4I5QA

Crystal structure and catalytic mechanism for peroplasmic disulfide-bond isomerase dsbc from salmonella enterica serovar typhimurium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
b'AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbC
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4i5qA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i5qA02
2C3NA 1GSFA 3IXRA 1ST9A 3HYPA 2H6YA 2AJQB 5G5EA 3FHKA 3DKSA 1GSUA 3QMXA 4L5LA 2H1BA 2GSSA 1XVWA 1PL1A 2VO4A 4HJMA 3C1SA 2I3YA 4O7HA 3IK7A 2IIYA 3H79A 1BQ7A 1V40A 2PVOC 2MMNA 3APOA 1SJZA 5GSSA 1B4PA 2IWTA 2DJ2A 2D2ZA 1LBKA 1OKTA 2F3MA 2ALBA 4MJBA 4MPFA 4N0VA 3ZVJD 3IPZA 3L9UA 1A0RP 5B7CA 4EDZA 2JZRA 1K0CA 2PN8A 1S3DA 3GN3A 2HE3A 5IMCA 3PR8A 5DDLA 5G31A 2BTOT 2L4CA 3H8QA 2N5FA 4PQ1A 1FG4A 1E2YA 4D73A 3A5WA 3I9V2 3RPPA 1N8JA 1DSBA 1AUCA 2GSRA 1HD2A 3DRNA 1DBYA 4MH3A 1PQNA 1JZRA 2C4JA 4FYUA 3UARA 2F8AA 3ZIVA 4V1Ap 3GYKA 1SJ6A 1GUKA 1K0MA 1OKDA 1XWKA 3QFBC 1GRXA 1SL1B 1GSEA 3GL5A 3UOMA 6GSXA 2VL3A 1FVJA 2H0IA 4TN8A 4K7OA 1WMJA 2IYJA 2FWGA 4IN0A 2H30A 1Y6EA 4DSRA 4AJ7A 1MDJA 2RIIA 4EL1A 2IJYA 2RLIA 1TU8A 1J08A 4JBBA 1TRVA 3HKRA 4G2EA 3WT1A 1S3CA 4XTSA 2LUSA 2CVKA 4OD7A 3D4TA 1ML6A 4PQHA 2H0GA 3P2AA 3IE3A 1FO5A 1X5CA 3Q19A 3FRCA 3BJ5A 3ZITA 2HNLA 2GDRA 4L5OA 1SD9A 2E2GA 4WF5A 3E9JB 1EEMA 3UIWA 2KUCA 4J2FA 2VL9A 1TOFA 6GSUA 1EOGA 4ZL7A 1EGOA 3DD3A 2LJRA 1BEDA 1YKAA 5DBQA 1OE8A 3EE2A 1YJ6A 4F03A 4AGSA 3IA1A 1FB0A 2H70A 4MZWA 2C0FA 1YQ1A 3TJFA 3KM6A 3DVXA 2KHPA 4NXIA 1GH2A 1WIKA 1TRSA 4GTUA 2OE0A 3F4SA 3RHCA 3F8UA 2XC2A 3TUEA 1BYEA 3U6VA 5J3RA 2CVDA 2XHFA 4IQAA 3QPMA 3ZZXA 6GSWA 1RQMA 4CHSA 3L78A 2FHEA 3LXZA 2VCQA 5DJMA 2E7PA 1QXHA 1A2LA 5ELGA 2A2RA 3IK9A 5GAND 2RM5A 12GSA 2K8VA 2VCXA 1OYJA 3M3MA 1XW6A 1AQWA 4ZILA 2DBCA 3VI7A 3TOUA 2N5AA 1FW1A 2IMEA 4NV5A 1G0TA 1HNCA 3DEXA 2HRFA 4ECJA 2H73A 5G2ZA 1XW9A 4O92A 3FZ5A 4KAEA 3TRPA 1DE1A 3LORA 4MF5A 3A2WA 4KCAA 1GSYA 1PA3A 5JCGA 1XPVA 4Z7XA 3UBLA 4MDCA 3F6DA 4ECIA 1T4YA 3G7JA 4ZB8A 1YEXA 1WP0A 3C71A 4ML1A 2OBIA 5CRGA 3CSJA 1TK5B 1NHOA 1IYIA 1MEKA 2AB6A 1LU4A 3TCOA 5IIZA 2OBKA 3TB2A 1VF2A 5LNKe 3CSIA 3O76A 3SWLA 3PH9A 2FD3A 4FYBA 3UVHA 5GSTA 2CX4A 5CRWA 2V41A 1TKDB 1S3AA 1T4ZA 1HYUA 4IP1A 3KGKA 2NBSA 4POMA 5EL8A 5FT3A 2H1AA 3Q74A 2PWJA 3EURA 2ZNMA 1PL2A 1GUMA 3O3TA 4YAPA 2ON7A 2H75A 3TKSA 4FO5A 4N0ZA 1TK0B 2KP2A 4NWYA 3KH7A 2MYGA 2YPMA 4GLTA 4F0BA 2X99A 4KDYA 2M46A 2LKUA 3GKMA 1OC9B 2R2JA 1JLWA 2V6KA 2GSTA 2H72A 4LL1B 2B5EA 2LQOA 5ECOB 3GRXA 5H5SA 5ID2B 2YZUA 5F8BA 2YZHA 1K3YA 4X1UA 1O7UA 2HSHA 1M2BA 2WZ9A 1O85A 2DIZA 4X0XA 3LEFA 1ERVA 4KDXA 4MLYA 2CT6A 1U87A 1T7PB 2V6OA 3F4RA 2JSZA 4JR4A 3RDWA 4NV2A 2FA8A 4AJ6A 3GSSA 4DSQA 2X8HA 2WB9A 2GZYA 3MWHA 2YP6A 2I9HA 4XS4B 1EOHA 1SJIA 5D9XA 3ZRDA 4OCEA 4KDUA 2O7KA 2H0HA 4TRXA 1JZWA 5JCUA 4K9ZA 4K7NA 4YQMA 2EIRA 4OCFA 3IAS2 2HZEB 2V1MA 4TR0A 3I6AA 1IYHA 3C1RA 3CTFA 3F9UA 4BVYA 4V2MA 4MZBA 2PERA 1QGVA 3DVWA 3NOFA 4POBA 1F3BA 3IDVA 4L0UA 1TI1A 2C0GA 5DQYA 5IMFA 3RPNA 3ZTLA 3VPQA 2VLTA 3FW2A 3EMPA 1TTZA 2HT9A 3CXGA 1M7TA 2WGRA 1A2JA 1FAAA 1K0DA 2A2SA 4K6XA 4EO3A 5ECNB 4DEJA 1R26A 2PUKC 4Q5QA 3NZNA 1K0AA 5LD0A 2L5OA 2LNTA 4GCIA 1EP7A 3GHAA 3VFIA 2PU9C 2JZTA 3DMLA 16GSA 1AAZA 3R2QA 2VCTA 3GSTA 3GUSA 4GSTA 2TIRA 4GXZA 5ECKB 5CP1A 3ED3A 3UL3A 3A3TA 4K0GA 1U3IA 4QL9A 5D9WA 3HDCA 2AAWA 1H4OA 1ERUA 3TRQA 4WBRD 5ENUA 4H86A 5IMVA 5IPHA 2R5GA 2M72A 2B7JA 4HZ2A 3FR9A 4ZXGA 5LCZA 1TXXA 1V2AA 4I2UA 5KN0A 4HS1A 1HNBA 5AGYA 17GSA 3UJ1A 3CTGA 4HEA2 1HQOA 1I5GA 5IO2A 1X9WB 3KJYA 2P5RA 5AIVA 3ZMKA 2PMTA 4ZIJA 5F07A 4GSNA 6GSSA 4IGJA 1WPIA 1GL8A 1M9AA 2K9FA 2K8SA 2VM1A 5F05A 3W8SA 4XRAA 4BA7A 3QCPA 1XZOA 2VLUA 1A8YA 1EZKA 2JADA 2C3TA 1KBNA 4K8MA 4FYCA 5L71A 3GTUA 1QK8A 7GSSA 4RQXA 3N5OA 3GNJA 4KA0A 1ZGNA 3D6IA 4EVMA 3LG6A 1PGTA 2DSAA 3KP8A 1TRUA 4TKYA 5KN1A 3IAM2 1ZCPA 2IFQB 4K2DA 4KCEA 2DLXA 2C0EA 2YN1A 4BWQA 1R7HA 3CMIA 1AXDA 3M1GA 3KP9A 4IQ1A 1B9YC 2B7KA 3ME8A 3P7XA 1SL0B 2AYTA 1PSQA 3BCIA 5EY6A 3EINA 3A2XA 5HQPA 3BOAA 1ILOA 2REMA 1X0RA 2JU5A 1GNEA 2NPBA 2QKEA 1JLVA 1Z7PA 5D9TA 3L0HA 2JSYA 1J9BA 2WJUA 2MBTA 3GFKA 2WFCA 5DQSA 1A24A 5B6NA 1BX9A 4HOJA 1M99A 2PGTA 2JZSA 14GSA 4V1Ag 2C3QA 3UVTA 4LLRA 2RM6A 1UA5A 4TR1A 2GS3A 3ISOA 5J9BA 5J4UA 2CVBA 2MZCA 2LRCA 4ECCA 1UVZA 1OC3A 2J9HA 3ERFA 1OC8A 4RQRA 4YQVA 3TKRA 4ZL9A 1M2AA 3P90A 3EYTA 1O6JA 2OADA 1VF3A 4ZL8A 2DJ1A 1R5PA 2WDUA 2GQKA 11GSA 3BD2A 1XWBA 5G1LA 2H6ZA 1TDIA 5D93A 4KSMA 3EU3A 4BWSA 1VF1A 1F2EA 2C0DA 3LGCA 2R6KA 3G7IA 3HY2A 1SKWB 4XS1A 2GT5A 1AC1A 5F06A 4BVXA 3VLNA 3HJMA 2YWIA 2H6XA 4EC0A 1PD21 2JACA 1NSWA 1ERTA 3JCML 4X43A 2HI7A 4OFNA 2H1GA 1F6MC 1ZOFA 1XOBA 3L9SA 5B8AA 4ECBA 1ZYEA 2IPAA 3GL3A 1AQXA 4OO4A 4E8EA 3GMFA 4O5RA 1K0BA 1Y25A 4I2TA 1GP1A 2LRNA 2L4QA 4POLA 3ZMLA 1CQGA 1I9DA 1MD3A 3DWVA 3WD6A 3FK8A 2IMFA 2WCIA 4RI6A 5C04A 5IMZA 4PX1A 1YZXA 1FVKA 2LJAA 4DSSA 1B8XA 1T1VA 5A4VA 1M2DA 4OMVA 2GZZA 3F3RA 5DALA 3DYRA 5ECRB 3UBKA 4MZCA 6GSTA 3TKSE 3F3QA 3HJPA 5FHIA 2GGTA 5CNWA 4GQCA 1OE7A 1WOUA 3ERWA 2G0FA 4E8HA 4IJIA 4AJ8A 1O81A 4QL7A 1XWCA 3ZVJA 4Q5RA 4JRRA 1FHEA 2O8VB 4WF4A 5A4UA 2TRCP 2OACA 3GX8A 3VWWA 4XHMA 1A0FA 19GSA 3BBYA 2A4VA 4ACSA 1KNGA 4POKA 2NDOA 5AN1A 2DMLA 2R37A 3HZ4A 3VPTA 4KE3A 2G2QA 1KTEA 4KSOA 1QQ2A 2IN3A 4QQ7A 6GSYA 3M8NA 3F4TA 4TXVA 5IQYA 5ECSA 2DJ3A 5H5RA 5EPFA 5J9CA 3J7Yk 5IMDA 5KEJA 2TRXA 4HDEA 4TXOA 2WS2A 4HU9A 1GLQA 1ACVA 2LEGA 4CW9A 5A4WA 1YY7A 4JR6A 3ZLPA 2AHEA 4OFMA 5HFKA 2F8FA 1XXUA 3F63A 5JWOB 2FUG2 3FY7A 3VWUA 4IW9A 5EVOA 2HZFA 3HVSA 2CZ3A 1SKRB 5JWRB 2LRTA 1B4QA 2CZ2A 2FY6A 5ECMB 2N5BA 5IPGA 2VAFA 1T3BA 2OKAA 4P3YB 1X5DA 4EUYA 3HJOA 4AF2A 4KNDA 5GZZB 1XCCA 3C7MA 2GQLA 2LSTA 4NPBA 3C8EA 3FEUA 4JE1A 3L4NA 1VGLA 2KP1A 4F9ZA 3GURA 1BG5A 2B3SA 4I8BA 2CV4A 3ZREA 1Z6MA 2FLSA 2I1UA 5J41A 2VOCA 3HHVA 1YF1A 5G5FA 3ZFLA 3FYGA 3GKKA 18GSA 2F9SA 1K0OA 2KLXA 1TRWA 2H8LA 4KH7A 4XCSA 1V98A 3KXOA 4LA1A 1Z5YE 20GSA 3MSZA 3VWXA 1F3AA 2L57A 2ZCTA 1E6BA 2FWEA 5IMAA 3KD0A 4RI7A 4FIWA 2IL3A 2GQMA 4OFTA 2DJJA 4PUAA 1FB6A 1HNAA 5DVBA 2R3XA 3FZAA 2B1KA 4LMWA 2I81A 3M0FA 5D73A 3IV4A 5HR3A 2X64A 4G10A 2M80A 1PX6A 2PVQA 1B48A 1Z9HA 3EWLA 3KCMA 4ZBAA 1EEJA 5CRHA 3TRXA 4MP4A 5G1KA 3APSA 2PBJA 4WXTA 1MDKA 2XPEA 3ERGA 5DJLA 2X8GA 1K3LA 5DAKA 4EKZA 4N11A 1PN9A 3TGZA 1N2AA 3N9JA 1QFNA 4XS4A 3LFLA 3M9JA 3LSZA 3H1NA 4JU5A 1ZYQB 1ZMAA 1XWAA 4MK3A 9GSSA 3GTUB 5D9VA 2HZEA 4GQFA 5KN2A 2BJXA 1FOVA 1KEBA 1QMVA 3D0ZA 2NTOA 1Z7RA 4WETA 3LXTA 4PQIA 1J0FA 3RHBA 1X9SB 4IELA 4I97A 5HFGA 1M0UA 4WEYA 1EP8A 2XBIA 1URMA 5HR1A 3PINA 2JL4A 3KMOA 2WULA 1Q4JA 2LV3A 1DE2A 3QOUA 1NM3A 2O85A 1WWJA 4NMUA 4D73B 1W4VA 5CRDA 3EC3A 2OE1A 4F82A 1GTBA 2ON5A 4BPYA 3TKSC 1JHBA 1U88A 1F9MA 1JZOA 4LMVA 1EV9A 2L6DA 3KTBA 2IMDA 5GAPD 2DJKA 3TJKA 4MJEA 1O8XA 4TR1B 1TU7A 2HXKA 2GTUA 2I4AA 1Z6NA 2FWHA 3RBTA 2LTKA 1A23A 4IVFA 4DVCA 2MBSA 4IP6A 3HVXA 2B1LA 5CYYA 3WGEA 4Q5FA 1TW9A 4HQZA 4EXJA 3IRAA 1M9BA 1R5AA 2QC7A 1X9MB 4TR3A 3HZ8A 2P5QA 4G19A 1USBA 3TKQA 4MCUA 1PMTA 1XW5A 3EU4A 2MMOA 3AY8A 2OE3A 3SBCA 3Q18A 3KZQA 3HCZA 5ELAA 4MA9A 4YH2A 1YKCA 2FCHA 1G7OA 1GNWA 1XOAA 1EV4A 3ZIJA 2LQQA 3OR5A 2AV4A 2C1YA 2CAIA 5AISA 4N10A 1T00A 2GZPA 1UN2A 1UC7A 2IY2A 1QUWA 2H74A 1PKWA 1PX7A 1OVNA 2VLVA 1ERWA 3UEMA 2VCZA 3GH9A 3D5JA 3KTLA 2L59A 1SYRA 4ISDA 4KX4A 2YANA 3CYNA 4IS0A 3E3EA 5ABRA 2B5XA 2K18A 4EF0A 4FH8A 4OWYA 3ME7A 3H4KA 1XVQA 1BJXA 1GTAA 2DJ0A 2FA4A 2IFQA 2XPDA 2L6CA 1MTCA 3A2VA 4XRDA 6GSVA 1ZZYA 3CRTA 5DCHA 5E59A 2VM2A 4WR4A 3D22A 3FZ9A 4ZBDA 4TOPA 2H76A 3VI5A 1SKSB 4DSSB 3EVIA 4WBJA 1RW1A 2H1DA 5ECPB 4XIHA 5DALB 1B9XC 3W6GA 4GSSA 5D8IA 