3CCS3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccs300
3CCU3 3CXC2 1YJN3 1JJ22 1QVF2 2OTL3 3I563 1KD14 2OTJ3 1VQL3 1KQS2 3CCS3 1K9M4 1YIT3 1Q814 1N8R4 3CC43 1YJW3 1VQ83 1VQP3 3I553 3CME3 1W2B2 3CCL3 3G713 1K8A4 1VQ43 2QEX3 1VQ73 1YI23 1VQ93 1Q824 1QVG2 3CCE3 1VQK3 1Q7Y4 3CMA3 3CC23 1NJI4 3CPW2 3CCR3 3CCV3 1YJ93 1Q864 1K734 1VQN3 3CCQ3 3G6E3 1VQM3 1M904 3G4S3 1YHQ3 1KC84 1VQ63 1VQO3 2QA43 1S723 1M1K4 3CCJ3 3OW22 1YIJ3 3CC73 3CD63 3CCM3 1VQ53
chains in the Genus database with same CATH superfamily
3NHXA 4JF8A 1GMQA 5DRVA 1RN4A 3ZFZA 2YFJB 1SARA 4WP5A 3UL6A 1UW1A 3OWUA 4AKZA 1QVF2 1IQ8A 1G96A 2W6JH 1U8CB 5BVBA 4KFDA 3B8LA 3DGMA 2HMKB 1BNFA 4N3VA 4WYKA 3N9HA 2W56A 3WOEB 1RRLA 1UUGB 3MWZA 4J8TA 4XBXA 2P05A 2SARA 3HIGA 4K61A 2E2UA 1NB5I 3SX1A 1OUNA 3NUVA 2D1WA 3UL5A 4O3VA 4GHOA 2GXFA 3NXJA 1LOWA 3HX8A 3CPOA 5AEWB 2R4IA 3GRDA 1OPYA 3KIIA 3NBRA 4RNZA 3SYUA 1RDSA 1F8NA 2D42A 3AMOB 1W6GA 1BRKA 2XH9A 5ELJA 1I3FA 3AHWA 1RGGA 4LGQA 3CD63 1A90A 3K0ZA 1UGHI 1TRPA 1A2PA 2LYXA 3OWSA 1AVLA 1A2KA 1TJDA 2OQEA 1DYUA 1HYFA 4FR9A 5LC6A 1PYLA 4EW5A 1FGMA 1JKGB 3NM2A 2CX0A 2BMQB 4LEHA 1BUQA 3EQQB 1C7HA 1BIRA 1UUVB 3ZG5A 2CW9A 2BIRA 1GD4A 1LRAA 3V92A 3WOFB 3F9SA 2OOVC 2K3DA 2Z6BA 1RGCA 2BMOB 1K734 5STDA 3DUKA 3DGNA 2CWUA 3EX9A 3OW22 3G8ZA 1AV4A 2CFLA 3AGOA 2F56A 3KCHA 1ASKA 1B20A 2IY2A 3JVCA 1IQYA 2GBXB 3N8BA 1DMQA 2AADA 1MWUA 2KF3A 3OWYA 2W03A 2XF3A 3L0RA 1OH0A 3B4PA 2FNQA 4LYLB 2YFLB 1OF5B 2BMRB 3LTBA 4I4KA 1RLSA 4RZMA 4X2OA 1EUIC 3SOYA 2CWTA 1IT8A 3EF8A 5G1LA 3RNTA 2CFKA 3ALAA 4XB5A 4HM3B 1VQK3 1BRNL 1QAKA 2SBLA 1NNVA 2F99A 3JUMA 3CCR3 1E97A 1UCIA 3VF1A 1VQN3 3GZBA 1CH0A 2C11A 1X1XA 1B2MA 1M904 3WMDA 1I0VA 4N6V0 1BNRA 1HZ1A 1S723 2BHMA 2KAAA 3U97A 1YVSA 2CKFB 4J5KA 4J5GA 5CF2A 1S5AA 3MHEA 4HM5B 1RGHA 2CC3A 3LMLA 4MJDA 4QWTA 4EV5A 3K7CA 2IA7A 3EE1A 3WA3A 1YVBI 3AMOA 3CCS3 1O7PB 1WNHA 4RNYA 5DREA 3FG1A 3CCL3 1AR0A 1W4NA 1L5GB 1YGWA 3MPHA 4R9KA 3B7CA 4FMBA 5IG4A 2Z7AA 1ZO2A 5EEOA 1YI23 1RN7A 4FMCA 7GSPA 1FZUA 3BIRA 1BNJA 1T5YA 1TP6A 2CX1A 3MSOA 5M19A 2C10A 2BU4A 2XFSA 4K1UA 4TX4A 5D81A 4HZBB 5AIIA 1PFPA 1UCKA 3SOAA 1JKGA 3KSPA 1RTUA 2R41A 1JBTA 1NB3I 4L8PA 3NQYA 4BL3A 1EQKA 1FUWA 1SPUA 2STDA 1MOLA 1MWTA 1SIIA 3ER7A 4HZ9B 4WHAA 1UCJA 1ULJB 2Z77A 3FGYA 3NBBA 1TUHA 3H3HA 3A5EA 2P09A 4L7KA 2ZDJA 1N9JA 3FKAA 4BL2A 5D82A 2E2VA 3PGBA 4FCMA 2B1XB 2HOHA 1VQP3 4PEJA 1K8A4 1WMOA 1VQ93 3T8NA 1TFOA 3NM7A 1I8VA 2MF7A 2RSXA 3N54B 4XDVA 5ELUA 2B24B 4BTXA 1EEJA 4EBGA 1NJI4 1OF5A 5CK6A 3CCV3 4EV2A 1YJ93 3LTAA 5IF6A 1IQXA 1A67A 4RNTA 2OQEC 3G4S3 1TU5A 3PYJA 2QA43 1W5ZA 3LTCA 1EG9B 3X3ZA 1JB5A 1VQ53 2W9PA 1BRIA 1YJW3 2QGUA 4KFEA 5IERA 2Z76A 6GSPA 2OTL3 3FCSB 2XRXB 3K63A 4GB5A 4MMXB 3F7SA 2RCDA 1VQ83 1MWRA 1OGXA 1D6ZA 1ROAA 3I553 1STDA 3X42A 2BO9B 1WMNA 3Q90A 1QVG2 4OUQA 2ML6A 3KN4A 4N6TA 5M1AA 1RGLA 4ZM8A 1IYYA 5TGNA 3CC23 1SJWA 1JB4A 4G1MB 7STDA 1X1YA 2CG0A 1R4YA 3IPTA 3FF0A 1KSIA 1VQO3 3ROBA 1AY7A 4O02B 3OXAA 1JV2B 4HBRA 4X2HA 1N9EA 3LH4A 3RGAA 1RGEA 7RNTA 2FXTA 4GSPA 4DKIA 1BNGA 3I563 2CIUA 1ULIB 2YFIB 5CXOA 1OCVA 1NWWA 3J7Yd 5HOHA 2JDIH 5AYRB 3WR2A 3KKGA 2ZA4A 5IG5A 2CHCA 5G1KA 3CNXA 1BRHA 4HM1B 1I70A 2CG1A 1K41A 1LOXA 1OACA 3DGLA 1RCLA 3CCE3 4FMDA 3BB9A 3F8XA 1TRQA 1BNIA 5KP3A 3K5TA 1M9GA 1IDPA 3M8CA 5AEUB 2ZHXB 4MMYB 1VQ63 1RMSA 1X1WA 4R1KA 2M7OA 3JUOA 3EC9A 3CCU3 3BNBA 2BT3A 2H0HA 3NV0B 1BSCA 4HM8B 5BU4A 1GMRA 1KD14 2PZVA 4HM2B 3VSYA 2CFDA 3HIIA 5KP1A 3PZWA 2C4BA 1BSEA 4N6OB 3D3LA 3GZRA 4HM7B 3S28A 4O2HA 3SLUA 1IT7A 1ZX2A 2XEPA 3D5GA 2HMLB 1D6UA 2I9WA 4KVHA 1ROVA 3GWRA 1Q7HA 1RCKA 1V57A 4R80A 3FG3A 1IU7A 1WQLB 1FGOA 1WMPA 2MC8A 1N5PA 4NPBA 5IG3A 1O7WB 1IV9A 1CQSA 1OHSA 1BSAA 1UI7A 2K54A 