3F8HA 1NNVA 3CME3 1RN4A 1G02A 4EW5A 5BU4A 5STDA 4STDA 4HM2B 2W9QA 2K54A 3FSDA 2GXFA 2CFKA 1RHLA 2ZA4A 1SIHA 3OWYA 1IK3A 1C7HA 1SPUA 1WTHA 3LZAA 2HMKB 3KSPA 1U8CB 4DKIA 1UI8A 1GSPA 1ZS7A 5M19A 2CC3A 1GOUA 5BIRA 3D5GA 1N9EA 3AGOA 5KP3A 3CCM3 2CIUA 2FXTA 5CF2A 1ISKA 3FGYA 4O8SA 2WO0A 1FUSA 4FMBA 3BIRA 5IW9A 4CDLA 4L7KA 2KCDA 1HZ1A 1LXEA 1QALA 1B2XA 2Y74A 1OH0A 3HI7A 3HZPA 1Q824 1RNTA 2HMOB 1BRJA 2XSHB 3FG3A 4LEHA 4EYCA 1FGTA 3KCHA 4HYZA 9RNTA 3GZRA 2FNQA 2PZVA 4MMYB 1DE3A 4OVMA 2Y73A 3NM2A 4JRFA 3G6E3 3BB9A 3NHXA 1MOLA 1MWTA 3EX9A 1B2ZA 1RN1A 2W0QA 3UL5A 1FGOA 1BNGA 5LC7A 1OF5B 1EKMA 1GOVA 3OWSA 3PXMA 4O3VA 2P05A 3CNMA 1ZX2A 2BNGA 3SX1A 4HM1B 1MNLA 1W2ZA 4H3UA 4IIAA 2UUGC 3WR2A 1IVXA 1BSCA 1I3IA 3B4PA 3JUOA 5AIGA 2R41A 1UCKA 1VQ43 4R1KA 7STDA 5G1LA 3FZWA 3FLJA 1BANA 5FGOA 3RNTA 2F98A 1FZUA 3IPTA 2J8XB 1U5OA 1DVDA 1AY7A 3FH1A 3WODG 2OTL3 2IUKA 2GEXA 3KZTA 1BRKA 3PGBA 2Q07A 2ZL8A 1X1YA 3CD63 2CW9A 1B2SA 3SYUA 3G713 1TRQA 2CKFB 1M904 2HMJB 1X1XA 1A2VA 1OHOA 2CWVA 3DH2A 1LOXA 1IQYA 1RGGA 3KFQC 3CCS3 2D42A 3GZYB 1RGEA 5AYSC 3DGYA 3AMOB 4XB5A 2F56A 3NBJA 3DMCA 3DY5A 3S29A 1JB5A 2RBIA 1BNRA 1FGQA 1MGWA 1RJOA 2BT3A 1JBRA 2GU1A 1K8A4 4BIRA 1BAOA 3RGAA 4U13A 2IUJA 1NWWA 1C54A 2E2TA 1V74A 1RCLA 1TJDA 2XH9A 3EJVA 4J9AA 1RSNA 1YHQ3 1YNVX 2INXA 2O9UX 1JV2B 3STDA 5I97A 2AADA 3LT9A 1EUIC 1NDOB 1VQ53 2M7OA 2YX9A 4LMIA 5KP1A 5GSPA 2QGUA 1M9GA 1E97A 3N54B 1LNHA 2IYJA 3M8CA 2CFLA 3N8BA 1W00A 1FUWA 1JZDA 3U97A 4G1MB 5EVHA 3LTCA 3A76A 2XSOB 1X1UA 3KN4A 3V99A 5IF6A 2LQVA 3PZWA 4WYKA 4X2HA 1RRHA 1ZGXA 3UL6A 1VQL3 4K1UA 2YFJB 3QRDA 3GSPA 2CFDA 1UCJA 2XFSA 5M1AA 3F7XA 1BSAA 1L5GB 1GD3A 1B2UA 4NPBA 2XRXB 1ULJB 2RCDA 1B3SA 1LNIA 3URPA 1W01A 5TGNA 1DMQA 3JUNA 4KT3B 3BNCA 5AI1A 1BNEA 1I8VA 1RGFA 1DMMA 3I0YA 1IVUA 3OWUA 3U1WA 1BGSA 1YGEA 1LRAA 4HM0B 3UB1A 8CHOA 3ZFZA 3NV0A 1RGKA 1UCIA 3BNBA 1KWIA 3EBYA 2HMNB 4XDVA 1D6UA 5AEUB 4FR9A 3GZBA 1BUQA 1Q7HA 1IYYA 1O7PB 2XGNA 1UUWB 3D5IA 2OQEA 4AKYA 5KP4A 1K9M4 1VQ93 1TTOA 1GD4A 3LH4A 2BHMA 4MMZB 2GBWB 4BU4A 1PYLA 2GU3A 1FA3A 3Q1CA 1CYVA 3LT8A 1SQWA 4FMDA 4PEJA 1OGZA 2QA43 1OPYA 1CQSA 3ZG0A 4MJDA 1HU9A 3I563 4Q53A 3K7CA 4XDWA 2CFGA 2LYXA 1WMNA 3DUKA 1S723 3BLZA 1VQ83 1B2MA 1TIJA 2E2UA 1IDPA
chains in the Genus database with same CATH topology
3G8ZA 3K5TA 2D1WA 2XR8B 4FMAA 2CG0A 2V1LA 4RBNA 1NU3A 4HZ9B 5D81A 1ZO2A 4FCZA 2B24B 3NUVA 1A67A 4MEIA 2HMLB 1W4NA 4XBXA 1AV4A 5BVBA 3D3LA 3CPW2 2OWPA 2CFWA 3FF0A 5AIIA 1JKGA 1EQKA 1STFI 4KVHA 4KZ1A 3DGOA 1OUNA 4R9LA 1AVKA 3MYTA 3G16A 3LTAA 3FCSB 2OOVC 1ASKA 1IVVA 3PYJA 2R4IA 1STDA 1EA2A 2WOFA 2HMMB 4R9KA 1IT7A 2W9PA 1N8QA 2CHCA 1IU7A 2W6JH 3Q2PA 3DGNA 2F86B 1EG9B 1A2KA 1OGXA 5CXOA 3LMLA 2WGOA 1VQ73 4FCMA 3LOYA 4LSOA 5IEPA 3EC9A 4ORLA 4TX4A 4EC6A 2RFRA 4RZMA 1Z1SA 3ECFA 1TUHA 3GZXB 3OV4A 3K63A 2P38A 4EXRA 3IMAB 1JB4A 1NO3A 1Q40A 3DGMA 3CC43 4HM7B 3FG4A 5EQLA 3H51A 4K1VA 3EN1B 3MHEA 3F7SA 5IG5A 3SOYA 1GYBA 2CWUA 2CWTA 3DGLA 3DZLA 1E3RA 2FGTA 2CH9A 2W56A 1QVF2 1O7NB 4R80A 1WMOA 3MG1A 2P0XA 2SBLA 3EHCA 5D82A 2STDA 1NJI4 4NREA 3B7CA 1CEWI 1YJW3 1R4CA 3T8UA 1RRLA 5DRVA 