3IC4A 3LYPA 2BMXA 4KUNA 3W8JA 1Q98A 4GRFA 2VL2C 1MD4A 2RUFA 4GF0A 4MJCA 5D96A 4EDYA 1XBSA 3DGQA 1MDIA 3WGXA 3GKNA 2OJLA 3F6FA 2ES7A 3FR6A 1ABAA 5HR2A 2WRTA 1OAZA 3RAZA 1TP9A 5COHA 4F2IA 3HA9A 4YAVA 2YNXA 4NHZA 4WKWA 2IMIA 4J57E 2LNSA 3QAVA 3TOTA 2HRNA 2OA7A 5IM9A 1JFUA 3E0UA 4MF7A 3F0IA 1TJDA 3J7Yb 2K6VA 4KB3A 2YJ7A 3TDGA 3IHQA 1SK2A 4IJ3A 1V9WA 2C8UA 1LJRA 3WGDA 3IBHA 2V32A 5ECQB 2H19A 1U6TA 4PUFC 5ECIB 4MH2A 4HJ2A 4XS6A 2HLSA 4TXOB 5F0GA 3US3A 2Z9SA 3DXBA 4YQUA 3GIXA 1ZL9A 2E2MA 5JCWA 3UMAA 3IOSA 1AQVA 1SENA 3I69A 2F51A 1G6YA 2YOIA 4OO5A 4G9HA 1SK1A 1PRXA 1THOA 3FKFA 3MAKA 3FZ4A 22GSA 4LL4B 4PGTA 1NHYA 4MMMA 3VK9A 4PNGA 3WT2A 3S9FA 3D4MA 4K0NA 3L9VA 1T8EB 5AIXA 2DC5A 1V57A 2VUPA 4V2NA 2YV9A 4MJAA 3GA4A 5JWQB 4ML6A 2J23A 2H01A 4I6XA 3GV1A 3QAWA 4HU7A 4MABA 4ID0A 1ON4A 3LWAA 5CAXA 4J56E 5DCGA 3KH9A 2CAQA 3KMNA 1DUGA 4JZQA 4PNFA 3TJGA 1GULA 2EIOA 2NVLA 3HVVA 2LS5A 5IOWA 2O87A 2MMZA 1WRYA 1O8WA 1EGRA 1V58A 2DMMA 3DIEA 2ZUPA 5HFIA 4KGIA 3TJBA 1H75A 2B6MA 3NIVA 4ULXA 2E0QA 1SK0A 4IHUA 4L8EA 5A5KA 4HI7A 1CQHA 2P31A 3TJJA 3LJRA 1JZDA 3EMXA 5FWGA 3C73A 2GSQA 2LJKA 4KW6A 3ZFBA 4ZB9A 2FGXA 2YWNA 1XWGA 2HSYA 5CO3A 3VURA 1WJKA 4NAXA 2YCDA 1VRSD 1A2MA 2EIQA 3LYKA 1GTUA 2VD0A 3MNGA 4PXOA 4WR5A 1SU9A 2IMKA 2VD1A 2R4VA 3M9KA 2X8CA 3VWVA 3BCKA 4L0WA 2YV7A 4NHWA 2GLRA 1G6WA 5E4WA 3P8WA 2QSIA 3ZYWA 5IO0A 3GH6A 4TR4A 2H66A 2L5LA 4BL7A 3KEBA 10GSA 2B5YA 4HQSA 1SD8A 4HUAA 1YEPA 3ZL5A 2MMAA 1O73A 1F37A 3O6TA 1AIUA 5C00A 5DAKB 3QR6A 3QD9A 3WYWA 2CQ9A 3G7YA 1RK4A 1WE0A 3HD5A 3MDKA 5ECHB 4TW5A 1AW9A 4ZB6A 4K1FA 4TVEA 2H71A 1GTIA 1TK8B 2DIYA 2CX3A 1GSDA 4Q5NA 2GT6A 2VCVA 2HFDA 13GSA 2YWMA 1THXA 4IBPA 2YJHA 1YF0A 5IOXA 5KN3A 1BAYA 1OC9A 3H93A 1SL2B 3KIJA 5H5QA 4F0CA 1K0NA 3I43A 5ID2A 3UAPA 2O89A 1PKZA 4PURA 5ECLB 3Q6OA 3D21A 2CA8A 1U3AA 2YWOA 4MF6A 1A8LA 3LQ7A 3GX0A 2XBQA 4K7IA 4V2LA 4MPGA 1GSQA 1VF4A 2V2GA 3IR4A 2VCWA 4ZBBA 1TI3A 3HXSA 1GLPA 5G30A 4JEDA 3QAGA 1NW2A 2C80A 2PPTA 5HR0A 4ILFA 1W89A 2RUEA 1Z3EA 2QGVA 3TKPA 3G9BA 1XIYA 5B6MA 3FR3A 3GKXA 4HZ4A 5J5NA 2FNOA 5B8BA 5INYA 4N30A 2FWFA 2GVPA 3PGTA 1SYXA 2HYXA 4CDOA 2AUVA 3CSHA 4IKHA 1EWXA 1GUHA 2KOKA 3APQA 8GSSA 4O32A 1YDKA 1R4WA 2EC4A 3V1WA 4I5QA 3K8NA 4GWRA 3CBUA 2VIMA 1G7EA 1GWCA 1X5EA 1GSSA 3QDNA 2VL2A 3QFAC 1K3OA 2P0GA 3CRUA 5CREA 3U5RE 1XFLA 4EE0A 4RUVA 1C72A
chains in the Genus database with same CATH superfamily
3F14A 3ALAA 2C3NA 1GSFA 3IXRA 1ST9A 3HYPA 2H6YA 2AJQB 3D5GA 3X42A 5G5EA 3SOAA 2CH9A 3FHKA 3DKSA 1GSUA 3QMXA 3GWRA 1ROVA 4L5LA 2H1BA 2GSSA 1XVWA 1PL1A 3NBJA 3L0RA 3S67A 2VO4A 1DMQA 1RDSA 4XBYA 4LYLB 4HJMA 1QVG2 3GZBA 4R1KA 3GSPA 3F7SA 3C1SA 1UGIA 2CFKA 2I3YA 1I2EA 4O7HA 3IK7A 1GOYA 2IIYA 3H79A 1YGEA 1BQ7A 3BNEA 1Q42A 1V40A 5G2GA 2PVOC 3QRDA 2MMNA 1OGXA 3SVAA 3APOA 1PY3A 1SJZA 5GSSA 3VSYA 1B4PA 2IWTA 4O5QA 1B2UA 1DMMA 3G16A 3D5IA 1ZO2A 2DJ2A 2CK3H 2D2ZA 2YFLB 1LBKA 1OKTA 2F3MA 2ALBA 4MJBA 4MPFA 4N0VA 3SOYA 1TTOA 3ZVJD 1BNEA 3IPZA 3L9UA 1D6UA 1A0RP 5B7CA 4EDZA 2JZRA 1K0CA 2PN8A 1S3DA 5HGRA 3GN3A 4TX4A 2HE3A 3BIRA 4X4JA 5IMCA 3PR8A 2R0PA 5DDLA 5G31A 2BTOT 2L4CA 1N8QA 2GU3A 3LTBA 3HK4A 3H8QA 3K0ZA 1RRLA 2N5FA 1STFI 4PQ1A 1FG4A 1E2YA 4D73A 1LOWA 3A5WA 3I9V2 3RPPA 1N8JA 1DSBA 1AUCA 2GSRA 1VQ83 1HD2A 3DRNA 5KP4A 1DBYA 4MH3A 3CPOA 1PQNA 1JZRA 2C4JA 4FYUA 1J2BA 3N9HA 3UARA 3DZLA 2F8AA 1HZ1A 1YJW3 4XB5A 1E97A 1KC84 3ZIVA 2QGUA 4V1Ap 3GYKA 1SJ6A 2ML5A 3DMCA 1GUKA 1K0MA 1OKDA 1XWKA 3IHGA 3QFBC 1GRXA 3WA3A 1DE3A 1SL1B 1RLSA 4RZMA 2W04A 2GSPA 1GSEA 3GL5A 3UOMA 6GSXA 2VL3A 1FVJA 2H0IA 4TN8A 1RTUA 2CWVA 4K7OA 1RGKA 1EG9B 1WMJA 3O8YA 2IYJA 2FWGA 1E3VA 4IN0A 1DETA 2H30A 1Y6EA 2HMMB 1JBTA 4N6MA 4DSRA 4AJ7A 1MDJA 2RIIA 4EL1A 2IJYA 2RLIA 1TU8A 1J08A 4HM4B 4JBBA 1TRVA 3HKRA 4G2EA 1IDPA 3WT1A 1F8NA 1S3CA 4XTSA 2LUSA 1X1XA 2CVKA 4OD7A 3D4TA 1ML6A 4PQHA 2H0GA 3P2AA 4X2OA 3IE3A 1BIRA 1FO5A 3CCE3 1X5CA 3Q19A 1O7MB 3FRCA 1JKGB 3BJ5A 3ZITA 4HYZA 2HNLA 2GDRA 5AIHA 1OGZA 4L5OA 1SD9A 1RN4A 2INXA 5AYSC 2E2GA 4WF5A 3LXUX 2HMKB 4MJDA 3RNTA 3E9JB 1CH0A 1BNFA 2HMNB 3CD63 3LW9A 1JB4A 1EEMA 3UIWA 2KUCA 4J2FA 2VL9A 1TOFA 1NB3I 6GSUA 2KF3A 4KVHA 1EOGA 4ZL7A 1EGOA 5IG4A 3DD3A 2LJRA 4O5UA 1BEDA 1YKAA 1OHPA 5DBQA 1OE8A 3EE2A 6STDA 2XR8B 1YJ6A 2KCDA 4EBGA 4F03A 4AGSA 3IA1A 1FB0A 2H70A 3K63A 4MZWA 1C7HA 2I9WA 2C0FA 2RNTA 2R4IA 1YQ1A 1VQN3 3B4OA 4MMYB 3TJFA 3KM6A 3DVXA 2KHPA 1E3RA 4NXIA 1GH2A 5CK6A 1US1A 2Y73A 1WIKA 1TRSA 2GU1A 2OE0A 4GTUA 3F4SA 1TIJA 3MKIA 4DKIA 1PU4A 3RHCA 3F8UA 2XC2A 3TUEA 1BYEA 3CPW2 3U6VA 5J3RA 2CVDA 2XHFA 4IQAA 2F5WA 3HIGA 2KF5A 3QPMA 2CX0A 3ZZXA 6GSWA 1RQMA 4CHSA 3L78A 2FHEA 3ZG0A 3DH2A 1VQ53 2D1WA 4O02B 2C11A 3LXZA 2VCQA 2F98A 5DJMA 4K61A 2E7PA 2F56A 4EW5A 1QXHA 1ZX2A 1A2LA 5RNTA 5ELGA 2A2RA 3IK9A 5GAND 2RM5A 3EJVA 12GSA 2K8VA 4N6LA 2VCXA 1OYJA 2SBLA 4O8SA 3M3MA 4STDA 1XW6A 1AQWA 4ZILA 2DBCA 3CQFA 3VI7A 3TOUA 2N5AA 1FW1A 2IMEA 3NM7A 4NV5A 1IYYA 1G0TA 1MWTA 1HNCA 3DEXA 2HRFA 4X2HA 2V1LA 4ECJA 3DGYA 2H73A 3KE7A 3F8XA 5G2ZA 7RNTA 1XW9A 4O92A 3FZ5A 4KAEA 3TRPA 3PCSA 1DE1A 3LORA 4HM8B 4MF5A 2CFLA 3NX0A 3ER7A 1GYBA 3CCL3 3A2WA 4KCAA 1GSYA 1PA3A 5JCGA 1JRQA 1XPVA 4BTYA 4Z7XA 1FGTA 4MDCA 3UBLA 3M8CA 3F6DA 2P0MA 2LYXA 2CKFB 4ECIA 3MPHA 1O7NB 3X40A 1T4YA 3G7JA 4ZB8A 1YEXA 4J9AA 4G0KA 1SJWA 3V99A 1WP0A 1IVXA 1WMOA 1O7PB 1XG8A 3C71A 2HMLB 4ML1A 2OBIA 4EV2A 5CRGA 1SIIA 4CCVA 3CSJA 1TK5B 1IYIA 1NHOA 1MEKA 2AB6A 1IVUA 1LU4A 3EHCA 3TCOA 2R41A 5IIZA 1EA2A 3PYJA 2OBKA 3G713 3TB2A 1VF2A 4BL7B 5LNKe 3CSIA 1BNSA 1YVBI 1M3JA 3O76A 3MG3A 3SWLA 3PH9A 2FD3A 4FYBA 3UVHA 2JQ5A 3FF0A 5GSTA 2FXTA 2CX4A 5CRWA 5AIIA 2V41A 1TKDB 1S3AA 1T4ZA 1HYUA 4IP1A 3KGKA 3F8HA 2NBSA 4POMA 5EL8A 1GOVA 5FT3A 2H1AA 3Q74A 2PWJA 3UL5A 3EURA 2ZNMA 1PL2A 1GUMA 1Q864 3O3TA 4YAPA 2UGIA 1BRSA 4WYKA 3KSED 4HM0B 2ON7A 2H75A 2AAEA 2BMRB 3TKSA 1FGRA 4FO5A 1YIJ3 4N0ZA 3NBBA 1TK0B 3LOYA 3WR2A 2KP2A 4NWYA 3KH7A 2MYGA 2YPMA 4GLTA 4F0BA 2X99A 2YFIB 4KDYA 2M46A 3CC43 2CX1A 3FZWA 3VF1A 1HKXA 4RBNA 2LKUA 3GKMA 2RCDA 1ULIB 1OC9B 2R2JA 1JLWA 2V6KA 2GSTA 2H72A 4LL1B 2B5EA 2LQOA 2UX0A 5ECOB 3GRXA 5H5SA 5ID2B 3BLZA 5BU4A 2YZUA 4N6TA 5F8BA 2W9QA 3STDA 2YZHA 1K3YA 1RGAA 3PZWA 1LNIA 4X1UA 1O7UA 2CFWA 1AR0A 1M2BA 2HSHA 2WZ9A 1O85A 1Q7HA 2DIZA 4X0XA 5D81A 3LEFA 1ERVA 4KDXA 4MLYA 1N9JA 3OWYA 2CT6A 1U87A 1T7PB 2V6OA 3F4RA 2JSZA 2PNCA 4JR4A 3RDWA 4NV2A 2FA8A 1TFOA 4AJ6A 1SARA 3GSSA 4DSQA 1RGHA 2X8HA 2WB9A 2GZYA 3MWHA 2YP6A 2I9HA 4XS4B 5DRVA 1EOHA 1SJIA 3FF2A 2XRXB 5LC7A 5D9XA 3ZRDA 4OCEA 4KDUA 2O7KA 3LH4A 2H0HA 4TRXA 1BNRA 5BXQA 1JZWA 5JCUA 4K9ZA 2LQVA 3EPTA 2RBIA 2E2VA 4K7NA 4YQMA 4MNNA 2EIRA 4G0LA 4OCFA 3IAS2 2HSMA 1OHSA 2HZEB 2V1MA 5ELJA 4TR0A 3I6AA 4HSCX 3AMOB 1IYHA 3C1RA 3CTFA 3F9UA 4BVYA 1GY7A 4V2MA 4MZBA 2PERA 1QGVA 3EBTA 4FQUA 1QJGA 3DVWA 3NOFA 1TP6A 4POBA 1F3BA 1OUNA 2BMQB 3IDVA 4LZIA 4L0UA 3CCJ3 3LTCA 1TI1A 1JV2B 3H3HA 2C0GA 5DQYA 2Q07A 3I0YA 5IMFA 2D42A 4FMDA 3RPNA 3ZTLA 4R4KA 3PCRA 2RSXA 3VPQA 2VLTA 3FW2A 3N8BA 2R0CA 3EMPA 1TTZA 2HT9A 3CXGA 3J7Yd 2CFGA 3BNDA 1M7TA 2WGRA 2BU4A 1A2JA 1FAAA 1K0DA 2A2SA 3BNBA 1GSPA 1W01A 4R80A 4K6XA 5ECNB 4DEJA 4EO3A 1R26A 2PUKC 2B24B 5M19A 2HRKA 3KFQC 4Q5QA 3NZNA 4ORLA 1K0AA 5LD0A 1K734 3OXAA 4EV5A 2L5OA 1B3SA 3KN4A 2LNTA 4GCIA 1X1WA 1S5AA 3ZFZA 1EP7A 3GHAA 5KOXA 2OOVA 3VFIA 2PU9C 2JZTA 1OF5A 16GSA 1AAZA 4EXRA 3DMLA 3R2QA 2VCTA 3GSTA 3GUSA 4GSTA 2TIRA 4GXZA 1FUSA 5ECKB 5CP1A 3LTAA 2R0GA 3ED3A 3HVNA 3UL3A 4ZM8A 3A3TA 4K0GA 1BANA 4J5GA 1U3IA 1OH0A 2W56A 2IA7A 4USSA 4QL9A 5D9WA 2BT3A 2F5MA 3HDCA 2AAWA 1H4OA 1CEWI 1QMAA 3MG2A 4ICYA 1ERUA 3OV4A 3TRQA 4WBRD 1EKMA 5ENUA 4H86A 