1I2EA 1M1XB 2OWPA 1FGRA 3NQZA 4HYZA 1MGRA 1BRSA 3PCRA 4IIAA 5JBSA 5BXQA 3CCJ3 3EN1B 3NX0A 1GMPA 1BNEA 2LQVA 1E3VA 3ZG0A 3DY5A 5JPPA 1GSPA 1MWSA 3G0KA 1RNBA 2CWVA 2OTJ3 1Y4KA 1UUWB 2GEXA 1G02A 1I0XA 3PS8A 5IENA 1YIT3 3SXXA 3D5IA 3X41A 4NHFA 4HAAA 3GZXB 3MG2A 1ZGXA 1WTHA 1QJGA 2K0MA 1CYVA 3WA2X 3RDEA 2F5MA 1B21A 3S67A 5IEPA 3JUNA 3STDA 3F14A 3O8YA 1FUTA 4RBNA 3BU4A 1RHLA 1LNHA 5AYSC 2HMMB 3EN8A 3AHSA 2KRTA 3I0YA 1W00A 4WFOA 4HOHA 2L1SA 3S5CA 4FMAA 2XSOB 1M1K4 1RKYA 1O7HB 4FCJA 2HMNB 3CXC2 1JBRA 4LZIA 1RSNA 1I3IA 3CNMA 1W02A 1RGFA 1R4CA 4K1VA 1E3RA 1LQGC 3GSPA 3D9RA 4N6UA 1KQS2 1IVXA 4HVNA 4BIRA 4AEQA 1UDII 1UI8A 2BNGA 3DMCA 1B27A 3S27A 1YNVX 4HM4B 1QMAA 2W0QA 3UJMA 1RJOA 2XGNA 2XFTA 1FUSA 3CME3 3G713 3NV0A 3FZWA 4R9LA 1A2VA 2IUJA 2QEX3 1VQ43 1DMMA 2KF5A 2F86B 4HJLB 1T2HA 2W9QA 2KXGA 3CMA3 3T8UA 2P0MA 1AQZA 3V99A 1GY7A 4EXRA 3GAXA 3FG4A 1JB2A 2F98A 1IV7A 1RGKA 3T0UA 4BTWA 1YIJ3 1Q9EA 1YGEA 2J8XB 4GL6A 3S29A 4BU4A 1V74A 3EHCA 1B2UA 1MNLA 1NO3A 4OVMA 4WWUC 3MG3A 1BUJA 1IVVA 2WOHA 1I2GA 1C54A 1BOXA 1N8R4 1IVWA 2WOFA 4HKVB 4STDA 1PU4A 1UGIA 4LMIA 1FGTA 2P0XA 5FGOA 3DZLA 1VZZA 2IUKA 9RNTA 3G16A 2GBWB 2WGOA 1T2IA 3JUPA 3Q1CA 2KF6A 1JZDA 4N6LA 5IW9A 1BRGA 1VQQA 1ISKA 5AIFA 1Q864 3FLJA 8RNTA 5CLKA 1G0TA 1BU4A 4EC6A 3WODG 1JRQA 1YHQ3 1HKXA 1DVCA 1DMNA 2HMJB 4MMZB 4ORLA 5RNTA 1CEWI 3MKIA 2RGQA 3CC43 1B2SA 4XBTA 1TIJA 3GZYB 1MGWA 1LVNA 2E2TA 1OGZA 4N6MA 2CH9A 4H61A 4O8SA 1FYSA 2O3OA 1B2XA 1GS3A 2ML5A 3HK4A 3KFQC 3Q2PA 2H0GA 3QK9A 1O7MB 2UGIA 3LZAA 1U5OA 1SQWA 1BANA 3DH2A 3IMAB 2XR8B 1GD3A 4ILFA 1W7CA 1EKMA 1D6YA 1JBSA 4IPBA 1O7GB 1Q40B 1Z1SA 1KWIA 5AIGA 4XDWA 3CC73 2P38A 3CCM3 1QAFA 2F5WA 1W01A 3BNDA 4XM4A 1JZOA 3F40A 3FH1A 1LOVA 3IJEB 3KZTA 5IG0A 1VQL3 3ECFA 2IMJA 1IK3A 1FGQA 2F4YA 2Y74A 3EBTA 1DVDA 3HZPA 2UX0A 3NBJA 3SVAA 2V1LA 3FSDA 4KT3B 6RNTA 5KP4A 4CCVA 3BNCA 2JQ5A 5FW5A 2QIYA 1W2ZA 3X40A 1OHPA 4U13A 4XBYA 5IEOA 1PY3A 2GU3A 2A15A 3D4AA 1Q7Y4 1BNSA 2WGQA 3F8HA 1TFKA 1JN5B 4R4KA 3DGYA 1VQM3 1GOVA 3F7XA 3CU3A 1RN1A 2CK3H 2O9UX 1QALA 5G2GA 3TDGA 3KSED 1EA2A 3HOHA 3JUQA 1LOYA 3AGNA 4H3UA 4N6NB 4HM0B 4KFFA 4CPKA 1OHOA 3VGNA 3OX9A 1BGSA 1B2ZA 1Q814 1BSDA 1K9M4 3WHOA 1FW7A 3PXMA 8CHOA 5CF1A 1HU9A 4EYCA 4OK0A 1STFI 2AAEA 3RGRA 4AKYA 3A76A 3UB1A 4LSOA 1ZS7A 2GU1A 3SEDA 1Q824 2PNCA 3UNLA 3LT8A 3X3YA 2GSPA 2H0IA 3FF2A 1GY5A 4BTYA 3CPW2 1Q42A 1GYBA 4HM6B 4J9AA 3U1WA 1LNIA 3E99A 1NU3A 5BIRA 5M18A 1N5HA 4CDLA 1LQMB 1V58A 3LXUX 4WYKB 3EJVA 4Q53A 2W56B 3LTDA 4IT7A 1BSBA 3PCSA 6STDA 2INXA 2OOVA 4NREA 1W6CA 1BVIA 1Q40A 2FGTA 2W2CA 3DM8A 3DXOA 1AVKA 1IVUA 1K28A 3K9MC 1FA3A 1RNTA 3EBYA 1W2B2 1N8QA 2GEYA 1RGAA 1VQ73 1CYUA 3B4OA 5HGRA 4MEIA 3URPA 4CJNA 3Q3FA 2UUGC 4K90B 1US1A 1X1UA 1BAOA 2XSHB 3HI7A 1I2FA 5LC7A 3CCQ3 2XGLA 3V98A 3G6E3 3WDGB 1O7NB 2RNTA 3EB8A 1KC84 1T3BA 1GY6A 2ZL8A 3QRDA 1BRJA 1W6YA 1NDOB 2Q07A 1DETA 2RBIA 1YJN3 3DGOA 1JN5A 1J2BA 1SIHA 1JJ22 5EVHA 5GSPA 5AI1A 2KCDA 3H51A 5EQLA 1RRHA 1DE3A 3LYGA 5I97A 1GOYA 2YX9A 3BLZA 4FCZA 1TTOA 1UCLA 2KF4A 1GOUA 2RFRA 3KE7A 1LXEA 3OV4A 5A0OB 2Y73A 4JRFA 4I5QA 5AIHA 2HMOB 2OCTA 3BNEA 3LOYA 3D79A 1JNQA 2IYJA 3MG1A 2CFWA 1B3SA 4L8OA 2CFGA 5JPUA 2WO0A 4KZ1A 3X3XA 3LT9A 3MYTA 2L4VA 2W04A 5D83A
chains in the Genus database with same CATH topology