3WA2X 2Z6BA 3LTBA 2F99A 2O3OA 5G2GA 3CU3A 4CCVA 3D9RA 1O7MB 4O02B 4N3VA 2P0MA 4KFEA 3WOEB 5JPPA 4XM4A 3F9SA 4K61A 1JN5A 3NQZA 2QIYA 4R4KA 1W6YA 3T0UA 3IJEB 1W2B2 2ML6A 1TP6A 4OUQA 3V98A 3GAXA 1QVG2 3SVAA 1J2BA 2ZDJA 1QJGA 1G96A 1ROAA 3O8YA 4AKZA 4L8OA 1Q814 1F8NA 2GEYA 3FG1A 5CLKA 1US1A 3HIIA 1TFOA 3WMDA 1M1XB 3T8NA 5IEOA 1E3VA 1W02A 3ROBA 5AYRB 4WWUC 1VZZA 1JB2A 2L4VA 5FW5A 3GRDA 3NXJA 1GY5A 4K90B 3MSOA 1N8R4 1KQS2 1RN7A 3MG3A 3GWRA 3UNLA 1UUVB 1PU4A 3X3XA 1K28A 1UW1A 4WP5A 4MMXB 2C11A 2K0MA 3F40A 3OX9A 3KKGA 1IV7A 4EV2A 3CXC2 3WOFB 5IERA 5JBSA 1VQN3 5HGRA 1O7GB 1QAKA 2JQ5A 4FCJA 5AEWB 2IA7A 1NB5I 2CG1A 3S5CA 2A15A 3EBTA 3N9HA 3G4S3 4N6OB 2WGQA 3FF2A 3JUMA 3CPOA 1N5PA 1WNHA 3OXAA 4H61A 3HIGA 3CC23 4WYKB 4FMCA 3CNXA 2BMQB 4HM6B 1FGMA 1OACA 1OF5A 4N6UA 3MWZA 1S5AA 3VSYA 3DXOA 3CCQ3 5A0OB 3PS8A 4BTXA 1A90A 2YFLB 3NM7A 3TDGA 2OQEC 1CYUA 1YJ93 1OHPA 2XEPA 2OTJ3 4KFFA 2W03A 3CCR3 1HKXA 4N6NB 3MPHA 2OOVA 1W5ZA 2GBXB 3Q90A 5CF1A 3EQQB 4N6V0 3L0RA 2W04A 3JVCA 3X3YA 3NV0B 3HK4A 4WFOA 4HZBB 3NQYA 5AIFA 3ALAA 3FKAA 4N6TA 1WQLB 2ML5A 3AMOA 6STDA 1TU5A 2OCTA 1VQ63 2E2VA 3B8LA 4GL6A 3HX8A 3PCRA 1N5HA 4XBTA 3F14A 2I9WA 3KIIA 4HBRA 5BXQA 3KSED 3EF8A 4I4KA 1KC84 1JRQA 1FGRA 2KRTA 1KD14 3X40A 3CCV3 1IVWA 3EB8A 2C10A 2RSXA 1M1K4 5ELJA 3F8XA 4NHFA 2BMRB 1AR0A 1W7CA 1W6CA 3KE7A 4HM3B 2W2CA 4OK0A 3ER7A 1DVCA 3MKIA 4XBYA 3RDEA 4IPBA 4L8PA 2MF7A 4N6MA 4EBGA 5IG0A 1D6ZA 1N9JA 1D6YA 1GY7A 3K0ZA 5ELUA 4RNYA 1JKGB 1VQO3 3B4OA 1TFKA 5JPUA 1T5YA 4LGQA 3QK9A 5DREA 3S28A 1Q42A 3CCL3 2BO9B 3CC73 4GB5A 2XF3A 1K734 3LXUX 2IMJA 4RNZA 1W6GA 4WHAA 5D83A 3SEDA 2XGLA 2XFTA 3PCSA 5LC6A 1WMPA 3BNEA 3NBRA 4HM5B 5IG4A 4LZIA 3LYGA 2P09A 1VQK3 2UX0A 3VGNA 1SJWA 3H3HA 1VQM3 1YVBI 3NX0A 2Z76A 4HJLB 4JF8A 1QAFA 3VF1A 1UI7A 1YIT3 3JUPA 1Q40B 4EV5A 3CMA3 3EE1A 3X42A 1Q864 4HM8B 3EN8A 4HM4B 4O2HA 5IENA 4HVNA 2Z77A 3BNDA 4IT7A 3CCU3 1IT8A 4HKVB 2B1XB 4N6LA 2W56B 1YI23 2MC8A 3V92A 1DYUA 1O7HB 1ROVA 1Y4KA 1NB3I 2RGQA 3UJMA 2KXGA 3G0KA 1RKYA 1VQP3 1JNQA 1YIJ3 2JDIH 5CK6A 1AVLA 4ZM8A 1GY6A 3JUQA 3WA3A 3SOAA 3X41A 1IV9A 1JJ22 2WOHA 3SXXA 4J8TA 3J7Yd 4QWTA 1PFPA 1SIIA 1ULIB 2Z7AA 3DM8A 3K9MC 4X2OA 3RGRA 2YFIB 5EEOA 1JN5B 3LTDA 5IG3A 1OHSA 3OW22 2BMOB 3S27A 1IQ8A 2CK3H 1YJN3 3E99A 5AIHA 3CCE3 1KSIA 3CCJ3 1LVNA 3S67A 3SLUA 4KFDA 3NBBA 3MG2A 1DMNA 3WDGB 1Q7Y4 1O7WB 1QMAA 3X3ZA 1GS3A 1K41A 4AEQA 4BTYA 3I553 1IQXA 2QEX3 4BTWA 2PNCA 1OCVA 3F8HA 3CME3 5STDA 4STDA 4HM2B 2W9QA 2K54A 3FSDA 2GXFA 2CFKA 1SIHA 3OWYA 1IK3A 1C7HA 1SPUA 1WTHA 3LZAA 2HMKB 3KSPA 1U8CB 1UI8A 2CC3A 1N9EA 3CCM3 5KP3A 2CIUA 2FXTA 5CF2A 1ISKA 3FGYA 4O8SA 2WO0A 4FMBA 5IW9A 4CDLA 4L7KA 2KCDA 1LXEA 1QALA 2Y74A 3HI7A 1OH0A 3HZPA 1Q824 2HMOB 2XSHB 3FG3A 4LEHA 4EYCA 1FGTA 4HYZA 3GZRA 2FNQA 2PZVA 4MMYB 4OVMA 2Y73A 3NM2A 4JRFA 3G6E3 3BB9A 3NHXA 1MOLA 3EX9A 2W0QA 3UL5A 1FGOA 5LC7A 1OF5B 1EKMA 3OWSA 3PXMA 4O3VA 2P05A 3CNMA 1ZX2A 2BNGA 3SX1A 4HM1B 1MNLA 1W2ZA 4H3UA 4IIAA 1IVXA 3B4PA 3JUOA 5AIGA 1VQ43 4R1KA 7STDA 3FZWA 3FLJA 5FGOA 2F98A 3IPTA 1U5OA 1DVDA 2OTL3 3FH1A 3WODG 2IUKA 2GEXA 3KZTA 3PGBA 2Q07A 2ZL8A 3CD63 2CW9A 3G713 