5IMVA 5IPHA 2XSHB 4FMCA 2R5GA 2M72A 2B7JA 1UUWB 4HZ2A 3AGNA 3FR9A 1GD3A 4ZXGA 5LCZA 1VZZA 1TXXA 2J8XB 1V2AA 4K5SA 4I2UA 1UGHI 5KN0A 3OW22 4KZ1A 1HNBA 17GSA 4HS1A 5AGYA 3UJ1A 3LMLA 3CTGA 3D9RA 4HEA2 1BOXA 1HQOA 1I5GA 4AKYA 1A2KA 5IO2A 1X9WB 3T8UA 3KJYA 3NXJA 2P5RA 2E2UA 5AIVA 3ZMKA 4BU4A 2PMTA 4ZIJA 5F07A 4GSNA 1VQ73 6GSSA 4IGJA 1WPIA 1GL8A 4BL2A 1M9AA 1BSAA 2K9FA 2K8SA 1YHQ3 2VM1A 3UL6A 5F05A 3W8SA 4XRAA 3DY5A 4BA7A 3QCPA 1XZOA 2VLUA 1DYUA 1A8YA 1EZKA 1MWSA 2JADA 2C3TA 1KBNA 1WMPA 4K8MA 3NQZA 3FG1A 4LEHA 1VQP3 4FYCA 5L71A 1KQS2 3JUNA 1JN5B 3GTUA 1B2ZA 1QK8A 2YFJB 3K9MC 4RQXA 7GSSA 1VQ93 3N5OA 1FGOA 3IMAB 3MG1A 3GNJA 4KA0A 1I0XA 1ZGNA 1RGFA 3D6IA 4EVMA 1B21A 1DVDA 5D82A 1BAOA 3LG6A 1PGTA 2DSAA 3KP8A 1TRUA 4TKYA 5KN1A 1BRIA 3GZYB 3IAM2 4FCZA 1HU9A 2QIYA 3RDEA 1ZYPA 1ZCPA 3PGBA 2IFQB 4K2DA 4KCEA 2DLXA 1BSBA 2W9PA 2C0EA 2YN1A 1QAKA 2BHMA 4BWQA 1R7HA 5STDA 3CMIA 1D6ZA 1QALA 1AXDA 3NM2A 3KP9A 3NHXA 4HOHA 1B9YC 4RNZA 3M1GA 4IQ1A 2B7KA 3ME8A 3P7XA 1SL0B 1UCIA 2AYTA 1PSQA 1AVLA 3BCIA 5EY6A 3EINA 3A2XA 5HQPA 5KP3A 3BOAA 1ILOA 2REMA 1X0RA 5AEWB 1GNEA 2JU5A 2NPBA 2QKEA 1JLVA 3HIIA 1Z7PA 5D9TA 4K90B 1W5ZA 3L0HA 2JSYA 1J9BA 2WJUA 3F40A 2MBTA 1KWIA 3GFKA 1M3IA 2WFCA 1GMQA 2W0QA 5DQSA 1RCLA 1A24A 3AHSA 5AEUB 5B6NA 1BX9A 2HOHA 4HOJA 1M99A 2PGTA 2JZSA 14GSA 4V1Ag 2C3QA 1LQGC 4KT3B 1R4YA 1Z1SA 3UVTA 1PFPA 1STDA 3OX9A 4LLRA 2RM6A 1UA5A 4TR1A 1PFOA 2GS3A 1VQQA 3ISOA 5J9BA 1M1K4 1OHOA 2ZHXB 5J4UA 1JB2A 5EVHA 2CVBA 2MZCA 1OACA 2LRCA 3NV0A 4ECCA 1UVZA 1OC3A 2J9HA 2Y74A 3ERFA 3HX8A 5HOHA 1OC8A 4RQRA 2WO0A 3TKRA 4YQVA 4ZL9A 2KXGA 1WMNA 1FGMA 1M2AA 3P90A 3FCSB 1S3RA 3JUMA 3EYTA 1O6JA 2OADA 5FGOA 1VF3A 3X41A 1O7HB 4MMXB 4ZL8A 2DJ1A 4L8OA 1R5PA 2WDUA 2W03A 2GQKA 3FSDA 2F4YA 3BD2A 11GSA 1XWBA 2Z6BA 1B2MA 5G1LA 1OPYA 2H6ZA 1TDIA 5D93A 1I70A 4KSMA 3EU3A 3KCHA 4BWSA 5IF6A 1VF1A 1F2EA 1GMRA 2C0DA 4WFOA 3LGCA 2R6KA 1RGLA 3G7IA 3HY2A 1SKWB 1IV7A 5JPPA 4XS1A 2GT5A 1AC1A 5F06A 4BVXA 3VLNA 3HJMA 2Z77A 2YWIA 1IT8A 2H6XA 4EC0A 1PD21 1BRGA 2JACA 3GZRA 1NSWA 1W4NA 4HM1B 2W2CA 1ERTA 3JCML 4X43A 2HI7A 3AHWA 4OFNA 5BVBA 1CYUA 2H1GA 3CNXA 1F6MC 1ZOFA 1XOBA 3L9SA 5B8AA 5CF2A 3WMDA 4ECBA 4MMZB 3D4AA 1ZYEA 2IPAA 5KOWA 1BRNL 1MOLA 3GL3A 5BMUA 3X3ZA 1AQXA 4OO4A 4E8EA 3GMFA 4O5RA 1K0BA 1Y25A 4I2TA 1GP1A 1AY7A 2LRNA 4GSPA 5IW9A 2L4QA 4K2XA 4POLA 1RGEA 3ZMLA 1CQGA 1I9DA 1MD3A 3DWVA 3WD6A 3FK8A 2IMFA 2WCIA 3FMWA 4HM7B 4XDWA 4RI6A 5C04A 5IMZA 4HZ9B 4PX1A 4Z2UA 1YZXA 2BMOB 4G1MB 2JDIH 4CJNA 1GMPA 3SLUA 4OVMA 3H51A 3CME3 1FVKA 4BIRA 3EB8A 4EC6A 2LJAA 4DSSA 1B8XA 1T1VA 5A4VA 1M2DA 1HYFA 4OMVA 2GZZA 3F3RA 1K41A 3K7CA 5DALA 2Z7AA 3DYRA 5JPUA 1LXEA 5ECRB 3UBKA 4MZCA 6GSTA 3EF8A 1MWRA 3TKSE 3F3QA 3HJPA 5FHIA 2GGTA 4GQCA 5CNWA 4Z2TA 1OE7A 2C10A 2FGTA 1WOUA 4R9KA 3ERWA 2G0FA 4E8HA 4YKFA 4IJIA 4HM2B 3KSPA 4AJ8A 1O81A 1XWCA 4QL7A 3DGNA 1SQWA 3UNLA 3ZVJA 4Q5RA 4JRRA 3MWZA 1UCJA 1FHEA 2P05A 1K28A 2O8VB 4WF4A 5A4UA 3A76A 2TRCP 3LYGA 2OACA 3GX8A 3VWWA 4XHMA 1A0FA 1LOXA 8RNTA 19GSA 3BBYA 2A4VA 1BSDA 4ACSA 1KNGA 4POKA 2NDOA 3HI7A 2DMLA 2R37A 3HZ4A 5AN1A 2BIRA 3VPTA 4KE3A 1W6GA 3Q2PA 2G2QA 1MGRA 1KTEA 1TFKA 4KSOA 1QQ2A 3K5TA 2IN3A 4QQ7A 3M8NA 6GSYA 3F4TA 4TXVA 1ROAA 5IQYA 4HZBB 5ECSA 2GBWB 2DJ3A 5H5RA 2L4VA 5EPFA 3E99A 4N3VA 5J9CA 3J7Yk 5IMDA 5KEJA 4HM5B 1UUGB 2TRXA 4HDEA 1K8A4 4TXOA 4HKVB 2WS2A 2XF3A 4HU9A 1GLQA 2ZDJA 2K3DA 3KIIA 1ACVA 2LEGA 4CW9A 5A4WA 1YY7A 4JR6A 1IQXA 3JVCA 3ZLPA 1RSNA 1I3IA 2AHEA 2XGNA 4OFMA 5HFKA 4EYCA 3ZG5A 1XXUA 2F8FA 3F63A 1B27A 5JWOB 3DGOA 2FUG2 3FY7A 3VWUA 4IW9A 1JNQA 3CCS3 4BIKA 3WOFB 1FZUA 5EVOA 2HZFA 1BSCA 2XFSA 2OQEC 3HVSA 2CZ3A 2CWTA 1SKRB 1Q40B 1TRQA 3RGAA 1AV4A 5JWRB 2LRTA 3GAXA 1B4QA 2CZ2A 1BNJA 2P0XA 2STDA 2FY6A 3FH1A 3IC8A 4L8PA 5ECMB 2N5BA 5IPGA 2OCTA 2VAFA 1T3BA 2OKAA 4P3YB 1X5DA 4EUYA 1OCVA 4FCJA 5BIRA 3HJOA 4AF2A 2CG1A 4KNDA 5GZZB 1XCCA 3C7MA 4LMIA 1LVNA 2GQLA 2LSTA 4NPBA 1I2GA 4RNYA 2QA1A 3C8EA 3FEUA 4JE1A 3MYTA 3L4NA 1NWWA 1VGLA 2KP1A 4BVYB 4F9ZA 3GURA 1UCLA 1DVCA 3FG4A 1VQ43 4N6UA 1BG5A 2B3SA 2CW9A 4HM6B 4I8BA 2CV4A 3ZREA 3IPTA 1Z6MA 2FLSA 2I1UA 5J41A 1KD14 2VOCA 3HHVA 1YF1A 3CCR3 5G5FA 1A2PA 3ZFLA 1UDII 4IT7A 3FYGA 1FA3A 3GKKA 18GSA 2CIUA 4MEIA 2F9SA 1RN7A 1K0OA 2KLXA 2HRAA 3LT8A 1RGGA 1TRWA 1TUHA 2H8LA 3MHEA 3S5CA 4KH7A 4XCSA 1V98A 3KXOA 4LA1A 1FUWA 1Z5YE 1VQM3 20GSA 3MSZA 1M1XB 1WQLB 1PYLA 3VWXA 1F3AA 2L57A 7STDA 1G96A 2ZCTA 1E6BA 1BUJA 4GL6A 2FWEA 5CXOA 8CHOA 1MWUA 3KD0A 4RI7A 5IMAA 1OF5B 4GHOA 4FIWA 2IL3A 2GQMA 3CU3A 1UI8A 3CXC2 4Q53A 1VQ63 4YKGA 3I553 4K1VA 4OFTA 2DJJA 4PUAA 4EIPA 3G8ZA 1FB6A 1HNAA 5DVBA 2MF7A 2R3XA 4R9LA 2Z76A 1MGWA 3FZAA 4CY8A 2B1KA 2OWPA 3B8LA 4LMWA 2I81A 3M0FA 5D73A 3IV4A 2GXFA 4HM3B 5HR3A 1N9EA 2X64A 4G10A 2M80A 2QEX3 1PX6A 3SX1A 2PVQA 3DUKA 2WGQA 1B48A 1Z9HA 3EWLA 1V74A 3KCMA 1LRAA 4ZBAA 1EEJA 5CRHA 3TRXA 4MP4A 5G1KA 3APSA 2PBJA 4WXTA 2WOFA 1MDKA 1W6YA 4N6V0 2XPEA 3G4S3 3ERGA 4K5RA 5DJLA 2X8GA 5AIGA 3PPUA 1K3LA 5DAKA 4EKZA 4N11A 1PN9A 4J8TA 3TGZA 5BRTA 1N2AA 3N9JA 4LSOA 5IEOA 2QA2A 2HMOB 1YI23 3D79A 1RGCA 3V98A 1QFNA 2MC8A 1M9GA 1EUIC 4XS4A 3LFLA 5IG5A 3M9JA 4HAAA 2P38A 3LSZA 3H1NA 1VQO3 4JU5A 1ZYQB 1ZMAA 1XWAA 5JBSA 4MK3A 9GSSA 3GTUB 2ZL8A 1NDOB 2IMJA 2IUKA 5D9VA 2HZEA 2UZ8A 4GQFA 1ULJB 3B4PA 5KN2A 2BJXA 1WNHA 1FOVA 3AMOA 1KEBA 1QMVA 3D0ZA 2NTOA 3A5IA 1Z7RA 4WETA 1ZS7A 3LXTA 4PQIA 4OK0A 3JUOA 1J0FA 3RHBA 1X9SB 1UCKA 4IELA 1W00A 4I97A 5HFGA 1M0UA 2CWUA 4WEYA 1EP8A 2GEYA 2XBIA 1URMA 5HR1A 3URPA 5ELUA 2AADA 3JUQA 3PINA 3S29A 2JL4A 1BRKA 3KMOA 2WULA 1Q4JA 2LV3A 1DE2A 3QOUA 1NM3A 2O85A 1WWJA 4NMUA 3EN1B 4D73B 2XH9A 1W4VA 1PN0A 3I563 3ECFA 3EC3A 5CRDA 2OE1A 4F82A 1GTBA 1O7WB 3T8NA 1UI7A 2ON5A 4BPYA 1Y4KA 3TKSC 1JHBA 1U88A 1F9MA 1JZOA 4LMVA 1EV9A 3CCM3 2L6DA 1GY6A 2YX9A 1EQKA 3KTBA 1LOVA 2IMDA 5GAPD 3WA2X 1UUVB 4HJLB 2DJKA 3NBRA 2GBXB 3TJKA 1M904 4MJEA 3BNCA 1O8XA 4TR1B 2X4AA 3Q3FA 1N5HA 1TU7A 3B7CA 3RGRA 2HXKA 2GTUA 2I4AA 1Z6NA 2IUJA 3DXOA 2FWHA 3NV0B 4OUQA 3RBTA 3G0KA 1BNGA 2LTKA 1A23A 4IVFA 4DVCA 2QA43 2MBSA 4IP6A 3HVXA 2B1LA 5CYYA 3WGEA 3WHOA 1FOHA 4Q5FA 1TW9A 2BO9B 4HQZA 4EXJA 3IRAA 1M9BA 1R5AA 2QC7A 5AYRB 3OWUA 1I2FA 1X9MB 4I4KA 4TR3A 3MIXA 3HZ8A 2P5QA 4G19A 3FGYA 1USBA 3TKQA 4MCUA 3BB9A 1PMTA 1XW5A 3EU4A 3UB1A 2MMOA 1RRHA 3AY8A 2OE3A 3SBCA 1X1YA 1BGSA 9RNTA 3KZQA 3Q18A 3HCZA 5DREA 3SEDA 5ELAA 4MA9A 4YH2A 1IU7A 3S28A 3CCQ3 1YKCA 2FCHA 1G7OA 1GNWA 1XOAA 1EV4A 3ZIJA 1FGQA 2LQQA 3OR5A 3F9SA 2AV4A 1A2VA 2C1YA 5GSPA 2CAIA 5AISA 4N10A 1RHLA 3EQQB 1T00A 2GZPA 1UN2A 3HZPA 4BVXB 1UC7A 4NHFA 2IY2A 1QUWA 2H74A 1LQMB 4BTWA 1PKWA 1IQYA 1YIT3 1PX7A 1IV9A 1OVNA 1ZGXA 5IG0A 2VLVA 1ERWA 2L1SA 3UEMA 2VCZA 3GH9A 1JN5A 4AEQA 3D5JA 3KTLA 2L59A 1SYRA 4ISDA 4KX4A 1Q9EA 2YANA 3CYNA 3PXMA 4IS0A 3E3EA 5ABRA 2A15A 2B5XA 2K18A 2XGLA 1BRJA 4EF0A 4FH8A 4OWYA 2F86B 2ML6A 5IERA 1K9M4 3ME7A 3T0UA 3H4KA 2UUGC 1XVQA 4EIQA 1BJXA 1GTAA 2DJ0A 2O3OA 2FA4A 2IFQA 2XPDA 2L6CA 1MTCA 4H3UA 3A2VA 2KF4A 4XRDA 6GSVA 1ZZYA 3CRTA 5DCHA 5E59A 3WOEB 2E2TA 5M1AA 2OQEA 1RNBA 2VM2A 4WR4A 3CNMA 2CC3A 3D22A 3FZ9A 4ZBDA 4TOPA 4PEJA 3WODG 2H76A 1CYVA 3VI5A 1I0VA 2OOVC 4CDLA 1SKSB 4DSSB 3EVIA 1MNLA 4WBJA 1RW1A 2H1DA 2RGQA 4AKZA 5ECPB 1AVKA 1CQSA 3BU4A 4XIHA 5DALB 1B9XC 1I8VA 3W6GA 4QWTA 4GSSA 5D8IA 2RFRA 3IC4A 4WWUC 5LC6A 1NO3A 1NB5I 3LYPA 2BMXA 1JBSA 1VQK3 3FKAA 4KUNA 3W8JA 1Q98A 4GRFA 1AQZA 2VL2C 2KF6A 1MD4A 3R3EA 1S723 2RUFA 1ZYNA 4GF0A 4MJCA 5D96A 4EDYA 2ZA4A 1XBSA 3DGQA 4KFFA 1MDIA 3WGXA 1BRHA 1KSIA 3GKNA 1RMSA 2OJLA 3F6FA 2ES7A 3FR6A 1ABAA 5HR2A 2WRTA 1OAZA 3RAZA 1TP9A 5COHA 1NU3A 4F2IA 3HA9A 4YAVA 2YNXA 3FLJA 1YJ93 