3NHXA 4JF8A 5DRVA 2YFJB 4WP5A 3UL6A 4AKZA 1UW1A 3OWUA 1QVF2 1IQ8A 1G96A 2W6JH 1U8CB 5BVBA 4KFDA 3B8LA 3DGMA 2HMKB 4N3VA 4WYKA 3N9HA 2W56A 3WOEB 1RRLA 3MWZA 4J8TA 4XBXA 2P05A 4K61A 3HIGA 1NB5I 2E2UA 3SX1A 1OUNA 3NUVA 2D1WA 3UL5A 4O3VA 2GXFA 3NXJA 3HX8A 3CPOA 5AEWB 2R4IA 3GRDA 1OPYA 3KIIA 3NBRA 4RNZA 1F8NA 2D42A 3AMOB 1W6GA 2XH9A 5ELJA 4LGQA 3CD63 1A90A 3K0ZA 2LYXA 3OWSA 1AVLA 1A2KA 2OQEA 1DYUA 5LC6A 4FR9A 1FGMA 1JKGB 3NM2A 1BUQA 2BMQB 4LEHA 3EQQB 1C7HA 1UUVB 2CW9A 1GD4A 3V92A 3WOFB 3F9SA 2OOVC 1K734 2Z6BA 2BMOB 5STDA 3DUKA 3DGNA 2CWUA 3EX9A 3OW22 3G8ZA 1AV4A 2CFLA 1ASKA 3JVCA 1IQYA 2GBXB 3N8BA 1DMQA 3OWYA 2W03A 2XF3A 3L0RA 1OH0A 3B4PA 2FNQA 4RZMA 2YFLB 1OF5B 2BMRB 3LTBA 4I4KA 4X2OA 3SOYA 1YJW3 2CWTA 1IT8A 3EF8A 2CFKA 3ALAA 4XB5A 4HM3B 1VQK3 1QAKA 2SBLA 3JUMA 2F99A 3CCR3 1E97A 3VF1A 1VQN3 3GZBA 2C11A 1M904 3WMDA 4N6V0 1S723 2BHMA 3U97A 2CKFB 5CF2A 1S5AA 3MHEA 4HM5B 2CC3A 4MJDA 3LMLA 4QWTA 4EV5A 3K7CA 2IA7A 3EE1A 3WA3A 1YVBI 3AMOA 3CCS3 1O7PB 1WNHA 4RNYA 5DREA 3FG1A 1AR0A 1W4NA 1L5GB 3MPHA 4R9KA 3B7CA 4FMBA 5IG4A 2Z7AA 1ZO2A 5EEOA 1YI23 1RN7A 4FMCA 1T5YA 1TP6A 3MSOA 2C10A 2XFSA 4K1UA 4TX4A 5D81A 4HZBB 5AIIA 1PFPA 3SOAA 1JKGA 3KSPA 1NB3I 4L8PA 3NQYA 1EQKA 1FUWA 1SPUA 2STDA 1MOLA 1SIIA 3ER7A 4HZ9B 4WHAA 1ULJB 2Z77A 3FGYA 3NBBA 1TUHA 3H3HA 2P09A 4L7KA 2ZDJA 1N9JA 3FKAA 5D82A 2E2VA 3PGBA 4FCMA 2B1XB 1VQP3 4PEJA 1K8A4 1WMOA 1VQ93 3T8NA 1TFOA 3NM7A 3N54B 2MF7A 2RSXA 4XDVA 5ELUA 2B24B 4BTXA 4EBGA 1NJI4 1OF5A 5CK6A 3CCV3 4EV2A 1YJ93 3LTAA 5IF6A 1IQXA 1A67A 2OQEC 3G4S3 1TU5A 3PYJA 2QA43 1W5ZA 3LTCA 1EG9B 3X3ZA 1JB5A 1VQ53 2W9PA 2QGUA 4KFEA 5IERA 2Z76A 2OTL3 3FCSB 2XRXB 3K63A 4GB5A 4MMXB 3F7SA 2RCDA 1VQ83 1ROAA 1OGXA 1D6ZA 3I553 1STDA 3X42A 2BO9B 1WMNA 3Q90A 1QVG2 4OUQA 2ML6A 3KN4A 4N6TA 4ZM8A 5TGNA 3CC23 1SJWA 1JB4A 4G1MB 7STDA 2CG0A 3IPTA 3FF0A 1KSIA 1VQO3 3ROBA 4O02B 3OXAA 1JV2B 4HBRA 4X2HA 1N9EA 3LH4A 3RGAA 2FXTA 3I563 2CIUA 1ULIB 2YFIB 5CXOA 1OCVA 1NWWA 3J7Yd 2JDIH 5AYRB 3KKGA 5IG5A 2CHCA 3CNXA 4HM1B 2CG1A 1K41A 1LOXA 1OACA 3DGLA 3CCE3 4FMDA 3BB9A 3F8XA 5KP3A 3K5TA 1M9GA 1IDPA 3M8CA 5AEUB 1VQ63 4MMYB 4R1KA 2M7OA 3JUOA 3EC9A 3CCU3 3BNBA 2BT3A 3NV0B 4HM8B 1KD14 2PZVA 4HM2B 3VSYA 2CFDA 3HIIA 5KP1A 3PZWA 4N6OB 3D3LA 3GZRA 4HM7B 3S28A 4O2HA 3SLUA 1IT7A 1ZX2A 2XEPA 2HMLB 1D6UA 2I9WA 4KVHA 1ROVA 3GWRA 4R80A 3FG3A 1IU7A 1WQLB 1FGOA 1WMPA 2MC8A 1N5PA 5IG3A 1O7WB 1IV9A 1CQSA 2OWPA 1OHSA 2K54A 1UI7A 3NQZA 1M1XB 5JBSA 1FGRA 4HYZA 4IIAA 3PCRA 3CCJ3 5BXQA 3EN1B 3NX0A 2LQVA 1E3VA 3DY5A 5JPPA 3G0KA 2CWVA 2OTJ3 1Y4KA 1UUWB 2GEXA 3PS8A 5IENA 1YIT3 3SXXA 3X41A 4NHFA 3GZXB 3MG2A 2K0MA 1WTHA 1QJGA 3WA2X 1CYVA 3RDEA 5IEPA 3S67A 3JUNA 3STDA 3F14A 3O8YA 4RBNA 5AYSC 1LNHA 2HMMB 3EN8A 2KRTA 3I0YA 1W00A 4WFOA 3S5CA 4FMAA 2XSOB 1M1K4 1RKYA 1O7HB 4FCJA 2HMNB 3CXC2 4LZIA 3CNMA 1W02A 4K1VA 1R4CA 1E3RA 3D9RA 4N6UA 1KQS2 1IVXA 4HVNA 4AEQA 1UI8A 2BNGA 3DMCA 3S27A 4HM4B 1QMAA 2W0QA 3UJMA 1RJOA 2XGNA 2XFTA 3CME3 3G713 3NV0A 3FZWA 4R9LA 1A2VA 2IUJA 2QEX3 1VQ43 1DMMA 4HJLB 2F86B 2W9QA 2KXGA 3CMA3 3T8UA 2P0MA 3V99A 1GY7A 4EXRA 3GAXA 3FG4A 1JB2A 2F98A 1IV7A 3T0UA 4BTWA 1YIJ3 4GL6A 1YGEA 3S29A 1V74A 3EHCA 1MNLA 1NO3A 4OVMA 4WWUC 3MG3A 1IVVA 2WOHA 1N8R4 1IVWA 2WOFA 4HKVB 4STDA 1PU4A 5FGOA 4LMIA 1FGTA 2P0XA 3CCL3 3DZLA 1VZZA 2IUKA 3G16A 2GBWB 2WGOA 3JUPA 3Q1CA 4N6LA 5IW9A 1ISKA 5AIFA 1Q864 3FLJA 5CLKA 4EC6A 3WODG 1JRQA 1YHQ3 1HKXA 1DVCA 1DMNA 2HMJB 4MMZB 4ORLA 1CEWI 3MKIA 2RGQA 3CC43 4XBTA 1TIJA 3GZYB 1LVNA 2E2TA 1OGZA 4N6MA 2CH9A 4H61A 4O8SA 2O3OA 1GS3A 2ML5A 3HK4A 3KFQC 3Q2PA 3QK9A 1O7MB 3LZAA 1U5OA 1SQWA 3IMAB 2XR8B 1GD3A 1W7CA 1EKMA 1D6YA 4IPBA 1O7GB 1Q40B 1Z1SA 1KWIA 5AIGA 4XDWA 3CC73 2P38A 3CCM3 1QAFA 4XM4A 1W01A 3BNDA 3F40A 3FH1A 3IJEB 3KZTA 5IG0A 1VQL3 3ECFA 2IMJA 1IK3A 1FGQA 2Y74A 3EBTA 1DVDA 3HZPA 2UX0A 3NBJA 3SVAA 2V1LA 3FSDA 5KP4A 4CCVA 3BNCA 2JQ5A 5FW5A 2QIYA 1W2ZA 3X40A 1OHPA 4U13A 4XBYA 5IEOA 2GU3A 2A15A 1Q7Y4 2WGQA 3F8HA 1TFKA 1JN5B 4R4KA 1VQM3 3F7XA 3CU3A 2CK3H 2O9UX 1QALA 5G2GA 3TDGA 3KSED 1EA2A 3JUQA 4H3UA 4N6NB 4HM0B 4KFFA 1OHOA 3VGNA 3OX9A 1Q814 1K9M4 3PXMA 8CHOA 5CF1A 1HU9A 4EYCA 