2CKFB 1M904 2HMJB 1A2VA 1OHOA 2CWVA 1LOXA 1IQYA 3KFQC 3CCS3 2D42A 3GZYB 5AYSC 3AMOB 4XB5A 3NBJA 3DMCA 3DY5A 3S29A 1JB5A 1FGQA 1RJOA 2BT3A 2GU1A 1K8A4 3RGAA 4U13A 2IUJA 1NWWA 2E2TA 1V74A 2XH9A 3EJVA 4J9AA 1YHQ3 2INXA 2O9UX 1JV2B 3STDA 5I97A 3LT9A 1NDOB 1VQ53 2M7OA 2YX9A 4LMIA 5KP1A 2QGUA 1M9GA 1E97A 3N54B 1LNHA 3M8CA 2CFLA 3N8BA 1W00A 1FUWA 3U97A 4G1MB 5EVHA 3LTCA 3A76A 2XSOB 3KN4A 3V99A 5IF6A 2LQVA 3PZWA 4WYKA 4X2HA 1RRHA 3UL6A 1VQL3 4K1UA 2YFJB 3QRDA 2CFDA 2XFSA 3F7XA 1L5GB 1GD3A 2XRXB 1ULJB 2RCDA 1W01A 5TGNA 1DMQA 3JUNA 3BNCA 5AI1A 3I0YA 1DMMA 1IVUA 3OWUA 3U1WA 1YGEA 4HM0B 3UB1A 8CHOA 3NV0A 3BNBA 1KWIA 3EBYA 2HMNB 4XDVA 1D6UA 5AEUB 4FR9A 3GZBA 1BUQA 1O7PB 2XGNA 1UUWB 2OQEA 4AKYA 5KP4A 1K9M4 1VQ93 1GD4A 3LH4A 2BHMA 4MMZB 2GBWB 2GU3A 1FA3A 3Q1CA 1CYVA 3LT8A 1SQWA 4FMDA 4PEJA 1OGZA 2QA43 1OPYA 1CQSA 4MJDA 1HU9A 3I563 4Q53A 3K7CA 4XDWA 2CFGA 2LYXA 1WMNA 3DUKA 1S723 3BLZA 1VQ83 1TIJA 2E2UA 1IDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS 2;  1Q7Y 4;  1YIT 3;  1VQ7 3;  1QVG 2;  1NJI 4;  3I55 3;  2QEX 3;  1JJ2 2;  3CCQ 3;  1VQO 3;  1Q82 4;  1K8A 4;  1YJW 3;  3CMA 3;  1Q86 4;  1VQL 3;  1Q81 4;  1VQ6 3;  1VQ4 3;  3CME 3;  3CPW 2;  1YJ9 3;  3CXC 2;  3CCL 3;  3CCU 3;  1K9M 4;  3CC4 3;  2OTJ 3;  3CC7 3;  1YHQ 3;  3CCR 3;  1KC8 4;  1VQ9 3;  1K73 4;  2OTL 3;  1VQN 3;  1KD1 4;  3G6E 3;  3OW2 2;  1YI2 3;  3CCV 3;  2QA4 3;  1M1K 4;  3CD6 3;  3G71 3;  3G4S 3;  1VQP 3;  1YJN 3;  1VQ5 3;  1M90 4;  3CCE 3;  3I56 3;  3CCJ 3;  1QVF 2;  3CC2 3;  1VQK 3;  1YIJ 3;  1S72 3;  3CCS 3;  1VQ8 3;  1VQM 3;  1N8R 4;  1W2B 2;  3CCM 3; 
#chains in the Genus database with same CATH topology
 3G8Z A;  3K5T A;  1I2E A;  2D1W A;  2XR8 B;  4I5Q A;  4FMA A;  2CG0 A;  1I3F A;  2V1L A;  1NU3 A;  3D4A A;  4HZ9 B;  4RBN A;  5D81 A;  1ZO2 A;  1BRS A;  4FCZ A;  2B24 B;  3NUV A;  1A67 A;  4MEI A;  2HML B;  1YGW A;  1W4N A;  1I2F A;  4XBX A;  1AV4 A;  5BVB A;  3D3L A;  4CJN A;  3CPW 2;  2OWP A;  2CFW A;  3FF0 A;  5AII A;  1JKG A;  1EQK A;  1STF I;  3HOH A;  4KVH A;  3DGO A;  1OUN A;  4KZ1 A;  1AVK A;  3MYT A;  3G16 A;  3LTA A;  3FCS B;  2OOV C;  4R9L A;  1ASK A;  1B27 A;  1IVV A;  3PYJ A;  2R4I A;  1JBT A;  1STD A;  1EA2 A;  2WOF A;  2HMM B;  4R9K A;  1IT7 A;  2W9P A;  1N8Q A;  1RGL A;  1IU7 A;  2CHC A;  2CX1 A;  2W6J H;  3Q2P A;  1X1W A;  3DGN A;  2F86 B;  3AHS A;  1EG9 B;  1A2K A;  1OGX A;  5CXO A;  6RNT A;  3LML A;  2WGO A;  1VQ7 3;  4FCM A;  3LOY A;  4LSO A;  5IEP A;  3EC9 A;  4ORL A;  4TX4 A;  4EC6 A;  2RFR A;  4RZM A;  1Z1S A;  1BNF A;  1TUH A;  3ECF A;  3GZX B;  3OV4 A;  1FYS A;  3K63 A;  1GOY A;  2P38 A;  3IMA B;  4EXR A;  1JB4 A;  1NO3 A;  1Q40 A;  3DGM A;  3CC4 3;  2F5M A;  4HM7 B;  3FG4 A;  5EQL A;  3H51 A;  4K1V A;  3EN1 B;  1BRH A;  3MHE A;  3F7S A;  5IG5 A;  1BRI A;  3SOY A;  1GYB A;  2CWU A;  2KAA A;  2CWT A;  3DGL A;  3DZL A;  1E3R A;  2FGT A;  2CH9 A;  2W56 A;  1QVF 2;  1MGR A;  1BOX A;  1O7N B;  4R80 A;  1RMS A;  1G0T A;  1WMO A;  3MG1 A;  2P0X A;  2SBL A;  3EHC A;  1BUJ A;  5D82 A;  2STD A;  1NJI 4;  4NRE A;  3B7C A;  1CEW I;  