4NHZA 4WKWA 2IMIA 4J57E 1ISKA 3Q1CA 2LNSA 3QAVA 3TOTA 4BTXA 1T5YA 5I97A 2HRNA 2OA7A 3V92A 5IENA 4XDVA 5IM9A 1JFUA 1RJOA 3E0UA 4MF7A 2B1XB 3F0IA 1TJDA 1FYSA 3J7Yb 2K6VA 4XBTA 4KB3A 2YJ7A 3TDGA 3IHQA 4Z2RA 1SK2A 4IJ3A 1V9WA 2C8UA 3WDGB 1LJRA 3IBHA 3WGDA 2V32A 5ECQB 2H19A 1U6TA 2K54A 4PUFC 5ECIB 4MH2A 1IQ8A 4HJ2A 4XS6A 2FNQA 2HLSA 4KF9A 4TXOB 5F0GA 1JKGA 4L7KA 1W2ZA 3US3A 5EQLA 2Z9SA 1GD4A 3DXBA 4YQUA 3LZAA 3GIXA 1ZL9A 2E2MA 5JCWA 3UMAA 1LOYA 1AQVA 3IOSA 1SENA 5TGNA 1T2IA 1UW1A 3I69A 2F51A 1G6YA 2YOIA 4OO5A 4NREA 4G9HA 1SK1A 1PRXA 1B20A 5FW5A 1THOA 1O7GB 3FKFA 3MAKA 3CC73 3FZ4A 22GSA 1W2B2 2DKIA 4LL4B 2OTL3 4PGTA 1NHYA 3G6E3 3CCU3 4MMMA 3VK9A 4PNGA 3WT2A 3SXXA 3EN8A 3S9FA 3D4MA 4K0NA 3L9VA 1T8EB 5AIXA 2DC5A 1V57A 2VUPA 4V2NA 1DMNA 2YV9A 4WYKB 3EC9A 2C4BA 3GA4A 4MJAA 3GRDA 1I3FA 1U8CB 5JWQB 4CY6A 4ML6A 3LT9A 3DGLA 3SYUA 1VQL3 2J23A 2H01A 4I6XA 3GV1A 3QAWA 4HU7A 4MABA 4ID0A 2HMJB 2CHCA 1ON4A 3LWAA 5CAXA 4J56E 1W02A 5DCGA 3F7XA 1TU5A 3KH9A 2GEXA 3U97A 2CAQA 3KMNA 1RKYA 1DUGA 4JZQA 4PNFA 3TJGA 1NNVA 1GULA 3PS8A 2EIOA 1NJI4 2NVLA 3HVVA 4GB5A 5A0OB 2LS5A 5IOWA 1IT7A 4G0IA 1X1UA 6RNTA 2O87A 2MMZA 4JF8A 1WRYA 1O8WA 1EGRA 1V58A 1L5GB 2DMMA 4LGQA 3DIEA 2ZUPA 2KRTA 4IIAA 5HFIA 4BL3A 4N6OB 4KGIA 2KAAA 4U13A 1SPUA 3TJBA 1H75A 2X49A 2F99A 2B6MA 1R4CA 5AI1A 3NIVA 4ULXA 2E0QA 1SK0A 4IHUA 4L8EA 5A5KA 4HI7A 1CQHA 2P31A 3TJJA 3LJRA 1JZDA 3EMXA 5FWGA 3C73A 2GSQA 1G02A 2M7OA 2LJKA 4KW6A 3ZFBA 4ZB9A 2FGXA 2YWNA 1XWGA 2HSYA 2O9UX 3NQYA 1YJN3 1B2SA 5CO3A 4O3VA 4FCMA 3VURA 1WJKA 4NAXA 4FMBA 5M18A 2YCDA 1VRSD 1A2MA 2EIQA 3LYKA 1GTUA 2VD0A 3MNGA 4PXOA 3KZTA 4WR5A 3OWSA 1SU9A 2IMKA 2VD1A 2A4HA 2R4VA 1GS3A 3M9KA 2X8CA 3VWVA 3KKGA 4FR9A 4N6NB 2XSOB 3BCKA 4L0WA 1IK3A 2YV7A 4NHWA 2GLRA 4H61A 1G6WA 1YNVX 5E4WA 3AGOA 4WP5A 3P8WA 1T2HA 2QSIA 3MYDA 3ZYWA 5IO0A 1IVVA 3GH6A 5EEOA 4KFEA 3D3LA 4TR4A 2H66A 2L5LA 4BL7A 3KEBA 10GSA 2B5YA 4HQSA 2CG0A 3QK9A 1SD8A 1Q824 4HUAA 4CPKA 4PTSA 1YEPA 3ZL5A 4RNTA 2MMAA 1O73A 3CC23 3X3YA 4FMAA 1F37A 3MSOA 1BNIA 4XM4A 1JJ22 1AIUA 3O6TA 5C00A 5DAKB 3QR6A 1QAFA 3QD9A 3WYWA 2CQ9A 1C54A 1RK4A 3G7YA 1WE0A 3HD5A 1A90A 3MDKA 7GSPA 5AIFA 5IG3A 5ECHB 1Q40A 4TW5A 1AW9A 3CCV3 2OTJ3 4ZB6A 4HBRA 1GY5A 4K1FA 4J5KA 3JUPA 6GSPA 4TVEA 3EE1A 2H71A 1GTIA 1TK8B 2DIYA 1W7CA 1BU4A 1YGWA 2CX3A 1GSDA 2BNGA 1A67A 4Q5NA 3ROBA 5KP1A 2GT6A 2VCVA 3A5EA 2HFDA 3HOHA 13GSA 2YWMA 2W56B 1THXA 4XBXA 4WHAA 4IBPA 2YJHA 1YF0A 1W6CA 5IOXA 5KN3A 1BAYA 1BSEA 1OC9A 3H93A 3LTDA 1SL2B 3CMA3 3KIJA 1FW7A 3GZXB 5H5QA 4F0CA 1K0NA 3I43A 5ID2A 3UAPA 2O89A 1TRPA 2PZVA 1PKZA 4PURA 5ECLB 3S27A 1JBRA 2XEPA 3Q6OA 1JB5A 3D21A 4KFDA 2K0MA 2CA8A 1U3AA 1ASKA 2YWOA 5IEPA 1N5PA 4MF6A 1IVWA 1SIHA 1A8LA 3N54B 3LQ7A 3IJEB 3GX0A 3UJMA 2WOHA 5D83A 2XBQA 4K7IA 4V2LA 4MPGA 1GSQA 2XFTA 1VF4A 2V2GA 3IR4A 2VCWA 2CFDA 3VGNA 1TI3A 3HXSA 4ZBBA 3DM8A 1GLPA 5G30A 4JEDA 3QAGA 4JRFA 1NW2A 2C80A 2PPTA 5HR0A 4ILFA 1W89A 2RUEA 1Z3EA 4HVNA 2QGVA 3TKPA 3G9BA 2P09A 1RNTA 4O2HA 1Q7Y4 1XIYA 1WTHA 5B6MA 3FR3A 1N8R4 3GKXA 4HZ4A 1BUQA 5J5NA 2FNOA 5B8BA 5INYA 4N30A 2FWFA 2GVPA 3PGTA 1SYXA 2HYXA 4CDOA 1Q814 2AUVA 3CSHA 2WGOA 4IKHA 1EWXA 1GOUA 1GUHA 5CF1A 2KOKA 1LNHA 3APQA 3NUVA 8GSSA 4O32A 3U1WA 1YDKA 1U5OA 1B2XA 1FUTA 3FG3A 1R4WA 2EC4A 3V1WA 4I5QA 1BVIA 3K8NA 4GWRA 4IPBA 2VIMA 3CBUA 3EX9A 1G7EA 1RCKA 1GWCA 1X5EA 1GSSA 3QDNA 3DGMA 1QVF2 2VL2A 2A2PA 1D6YA 5CLKA 2DKHA 3QFAC 3EBYA 4A5PA 1RN1A 1K3OA 2P0GA 3CRUA 2SARA 5CREA 3U5RE 1XFLA 3X3XA 2W6JH 1YVSA 4EE0A 4RUVA 4K1UA 3Q90A 1C72A
chains in the Genus database with same CATH topology
2C3NA 1GSFA 3IXRA 1ST9A 3HYPA 2H6YA 2AJQB 5G5EA 3FHKA 3DKSA 1GSUA 3QMXA 4L5LA 2H1BA 2GSSA 1XVWA 1PL1A 2VO4A 4HJMA 3C1SA 2I3YA 4O7HA 3IK7A 2IIYA 3H79A 1BQ7A 1V40A 2PVOC 2MMNA 3APOA 1SJZA 5GSSA 1B4PA 2IWTA 4O5QA 2DJ2A 2D2ZA 1LBKA 1OKTA 2F3MA 2ALBA 4MJBA 4MPFA 4N0VA 3ZVJD 3IPZA 3L9UA 1A0RP 5B7CA 4EDZA 2JZRA 1K0CA 2PN8A 1S3DA 3GN3A 2HE3A 4X4JA 5IMCA 3PR8A 2R0PA 5DDLA 5G31A 2BTOT 2L4CA 3H8QA 2N5FA 4PQ1A 1FG4A 1E2YA 4D73A 3A5WA 3I9V2 3RPPA 1N8JA 1DSBA 1AUCA 2GSRA 1HD2A 3DRNA 1DBYA 4MH3A 1PQNA 1JZRA 2C4JA 4FYUA 3UARA 2F8AA 3ZIVA 4V1Ap 3GYKA 1SJ6A 1GUKA 1K0MA 1OKDA 1XWKA 3IHGA 3QFBC 1GRXA 1SL1B 1GSEA 3GL5A 3UOMA 6GSXA 2VL3A 1FVJA 2H0IA 4TN8A 4K7OA 1WMJA 2IYJA 2FWGA 4IN0A 2H30A 1Y6EA 4DSRA 4AJ7A 1MDJA 2RIIA 4EL1A 2IJYA 2RLIA 1TU8A 1J08A 4JBBA 1TRVA 3HKRA 4G2EA 3WT1A 1S3CA 4XTSA 2LUSA 2CVKA 4OD7A 3D4TA 1ML6A 4PQHA 2H0GA 3P2AA 3IE3A 1FO5A 1X5CA 3Q19A 3FRCA 3BJ5A 3ZITA 2HNLA 2GDRA 4L5OA 1SD9A 2E2GA 4WF5A 3E9JB 3LW9A 1EEMA 3UIWA 2KUCA 4J2FA 2VL9A 1TOFA 6GSUA 1EOGA 4ZL7A 1EGOA 3DD3A 2LJRA 4O5UA 1BEDA 1YKAA 5DBQA 1OE8A 3EE2A 1YJ6A 4F03A 4AGSA 3IA1A 1FB0A 2H70A 4MZWA 2C0FA 1YQ1A 3TJFA 3KM6A 3DVXA 2KHPA 4NXIA 1GH2A 1WIKA 1TRSA 4GTUA 2OE0A 3F4SA 3RHCA 3F8UA 2XC2A 3TUEA 1BYEA 3U6VA 5J3RA 2CVDA 2XHFA 4IQAA 3QPMA 3ZZXA 6GSWA 1RQMA 4CHSA 3L78A 2FHEA 3LXZA 2VCQA 5DJMA 2E7PA 1QXHA 1A2LA 5ELGA 2A2RA 3IK9A 5GAND 2RM5A 12GSA 2K8VA 2VCXA 1OYJA 3M3MA 1XW6A 1AQWA 4ZILA 2DBCA 3VI7A 3TOUA 2N5AA 1FW1A 2IMEA 4NV5A 1G0TA 1HNCA 3DEXA 2HRFA 4ECJA 2H73A 5G2ZA 1XW9A 4O92A 3FZ5A 4KAEA 3TRPA 1DE1A 3LORA 4MF5A 3A2WA 4KCAA 1GSYA 1PA3A 5JCGA 1XPVA 4Z7XA 3UBLA 4MDCA 3F6DA 4ECIA 1T4YA 3G7JA 4ZB8A 1YEXA 4G0KA 1WP0A 3C71A 4ML1A 2OBIA 5CRGA 3CSJA 1TK5B 1NHOA 1IYIA 1MEKA 2AB6A 1LU4A 3TCOA 5IIZA 2OBKA 3TB2A 1VF2A 4BL7B 5LNKe 3CSIA 3O76A 3SWLA 3PH9A 2FD3A 4FYBA 3UVHA 5GSTA 2CX4A 5CRWA 2V41A 1TKDB 1S3AA 1T4ZA 1HYUA 4IP1A 3KGKA 2NBSA 4POMA 5EL8A 5FT3A 2H1AA 3Q74A 2PWJA 3EURA 2ZNMA 1PL2A 1GUMA 3O3TA 4YAPA 2ON7A 2H75A 3TKSA 4FO5A 4N0ZA 1TK0B 2KP2A 4NWYA 3KH7A 2MYGA 2YPMA 4GLTA 4F0BA 2X99A 4KDYA 2M46A 2LKUA 3GKMA 1OC9B 2R2JA 1JLWA 2V6KA 2GSTA 2H72A 4LL1B 2B5EA 2LQOA 5ECOB 3GRXA 5H5SA 5ID2B 2YZUA 5F8BA 2YZHA 1K3YA 4X1UA 1O7UA 2HSHA 1M2BA 2WZ9A 1O85A 2DIZA 4X0XA 3LEFA 1ERVA 4KDXA 4MLYA 2CT6A 1U87A 1T7PB 2V6OA 3F4RA 2JSZA 4JR4A 3RDWA 4NV2A 2FA8A 4AJ6A 3GSSA 4DSQA 2X8HA 2WB9A 2GZYA 3MWHA 2YP6A 2I9HA 4XS4B 1EOHA 1SJIA 5D9XA 3ZRDA 4OCEA 4KDUA 2O7KA 2H0HA 4TRXA 1JZWA 5JCUA 4K9ZA 3EPTA 4K7NA 4YQMA 4MNNA 2EIRA 4G0LA 4OCFA 3IAS2 2HSMA 2HZEB 2V1MA 4TR0A 3I6AA 1IYHA 3C1RA 3CTFA 3F9UA 4BVYA 4V2MA 4MZBA 2PERA 1QGVA 4FQUA 3DVWA 3NOFA 4POBA 1F3BA 3IDVA 4L0UA 1TI1A 2C0GA 5DQYA 5IMFA 3RPNA 3ZTLA 3VPQA 2VLTA 3FW2A 2R0CA 3EMPA 1TTZA 2HT9A 3CXGA 1M7TA 2WGRA 1A2JA 1FAAA 1K0DA 2A2SA 4K6XA 4EO3A 5ECNB 4DEJA 1R26A 2PUKC 2HRKA 4Q5QA 3NZNA 1K0AA 5LD0A 2L5OA 2LNTA 4GCIA 1EP7A 3GHAA 5KOXA 3VFIA 2PU9C 2JZTA 3DMLA 16GSA 1AAZA 3R2QA 2VCTA 3GSTA 3GUSA 4GSTA 2TIRA 4GXZA 5ECKB 5CP1A 2R0GA 3ED3A 3UL3A 3A3TA 4K0GA 1U3IA 4USSA 4QL9A 5D9WA 3HDCA 2AAWA 1H4OA 4ICYA 1ERUA 3TRQA 4WBRD 5ENUA 4H86A 5IMVA 5IPHA 2R5GA 2M72A 2B7JA 4HZ2A 3FR9A 4ZXGA 5LCZA 1TXXA 1V2AA 4K5SA 4I2UA 5KN0A 4HS1A 1HNBA 5AGYA 17GSA 3UJ1A 3CTGA 4HEA2 1HQOA 1I5GA 5IO2A 1X9WB 3KJYA 2P5RA 5AIVA 3ZMKA 2PMTA 4ZIJA 5F07A 4GSNA 6GSSA 4IGJA 1WPIA 1GL8A 1M9AA 2K9FA 2K8SA 2VM1A 5F05A 3W8SA 4XRAA 4BA7A 3QCPA 1XZOA 2VLUA 1A8YA 1EZKA 2JADA 2C3TA 1KBNA 4K8MA 4FYCA 5L71A 3GTUA 1QK8A 7GSSA 4RQXA 3N5OA 3GNJA 4KA0A 1ZGNA 3D6IA 4EVMA 3LG6A 1PGTA 2DSAA 3KP8A 1TRUA 4TKYA 5KN1A 3IAM2 1ZYPA 1ZCPA 2IFQB 4K2DA 4KCEA 2DLXA 2C0EA 2YN1A 4BWQA 1R7HA 3CMIA 1AXDA 3M1GA 3KP9A 4IQ1A 1B9YC 2B7KA 3ME8A 3P7XA 1SL0B 2AYTA 1PSQA 3BCIA 5EY6A 3EINA 3A2XA 5HQPA 3BOAA 1ILOA 2REMA 1X0RA 2JU5A 1GNEA 2NPBA 2QKEA 1JLVA 1Z7PA 5D9TA 3L0HA 2JSYA 1J9BA 2WJUA 2MBTA 3GFKA 2WFCA 5DQSA 1A24A 5B6NA 1BX9A 4HOJA 1M99A 2PGTA 2JZSA 14GSA 4V1Ag 2C3QA 3UVTA 4LLRA 2RM6A 1UA5A 4TR1A 2GS3A 3ISOA 5J9BA 5J4UA 2CVBA 2MZCA 