4OK0A 1STFI 3RGRA 4AKYA 3A76A 3UB1A 4LSOA 1Q824 2GU1A 3SEDA 2PNCA 3UNLA 3LT8A 3X3YA 3FF2A 1GY5A 4BTYA 3CPW2 1Q42A 1GYBA 4HM6B 4J9AA 3U1WA 3E99A 1NU3A 1N5HA 4CDLA 3LXUX 4WYKB 3EJVA 4Q53A 2W56B 3LTDA 4IT7A 3PCSA 6STDA 2INXA 2OOVA 4NREA 1W6CA 1Q40A 2FGTA 2W2CA 3DM8A 3DXOA 1AVKA 1IVUA 1K28A 3K9MC 1FA3A 3EBYA 1W2B2 1N8QA 2GEYA 1VQ73 1CYUA 3B4OA 5HGRA 4MEIA 4K90B 1US1A 2XSHB 3HI7A 5LC7A 3CCQ3 2XGLA 3V98A 3G6E3 3WDGB 1O7NB 3EB8A 1KC84 1GY6A 2ZL8A 3QRDA 1W6YA 1NDOB 2Q07A 1YJN3 3DGOA 1JN5A 1J2BA 1SIHA 1JJ22 5EVHA 5AI1A 2KCDA 3H51A 5EQLA 1RRHA 3LYGA 5I97A 2YX9A 3BLZA 4FCZA 3KE7A 3OV4A 2RFRA 1LXEA 5A0OB 2Y73A 4JRFA 5AIHA 2HMOB 2OCTA 3BNEA 3LOYA 1JNQA 3MG1A 2CFWA 4L8OA 2CFGA 5JPUA 2WO0A 4KZ1A 3X3XA 3LT9A 3MYTA 2L4VA 2W04A 5D83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU 3;  3CXC 2;  1YJN 3;  1JJ2 2;  1QVF 2;  2OTL 3;  3I56 3;  1KD1 4;  2OTJ 3;  1VQL 3;  1KQS 2;  3CCS 3;  1K9M 4;  1YIT 3;  1Q81 4;  1N8R 4;  3CC4 3;  1YJW 3;  1VQ8 3;  1VQP 3;  3I55 3;  3CME 3;  1W2B 2;  3CCL 3;  3G71 3;  1K8A 4;  1VQ4 3;  2QEX 3;  1VQ7 3;  1YI2 3;  1VQ9 3;  1Q82 4;  1QVG 2;  3CCE 3;  1VQK 3;  1Q7Y 4;  3CMA 3;  3CC2 3;  1NJI 4;  3CPW 2;  3CCR 3;  3CCV 3;  1YJ9 3;  1Q86 4;  1K73 4;  1VQN 3;  3CCQ 3;  3G6E 3;  1VQM 3;  1M90 4;  3G4S 3;  1YHQ 3;  1KC8 4;  1VQ6 3;  1VQO 3;  2QA4 3;  1S72 3;  1M1K 4;  3CCJ 3;  3OW2 2;  1YIJ 3;  3CC7 3;  3CD6 3;  3CCM 3;  1VQ5 3; 
#chains in the Genus database with same CATH topology
 3NHX A;  4JF8 A;  1GMQ A;  5DRV A;  1RN4 A;  3ZFZ A;  2YFJ B;  1SAR A;  4WP5 A;  3UL6 A;  1UW1 A;  3OWU A;  4AKZ A;  1QVF 2;  1IQ8 A;  1G96 A;  2W6J H;  1U8C B;  5BVB A;  4KFD A;  3B8L A;  3DGM A;  2HMK B;  1BNF A;  4N3V A;  4WYK A;  3N9H A;  2W56 A;  3WOE B;  1RRL A;  1UUG B;  3MWZ A;  4J8T A;  4XBX A;  2P05 A;  2SAR A;  3HIG A;  4K61 A;  2E2U A;  1NB5 I;  3SX1 A;  1OUN A;  3NUV A;  2D1W A;  3UL5 A;  4O3V A;  4GHO A;  2GXF A;  3NXJ A;  1LOW A;  3HX8 A;  3CPO A;  5AEW B;  2R4I A;  3GRD A;  1OPY A;  3KII A;  3NBR A;  4RNZ A;  3SYU A;  1RDS A;  1F8N A;  2D42 A;  3AMO B;  1W6G A;  1BRK A;  2XH9 A;  5ELJ A;  1I3F A;  3AHW A;  1RGG A;  4LGQ A;  3CD6 3;  1A90 A;  3K0Z A;  1UGH I;  1TRP A;  1A2P A;  2LYX A;  3OWS A;  1AVL A;  1A2K A;  1TJD A;  2OQE A;  1DYU A;  1HYF A;  4FR9 A;  5LC6 A;  1PYL A;  4EW5 A;  1FGM A;  1JKG B;  3NM2 A;  2CX0 A;  2BMQ B;  4LEH A;  1BUQ A;  3EQQ B;  1C7H A;  1BIR A;  1UUV B;  3ZG5 A;  2CW9 A;  2BIR A;  1GD4 A;  1LRA A;  3V92 A;  3WOF B;  3F9S A;  2OOV C;  2K3D A;  2Z6B A;  1RGC A;  2BMO B;  1K73 4;  5STD A;  3DUK A;  3DGN A;  2CWU A;  3EX9 A;  3OW2 2;  3G8Z A;  1AV4 A;  2CFL A;  3AGO A;  2F56 A;  3KCH A;  1ASK A;  1B20 A;  2IY2 A;  3JVC A;  1IQY A;  2GBX B;  3N8B A;  1DMQ A;  2AAD A;  1MWU A;  2KF3 A;  3OWY A;  2W03 A;  2XF3 A;  3L0R A;  1OH0 A;  3B4P A;  2FNQ A;  4LYL B;  2YFL B;  1OF5 B;  2BMR B;  3LTB A;  4I4K A;  1RLS A;  4RZM A;  4X2O A;  1EUI C;  3SOY A;  2CWT A;  1IT8 A;  3EF8 A;  5G1L A;  3RNT A;  2CFK A;  3ALA A;  4XB5 A;  4HM3 B;  1VQK 3;  1BRN L;  1QAK A;  2SBL A;  1NNV A;  2F99 A;  3JUM A;  3CCR 3;  1E97 A;  1UCI A;  3VF1 A;  1VQN 3;  3GZB A;  1CH0 A;  2C11 A;  1X1X A;  1B2M A;  1M90 4;  3WMD A;  1I0V A;  4N6V 0;  1BNR A;  1HZ1 A;  1S72 3;  2BHM A;  2KAA A;  3U97 A;  1YVS A;  2CKF B;  4J5K A;  4J5G A;  5CF2 A;  1S5A A;  3MHE A;  4HM5 B;  1RGH A;  2CC3 A;  3LML A;  4MJD A;  4QWT A;  4EV5 A;  3K7C A;  2IA7 A;  3EE1 A;  3WA3 A;  1YVB I;  3AMO A;  3CCS 3;  1O7P B;  1WNH A;  4RNY A;  5DRE A;  3FG1 A;  3CCL 3;  1AR0 A;  1W4N A;  1L5G B;  1YGW A;  3MPH A;  4R9K A;  3B7C A;  4FMB A;  5IG4 A;  2Z7A A;  1ZO2 A;  5EEO A;  1YI2 3;  1RN7 A;  4FMC A;  7GSP