1YJW 3;  1LOY A;  1R4C A;  3T8U A;  1GMQ A;  1RRL A;  5DRV A;  3WA2 X;  2Z6B A;  3LTB A;  2F99 A;  2O3O A;  5G2G A;  3CU3 A;  3AHW A;  3WHO A;  4CCV A;  3ZG5 A;  3D9R A;  1O7M B;  4O02 B;  2H0I A;  1MWU A;  4N3V A;  2P0M A;  2UGI A;  4KFE A;  3WOE B;  5JPP A;  4XM4 A;  1T3B A;  3F9S A;  1JN5 A;  4K61 A;  3NQZ A;  2QIY A;  4J5K A;  4R4K A;  1W6Y A;  2AAE A;  3T0U A;  3IJE B;  1W2B 2;  2ML6 A;  1TP6 A;  4OUQ A;  3V98 A;  3GAX A;  1QVG 2;  3SVA A;  1J2B A;  2ZDJ A;  1QJG A;  1G96 A;  5HOH A;  1ROA A;  3O8Y A;  4AKZ A;  4L8O A;  1Q81 4;  1T2I A;  1RDS A;  1F8N A;  2GEY A;  3FG1 A;  5CLK A;  1US1 A;  3HII A;  1V57 A;  1BRN L;  1TFO A;  3WMD A;  1AQZ A;  1M1X B;  4RNT A;  3T8N A;  5IEO A;  1E3V A;  1W02 A;  3ROB A;  5AYR B;  4WWU C;  1VZZ A;  1BIR A;  4CPK A;  1JB2 A;  2L4V A;  2F5W A;  3GRD A;  5FW5 A;  1MWS A;  3NXJ A;  1GY5 A;  2KF3 A;  4K90 B;  7RNT A;  3MSO A;  1RTU A;  1N8R 4;  1KQS 2;  1TRP A;  1RN7 A;  3MG3 A;  3GWR A;  3UNL A;  1RGA A;  1UUV B;  2GSP A;  1I2G A;  1PU4 A;  3X3X A;  1K28 A;  1UW1 A;  4WP5 A;  3BU4 A;  4MMX B;  2C11 A;  2K0M A;  1BSB A;  3F40 A;  3OX9 A;  5RNT A;  3KKG A;  1IV7 A;  4EV2 A;  8RNT A;  3CXC 2;  1B21 A;  3WOF B;  5IER A;  5JBS A;  1VQN 3;  5HGR A;  1O7G B;  1BNI A;  1QAK A;  2CX0 A;  2JQ5 A;  2IA7 A;  4FCJ A;  5AEW B;  1NB5 I;  2CG1 A;  3S5C A;  2A15 A;  3EBT A;  3N9H A;  3G4S 3;  1PY3 A;  4BL3 A;  4N6O B;  2WGQ A;  3FF2 A;  3JUM A;  3CPO A;  1N5P A;  1WNH A;  3OXA A;  4H61 A;  3HIG A;  3CC2 3;  4WYK B;  3Q3F A;  4FMC A;  3CNX A;  2BMQ B;  4HM6 B;  1FGM A;  1OAC A;  1OF5 A;  4N6U A;  3MWZ A;  1S5A A;  3VSY A;  1UDI I;  3DXO A;  3CCQ 3;  1I0V A;  5A0O B;  4BL2 A;  3PS8 A;  4BTX A;  1A2P A;  1A90 A;  2YFL B;  3NM7 A;  3TDG A;  2OQE C;  1CYU A;  1YJ9 3;  1OHP A;  2XEP A;  2OTJ 3;  4KFF A;  2W03 A;  3CCR 3;  1HKX A;  4N6N B;  2H0G A;  3MPH A;  2K3D A;  1GMP A;  2OOV A;  1W5Z A;  2GBX B;  3Q90 A;  5CF1 A;  3EQQ B;  4N6V 0;  3L0R A;  2W04 A;  3JVC A;  3X3Y A;  3NV0 B;  1CH0 A;  1DET A;  3HK4 A;  1JBS A;  4WFO A;  2SAR A;  1Q9E A;  4HZB B;  1BU4 A;  3NQY A;  5AIF A;  3ALA A;  3FKA A;  4N6T A;  1I70 A;  1V58 A;  1WQL B;  2ML5 A;  3AMO A;  6STD A;  1TU5 A;  1RNB A;  2OCT A;  1VQ6 3;  1BNS A;  2E2V A;  3B8L A;  3HX8 A;  3PCR A;  1N5H A;  4GL6 A;  3F14 A;  4XBT A;  2I9W A;  3KII A;  4HBR A;  2HOH A;  5BXQ A;  3KSE D;  1FUT A;  3EF8 A;  4I4K A;  1BRG A;  1KC8 4;  1JRQ A;  1FGR A;  2KRT A;  1KD1 4;  3X40 A;  3CCV 3;  1IVW A;  2BIR A;  3EB8 A;  2C10 A;  2RSX A;  1M1K 4;  5ELJ A;  3F8X A;  4NHF A;  2BMR B;  1MWR A;  1AR0 A;  1UUG B;  1W7C A;  1W6C A;  3KE7 A;  4HM3 B;  2W2C A;  4OK0 A;  3ER7 A;  1DVC A;  3MKI A;  4XBY A;  3RDE A;  4IPB A;  4L8P A;  4HAA A;  2L1S A;  2MF7 A;  4N6M A;  5IG0 A;  1D6Z A;  4EBG A;  1N9J A;  1D6Y A;  1GY7 A;  2ZHX B;  3K0Z A;  5ELU A;  2KF4 A;  4RNY A;  1VQQ A;  1JKG B;  3B4O A;  1VQO 3;  1TFK A;  1B20 A;  2RNT A;  2KF6 A;  5JPU A;  1T5Y A;  4LGQ A;  4HOH A;  3QK9 A;  5DRE A;  3S28 A;  1Q42 A;  3D79 A;  4LYL B;  2BO9 B;  3CCL 3;  3CC7 3;  2C4B A;  4GB5 A;  2XF3 A;  1K73 