2LRCA 4ECCA 1UVZA 1OC3A 2J9HA 3ERFA 1OC8A 4RQRA 4YQVA 3TKRA 4ZL9A 1M2AA 3P90A 3EYTA 1O6JA 2OADA 1VF3A 4ZL8A 2DJ1A 1R5PA 2WDUA 2GQKA 11GSA 3BD2A 1XWBA 5G1LA 2H6ZA 1TDIA 5D93A 4KSMA 3EU3A 4BWSA 1VF1A 1F2EA 2C0DA 3LGCA 2R6KA 3G7IA 3HY2A 1SKWB 4XS1A 2GT5A 1AC1A 5F06A 4BVXA 3VLNA 3HJMA 2YWIA 2H6XA 4EC0A 1PD21 2JACA 1NSWA 1ERTA 3JCML 4X43A 2HI7A 4OFNA 2H1GA 1F6MC 1ZOFA 1XOBA 3L9SA 5B8AA 4ECBA 1ZYEA 2IPAA 5KOWA 3GL3A 5BMUA 1AQXA 4OO4A 4E8EA 3GMFA 4O5RA 1K0BA 1Y25A 4I2TA 1GP1A 2LRNA 2L4QA 4K2XA 4POLA 3ZMLA 1CQGA 1I9DA 1MD3A 3DWVA 3WD6A 3FK8A 2IMFA 2WCIA 3FMWA 4RI6A 5C04A 5IMZA 4PX1A 4Z2UA 1YZXA 1FVKA 2LJAA 4DSSA 1B8XA 1T1VA 5A4VA 1M2DA 4OMVA 2GZZA 3F3RA 5DALA 3DYRA 5ECRB 3UBKA 4MZCA 6GSTA 3TKSE 3F3QA 3HJPA 5FHIA 2GGTA 5CNWA 4GQCA 4Z2TA 1OE7A 1WOUA 3ERWA 2G0FA 4E8HA 4YKFA 4IJIA 4AJ8A 1O81A 4QL7A 1XWCA 3ZVJA 4Q5RA 4JRRA 1FHEA 2O8VB 4WF4A 5A4UA 2TRCP 2OACA 3GX8A 3VWWA 4XHMA 1A0FA 19GSA 3BBYA 2A4VA 4ACSA 1KNGA 4POKA 2NDOA 5AN1A 2DMLA 2R37A 3HZ4A 3VPTA 4KE3A 2G2QA 1KTEA 4KSOA 1QQ2A 2IN3A 4QQ7A 6GSYA 3M8NA 3F4TA 4TXVA 5IQYA 5ECSA 2DJ3A 5H5RA 5EPFA 5J9CA 3J7Yk 5IMDA 5KEJA 2TRXA 4HDEA 4TXOA 2WS2A 4HU9A 1GLQA 1ACVA 2LEGA 4CW9A 5A4WA 1YY7A 4JR6A 3ZLPA 2AHEA 4OFMA 5HFKA 2F8FA 1XXUA 3F63A 5JWOB 2FUG2 3FY7A 3VWUA 4IW9A 5EVOA 2HZFA 3HVSA 2CZ3A 1SKRB 5JWRB 2LRTA 1B4QA 2CZ2A 2FY6A 3IC8A 5ECMB 2N5BA 5IPGA 2VAFA 1T3BA 2OKAA 4P3YB 1X5DA 4EUYA 3HJOA 4AF2A 4KNDA 5GZZB 1XCCA 3C7MA 2GQLA 2LSTA 4NPBA 2QA1A 3C8EA 3FEUA 4JE1A 3L4NA 1VGLA 2KP1A 4BVYB 4F9ZA 3GURA 1BG5A 2B3SA 4I8BA 2CV4A 3ZREA 1Z6MA 2FLSA 2I1UA 5J41A 2VOCA 3HHVA 1YF1A 5G5FA 3ZFLA 3FYGA 3GKKA 18GSA 2F9SA 1K0OA 2KLXA 2HRAA 1TRWA 2H8LA 4KH7A 4XCSA 1V98A 3KXOA 4LA1A 1Z5YE 20GSA 3MSZA 3VWXA 1F3AA 2L57A 2ZCTA 1E6BA 2FWEA 5IMAA 3KD0A 4RI7A 4FIWA 2IL3A 2GQMA 4YKGA 4OFTA 2DJJA 4PUAA 4EIPA 1FB6A 1HNAA 5DVBA 2R3XA 3FZAA 4CY8A 2B1KA 4LMWA 2I81A 3M0FA 5D73A 3IV4A 5HR3A 2X64A 4G10A 2M80A 1PX6A 2PVQA 1B48A 1Z9HA 3EWLA 3KCMA 4ZBAA 1EEJA 5CRHA 3TRXA 4MP4A 5G1KA 3APSA 2PBJA 4WXTA 1MDKA 2XPEA 3ERGA 4K5RA 5DJLA 2X8GA 3PPUA 1K3LA 5DAKA 4EKZA 4N11A 1PN9A 3TGZA 5BRTA 1N2AA 3N9JA 2QA2A 1QFNA 4XS4A 3LFLA 3M9JA 3LSZA 3H1NA 4JU5A 1ZYQB 1ZMAA 1XWAA 4MK3A 9GSSA 3GTUB 5D9VA 2HZEA 2UZ8A 4GQFA 5KN2A 2BJXA 1FOVA 1KEBA 1QMVA 3D0ZA 2NTOA 3A5IA 1Z7RA 4WETA 3LXTA 4PQIA 1J0FA 3RHBA 1X9SB 4IELA 4I97A 5HFGA 1M0UA 4WEYA 1EP8A 2XBIA 1URMA 5HR1A 3PINA 2JL4A 3KMOA 2WULA 1Q4JA 2LV3A 1DE2A 3QOUA 1NM3A 2O85A 1WWJA 4NMUA 4D73B 1W4VA 5CRDA 1PN0A 3EC3A 2OE1A 4F82A 1GTBA 2ON5A 4BPYA 3TKSC 1JHBA 1U88A 1F9MA 1JZOA 4LMVA 1EV9A 2L6DA 3KTBA 2IMDA 5GAPD 2DJKA 3TJKA 4MJEA 1O8XA 4TR1B 2X4AA 1TU7A 2HXKA 2GTUA 2I4AA 1Z6NA 2FWHA 3RBTA 2LTKA 1A23A 4IVFA 4DVCA 2MBSA 4IP6A 3HVXA 2B1LA 5CYYA 3WGEA 1FOHA 4Q5FA 1TW9A 4HQZA 4EXJA 3IRAA 1M9BA 1R5AA 2QC7A 1X9MB 4TR3A 3MIXA 3HZ8A 2P5QA 4G19A 1USBA 3TKQA 4MCUA 1PMTA 1XW5A 3EU4A 2MMOA 3AY8A 2OE3A 3SBCA 3Q18A 3KZQA 3HCZA 5ELAA 4MA9A 4YH2A 1YKCA 2FCHA 1G7OA 1GNWA 1XOAA 1EV4A 3ZIJA 2LQQA 3OR5A 2AV4A 2C1YA 2CAIA 5AISA 4N10A 1T00A 2GZPA 1UN2A 4BVXB 1UC7A 2IY2A 1QUWA 2H74A 1PKWA 1PX7A 1OVNA 2VLVA 1ERWA 3UEMA 2VCZA 3GH9A 3D5JA 3KTLA 2L59A 1SYRA 4ISDA 4KX4A 2YANA 3CYNA 4IS0A 3E3EA 5ABRA 2B5XA 2K18A 4EF0A 4FH8A 4OWYA 3ME7A 3H4KA 1XVQA 4EIQA 1BJXA 1GTAA 2DJ0A 2FA4A 2IFQA 2XPDA 2L6CA 1MTCA 3A2VA 4XRDA 6GSVA 1ZZYA 3CRTA 5DCHA 5E59A 2VM2A 4WR4A 3D22A 3FZ9A 4ZBDA 4TOPA 2H76A 3VI5A 1SKSB 4DSSB 3EVIA 4WBJA 1RW1A 2H1DA 5ECPB 4XIHA 5DALB 1B9XC 3W6GA 4GSSA 5D8IA 3IC4A 3LYPA 2BMXA 4KUNA 3W8JA 1Q98A 4GRFA 2VL2C 1MD4A 3R3EA 2RUFA 1ZYNA 4GF0A 4MJCA 5D96A 4EDYA 1XBSA 3DGQA 1MDIA 3WGXA 3GKNA 2OJLA 3F6FA 2ES7A 3FR6A 1ABAA 5HR2A 2WRTA 1OAZA 3RAZA 1TP9A 5COHA 4F2IA 3HA9A 4YAVA 2YNXA 4NHZA 4WKWA 2IMIA 4J57E 2LNSA 3QAVA 3TOTA 2HRNA 2OA7A 5IM9A 1JFUA 3E0UA 4MF7A 3F0IA 1TJDA 3J7Yb 2K6VA 4KB3A 2YJ7A 3TDGA 3IHQA 4Z2RA 1SK2A 4IJ3A 1V9WA 2C8UA 1LJRA 3WGDA 3IBHA 2V32A 5ECQB 2H19A 1U6TA 4PUFC 5ECIB 4MH2A 4HJ2A 4XS6A 2HLSA 4KF9A 4TXOB 5F0GA 3US3A 2Z9SA 3DXBA 4YQUA 3GIXA 1ZL9A 2E2MA 5JCWA 3UMAA 3IOSA 1AQVA 1SENA 3I69A 2F51A 1G6YA 2YOIA 4OO5A 4G9HA 1SK1A 1PRXA 1THOA 3FKFA 3MAKA 3FZ4A 22GSA 4LL4B 2DKIA 4PGTA 1NHYA 4MMMA 3VK9A 4PNGA 3WT2A 3S9FA 3D4MA 4K0NA 3L9VA 1T8EB 5AIXA 2DC5A 1V57A 2VUPA 4V2NA 2YV9A 4MJAA 3GA4A 5JWQB 4CY6A 4ML6A 2J23A 2H01A 4I6XA 3GV1A 3QAWA 4HU7A 4MABA 4ID0A 1ON4A 3LWAA 5CAXA 4J56E 5DCGA 3KH9A 2CAQA 3KMNA 1DUGA 4JZQA 4PNFA 3TJGA 1GULA 2EIOA 2NVLA 3HVVA 2LS5A 5IOWA 4G0IA 2O87A 2MMZA 1WRYA 1O8WA 1EGRA 1V58A 2DMMA 3DIEA 2ZUPA 5HFIA 4KGIA 3TJBA 1H75A 2X49A 2B6MA 3NIVA 4ULXA 2E0QA 1SK0A 4IHUA 4L8EA 5A5KA 4HI7A 1CQHA 2P31A 3TJJA 3LJRA 1JZDA 3EMXA 5FWGA 3C73A 2GSQA 2LJKA 4KW6A 3ZFBA 4ZB9A 2FGXA 2YWNA 1XWGA 2HSYA 5CO3A 3VURA 1WJKA 4NAXA 2YCDA 1VRSD 1A2MA 2EIQA 3LYKA 1GTUA 2VD0A 3MNGA 4PXOA 4WR5A 1SU9A 2IMKA 2VD1A 2A4HA 2R4VA 3M9KA 2X8CA 3VWVA 3BCKA 4L0WA 2YV7A 4NHWA 2GLRA 1G6WA 5E4WA 3P8WA 2QSIA 3MYDA 3ZYWA 5IO0A 3GH6A 4TR4A 2H66A 2L5LA 4BL7A 3KEBA 10GSA 2B5YA 4HQSA 1SD8A 4HUAA 4PTSA 1YEPA 3ZL5A 2MMAA 1O73A 1F37A 3O6TA 1AIUA 5C00A 5DAKB 3QR6A 3QD9A 3WYWA 2CQ9A 3G7YA 1RK4A 1WE0A 3HD5A 3MDKA 5ECHB 4TW5A 1AW9A 4ZB6A 4K1FA 4TVEA 2H71A 1GTIA 1TK8B 2DIYA 2CX3A 1GSDA 4Q5NA 2GT6A 2VCVA 2HFDA 13GSA 2YWMA 1THXA 4IBPA 2YJHA 1YF0A 5IOXA 5KN3A 1BAYA 1OC9A 3H93A 1SL2B 3KIJA 5H5QA 4F0CA 1K0NA 3I43A 5ID2A 3UAPA 2O89A 1PKZA 4PURA 5ECLB 3Q6OA 3D21A 2CA8A 1U3AA 2YWOA 4MF6A 1A8LA 3LQ7A 3GX0A 2XBQA 4K7IA 4V2LA 4MPGA 1GSQA 1VF4A 2V2GA 3IR4A 2VCWA 4ZBBA 1TI3A 3HXSA 1GLPA 5G30A 4JEDA 3QAGA 1NW2A 2C80A 2PPTA 5HR0A 4ILFA 1W89A 2RUEA 1Z3EA 2QGVA 3TKPA 3G9BA 1XIYA 5B6MA 3FR3A 3GKXA 4HZ4A 5J5NA 2FNOA 5B8BA 5INYA 4N30A 2FWFA 2GVPA 3PGTA 1SYXA 2HYXA 4CDOA 2AUVA 3CSHA 4IKHA 1EWXA 1GUHA 2KOKA 3APQA 8GSSA 4O32A 1YDKA 1R4WA 2EC4A 3V1WA 4I5QA 3K8NA 4GWRA 3CBUA 2VIMA 1G7EA 1GWCA 1X5EA 1GSSA 3QDNA 2VL2A 2A2PA 2DKHA 3QFAC 4A5PA 1K3OA 2P0GA 3CRUA 5CREA 3U5RE 1XFLA 4EE0A 4RUVA 1C72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C3N A;  1GSF A;  3IXR A;  1ST9 A;  3HYP A;  2H6Y A;  2AJQ B;  5G5E A;  3FHK A;  3DKS A;  1GSU A;  3QMX A;  4L5L A;  2H1B A;  2GSS A;  1XVW A;  1PL1 A;  2VO4 A;  4HJM A;  3C1S A;  2I3Y A;  4O7H A;  3IK7 A;  2IIY A;  3H79 A;  1BQ7 A;  1V40 A;  2PVO C;  2MMN A;  3APO A;  1SJZ A;  5GSS A;  1B4P A;  2IWT A;  2DJ2 A;  2D2Z A;  1LBK A;  1OKT A;  2F3M A;  2ALB A;  4MJB A;  4MPF A;  4N0V A;  3ZVJ D;  3IPZ A;  3L9U A;  1A0R P;  5B7C A;  4EDZ A;  2JZR A;  1K0C A;  2PN8 A;  1S3D A;  3GN3 A;  2HE3 A;  5IMC A;  3PR8 A;  5DDL A;  5G31 A;  2BTO T;  2L4C A;  3H8Q A;  2N5F A;  4PQ1 A;  1FG4 A;  1E2Y A;  4D73 A;  3A5W A;  3I9V 2;  3RPP A;  1N8J A;  1DSB A;  1AUC A;  2GSR A;  1HD2 A;  3DRN A;  1DBY A;  4MH3 A;  1PQN A;  1JZR A;  2C4J A;  4FYU A;  3UAR A;  2F8A A;  3ZIV A;  4V1A p;  3GYK A;  1SJ6 A;  1GUK A;  1K0M A;  1OKD A;  1XWK A;  3QFB C;  1GRX A;  1SL1 B;  1GSE A;  3GL5 A;  3UOM A;  6GSX A;  2VL3 A;  1FVJ A;  2H0I A;  4TN8 A;  4K7O A;  1WMJ A;  2IYJ A;  2FWG A;  4IN0 A;  2H30 A;  1Y6E A;  4DSR A;  4AJ7 A;  1MDJ A;  2RII A;  4EL1 A;  2IJY A;  2RLI A;  1TU8 A;  1J08 A;  4JBB A;  1TRV A;  3HKR A;  4G2E A;  3WT1 A;  1S3C A;  4XTS A;  2LUS A;  2CVK A;  4OD7 A;  3D4T A;  1ML6 A;  4PQH A;  2H0G A;  3P2A A;  3IE3 A;  1FO5 A;  1X5C A;  3Q19 A;  3FRC A;  3BJ5 A;  3ZIT A;  2HNL A;  2GDR A;  4L5O A;  1SD9 A;  2E2G A;  4WF5 A;  3E9J B;  1EEM A;  3UIW A;  2KUC A;  4J2F A;  2VL9 A;  1TOF A;  6GSU A;  1EOG A;  4ZL7 A;  1EGO A;  3DD3 A;  2LJR A;  1BED A;  1YKA A;  5DBQ A;  1OE8 A;  3EE2 A;  1YJ6 A;  4F03 A;  4AGS A;  3IA1 