A;  1FZU A;  3BIR A;  1BNJ A;  1T5Y A;  1TP6 A;  2CX1 A;  3MSO A;  5M19 A;  2C10 A;  2BU4 A;  2XFS A;  4K1U A;  4TX4 A;  5D81 A;  4HZB B;  5AII A;  1PFP A;  1UCK A;  3SOA A;  1JKG A;  3KSP A;  1RTU A;  2R41 A;  1JBT A;  1NB3 I;  4L8P A;  3NQY A;  4BL3 A;  1EQK A;  1FUW A;  1SPU A;  2STD A;  1MOL A;  1MWT A;  1SII A;  3ER7 A;  4HZ9 B;  4WHA A;  1UCJ A;  1ULJ B;  2Z77 A;  3FGY A;  3NBB A;  1TUH A;  3H3H A;  3A5E A;  2P09 A;  4L7K A;  2ZDJ A;  1N9J A;  3FKA A;  4BL2 A;  5D82 A;  2E2V A;  3PGB A;  4FCM A;  2B1X B;  2HOH A;  1VQP 3;  4PEJ A;  1K8A 4;  1WMO A;  1VQ9 3;  3T8N A;  1TFO A;  3NM7 A;  1I8V A;  2MF7 A;  2RSX A;  3N54 B;  4XDV A;  5ELU A;  2B24 B;  4BTX A;  1EEJ A;  4EBG A;  1NJI 4;  1OF5 A;  5CK6 A;  3CCV 3;  4EV2 A;  1YJ9 3;  3LTA A;  5IF6 A;  1IQX A;  1A67 A;  4RNT A;  2OQE C;  3G4S 3;  1TU5 A;  3PYJ A;  2QA4 3;  1W5Z A;  3LTC A;  1EG9 B;  3X3Z A;  1JB5 A;  1VQ5 3;  2W9P A;  1BRI A;  1YJW 3;  2QGU A;  4KFE A;  5IER A;  2Z76 A;  6GSP A;  2OTL 3;  3FCS B;  2XRX B;  3K63 A;  4GB5 A;  4MMX B;  3F7S A;  2RCD A;  1VQ8 3;  1MWR A;  1OGX A;  1D6Z A;  1ROA A;  3I55 3;  1STD A;  3X42 A;  2BO9 B;  1WMN A;  3Q90 A;  1QVG 2;  4OUQ A;  2ML6 A;  3KN4 A;  4N6T A;  5M1A A;  1RGL A;  4ZM8 A;  1IYY A;  5TGN A;  3CC2 3;  1SJW A;  1JB4 A;  4G1M B;  7STD A;  1X1Y A;  2CG0 A;  1R4Y A;  3IPT A;  3FF0 A;  1KSI A;  1VQO 3;  3ROB A;  1AY7 A;  4O02 B;  3OXA A;  1JV2 B;  4HBR A;  4X2H A;  1N9E A;  3LH4 A;  3RGA A;  1RGE A;  7RNT A;  2FXT A;  4GSP A;  4DKI A;  1BNG A;  3I56 3;  2CIU A;  1ULI B;  2YFI B;  5CXO A;  1OCV A;  1NWW A;  3J7Y d;  5HOH A;  2JDI H;  5AYR B;  3WR2 A;  3KKG A;  2ZA4 A;  5IG5 A;  2CHC A;  5G1K A;  3CNX A;  1BRH A;  4HM1 B;  1I70 A;  2CG1 A;  1K41 A;  1LOX A;  1OAC A;  3DGL A;  1RCL A;  3CCE 3;  4FMD A;  3BB9 A;  3F8X A;  1TRQ A;  1BNI A;  5KP3 A;  3K5T A;  1M9G A;  1IDP A;  3M8C A;  5AEU B;  2ZHX B;  4MMY B;  1VQ6 3;  1RMS A;  1X1W A;  4R1K A;  2M7O A;  3JUO A;  3EC9 A;  3CCU 3;  3BNB A;  2BT3 A;  2H0H A;  3NV0 B;  1BSC A;  4HM8 B;  5BU4 A;  1GMR A;  1KD1 4;  2PZV A;  4HM2 B;  3VSY A;  2CFD A;  3HII A;  5KP1 A;  3PZW A;  2C4B A;  1BSE A;  4N6O B;  3D3L A;  3GZR A;  4HM7 B;  3S28 A;  4O2H A;  3SLU A;  1IT7 A;  1ZX2 A;  2XEP A;  3D5G A;  2HML B;  1D6U A;  2I9W A;  4KVH A;  1ROV A;  3GWR A;  1Q7H A;  1RCK A;  1V57 A;  4R80 A;  3FG3 A;  1IU7 A;  1WQL B;  1FGO A;  1WMP A;  2MC8 A;  1N5P A;  4NPB A;  5IG3 A;  1O7W B;  1IV9 A;  1CQS A;  1OHS A;  1BSA A;  1UI7 A;  2K54 A;  1I2E A;  1M1X B;  2OWP A;  1FGR A;  3NQZ A;  4HYZ A;  1MGR A;  1BRS A;  3PCR A;  4IIA A;  5JBS A;  5BXQ A;  3CCJ 3;  3EN1 B;  3NX0 A;  1GMP A;  1BNE A;  2LQV A;  1E3V A;  3ZG0 A;  3DY5 A;  5JPP A;  1GSP A;  1MWS A;  3G0K A;  1RNB A;  2CWV A;  2OTJ 3;  1Y4K A;  1UUW B;  2GEX A;  1G02 A;  1I0X A;  3PS8 A;  5IEN A;  1YIT 3;  3SXX A;  3D5I A;  3X41 A;  4NHF A;  4HAA A;  3GZX B;  3MG2 A;  1ZGX A;  1WTH A;  1QJG A;  2K0M A;  1CYV A;  3WA2 X;  3RDE A;  2F5M A;  1B21 A;  3S67 A;  5IEP A;  3JUN A;  3STD A;  3F14 A;  3O8Y A;  1FUT A;  4RBN A;  3BU4 A;  1RHL A;  1LNH A;  5AYS C;  2HMM B;  3EN8 A;  3AHS A;  2KRT A;  3I0Y A;  1W00 A;  4WFO A;  4HOH A;  2L1S A;  3S5C A;  4FMA A;  2XSO B;  1M1K 4;  1RKY A;  1O7H B;  4FCJ A;  2HMN B;  3CXC 2;  1JBR A;  4LZI A;  1RSN A;  1I3I A;  3CNM A;  1W02 A;  1RGF A;  1R4C A;  4K1V A;  1E3R A;  1LQG C;  3GSP A;  3D9R A;  4N6U A;  1KQS 2;  1IVX A;  4HVN A;  4BIR A;  4AEQ A;  1UDI I;  1UI8 A;  2BNG A;  3DMC A;  1B27 A;  3S27 A;  1YNV X;  4HM4 B;  1QMA A;  2W0Q A;  3UJM A;  1RJO A;  2XGN A;  2XFT A;  1FUS A;  3CME 3;  3G71 3;  3NV0 A;  3FZW A;  4R9L A;  1A2V A;  2IUJ A;  2QEX 