4;  3LXU X;  2IMJ A;  7GSP A;  4RNZ A;  1W6G A;  4GHO A;  4WHA A;  5D83 A;  3SED A;  1BNJ A;  2IY2 A;  2XGL A;  2XFT A;  3PCS A;  2BU4 A;  5LC6 A;  4GSP A;  1WMP A;  3BNE A;  3NBR A;  4HM5 B;  5IG4 A;  4LZI A;  3LYG A;  2P09 A;  1VQK 3;  2UX0 A;  3VGN A;  1SJW A;  3H3H A;  1VQM 3;  1YVB I;  3NX0 A;  2Z76 A;  4HJL B;  4JF8 A;  1QAF A;  2H0H A;  3VF1 A;  1UI7 A;  6GSP A;  1YIT 3;  3JUP A;  1LOW A;  1Q40 B;  4EV5 A;  3CMA 3;  1T2H A;  3EE1 A;  3X42 A;  1Q86 4;  4HM8 B;  3EN8 A;  4HM4 B;  1UGI A;  4O2H A;  5IEN A;  4HVN A;  2Z77 A;  3BND A;  4IT7 A;  3CCU 3;  1IT8 A;  4HKV B;  2B1X B;  4N6L A;  4ILF A;  2F4Y A;  2W56 B;  1YI2 3;  1EEJ A;  2MC8 A;  1BSD A;  1UCL A;  3V92 A;  1DYU A;  1FW7 A;  1O7H B;  1ROV A;  1Y4K A;  1NB3 I;  2RGQ A;  3UJM A;  2KXG A;  3G0K A;  1RKY A;  1JZO A;  1VQP 3;  5G1K A;  1JNQ A;  1YIJ 3;  2JDI H;  1LOV A;  5CK6 A;  1AVL A;  4ZM8 A;  4J5G A;  1GY6 A;  3JUQ A;  3WA3 A;  1RCK A;  3SOA A;  3X41 A;  1IV9 A;  1JJ2 2;  2WOH A;  3SXX A;  1I0X A;  4J8T A;  3J7Y d;  4QWT A;  1PFP A;  1SII A;  1ULI B;  2Z7A A;  3DM8 A;  3K9M C;  4X2O A;  3RGR A;  2YFI B;  1LQM B;  5M18 A;  1LQG C;  5EEO A;  1RGC A;  1JN5 B;  3LTD A;  5IG3 A;  1OHS A;  3OW2 2;  1BVI A;  2BMO B;  2KF5 A;  1IQ8 A;  2CK3 H;  3S27 A;  1YJN 3;  1HYF A;  3E99 A;  5AIH A;  3CCE 3;  1KSI A;  1RLS A;  3CCJ 3;  1R4Y A;  3AGN A;  1LVN A;  1RGH A;  3S67 A;  3SLU A;  1GMR A;  4KFD A;  3NBB A;  3MG2 A;  1DMN A;  1YVS A;  3WDG B;  1Q7Y 4;  1UGH I;  1O7W B;  1QMA A;  1SAR A;  1GS3 A;  1K41 A;  3X3Z A;  1BSE A;  4AEQ A;  1IQX A;  4BTY A;  3I55 3;  2QEX 3;  4BTW A;  3A5E A;  2PNC A;  1OCV A;  3F8H A;  1NNV A;  3CME 3;  1RN4 A;  1G02 A;  4EW5 A;  5BU4 A;  5STD A;  4STD A;  4HM2 B;  2W9Q A;  2K54 A;  3FSD A;  2GXF A;  2CFK A;  1RHL A;  2ZA4 A;  1SIH A;  3OWY A;  1IK3 A;  1C7H A;  1SPU A;  1WTH A;  3LZA A;  2HMK B;  3KSP A;  1U8C B;  4DKI A;  1UI8 A;  1GSP A;  1ZS7 A;  5M19 A;  2CC3 A;  1GOU A;  5BIR A;  3D5G A;  1N9E A;  3AGO A;  5KP3 A;  3CCM 3;  2CIU A;  2FXT A;  5CF2 A;  1ISK A;  3FGY A;  4O8S A;  2WO0 A;  1FUS A;  4FMB A;  3BIR A;  5IW9 A;  4CDL A;  4L7K A;  2KCD A;  1HZ1 A;  1LXE A;  1QAL A;  1B2X A;  2Y74 A;  1OH0 A;  3HI7 A;  3HZP A;  1Q82 4;  1RNT A;  2HMO B;  1BRJ A;  2XSH B;  3FG3 A;  4LEH A;  4EYC A;  1FGT A;  3KCH A;  4HYZ A;  9RNT A;  3GZR A;  2FNQ A;  2PZV A;  4MMY B;  1DE3 A;  4OVM A;  2Y73 A;  3NM2 A;  4JRF A;  3G6E 3;  3BB9 A;  3NHX A;  1MOL A;  1MWT A;  3EX9 A;  1B2Z A;  1RN1 A;  2W0Q A;  3UL5 A;  1FGO A;  1BNG A;  5LC7 A;  1OF5 B;  1EKM A;  1GOV A;  3OWS A;  3PXM A;  4O3V A;  2P05 A;  3CNM A;  1ZX2 A;  2BNG A;  3SX1 A;  4HM1 B;  1MNL A;  1W2Z A;  4H3U A;  4IIA A;  2UUG C;  3WR2 A;  1IVX A;  1BSC A;  1I3I A;  3B4P A;  3JUO A;  5AIG A;  2R41 A;  1UCK A;  1VQ4 3;  4R1K A;  7STD A;  5G1L A;  3FZW A;  3FLJ A;  1BAN A;  5FGO A;  3RNT A;  2F98 A;  1FZU A;  3IPT A;  2J8X B;  1U5O A;  1DVD A;  1AY7 A;  3FH1 A;  3WOD G;  2OTL 3;  2IUK A;  2GEX A;  3KZT A;  1BRK A;  3PGB A;  2Q07 A;  2ZL8 A;  1X1Y A;  3CD6 3;  2CW9 A;  1B2S A;  3SYU A;  3G71 3;  