A;  1FB0 A;  2H70 A;  4MZW A;  2C0F A;  1YQ1 A;  3TJF A;  3KM6 A;  3DVX A;  2KHP A;  4NXI A;  1GH2 A;  1WIK A;  1TRS A;  4GTU A;  2OE0 A;  3F4S A;  3RHC A;  3F8U A;  2XC2 A;  3TUE A;  1BYE A;  3U6V A;  5J3R A;  2CVD A;  2XHF A;  4IQA A;  3QPM A;  3ZZX A;  6GSW A;  1RQM A;  4CHS A;  3L78 A;  2FHE A;  3LXZ A;  2VCQ A;  5DJM A;  2E7P A;  1QXH A;  1A2L A;  5ELG A;  2A2R A;  3IK9 A;  5GAN D;  2RM5 A;  12GS A;  2K8V A;  2VCX A;  1OYJ A;  3M3M A;  1XW6 A;  1AQW A;  4ZIL A;  2DBC A;  3VI7 A;  3TOU A;  2N5A A;  1FW1 A;  2IME A;  4NV5 A;  1G0T A;  1HNC A;  3DEX A;  2HRF A;  4ECJ A;  2H73 A;  5G2Z A;  1XW9 A;  4O92 A;  3FZ5 A;  4KAE A;  3TRP A;  1DE1 A;  3LOR A;  4MF5 A;  3A2W A;  4KCA A;  1GSY A;  1PA3 A;  5JCG A;  1XPV A;  4Z7X A;  3UBL A;  4MDC A;  3F6D A;  4ECI A;  1T4Y A;  3G7J A;  4ZB8 A;  1YEX A;  1WP0 A;  3C71 A;  4ML1 A;  2OBI A;  5CRG A;  3CSJ A;  1TK5 B;  1NHO A;  1IYI A;  1MEK A;  2AB6 A;  1LU4 A;  3TCO A;  5IIZ A;  2OBK A;  3TB2 A;  1VF2 A;  5LNK e;  3CSI A;  3O76 A;  3SWL A;  3PH9 A;  2FD3 A;  4FYB A;  3UVH A;  5GST A;  2CX4 A;  5CRW A;  2V41 A;  1TKD B;  1S3A A;  1T4Z A;  1HYU A;  4IP1 A;  3KGK A;  2NBS A;  4POM A;  5EL8 A;  5FT3 A;  2H1A A;  3Q74 A;  2PWJ A;  3EUR A;  2ZNM A;  1PL2 A;  1GUM A;  3O3T A;  4YAP A;  2ON7 A;  2H75 A;  3TKS A;  4FO5 A;  4N0Z A;  1TK0 B;  2KP2 A;  4NWY A;  3KH7 A;  2MYG A;  2YPM A;  4GLT A;  4F0B A;  2X99 A;  4KDY A;  2M46 A;  2LKU A;  3GKM A;  1OC9 B;  2R2J A;  1JLW A;  2V6K A;  2GST A;  2H72 A;  4LL1 B;  2B5E A;  2LQO A;  5ECO B;  3GRX A;  5H5S A;  5ID2 B;  2YZU A;  5F8B A;  2YZH A;  1K3Y A;  4X1U A;  1O7U A;  2HSH A;  1M2B A;  2WZ9 A;  1O85 A;  2DIZ A;  4X0X A;  3LEF A;  1ERV A;  4KDX A;  4MLY A;  2CT6 A;  1U87 A;  1T7P B;  2V6O A;  3F4R A;  2JSZ A;  4JR4 A;  3RDW A;  4NV2 A;  2FA8 A;  4AJ6 A;  3GSS A;  4DSQ A;  2X8H A;  2WB9 A;  2GZY A;  3MWH A;  2YP6 A;  2I9H A;  4XS4 B;  1EOH A;  1SJI A;  5D9X A;  3ZRD A;  4OCE A;  4KDU A;  2O7K A;  2H0H A;  4TRX A;  1JZW A;  5JCU A;  4K9Z A;  4K7N A;  4YQM A;  2EIR A;  4OCF A;  3IAS 2;  2HZE B;  2V1M A;  4TR0 A;  3I6A A;  1IYH A;  3C1R A;  3CTF A;  3F9U A;  4BVY A;  4V2M A;  4MZB A;  2PER A;  1QGV A;  3DVW A;  3NOF A;  4POB A;  1F3B A;  3IDV A;  4L0U A;  1TI1 A;  2C0G A;  5DQY A;  5IMF A;  3RPN A;  3ZTL A;  3VPQ A;  2VLT A;  3FW2 A;  3EMP A;  1TTZ A;  2HT9 A;  3CXG A;  1M7T A;  2WGR A;  1A2J A;  1FAA A;  1K0D A;  2A2S A;  4K6X A;  4EO3 A;  5ECN B;  4DEJ A;  1R26 A;  2PUK C;  4Q5Q A;  3NZN A;  1K0A A;  5LD0 A;  2L5O A;  2LNT A;  4GCI A;  1EP7 A;  3GHA A;  3VFI A;  2PU9 C;  2JZT A;  3DML A;  16GS A;  1AAZ A;  3R2Q A;  2VCT A;  3GST A;  3GUS A;  4GST A;  2TIR A;  4GXZ A;  5ECK B;  5CP1 A;  3ED3 A;  3UL3 A;  3A3T A;  4K0G A;  1U3I A;  4QL9 A;  5D9W A;  3HDC A;  2AAW A;  1H4O A;  1ERU A;  3TRQ A;  4WBR D;  5ENU A;  4H86 A;  5IMV A;  5IPH A;  2R5G A;  2M72 A;  2B7J A;  4HZ2 A;  3FR9 A;  4ZXG A;  5LCZ A;  1TXX A;  1V2A A;  4I2U A;  5KN0 A;  4HS1 A;  1HNB A;  5AGY A;  17GS A;  3UJ1 A;  3CTG A;  4HEA 2;  1HQO A;  1I5G A;  5IO2 A;  1X9W B;  3KJY A;  2P5R A;  5AIV A;  3ZMK A;  2PMT A;  4ZIJ A;  5F07 A;  4GSN A;  6GSS A;  4IGJ A;  1WPI A;  1GL8 A;  1M9A A;  2K9F A;  2K8S A;  2VM1 A;  5F05 A;  3W8S A;  4XRA A;  4BA7 A;  3QCP A;  1XZO A;  2VLU A;  1A8Y A;  1EZK A;  2JAD A;  2C3T A;  1KBN A;  4K8M A;  4FYC A;  5L71 A;  3GTU A;  1QK8 A;  7GSS A;  4RQX A;  3N5O A;  3GNJ A;  4KA0 A;  1ZGN A;  3D6I A;  4EVM A;  3LG6 A;  1PGT A;  2DSA A;  3KP8 A;  1TRU A;  4TKY A;  5KN1 A;  3IAM 2;  1ZCP A;  2IFQ B;  4K2D A;  4KCE A;  2DLX A;  2C0E A;  2YN1 A;  4BWQ A;  1R7H A;  3CMI A;  1AXD A;  3M1G A;  3KP9 A;  4IQ1 A;  1B9Y C;  2B7K A;  3ME8 A;  3P7X A;  1SL0 B;  2AYT A;  1PSQ A;  3BCI A;  5EY6 A;  3EIN A;  3A2X A;  5HQP A;  3BOA A;  1ILO A;  2REM A;  1X0R A;  2JU5 A;  1GNE A;  2NPB A;  2QKE A;  1JLV A;  1Z7P A;  5D9T A;  3L0H A;  2JSY A;  1J9B A;  2WJU A;  2MBT A;  3GFK A;  2WFC A;  5DQS A;  1A24 A;  5B6N A;  1BX9 A;  4HOJ A;  1M99 A;  2PGT A;  2JZS A;  14GS A;  4V1A g;  2C3Q A;  3UVT A;  4LLR A;  2RM6 A;  1UA5 A;  4TR1 A;  2GS3 A;  3ISO A;  5J9B A;  5J4U A;  2CVB A;  2MZC A;  2LRC A;  4ECC A;  1UVZ A;  1OC3 A;  2J9H A;  3ERF A;  1OC8 A;  4RQR A;  4YQV A;  3TKR A;  4ZL9 A;  1M2A A;  3P90 A;  3EYT A;  1O6J A;  2OAD A;  1VF3 A;  4ZL8 A;  2DJ1 A;  1R5P A;  2WDU A;  2GQK A;  11GS A;  3BD2 A;  1XWB A;  5G1L A;  2H6Z A;  1TDI A;  5D93 A;  4KSM A;  3EU3 A;  4BWS A;  1VF1 A;  1F2E A;  2C0D A;  3LGC A;  2R6K A;  3G7I A;  3HY2 A;  1SKW B;  4XS1 A;  2GT5 A;  1AC1 A;  5F06 A;  4BVX A;  3VLN A;  3HJM A;  2YWI A;  2H6X A;  4EC0 A;  1PD2 1;  2JAC A;  1NSW A;  1ERT A;  3JCM L;  4X43 A;  2HI7 A;  4OFN A;  2H1G A;  1F6M C;  1ZOF A;  1XOB A;  3L9S A;  5B8A A;  4ECB A;  1ZYE A;  2IPA A;  3GL3 A;  1AQX A;  4OO4 A;  4E8E A;  3GMF A;  4O5R A;  1K0B A;  1Y25 A;  4I2T A;  1GP1 A;  2LRN A;  2L4Q A;  4POL A;  3ZML A;  1CQG A;  1I9D A;  1MD3 A;  3DWV A;  3WD6 A;  3FK8 A;  2IMF A;  2WCI A;  4RI6 A;  5C04 A;  5IMZ A;  4PX1 A;  1YZX A;  1FVK A;  2LJA A;  4DSS A;  1B8X A;  1T1V A;  5A4V A;  1M2D A;  4OMV A;  2GZZ A;  3F3R A;  5DAL A;  3DYR A;  5ECR B;  3UBK A;  4MZC A;  6GST A;  3TKS E;  3F3Q A;  3HJP A;  5FHI A;  2GGT A;  5CNW A;  4GQC A;  1OE7 A;  1WOU A;  3ERW A;  2G0F A;  4E8H A;  4IJI A;  4AJ8 A;  1O81 A;  4QL7 A;  1XWC A;  3ZVJ A;  4Q5R A;  4JRR A;  1FHE A;  2O8V B;  4WF4 A;  5A4U A;  2TRC P;  2OAC A;  3GX8 A;  3VWW A;  4XHM A;  1A0F A;  19GS A;  3BBY A;  2A4V A;  4ACS A;  1KNG A;  4POK A;  2NDO A;  5AN1 A;  2DML A;  2R37 A;  3HZ4 A;  3VPT A;  4KE3 A;  2G2Q A;  1KTE A;  4KSO A;  1QQ2 A;  2IN3 A;  4QQ7 A;  6GSY A;  3M8N A;  3F4T A;  4TXV A;  5IQY A;  5ECS A;  2DJ3 A;  5H5R A;  5EPF A;  5J9C A;  3J7Y k;  5IMD A;  5KEJ A;  2TRX A;  4HDE A;  4TXO A;  2WS2 A;  4HU9 A;  1GLQ A;  1ACV A;  2LEG A;  4CW9 A;  5A4W A;  1YY7 A;  4JR6 A;  3ZLP A;  2AHE A;  4OFM A;  5HFK A;  2F8F A;  1XXU A;  3F63 A;  5JWO B;  2FUG 2;  3FY7 A;  3VWU A;  4IW9 A;  5EVO A;  2HZF A;  3HVS A;  2CZ3 A;  1SKR B;  5JWR B;  2LRT A;  1B4Q A;  2CZ2 A;  2FY6 A;  5ECM B;  2N5B A;  5IPG A;  2VAF A;  1T3B A;  2OKA A;  4P3Y B;  1X5D A;  4EUY A;  3HJO A;  4AF2 A;  4KND A;  5GZZ B;  1XCC A;  3C7M A;  2GQL A;  2LST A;  4NPB A;  3C8E A;  3FEU A;  4JE1 A;  3L4N A;  1VGL A;  2KP1 A;  4F9Z A;  3GUR A;  1BG5 A;  2B3S A;  4I8B A;  2CV4 A;  3ZRE A;  1Z6M A;  2FLS A;  2I1U A;  5J41 A;  2VOC A;  3HHV A;  1YF1 A;  5G5F A;  3ZFL A;  3FYG A;  3GKK A;  18GS A;  2F9S A;  1K0O A;  2KLX A;  1TRW A;  2H8L A;  4KH7 A;  4XCS A;  1V98 A;  3KXO A;  4LA1 A;  1Z5Y E;  20GS A;  3MSZ A;  3VWX A;  1F3A A;  2L57 A;  2ZCT A;  1E6B A;  2FWE A;  5IMA A;  3KD0 A;  4RI7 A;  4FIW A;  2IL3 A;  2GQM A;  4OFT A;  2DJJ A;  4PUA A;  1FB6 A;  1HNA A;  5DVB A;  2R3X A;  3FZA A;  2B1K A;  4LMW A;  2I81 A;  3M0F A;  5D73 A;  3IV4 A;  5HR3 A;  2X64 A;  4G10 A;  2M80 A;  1PX6 A;  2PVQ A;  1B48 A;  1Z9H A;  3EWL A;  3KCM A;  4ZBA A;  1EEJ A;  5CRH A;  3TRX A;  4MP4 A;  5G1K A;  3APS A;  2PBJ A;  4WXT A;  1MDK A;  2XPE A;  3ERG A;  5DJL A;  2X8G A;  1K3L A;  5DAK A;  4EKZ A;  4N11 A;  1PN9 A;  3TGZ A;  1N2A A;  3N9J A;  1QFN A;  4XS4 A;  3LFL A;  3M9J A;  3LSZ A;  3H1N A;  4JU5 A;  1ZYQ B;  1ZMA A;  1XWA A;  4MK3 A;  9GSS A;  3GTU B;  5D9V A;  2HZE A;  4GQF A;  5KN2 A;  2BJX A;  1FOV A;  1KEB A;  1QMV A;  3D0Z A;  2NTO A;  1Z7R A;  4WET A;  3LXT A;  4PQI A;  1J0F A;  3RHB A;  1X9S B;  4IEL A;  4I97 A;  5HFG A;  1M0U A;  4WEY A;  1EP8 A;  