3;  1VQ4 3;  1DMM A;  2KF5 A;  2F86 B;  4HJL B;  1T2H A;  2W9Q A;  2KXG A;  3CMA 3;  3T8U A;  2P0M A;  1AQZ A;  3V99 A;  1GY7 A;  4EXR A;  3GAX A;  3FG4 A;  1JB2 A;  2F98 A;  1IV7 A;  1RGK A;  3T0U A;  4BTW A;  1YIJ 3;  1Q9E A;  1YGE A;  2J8X B;  4GL6 A;  3S29 A;  4BU4 A;  1V74 A;  3EHC A;  1B2U A;  1MNL A;  1NO3 A;  4OVM A;  4WWU C;  3MG3 A;  1BUJ A;  1IVV A;  2WOH A;  1I2G A;  1C54 A;  1BOX A;  1N8R 4;  1IVW A;  2WOF A;  4HKV B;  4STD A;  1PU4 A;  1UGI A;  4LMI A;  1FGT A;  2P0X A;  5FGO A;  3DZL A;  1VZZ A;  2IUK A;  9RNT A;  3G16 A;  2GBW B;  2WGO A;  1T2I A;  3JUP A;  3Q1C A;  2KF6 A;  1JZD A;  4N6L A;  5IW9 A;  1BRG A;  1VQQ A;  1ISK A;  5AIF A;  1Q86 4;  3FLJ A;  8RNT A;  5CLK A;  1G0T A;  1BU4 A;  4EC6 A;  3WOD G;  1JRQ A;  1YHQ 3;  1HKX A;  1DVC A;  1DMN A;  2HMJ B;  4MMZ B;  4ORL A;  5RNT A;  1CEW I;  3MKI A;  2RGQ A;  3CC4 3;  1B2S A;  4XBT A;  1TIJ A;  3GZY B;  1MGW A;  1LVN A;  2E2T A;  1OGZ A;  4N6M A;  2CH9 A;  4H61 A;  4O8S A;  1FYS A;  2O3O A;  1B2X A;  1GS3 A;  2ML5 A;  3HK4 A;  3KFQ C;  3Q2P A;  2H0G A;  3QK9 A;  1O7M B;  2UGI A;  3LZA A;  1U5O A;  1SQW A;  1BAN A;  3DH2 A;  3IMA B;  2XR8 B;  1GD3 A;  4ILF A;  1W7C A;  1EKM A;  1D6Y A;  1JBS A;  4IPB A;  1O7G B;  1Q40 B;  1Z1S A;  1KWI A;  5AIG A;  4XDW A;  3CC7 3;  2P38 A;  3CCM 3;  1QAF A;  2F5W A;  1W01 A;  3BND A;  4XM4 A;  1JZO A;  3F40 A;  3FH1 A;  1LOV A;  3IJE B;  3KZT A;  5IG0 A;  1VQL 3;  3ECF A;  2IMJ A;  1IK3 A;  1FGQ A;  2F4Y A;  2Y74 A;  3EBT A;  1DVD A;  3HZP A;  2UX0 A;  3NBJ A;  3SVA A;  2V1L A;  3FSD A;  4KT3 B;  6RNT A;  5KP4 A;  4CCV A;  3BNC A;  2JQ5 A;  5FW5 A;  2QIY A;  1W2Z A;  3X40 A;  1OHP A;  4U13 A;  4XBY A;  5IEO A;  1PY3 A;  2GU3 A;  2A15 A;  3D4A A;  1Q7Y 4;  1BNS A;  2WGQ A;  3F8H A;  1TFK A;  1JN5 B;  4R4K A;  3DGY A;  1VQM 3;  1GOV A;  3F7X A;  3CU3 A;  1RN1 A;  2CK3 H;  2O9U X;  1QAL A;  5G2G A;  3TDG A;  3KSE D;  1EA2 A;  3HOH A;  3JUQ A;  1LOY A;  3AGN A;  4H3U A;  4N6N B;  4HM0 B;  4KFF A;  4CPK A;  1OHO A;  3VGN A;  3OX9 A;  1BGS A;  1B2Z A;  1Q81 4;  1BSD A;  1K9M 4;  3WHO A;  1FW7 A;  3PXM A;  8CHO A;  5CF1 A;  1HU9 A;  4EYC A;  4OK0 A;  1STF I;  2AAE A;  3RGR A;  4AKY A;  3A76 A;  3UB1 A;  4LSO A;  1ZS7 A;  2GU1 A;  3SED A;  1Q82 4;  2PNC A;  3UNL A;  3LT8 A;  3X3Y A;  2GSP A;  2H0I A;  3FF2 A;  1GY5 A;  4BTY A;  3CPW 2;  1Q42 A;  1GYB A;  4HM6 B;  4J9A A;  3U1W A;  1LNI A;  3E99 A;  1NU3 A;  5BIR A;  5M18 A;  1N5H A;  4CDL A;  1LQM B;  1V58 A;  3LXU X;  4WYK B;  3EJV A;  4Q53 A;  2W56 B;  3LTD A;  4IT7 A;  1BSB A;  3PCS A;  6STD A;  2INX A;  2OOV A;  4NRE A;  1W6C A;  1BVI A;  1Q40 A;  2FGT A;  2W2C A;  3DM8 A;  3DXO A;  1AVK A;  1IVU A;  1K28 A;  3K9M C;  1FA3 A;  1RNT A;  3EBY A;  1W2B 2;  1N8Q A;  2GEY A;  1RGA A;  1VQ7 3;  1CYU A;  3B4O A;  5HGR A;  4MEI A;  3URP A;  4CJN A;  3Q3F A;  2UUG C;  4K90 B;  1US1 A;  1X1U A;  1BAO A;  2XSH B;  3HI7 A;  1I2F A;  5LC7 A;  3CCQ 3;  2XGL A;  3V98 A;  3G6E 3;  3WDG B;  1O7N B;  2RNT A;  3EB8 A;  1KC8 4;  1T3B A;  1GY6 A;  2ZL8 A;  3QRD A;  1BRJ A;  1W6Y A;  1NDO B;  2Q07 A;  1DET A;  2RBI A;  1YJN 3;  3DGO A;  1JN5 A;  1J2B A;  1SIH A;  1JJ2 2;  5EVH A;  5GSP A;  5AI1 A;  2KCD A;  3H51 A;  5EQL A;  1RRH A;  1DE3 A;  3LYG A;  5I97 A;  1GOY A;  2YX9 A;  3BLZ A;  4FCZ A;  1TTO A;  1UCL A;  2KF4 A;  1GOU A;  2RFR A;  3KE7 A;  1LXE A;  3OV4 A;  5A0O B;  2Y73 A;  4JRF A;  4I5Q A;  5AIH A;  2HMO B;  2OCT A;  3BNE A;  3LOY A;  3D79 A;  1JNQ A;  2IYJ A;  3MG1 A;  2CFW A;  1B3S A;  4L8O A;  2CFG A;  5JPU A;  2WO0 A;  4KZ1 A;  3X3X A;  3LT9 A;  3MYT A;  2L4V A;  2W04 A;  5D83 A; 
#chains in the Genus database with same CATH homology