1TRQ A;  2CKF B;  1M90 4;  2HMJ B;  1X1X A;  1A2V A;  1OHO A;  2CWV A;  3DH2 A;  1LOX A;  1IQY A;  1RGG A;  3KFQ C;  3CCS 3;  2D42 A;  3GZY B;  1RGE A;  5AYS C;  3DGY A;  3AMO B;  4XB5 A;  2F56 A;  3NBJ A;  3DMC A;  3DY5 A;  3S29 A;  1JB5 A;  2RBI A;  1BNR A;  1FGQ A;  1MGW A;  1RJO A;  2BT3 A;  1JBR A;  2GU1 A;  1K8A 4;  4BIR A;  1BAO A;  3RGA A;  4U13 A;  2IUJ A;  1NWW A;  1C54 A;  2E2T A;  1V74 A;  1RCL A;  1TJD A;  2XH9 A;  3EJV A;  4J9A A;  1RSN A;  1YHQ 3;  1YNV X;  2INX A;  2O9U X;  1JV2 B;  3STD A;  5I97 A;  2AAD A;  3LT9 A;  1EUI C;  1NDO B;  1VQ5 3;  2M7O A;  2YX9 A;  4LMI A;  5KP1 A;  5GSP A;  2QGU A;  1M9G A;  1E97 A;  3N54 B;  1LNH A;  2IYJ A;  3M8C A;  2CFL A;  3N8B A;  1W00 A;  1FUW A;  1JZD A;  3U97 A;  4G1M B;  5EVH A;  3LTC A;  3A76 A;  2XSO B;  1X1U A;  3KN4 A;  3V99 A;  5IF6 A;  2LQV A;  3PZW A;  4WYK A;  4X2H A;  1RRH A;  1ZGX A;  3UL6 A;  1VQL 3;  4K1U A;  2YFJ B;  3QRD A;  3GSP A;  2CFD A;  1UCJ A;  2XFS A;  5M1A A;  3F7X A;  1BSA A;  1L5G B;  1GD3 A;  1B2U A;  4NPB A;  2XRX B;  1ULJ B;  2RCD A;  1B3S A;  1LNI A;  3URP A;  1W01 A;  5TGN A;  1DMQ A;  3JUN A;  4KT3 B;  3BNC A;  5AI1 A;  1BNE A;  1I8V A;  1RGF A;  1DMM A;  3I0Y A;  1IVU A;  3OWU A;  3U1W A;  1BGS A;  1YGE A;  1LRA A;  4HM0 B;  3UB1 A;  8CHO A;  3ZFZ A;  3NV0 A;  1RGK A;  1UCI A;  3BNB A;  1KWI A;  3EBY A;  2HMN B;  4XDV A;  1D6U A;  5AEU B;  4FR9 A;  3GZB A;  1BUQ A;  1Q7H A;  1IYY A;  1O7P B;  2XGN A;  1UUW B;  3D5I A;  2OQE A;  4AKY A;  5KP4 A;  1K9M 4;  1VQ9 3;  1TTO A;  1GD4 A;  3LH4 A;  2BHM A;  4MMZ B;  2GBW B;  4BU4 A;  1PYL A;  2GU3 A;  1FA3 A;  3Q1C A;  1CYV A;  3LT8 A;  1SQW A;  4FMD A;  4PEJ A;  1OGZ A;  2QA4 3;  1OPY A;  1CQS A;  3ZG0 A;  4MJD A;  1HU9 A;  3I56 3;  4Q53 A;  3K7C A;  4XDW A;  2CFG A;  2LYX A;  1WMN A;  3DUK A;  1S72 3;  3BLZ A;  1VQ8 3;  1B2M A;  1TIJ A;  2E2U A;  1IDP A; 
#chains in the Genus database with same CATH homology
 3G8Z A;  3K5T A;  2D1W A;  2XR8 B;  4FMA A;  2CG0 A;  2V1L A;  4RBN A;  1NU3 A;  4HZ9 B;  5D81 A;  1ZO2 A;  4FCZ A;  2B24 B;  3NUV A;  1A67 A;  4MEI A;  2HML B;  1W4N A;  4XBX A;  1AV4 A;  5BVB A;  3D3L A;  3CPW 2;  2OWP A;  2CFW A;  3FF0 A;  5AII A;  1JKG A;  1EQK A;  1STF I;  4KVH A;  4KZ1 A;  3DGO A;  1OUN A;  4R9L A;  1AVK A;  3MYT A;  3G16 A;  3LTA A;  3FCS B;  2OOV C;  1ASK A;  1IVV A;  3PYJ A;  2R4I A;  1STD A;  1EA2 A;  2WOF A;  2HMM B;  4R9K A;  1IT7 A;  2W9P A;  1N8Q A;  2CHC A;  1IU7 A;  2W6J H;  3Q2P A;  3DGN A;  2F86 B;  1EG9 B;  1A2K A;  1OGX A;  5CXO A;  3LML A;  2WGO A;  1VQ7 3;  4FCM A;  3LOY A;  4LSO A;  5IEP A;  3EC9 A;  4ORL A;  4TX4 A;  4EC6 A;  2RFR A;  4RZM A;  1Z1S A;  3ECF A;  1TUH A;  3GZX B;  3OV4 A;  3K63 A;  2P38 A;  4EXR A;  3IMA B;  1JB4 A;  1NO3 A;  1Q40 A;  3DGM A;  3CC4 3;  4HM7 B;  3FG4 A;  5EQL A;  3H51 A;  4K1V A;  3EN1 B;  3MHE A;  3F7S A;  5IG5 A;  3SOY A;  1GYB A;  2CWU A;  2CWT A;  3DGL A;  3DZL A;  1E3R A;  2FGT A;  2CH9 A;  2W56 A;  1QVF 2;  1O7N B;  4R80 A;  1WMO A;  3MG1 A;  2P0X A;  2SBL A;  3EHC A;  5D82 A;  2STD A;  1NJI 4;  4NRE