2XBI A;  1URM A;  5HR1 A;  3PIN A;  2JL4 A;  3KMO A;  2WUL A;  1Q4J A;  2LV3 A;  1DE2 A;  3QOU A;  1NM3 A;  2O85 A;  1WWJ A;  4NMU A;  4D73 B;  1W4V A;  5CRD A;  3EC3 A;  2OE1 A;  4F82 A;  1GTB A;  2ON5 A;  4BPY A;  3TKS C;  1JHB A;  1U88 A;  1F9M A;  1JZO A;  4LMV A;  1EV9 A;  2L6D A;  3KTB A;  2IMD A;  5GAP D;  2DJK A;  3TJK A;  4MJE A;  1O8X A;  4TR1 B;  1TU7 A;  2HXK A;  2GTU A;  2I4A A;  1Z6N A;  2FWH A;  3RBT A;  2LTK A;  1A23 A;  4IVF A;  4DVC A;  2MBS A;  4IP6 A;  3HVX A;  2B1L A;  5CYY A;  3WGE A;  4Q5F A;  1TW9 A;  4HQZ A;  4EXJ A;  3IRA A;  1M9B A;  1R5A A;  2QC7 A;  1X9M B;  4TR3 A;  3HZ8 A;  2P5Q A;  4G19 A;  1USB A;  3TKQ A;  4MCU A;  1PMT A;  1XW5 A;  3EU4 A;  2MMO A;  3AY8 A;  2OE3 A;  3SBC A;  3Q18 A;  3KZQ A;  3HCZ A;  5ELA A;  4MA9 A;  4YH2 A;  1YKC A;  2FCH A;  1G7O A;  1GNW A;  1XOA A;  1EV4 A;  3ZIJ A;  2LQQ A;  3OR5 A;  2AV4 A;  2C1Y A;  2CAI A;  5AIS A;  4N10 A;  1T00 A;  2GZP A;  1UN2 A;  1UC7 A;  2IY2 A;  1QUW A;  2H74 A;  1PKW A;  1PX7 A;  1OVN A;  2VLV A;  1ERW A;  3UEM A;  2VCZ A;  3GH9 A;  3D5J A;  3KTL A;  2L59 A;  1SYR A;  4ISD A;  4KX4 A;  2YAN A;  3CYN A;  4IS0 A;  3E3E A;  5ABR A;  2B5X A;  2K18 A;  4EF0 A;  4FH8 A;  4OWY A;  3ME7 A;  3H4K A;  1XVQ A;  1BJX A;  1GTA A;  2DJ0 A;  2FA4 A;  2IFQ A;  2XPD A;  2L6C A;  1MTC A;  3A2V A;  4XRD A;  6GSV A;  1ZZY A;  3CRT A;  5DCH A;  5E59 A;  2VM2 A;  4WR4 A;  3D22 A;  3FZ9 A;  4ZBD A;  4TOP A;  2H76 A;  3VI5 A;  1SKS B;  4DSS B;  3EVI A;  4WBJ A;  1RW1 A;  2H1D A;  5ECP B;  4XIH A;  5DAL B;  1B9X C;  3W6G A;  4GSS A;  5D8I A;  3IC4 A;  3LYP A;  2BMX A;  4KUN A;  3W8J A;  1Q98 A;  4GRF A;  2VL2 C;  1MD4 A;  2RUF A;  4GF0 A;  4MJC A;  5D96 A;  4EDY A;  1XBS A;  3DGQ A;  1MDI A;  3WGX A;  3GKN A;  2OJL A;  3F6F A;  2ES7 A;  3FR6 A;  1ABA A;  5HR2 A;  2WRT A;  1OAZ A;  3RAZ A;  1TP9 A;  5COH A;  4F2I A;  3HA9 A;  4YAV A;  2YNX A;  4NHZ A;  4WKW A;  2IMI A;  4J57 E;  2LNS A;  3QAV A;  3TOT A;  2HRN A;  2OA7 A;  5IM9 A;  1JFU A;  3E0U A;  4MF7 A;  3F0I A;  1TJD A;  3J7Y b;  2K6V A;  4KB3 A;  2YJ7 A;  3TDG A;  3IHQ A;  1SK2 A;  4IJ3 A;  1V9W A;  2C8U A;  1LJR A;  3WGD A;  3IBH A;  2V32 A;  5ECQ B;  2H19 A;  1U6T A;  4PUF C;  5ECI B;  4MH2 A;  4HJ2 A;  4XS6 A;  2HLS A;  4TXO B;  5F0G A;  3US3 A;  2Z9S A;  3DXB A;  4YQU A;  3GIX A;  1ZL9 A;  2E2M A;  5JCW A;  3UMA A;  3IOS A;  1AQV A;  1SEN A;  3I69 A;  2F51 A;  1G6Y A;  2YOI A;  4OO5 A;  4G9H A;  1SK1 A;  1PRX A;  1THO A;  3FKF A;  3MAK A;  3FZ4 A;  22GS A;  4LL4 B;  4PGT A;  1NHY A;  4MMM A;  3VK9 A;  4PNG A;  3WT2 A;  3S9F A;  3D4M A;  4K0N A;  3L9V A;  1T8E B;  5AIX A;  2DC5 A;  1V57 A;  2VUP A;  4V2N A;  2YV9 A;  4MJA A;  3GA4 A;  5JWQ B;  4ML6 A;  2J23 A;  2H01 A;  4I6X A;  3GV1 A;  3QAW A;  4HU7 A;  4MAB A;  4ID0 A;  1ON4 A;  3LWA A;  5CAX A;  4J56 E;  5DCG A;  3KH9 A;  2CAQ A;  3KMN A;  1DUG A;  4JZQ A;  4PNF A;  3TJG A;  1GUL A;  2EIO A;  2NVL A;  3HVV A;  2LS5 A;  5IOW A;  2O87 A;  2MMZ A;  1WRY A;  1O8W A;  1EGR A;  1V58 A;  2DMM A;  3DIE A;  2ZUP A;  5HFI A;  4KGI A;  3TJB A;  1H75 A;  2B6M A;  3NIV A;  4ULX A;  2E0Q A;  1SK0 A;  4IHU A;  4L8E A;  5A5K A;  4HI7 A;  1CQH A;  2P31 A;  3TJJ A;  3LJR A;  1JZD A;  3EMX A;  5FWG A;  3C73 A;  2GSQ A;  2LJK A;  4KW6 A;  3ZFB A;  4ZB9 A;  2FGX A;  2YWN A;  1XWG A;  2HSY A;  5CO3 A;  3VUR A;  1WJK A;  4NAX A;  2YCD A;  1VRS D;  1A2M A;  2EIQ A;  3LYK A;  1GTU A;  2VD0 A;  3MNG A;  4PXO A;  4WR5 A;  1SU9 A;  2IMK A;  2VD1 A;  2R4V A;  3M9K A;  2X8C A;  3VWV A;  3BCK A;  4L0W A;  2YV7 A;  4NHW A;  2GLR A;  1G6W A;  5E4W A;  3P8W A;  2QSI A;  3ZYW A;  5IO0 A;  3GH6 A;  4TR4 A;  2H66 A;  2L5L A;  4BL7 A;  3KEB A;  10GS A;  2B5Y A;  4HQS A;  1SD8 A;  4HUA A;  1YEP A;  3ZL5 A;  2MMA A;  1O73 A;  1F37 A;  3O6T A;  1AIU A;  5C00 A;  5DAK B;  3QR6 A;  3QD9 A;  3WYW A;  2CQ9 A;  3G7Y A;  1RK4 A;  1WE0 A;  3HD5 A;  3MDK A;  5ECH B;  4TW5 A;  1AW9 A;  4ZB6 A;  4K1F A;  4TVE A;  2H71 A;  1GTI A;  1TK8 B;  2DIY A;  2CX3 A;  1GSD A;  4Q5N A;  2GT6 A;  2VCV A;  2HFD A;  13GS A;  2YWM A;  1THX A;  4IBP A;  2YJH A;  1YF0 A;  5IOX A;  5KN3 A;  1BAY A;  1OC9 A;  3H93 A;  1SL2 B;  3KIJ A;  5H5Q A;  4F0C A;  1K0N A;  3I43 A;  5ID2 A;  3UAP A;  2O89 A;  1PKZ A;  4PUR A;  5ECL B;  3Q6O A;  3D21 A;  2CA8 A;  1U3A A;  2YWO A;  4MF6 A;  1A8L A;  3LQ7 A;  3GX0 A;  2XBQ A;  4K7I A;  4V2L A;  4MPG A;  1GSQ A;  1VF4 A;  2V2G A;  3IR4 A;  2VCW A;  4ZBB A;  1TI3 A;  3HXS A;  1GLP A;  5G30 A;  4JED A;  3QAG A;  1NW2 A;  2C80 A;  2PPT A;  5HR0 A;  4ILF A;  1W89 A;  2RUE A;  1Z3E A;  2QGV A;  3TKP A;  3G9B A;  1XIY A;  5B6M A;  3FR3 A;  3GKX A;  4HZ4 A;  5J5N A;  2FNO A;  5B8B A;  5INY A;  4N30 A;  2FWF A;  2GVP A;  3PGT A;  1SYX A;  2HYX A;  4CDO A;  2AUV A;  3CSH A;  4IKH A;  1EWX A;  1GUH A;  2KOK A;  3APQ A;  8GSS A;  4O32 A;  1YDK A;  1R4W A;  2EC4 A;  3V1W A;  4I5Q A;  3K8N A;  4GWR A;  3CBU A;  2VIM A;  1G7E A;  1GWC A;  1X5E A;  1GSS A;  3QDN A;  2VL2 A;  3QFA C;  1K3O A;  2P0G A;  3CRU A;  5CRE A;  3U5R E;  1XFL A;  4EE0 A;  4RUV A;  1C72 A; 
#chains in the Genus database with same CATH topology
 3F14 A;  3ALA A;  2C3N A;  1GSF A;  3IXR A;  1ST9 A;  3HYP A;  2H6Y A;  2AJQ B;  3D5G A;  3X42 A;  5G5E A;  3SOA A;  2CH9 A;  3FHK A;  3DKS A;  1GSU A;  3QMX A;  3GWR A;  1ROV A;  4L5L A;  2H1B A;  2GSS A;  1XVW A;  1PL1 A;  3NBJ A;  3L0R A;  3S67 A;  2VO4 A;  1DMQ A;  1RDS A;  4XBY A;  4LYL B;  4HJM A;  1QVG 2;  3GZB A;  4R1K A;  3GSP A;  3F7S A;  3C1S A;  1UGI A;  2CFK A;  2I3Y A;  1I2E A;  4O7H A;  3IK7 A;  1GOY A;  2IIY A;  3H79 A;  1YGE A;  1BQ7 A;  3BNE A;  1Q42 A;  1V40 A;  5G2G A;  2PVO C;  3QRD A;  2MMN A;  1OGX A;  3SVA A;  3APO A;  1PY3 A;  1SJZ A;  5GSS A;  3VSY A;  1B4P A;  2IWT A;  4O5Q A;  1B2U A;  1DMM A;  3G16 A;  3D5I A;  1ZO2 A;  2DJ2 A;  2CK3 H;  2D2Z A;  2YFL B;  1LBK A;  1OKT A;  2F3M A;  2ALB A;  4MJB A;  4MPF A;  4N0V A;  3SOY A;  1TTO A;  3ZVJ D;  1BNE A;  3IPZ A;  3L9U A;  1D6U A;  1A0R P;  5B7C A;  4EDZ A;  2JZR A;  1K0C A;  2PN8 A;  1S3D A;  5HGR A;  3GN3 A;  4TX4 A;  2HE3 A;  3BIR A;  4X4J A;  5IMC A;  3PR8 A;  2R0P A;  5DDL A;  5G31 A;  2BTO T;  2L4C A;  1N8Q A;  2GU3 A;  3LTB A;  3HK4 A;  3H8Q A;  3K0Z A;  1RRL A;  2N5F A;  1STF I;  4PQ1 A;  1FG4 A;  1E2Y A;  4D73 A;  1LOW A;  3A5W A;  3I9V 2;  3RPP A;  1N8J A;  1DSB A;  1AUC A;  2GSR A;  1VQ8 3;  1HD2 A;  3DRN A;  5KP4 A;  1DBY A;  4MH3 A;  3CPO A;  1PQN A;  1JZR A;  2C4J A;  4FYU A;  1J2B A;  3N9H A;  3UAR A;  3DZL A;  2F8A A;  1HZ1 A;  1YJW 3;  4XB5 A;  1E97 A;  1KC8 4;  3ZIV A;  2QGU A;  4V1A p;  3GYK A;  1SJ6 A;  2ML5 A;  3DMC A;  1GUK A;  1K0M A;  1OKD A;  1XWK A;  3IHG A;  3QFB C;  1GRX A;  3WA3 A;  1DE3 A;  1SL1 B;  1RLS A;  4RZM A;  2W04 A;  2GSP A;  1GSE A;  3GL5 A;  3UOM A;  6GSX A;  2VL3 A;  1FVJ A;  2H0I A;  4TN8 A;  1RTU A;  2CWV A;  4K7O A;  1RGK A;  1EG9 B;  1WMJ A;  3O8Y A;  2IYJ A;  2FWG A;  1E3V A;  4IN0 A;  1DET A;  2H30 A;  1Y6E A;  2HMM B;  1JBT A;  4N6M A;  4DSR A;  4AJ7 A;  1MDJ A;  2RII A;  4EL1 A;  2IJY A;  2RLI A;  1TU8 A;  1J08 A;  4HM4 B;  4JBB A;  1TRV A;  3HKR A;  4G2E A;  1IDP A;  3WT1 A;  1F8N A;  1S3C A;  4XTS A;  2LUS A;  1X1X A;  2CVK A;  4OD7 A;  3D4T A;  1ML6 A;  4PQH A;  2H0G A;  3P2A A;  4X2O A;  3IE3 A;  1BIR A;  1FO5 A;  3CCE 3;  1X5C A;  3Q19 A;  1O7M B;  3FRC A;  1JKG B;  3BJ5 A;  3ZIT A;  4HYZ A;  2HNL A;  2GDR A;  5AIH A;  1OGZ A;  4L5O A;  1SD9 A;  1RN4 A;  2INX A;  5AYS C;  2E2G A;  4WF5 A;  3LXU