 3NHX A;  4JF8 A;  5DRV A;  2YFJ B;  4WP5 A;  3UL6 A;  4AKZ A;  1UW1 A;  3OWU A;  1QVF 2;  1IQ8 A;  1G96 A;  2W6J H;  1U8C B;  5BVB A;  4KFD A;  3B8L A;  3DGM A;  2HMK B;  4N3V A;  4WYK A;  3N9H A;  2W56 A;  3WOE B;  1RRL A;  3MWZ A;  4J8T A;  4XBX A;  2P05 A;  4K61 A;  3HIG A;  1NB5 I;  2E2U A;  3SX1 A;  1OUN A;  3NUV A;  2D1W A;  3UL5 A;  4O3V A;  2GXF A;  3NXJ A;  3HX8 A;  3CPO A;  5AEW B;  2R4I A;  3GRD A;  1OPY A;  3KII A;  3NBR A;  4RNZ A;  1F8N A;  2D42 A;  3AMO B;  1W6G A;  2XH9 A;  5ELJ A;  4LGQ A;  3CD6 3;  1A90 A;  3K0Z A;  2LYX A;  3OWS A;  1AVL A;  1A2K A;  2OQE A;  1DYU A;  5LC6 A;  4FR9 A;  1FGM A;  1JKG B;  3NM2 A;  1BUQ A;  2BMQ B;  4LEH A;  3EQQ B;  1C7H A;  1UUV B;  2CW9 A;  1GD4 A;  3V92 A;  3WOF B;  3F9S A;  2OOV C;  1K73 4;  2Z6B A;  2BMO B;  5STD A;  3DUK A;  3DGN A;  2CWU A;  3EX9 A;  3OW2 2;  3G8Z A;  1AV4 A;  2CFL A;  1ASK A;  3JVC A;  1IQY A;  2GBX B;  3N8B A;  1DMQ A;  3OWY A;  2W03 A;  2XF3 A;  3L0R A;  1OH0 A;  3B4P A;  2FNQ A;  4RZM A;  2YFL B;  1OF5 B;  2BMR B;  3LTB A;  4I4K A;  4X2O A;  3SOY A;  1YJW 3;  2CWT A;  1IT8 A;  3EF8 A;  2CFK A;  3ALA A;  4XB5 A;  4HM3 B;  1VQK 3;  1QAK A;  2SBL A;  3JUM A;  2F99 A;  3CCR 3;  1E97 A;  3VF1 A;  1VQN 3;  3GZB A;  2C11 A;  1M90 4;  3WMD A;  4N6V 0;  1S72 3;  2BHM A;  3U97 A;  2CKF B;  5CF2 A;  1S5A A;  3MHE A;  4HM5 B;  2CC3 A;  4MJD A;  3LML A;  4QWT A;  4EV5 A;  3K7C A;  2IA7 A;  3EE1 A;  3WA3 A;  1YVB I;  3AMO A;  3CCS 3;  1O7P B;  1WNH A;  4RNY A;  5DRE A;  3FG1 A;  1AR0 A;  1W4N A;  1L5G B;  3MPH A;  4R9K A;  3B7C A;  4FMB A;  5IG4 A;  2Z7A A;  1ZO2 A;  5EEO A;  1YI2 3;  1RN7 A;  4FMC A;  1T5Y A;  1TP6 A;  3MSO A;  2C10 A;  2XFS A;  4K1U A;  4TX4 A;  5D81 A;  4HZB B;  5AII A;  1PFP A;  3SOA A;  1JKG A;  3KSP A;  1NB3 I;  4L8P A;  3NQY A;  1EQK A;  1FUW A;  1SPU A;  2STD A;  1MOL A;  1SII A;  3ER7 A;  4HZ9 B;  4WHA A;  1ULJ B;  2Z77 A;  3FGY A;  3NBB A;  1TUH A;  3H3H A;  2P09 A;  4L7K A;  2ZDJ A;  1N9J A;  3FKA A;  5D82 A;  2E2V A;  3PGB A;  4FCM A;  2B1X B;  1VQP 3;  4PEJ A;  1K8A 4;  1WMO A;  1VQ9 3;  3T8N A;  1TFO A;  3NM7 A;  3N54 B;  2MF7 A;  2RSX A;  4XDV A;  5ELU A;  2B24 B;  4BTX A;  4EBG A;  1NJI 4;  1OF5 A;  5CK6 A;  3CCV 3;  4EV2 A;  1YJ9 3;  3LTA A;  5IF6 A;  1IQX A;  1A67 A;  2OQE C;  3G4S 3;  1TU5 A;  3PYJ A;  2QA4 3;  1W5Z A;  3LTC A;  1EG9 B;  3X3Z A;  1JB5 A;  1VQ5 3;  2W9P A;  2QGU A;  4KFE A;  5IER A;  2Z76 A;  2OTL 3;  3FCS B;  2XRX B;  3K63 A;  4GB5 A;  4MMX B;  3F7S A;  2RCD A;  1VQ8 3;  1ROA A;  1OGX A;  1D6Z A;  3I55 3;  1STD A;  3X42 A;  2BO9 B;  1WMN A;  3Q90 A;  1QVG 2;  4OUQ A;  2ML6 A;  3KN4 A;  4N6T A;  4ZM8 A;  5TGN A;  3CC2 3;  1SJW A;  1JB4 A;  4G1M B;  7STD A;  2CG0 A;  3IPT A;  3FF0 A;  1KSI A;  1VQO 3;  3ROB A;  4O02 B;  3OXA A;  1JV2 B;  4HBR A;  4X2H A;  1N9E A;  3LH4 A;  3RGA A;  2FXT A;  3I56 3;  2CIU A;  1ULI B;  2YFI B;  5CXO A;  1OCV A;  1NWW A;  3J7Y d;  2JDI H;  5AYR B;  3KKG A;  5IG5 A;  2CHC A;  3CNX A;  4HM1 B;  2CG1 A;  1K41 A;  1LOX A;  1OAC A;  3DGL A;  3CCE 3;  4FMD A;  3BB9 A;  3F8X A;  5KP3 A;  3K5T A;  1M9G A;  1IDP A;  3M8C A;  5AEU B;  1VQ6 3;  4MMY B;  4R1K A;  2M7O A;  3JUO A;  3EC9 A;  3CCU 3;  3BNB A;  2BT3 A;  3NV0 B;  4HM8 B;  1KD1 4;  2PZV A;  4HM2 B;  3VSY A;  2CFD A;  3HII A;  5KP1 A;  3PZW A;  4N6O B;  3D3L A;  3GZR A;  4HM7 B;  3S28 A;  4O2H A;  3SLU A;  1IT7 A;  1ZX2 A;  2XEP A;  2HML B;  1D6U A;  2I9W A;  4KVH A;  1ROV A;  3GWR A;  4R80 A;  3FG3 A;  1IU7 A;  1WQL B;  1FGO A;  1WMP A;  2MC8 A;  1N5P A;  5IG3 A;  1O7W B;  1IV9 A;  1CQS A;  2OWP A;  1OHS A;  2K54 A;  1UI7 A;  3NQZ A;  1M1X B;  5JBS