A;  3B7C A;  1CEW I;  1YJW 3;  1R4C A;  3T8U A;  1RRL A;  5DRV A;  3WA2 X;  2Z6B A;  3LTB A;  2F99 A;  2O3O A;  5G2G A;  3CU3 A;  4CCV A;  3D9R A;  1O7M B;  4O02 B;  4N3V A;  2P0M A;  4KFE A;  3WOE B;  5JPP A;  4XM4 A;  3F9S A;  4K61 A;  1JN5 A;  3NQZ A;  2QIY A;  4R4K A;  1W6Y A;  3T0U A;  3IJE B;  1W2B 2;  2ML6 A;  1TP6 A;  4OUQ A;  3V98 A;  3GAX A;  1QVG 2;  3SVA A;  1J2B A;  2ZDJ A;  1QJG A;  1G96 A;  1ROA A;  3O8Y A;  4AKZ A;  4L8O A;  1Q81 4;  1F8N A;  2GEY A;  3FG1 A;  5CLK A;  1US1 A;  3HII A;  1TFO A;  3WMD A;  1M1X B;  3T8N A;  5IEO A;  1E3V A;  1W02 A;  3ROB A;  5AYR B;  4WWU C;  1VZZ A;  1JB2 A;  2L4V A;  5FW5 A;  3GRD A;  3NXJ A;  1GY5 A;  4K90 B;  3MSO A;  1N8R 4;  1KQS 2;  1RN7 A;  3MG3 A;  3GWR A;  3UNL A;  1UUV B;  1PU4 A;  3X3X A;  1K28 A;  1UW1 A;  4WP5 A;  4MMX B;  2C11 A;  2K0M A;  3F40 A;  3OX9 A;  3KKG A;  1IV7 A;  4EV2 A;  3CXC 2;  3WOF B;  5IER A;  5JBS A;  1VQN 3;  5HGR A;  1O7G B;  1QAK A;  2JQ5 A;  4FCJ A;  5AEW B;  2IA7 A;  1NB5 I;  2CG1 A;  3S5C A;  2A15 A;  3EBT A;  3N9H A;  3G4S 3;  4N6O B;  2WGQ A;  3FF2 A;  3JUM A;  3CPO A;  1N5P A;  1WNH A;  3OXA A;  4H61 A;  3HIG A;  3CC2 3;  4WYK B;  4FMC A;  3CNX A;  2BMQ B;  4HM6 B;  1FGM A;  1OAC A;  1OF5 A;  4N6U A;  3MWZ A;  1S5A A;  3VSY A;  3DXO A;  3CCQ 3;  5A0O B;  3PS8 A;  4BTX A;  1A90 A;  2YFL B;  3NM7 A;  3TDG A;  2OQE C;  1CYU A;  1YJ9 3;  1OHP A;  2XEP A;  2OTJ 3;  4KFF A;  2W03 A;  3CCR 3;  1HKX A;  4N6N B;  3MPH A;  2OOV A;  1W5Z A;  2GBX B;  3Q90 A;  5CF1 A;  3EQQ B;  4N6V 0;  3L0R A;  2W04 A;  3JVC A;  3X3Y A;  3NV0 B;  3HK4 A;  4WFO A;  4HZB B;  3NQY A;  5AIF A;  3ALA A;  3FKA A;  4N6T A;  1WQL B;  2ML5 A;  3AMO A;  6STD A;  1TU5 A;  2OCT A;  1VQ6 3;  2E2V A;  3B8L A;  4GL6 A;  3HX8 A;  3PCR A;  1N5H A;  4XBT A;  3F14 A;  2I9W A;  3KII A;  4HBR A;  5BXQ A;  3KSE D;  3EF8 A;  4I4K A;  1KC8 4;  1JRQ A;  1FGR A;  2KRT A;  1KD1 4;  3X40 A;  3CCV 3;  1IVW A;  3EB8 A;  2C10 A;  2RSX A;  1M1K 4;  5ELJ A;  3F8X A;  4NHF A;  2BMR B;  1AR0 A;  1W7C A;  1W6C A;  3KE7 A;  4HM3 B;  2W2C A;  4OK0 A;  3ER7 A;  1DVC A;  3MKI A;  4XBY A;  3RDE A;  4IPB A;  4L8P A;  2MF7 A;  4N6M A;  4EBG A;  5IG0 A;  1D6Z A;  1N9J A;  1D6Y A;  1GY7 A;  3K0Z A;  5ELU A;  4RNY A;  1JKG B;  1VQO 3;  3B4O A;  1TFK A;  5JPU A;  1T5Y A;  4LGQ A;  3QK9 A;  5DRE A;  3S28 A;  1Q42 A;  3CCL 3;  2BO9 B;  3CC7 3;  4GB5 A;  2XF3 A;  1K73 4;  3LXU X;  2IMJ A;  4RNZ A;  1W6G A;  4WHA A;  5D83 A;  3SED A;  2XGL A;  2XFT A;  3PCS A;  5LC6 A;  1WMP A;  3BNE A;  3NBR A;  4HM5 B;  5IG4 A;  4LZI A;  3LYG A;  2P09 A;  1VQK 3;  2UX0 A;  3VGN A;  1SJW A;  3H3H A;  1VQM 3;  1YVB I;  3NX0 A;  2Z76 A;  4HJL B;  4JF8 A;  1QAF A;  3VF1 A;  1UI7 A;  1YIT 3;  3JUP A;  1Q40 B;  4EV5 A;  3CMA 3;  3EE1 A;  3X42 A;  1Q86 4;  4HM8 B;  3EN8 A;  4HM4 B;  4O2H A;  5IEN A;  4HVN A;  2Z77 A;  3BND A;  4IT7 A;  3CCU 3;  1IT8 A;  4HKV B;  2B1X B;  4N6L A;  2W56 B;  1YI2 3;  2MC8 A;  3V92 A;  1DYU A;  1O7H B;  1ROV A;  1Y4K A;  1NB3 I;  2RGQ A;  3UJM A;  2KXG A;  3G0K A;  1RKY A;  1VQP 3;  1JNQ A;  