A;  1FGR A;  4HYZ A;  4IIA A;  3PCR A;  3CCJ 3;  5BXQ A;  3EN1 B;  3NX0 A;  2LQV A;  1E3V A;  3DY5 A;  5JPP A;  3G0K A;  2CWV A;  2OTJ 3;  1Y4K A;  1UUW B;  2GEX A;  3PS8 A;  5IEN A;  1YIT 3;  3SXX A;  3X41 A;  4NHF A;  3GZX B;  3MG2 A;  2K0M A;  1WTH A;  1QJG A;  3WA2 X;  1CYV A;  3RDE A;  5IEP A;  3S67 A;  3JUN A;  3STD A;  3F14 A;  3O8Y A;  4RBN A;  5AYS C;  1LNH A;  2HMM B;  3EN8 A;  2KRT A;  3I0Y A;  1W00 A;  4WFO A;  3S5C A;  4FMA A;  2XSO B;  1M1K 4;  1RKY A;  1O7H B;  4FCJ A;  2HMN B;  3CXC 2;  4LZI A;  3CNM A;  1W02 A;  4K1V A;  1R4C A;  1E3R A;  3D9R A;  4N6U A;  1KQS 2;  1IVX A;  4HVN A;  4AEQ A;  1UI8 A;  2BNG A;  3DMC A;  3S27 A;  4HM4 B;  1QMA A;  2W0Q A;  3UJM A;  1RJO A;  2XGN A;  2XFT A;  3CME 3;  3G71 3;  3NV0 A;  3FZW A;  4R9L A;  1A2V A;  2IUJ A;  2QEX 3;  1VQ4 3;  1DMM A;  4HJL B;  2F86 B;  2W9Q A;  2KXG A;  3CMA 3;  3T8U A;  2P0M A;  3V99 A;  1GY7 A;  4EXR A;  3GAX A;  3FG4 A;  1JB2 A;  2F98 A;  1IV7 A;  3T0U A;  4BTW A;  1YIJ 3;  4GL6 A;  1YGE A;  3S29 A;  1V74 A;  3EHC A;  1MNL A;  1NO3 A;  4OVM A;  4WWU C;  3MG3 A;  1IVV A;  2WOH A;  1N8R 4;  1IVW A;  2WOF A;  4HKV B;  4STD A;  1PU4 A;  5FGO A;  4LMI A;  1FGT A;  2P0X A;  3CCL 3;  3DZL A;  1VZZ A;  2IUK A;  3G16 A;  2GBW B;  2WGO A;  3JUP A;  3Q1C A;  4N6L A;  5IW9 A;  1ISK A;  5AIF A;  1Q86 4;  3FLJ A;  5CLK A;  4EC6 A;  3WOD G;  1JRQ A;  1YHQ 3;  1HKX A;  1DVC A;  1DMN A;  2HMJ B;  4MMZ B;  4ORL A;  1CEW I;  3MKI A;  2RGQ A;  3CC4 3;  4XBT A;  1TIJ A;  3GZY B;  1LVN A;  2E2T A;  1OGZ A;  4N6M A;  2CH9 A;  4H61 A;  4O8S A;  2O3O A;  1GS3 A;  2ML5 A;  3HK4 A;  3KFQ C;  3Q2P A;  3QK9 A;  1O7M B;  3LZA A;  1U5O A;  1SQW A;  3IMA B;  2XR8 B;  1GD3 A;  1W7C A;  1EKM A;  1D6Y A;  4IPB A;  1O7G B;  1Q40 B;  1Z1S A;  1KWI A;  5AIG A;  4XDW A;  3CC7 3;  2P38 A;  3CCM 3;  1QAF A;  4XM4 A;  1W01 A;  3BND A;  3F40 A;  3FH1 A;  3IJE B;  3KZT A;  5IG0 A;  1VQL 3;  3ECF A;  2IMJ A;  1IK3 A;  1FGQ A;  2Y74 A;  3EBT A;  1DVD A;  3HZP A;  2UX0 A;  3NBJ A;  3SVA A;  2V1L A;  3FSD A;  5KP4 A;  4CCV A;  3BNC A;  2JQ5 A;  5FW5 A;  2QIY A;  1W2Z A;  3X40 A;  1OHP A;  4U13 A;  4XBY A;  5IEO A;  2GU3 A;  2A15 A;  1Q7Y 4;  2WGQ A;  3F8H A;  1TFK A;  1JN5 B;  4R4K A;  1VQM 3;  3F7X A;  3CU3 A;  2CK3 H;  2O9U X;  1QAL A;  5G2G A;  3TDG A;  3KSE D;  1EA2 A;  3JUQ A;  4H3U A;  4N6N B;  4HM0 B;  4KFF A;  1OHO A;  3VGN A;  3OX9 A;  1Q81 4;  1K9M 4;  3PXM A;  8CHO A;  5CF1 A;  1HU9 A;  4EYC A;  4OK0 A;  1STF I;  3RGR A;  4AKY A;  3A76 A;  3UB1 A;  4LSO A;  1Q82 4;  2GU1 A;  3SED A;  2PNC A;  3UNL A;  3LT8 A;  3X3Y A;  3FF2 A;  1GY5 A;  4BTY A;  3CPW 2;  1Q42 A;  1GYB A;  4HM6 B;  4J9A A;  3U1W A;  3E99 A;  1NU3 A;  1N5H A;  4CDL A;  3LXU X;  4WYK B;  3EJV A;  4Q53 A;  2W56 B;  3LTD A;  4IT7 A;  3PCS A;  6STD A;  2INX A;  2OOV A;  4NRE A;  1W6C A;  1Q40 A;  2FGT A;  2W2C A;  3DM8 A;  3DXO A;  1AVK A;  1IVU A;  1K28 A;  3K9M C;  1FA3 A;  3EBY A;  1W2B 2;  1N8Q A;  2GEY A;  1VQ7 3;  1CYU A;  3B4O A;  5HGR A;  4MEI A;  4K90 B;  1US1 A;  2XSH B;  3HI7 A;  5LC7 A;  3CCQ 3;  2XGL A;  3V98 A;  3G6E 3;  3WDG B;  1O7N B;  3EB8 A;  1KC8 4;  1GY6 A;  2ZL8 A;  3QRD A;  1W6Y A;  1NDO B;  2Q07 A;  1YJN 3;  3DGO A;  1JN5 A;  1J2B A;  1SIH A;  1JJ2 2;  5EVH A;  5AI1 A;  2KCD A;  3H51 A;  5EQL A;  1RRH A;  3LYG A;  5I97 A;  2YX9 A;  3BLZ A;  4FCZ A;  3KE7 A;  3OV4 A;  2RFR A;  1LXE A;  5A0O B;  2Y73 A;  4JRF A;  5AIH A;  2HMO B;  2OCT A;  3BNE A;  3LOY A;  1JNQ A;  3MG1 A;  2CFW A;  4L8O A;  2CFG A;  5JPU A;  2WO0 A;  4KZ1 A;  3X3X A;  3LT9 A;  3MYT A;  2L4V A;  2W04 A;  5D83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...