1YIJ 3;  2JDI H;  5CK6 A;  1AVL A;  4ZM8 A;  1GY6 A;  3JUQ A;  3WA3 A;  3SOA A;  3X41 A;  1IV9 A;  1JJ2 2;  2WOH A;  3SXX A;  4J8T A;  3J7Y d;  4QWT A;  1PFP A;  1SII A;  1ULI B;  2Z7A A;  3DM8 A;  3K9M C;  4X2O A;  3RGR A;  2YFI B;  5EEO A;  1JN5 B;  3LTD A;  5IG3 A;  1OHS A;  3OW2 2;  2BMO B;  3S27 A;  1IQ8 A;  2CK3 H;  1YJN 3;  3E99 A;  5AIH A;  3CCE 3;  1KSI A;  3CCJ 3;  1LVN A;  3S67 A;  3SLU A;  4KFD A;  3NBB A;  3MG2 A;  1DMN A;  3WDG B;  1Q7Y 4;  1O7W B;  1QMA A;  3X3Z A;  1GS3 A;  1K41 A;  4AEQ A;  4BTY A;  3I55 3;  1IQX A;  2QEX 3;  4BTW A;  2PNC A;  1OCV A;  3F8H A;  3CME 3;  5STD A;  4STD A;  4HM2 B;  2W9Q A;  2K54 A;  3FSD A;  2GXF A;  2CFK A;  1SIH A;  3OWY A;  1IK3 A;  1C7H A;  1SPU A;  1WTH A;  3LZA A;  2HMK B;  3KSP A;  1U8C B;  1UI8 A;  2CC3 A;  1N9E A;  3CCM 3;  5KP3 A;  2CIU A;  2FXT A;  5CF2 A;  1ISK A;  3FGY A;  4O8S A;  2WO0 A;  4FMB A;  5IW9 A;  4CDL A;  4L7K A;  2KCD A;  1LXE A;  1QAL A;  2Y74 A;  3HI7 A;  1OH0 A;  3HZP A;  1Q82 4;  2HMO B;  2XSH B;  3FG3 A;  4LEH A;  4EYC A;  1FGT A;  4HYZ A;  3GZR A;  2FNQ A;  2PZV A;  4MMY B;  4OVM A;  2Y73 A;  3NM2 A;  4JRF A;  3G6E 3;  3BB9 A;  3NHX A;  1MOL A;  3EX9 A;  2W0Q A;  3UL5 A;  1FGO A;  5LC7 A;  1OF5 B;  1EKM A;  3OWS A;  3PXM A;  4O3V A;  2P05 A;  3CNM A;  1ZX2 A;  2BNG A;  3SX1 A;  4HM1 B;  1MNL A;  1W2Z A;  4H3U A;  4IIA A;  1IVX A;  3B4P A;  3JUO A;  5AIG A;  1VQ4 3;  4R1K A;  7STD A;  3FZW A;  3FLJ A;  5FGO A;  2F98 A;  3IPT A;  1U5O A;  1DVD A;  2OTL 3;  3FH1 A;  3WOD G;  2IUK A;  2GEX A;  3KZT A;  3PGB A;  2Q07 A;  2ZL8 A;  3CD6 3;  2CW9 A;  3G71 3;  2CKF B;  1M90 4;  2HMJ B;  1A2V A;  1OHO A;  2CWV A;  1LOX A;  1IQY A;  3KFQ C;  3CCS 3;  2D42 A;  3GZY B;  5AYS C;  3AMO B;  4XB5 A;  3NBJ A;  3DMC A;  3DY5 A;  3S29 A;  1JB5 A;  1FGQ A;  1RJO A;  2BT3 A;  2GU1 A;  1K8A 4;  3RGA A;  4U13 A;  2IUJ A;  1NWW A;  2E2T A;  1V74 A;  2XH9 A;  3EJV A;  4J9A A;  1YHQ 3;  2INX A;  2O9U X;  1JV2 B;  3STD A;  5I97 A;  3LT9 A;  1NDO B;  1VQ5 3;  2M7O A;  2YX9 A;  4LMI A;  5KP1 A;  2QGU A;  1M9G A;  1E97 A;  3N54 B;  1LNH A;  3M8C A;  2CFL A;  3N8B A;  1W00 A;  1FUW A;  3U97 A;  4G1M B;  5EVH A;  3LTC A;  3A76 A;  2XSO B;  3KN4 A;  3V99 A;  5IF6 A;  2LQV A;  3PZW A;  4WYK A;  4X2H A;  1RRH A;  3UL6 A;  1VQL 3;  4K1U A;  2YFJ B;  3QRD A;  2CFD A;  2XFS A;  3F7X A;  1L5G B;  1GD3 A;  2XRX B;  1ULJ B;  2RCD A;  1W01 A;  5TGN A;  1DMQ A;  3JUN A;  3BNC A;  5AI1 A;  3I0Y A;  1DMM A;  1IVU A;  3OWU A;  3U1W A;  1YGE A;  4HM0 B;  3UB1 A;  8CHO A;  3NV0 A;  3BNB A;  1KWI A;  3EBY A;  2HMN B;  4XDV A;  1D6U A;  5AEU B;  4FR9 A;  3GZB A;  1BUQ A;  1O7P B;  2XGN A;  1UUW B;  2OQE A;  4AKY A;  5KP4 A;  1K9M 4;  1VQ9 3;  1GD4 A;  3LH4 A;  2BHM A;  4MMZ B;  2GBW B;  2GU3 A;  1FA3 A;  3Q1C A;  1CYV A;  3LT8 A;  1SQW A;  4FMD A;  4PEJ A;  1OGZ A;  2QA4 3;  1OPY A;  1CQS A;  4MJD A;  1HU9 A;  3I56 3;  4Q53 A;  3K7C A;  4XDW A;  2CFG A;  2LYX A;  1WMN A;  3DUK A;  1S72 3;  3BLZ A;  1VQ8 3;  1TIJ A;  2E2U A;  1IDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...