X;  2HMK B;  4MJD A;  3RNT A;  3E9J B;  1CH0 A;  1BNF A;  2HMN B;  3CD6 3;  3LW9 A;  1JB4 A;  1EEM A;  3UIW A;  2KUC A;  4J2F A;  2VL9 A;  1TOF A;  1NB3 I;  6GSU A;  2KF3 A;  4KVH A;  1EOG A;  4ZL7 A;  1EGO A;  5IG4 A;  3DD3 A;  2LJR A;  4O5U A;  1BED A;  1YKA A;  1OHP A;  5DBQ A;  1OE8 A;  3EE2 A;  6STD A;  2XR8 B;  1YJ6 A;  2KCD A;  4EBG A;  4F03 A;  4AGS A;  3IA1 A;  1FB0 A;  2H70 A;  3K63 A;  4MZW A;  1C7H A;  2I9W A;  2C0F A;  2RNT A;  2R4I A;  1YQ1 A;  1VQN 3;  3B4O A;  4MMY B;  3TJF A;  3KM6 A;  3DVX A;  2KHP A;  1E3R A;  4NXI A;  1GH2 A;  5CK6 A;  1US1 A;  2Y73 A;  1WIK A;  1TRS A;  2GU1 A;  2OE0 A;  4GTU A;  3F4S A;  1TIJ A;  3MKI A;  4DKI A;  1PU4 A;  3RHC A;  3F8U A;  2XC2 A;  3TUE A;  1BYE A;  3CPW 2;  3U6V A;  5J3R A;  2CVD A;  2XHF A;  4IQA A;  2F5W A;  3HIG A;  2KF5 A;  3QPM A;  2CX0 A;  3ZZX A;  6GSW A;  1RQM A;  4CHS A;  3L78 A;  2FHE A;  3ZG0 A;  3DH2 A;  1VQ5 3;  2D1W A;  4O02 B;  2C11 A;  3LXZ A;  2VCQ A;  2F98 A;  5DJM A;  4K61 A;  2E7P A;  2F56 A;  4EW5 A;  1QXH A;  1ZX2 A;  1A2L A;  5RNT A;  5ELG A;  2A2R A;  3IK9 A;  5GAN D;  2RM5 A;  3EJV A;  12GS A;  2K8V A;  4N6L A;  2VCX A;  1OYJ A;  2SBL A;  4O8S A;  3M3M A;  4STD A;  1XW6 A;  1AQW A;  4ZIL A;  2DBC A;  3CQF A;  3VI7 A;  3TOU A;  2N5A A;  1FW1 A;  2IME A;  3NM7 A;  4NV5 A;  1IYY A;  1G0T A;  1MWT A;  1HNC A;  3DEX A;  2HRF A;  4X2H A;  2V1L A;  4ECJ A;  3DGY A;  2H73 A;  3KE7 A;  3F8X A;  5G2Z A;  7RNT A;  1XW9 A;  4O92 A;  3FZ5 A;  4KAE A;  3TRP A;  3PCS A;  1DE1 A;  3LOR A;  4HM8 B;  4MF5 A;  2CFL A;  3NX0 A;  3ER7 A;  1GYB A;  3CCL 3;  3A2W A;  4KCA A;  1GSY A;  1PA3 A;  5JCG A;  1JRQ A;  1XPV A;  4BTY A;  4Z7X A;  1FGT A;  4MDC A;  3UBL A;  3M8C A;  3F6D A;  2P0M A;  2LYX A;  2CKF B;  4ECI A;  3MPH A;  1O7N B;  3X40 A;  1T4Y A;  3G7J A;  4ZB8 A;  1YEX A;  4J9A A;  4G0K A;  1SJW A;  3V99 A;  1WP0 A;  1IVX A;  1WMO A;  1O7P B;  1XG8 A;  3C71 A;  2HML B;  4ML1 A;  2OBI A;  4EV2 A;  5CRG A;  1SII A;  4CCV A;  3CSJ A;  1TK5 B;  1IYI A;  1NHO A;  1MEK A;  2AB6 A;  1IVU A;  1LU4 A;  3EHC A;  3TCO A;  2R41 A;  5IIZ A;  1EA2 A;  3PYJ A;  2OBK A;  3G71 3;  3TB2 A;  1VF2 A;  4BL7 B;  5LNK e;  3CSI A;  1BNS A;  1YVB I;  1M3J A;  3O76 A;  3MG3 A;  3SWL A;  3PH9 A;  2FD3 A;  4FYB A;  3UVH A;  2JQ5 A;  3FF0 A;  5GST A;  2FXT A;  2CX4 A;  5CRW A;  5AII A;  2V41 A;  1TKD B;  1S3A A;  1T4Z A;  1HYU A;  4IP1 A;  3KGK A;  3F8H A;  2NBS A;  4POM A;  5EL8 A;  1GOV A;  5FT3 A;  2H1A A;  3Q74 A;  2PWJ A;  3UL5 A;  3EUR A;  2ZNM A;  1PL2 A;  1GUM A;  1Q86 4;  3O3T A;  4YAP A;  2UGI A;  1BRS A;  4WYK A;  3KSE D;  4HM0 B;  2ON7 A;  2H75 A;  2AAE A;  2BMR B;  3TKS A;  1FGR A;  4FO5 A;  1YIJ 3;  4N0Z A;  3NBB A;  1TK0 B;  3LOY A;  3WR2 A;  2KP2 A;  4NWY A;  3KH7 A;  2MYG A;  2YPM A;  4GLT A;  4F0B A;  2X99 A;  2YFI B;  4KDY A;  2M46 A;  3CC4 3;  2CX1 A;  3FZW A;  3VF1 A;  1HKX A;  4RBN A;  2LKU A;  3GKM A;  2RCD A;  1ULI B;  1OC9 B;  2R2J A;  1JLW A;  2V6K A;  2GST A;  2H72 A;  4LL1 B;  2B5E A;  2LQO A;  2UX0 A;  5ECO B;  3GRX A;  5H5S A;  5ID2 B;  3BLZ A;  5BU4 A;  2YZU A;  4N6T A;  5F8B A;  2W9Q A;  3STD A;  2YZH A;  1K3Y A;  1RGA A;  3PZW A;  1LNI A;  4X1U A;  1O7U A;  2CFW A;  1AR0 A;  1M2B A;  2HSH A;  2WZ9 A;  1O85 A;  1Q7H A;  2DIZ A;  4X0X A;  5D81 A;  3LEF A;  1ERV A;  4KDX A;  4MLY A;  1N9J A;  3OWY A;  2CT6 A;  1U87 A;  1T7P B;  2V6O A;  3F4R A;  2JSZ A;  2PNC A;  4JR4 A;  3RDW A;  4NV2 A;  2FA8 A;  1TFO A;  4AJ6 A;  1SAR A;  3GSS A;  4DSQ A;  1RGH A;  2X8H A;  2WB9 A;  2GZY A;  3MWH A;  2YP6 A;  2I9H A;  4XS4 B;  5DRV A;  1EOH A;  1SJI A;  3FF2 A;  2XRX B;  5LC7 A;  5D9X A;  3ZRD A;  4OCE A;  4KDU A;  2O7K A;  3LH4 A;  2H0H A;  4TRX A;  1BNR A;  5BXQ A;  1JZW A;  5JCU A;  4K9Z A;  2LQV A;  3EPT A;  2RBI A;  2E2V A;  4K7N A;  4YQM A;  4MNN A;  2EIR A;  4G0L A;  4OCF A;  3IAS 2;  2HSM A;  1OHS A;  2HZE B;  2V1M A;  5ELJ A;  4TR0 A;  3I6A A;  4HSC X;  3AMO B;  1IYH A;  3C1R A;  3CTF A;  3F9U A;  4BVY A;  1GY7 A;  4V2M A;  4MZB A;  2PER A;  1QGV A;  3EBT A;  4FQU A;  1QJG A;  3DVW A;  3NOF A;  1TP6 A;  4POB A;  1F3B A;  1OUN A;  2BMQ B;  3IDV A;  4LZI A;  4L0U A;  3CCJ 3;  3LTC A;  1TI1 A;  1JV2 B;  3H3H A;  2C0G A;  5DQY A;  2Q07 A;  3I0Y A;  5IMF A;  2D42 A;  4FMD A;  3RPN A;  3ZTL A;  4R4K A;  3PCR A;  2RSX A;  3VPQ A;  2VLT A;  3FW2 A;  3N8B A;  2R0C A;  3EMP A;  1TTZ A;  2HT9 A;  3CXG A;  3J7Y d;  2CFG A;  3BND A;  1M7T A;  2WGR A;  2BU4 A;  1A2J A;  1FAA A;  1K0D A;  2A2S A;  3BNB A;  1GSP A;  1W01 A;  4R80 A;  4K6X A;  5ECN B;  4DEJ A;  4EO3 A;  1R26 A;  2PUK C;  2B24 B;  5M19 A;  2HRK A;  3KFQ C;  4Q5Q A;  3NZN A;  4ORL A;  1K0A A;  5LD0 A;  1K73 4;  3OXA A;  4EV5 A;  2L5O A;  1B3S A;  3KN4 A;  2LNT A;  4GCI A;  1X1W A;  1S5A A;  3ZFZ A;  1EP7 A;  3GHA A;  5KOX A;  2OOV A;  3VFI A;  2PU9 C;  2JZT A;  1OF5 A;  16GS A;  1AAZ A;  4EXR A;  3DML A;  3R2Q A;  2VCT A;  3GST A;  3GUS A;  4GST A;  2TIR A;  4GXZ A;  1FUS A;  5ECK B;  5CP1 A;  3LTA A;  2R0G A;  3ED3 A;  3HVN A;  3UL3 A;  4ZM8 A;  3A3T A;  4K0G A;  1BAN A;  4J5G A;  1U3I A;  1OH0 A;  2W56 A;  2IA7 A;  4USS A;  4QL9 A;  5D9W A;  2BT3 A;  2F5M A;  3HDC A;  2AAW A;  1H4O A;  1CEW I;  1QMA A;  3MG2 A;  4ICY A;  1ERU A;  3OV4 A;  3TRQ A;  4WBR D;  1EKM A;  5ENU A;  4H86 A;  5IMV A;  5IPH A;  2XSH B;  4FMC A;  2R5G A;  2M72 A;  2B7J A;  1UUW B;  4HZ2 A;  3AGN A;  3FR9 A;  1GD3 A;  4ZXG A;  5LCZ A;  1VZZ A;  1TXX A;  2J8X B;  1V2A A;  4K5S A;  4I2U A;  1UGH I;  5KN0 A;  3OW2 2;  4KZ1 A;  1HNB A;  17GS A;  4HS1 A;  5AGY A;  3UJ1 A;  3LML A;  3CTG A;  3D9R A;  4HEA 2;  1BOX A;  1HQO A;  1I5G A;  4AKY A;  1A2K A;  5IO2 A;  1X9W B;  3T8U A;  3KJY A;  3NXJ A;  2P5R A;  2E2U A;  5AIV A;  3ZMK A;  4BU4 A;  2PMT A;  4ZIJ A;  5F07 A;  4GSN A;  1VQ7 3;  6GSS A;  4IGJ A;  1WPI A;  1GL8 A;  4BL2 A;  1M9A A;  1BSA A;  2K9F A;  2K8S A;  1YHQ 3;  2VM1 A;  3UL6 A;  5F05 A;  3W8S A;  4XRA A;  3DY5 A;  4BA7 A;  3QCP A;  1XZO A;  2VLU A;  1DYU A;  1A8Y A;  1EZK A;  1MWS A;  2JAD A;  2C3T A;  1KBN A;  1WMP A;  4K8M A;  3NQZ A;  3FG1 A;  4LEH A;  1VQP 3;  4FYC A;  5L71 A;  1KQS 2;  3JUN A;  1JN5 B;  3GTU A;  1B2Z A;  1QK8 A;  2YFJ B;  3K9M C;  4RQX A;  7GSS A;  1VQ9 3;  3N5O A;  1FGO A;  3IMA B;  3MG1 A;  3GNJ A;  4KA0 A;  1I0X A;  1ZGN A;  1RGF A;  3D6I A;  4EVM A;  1B21 A;  1DVD A;  5D82 A;  1BAO A;  3LG6 A;  1PGT A;  2DSA A;  3KP8 A;  1TRU A;  4TKY A;  5KN1 A;  1BRI A;  3GZY B;  3IAM 2;  4FCZ A;  1HU9 A;  2QIY A;  3RDE A;  1ZYP A;  1ZCP A;  3PGB A;  2IFQ B;  4K2D A;  4KCE A;  2DLX A;  1BSB A;  2W9P A;  2C0E A;  2YN1 A;  1QAK A;  2BHM A;  4BWQ A;  1R7H A;  5STD A;  3CMI A;  1D6Z A;  1QAL A;  1AXD A;  3NM2 A;  3KP9 A;  3NHX A;  4HOH A;  1B9Y C;  4RNZ A;  3M1G A;  4IQ1 A;  2B7K A;  3ME8 A;  3P7X A;  1SL0 B;  1UCI A;  2AYT A;  1PSQ A;  1AVL A;  3BCI A;  5EY6 A;  3EIN A;  3A2X A;  5HQP A;  5KP3 A;  3BOA A;  1ILO A;  2REM A;  1X0R A;  5AEW B;  1GNE A;  2JU5 A;  2NPB A;  2QKE A;  1JLV A;  3HII A;  1Z7P A;  5D9T A;  4K90 B;  1W5Z A;  3L0H A;  2JSY A;  1J9B A;  2WJU A;  3F40 A;  2MBT A;  1KWI A;  3GFK A;  1M3I A;  2WFC A;  1GMQ A;  2W0Q A;  5DQS A;  1RCL A;  1A24 A;  3AHS A;  5AEU B;  5B6N A;  1BX9 A;  2HOH A;  4HOJ A;  1M99 A;  2PGT A;  2JZS A;  14GS A;  4V1A g;  2C3Q A;  1LQG C;  4KT3 B;  1R4Y A;  1Z1S A;  3UVT A;  1PFP A;  1STD A;  3OX9 A;  4LLR A;  2RM6 A;  1UA5 A;  4TR1 A;  1PFO A;  2GS3 A;  1VQQ A;  3ISO A;  5J9B A;  1M1K 4;  1OHO A;  2ZHX B;  5J4U A;  1JB2 A;  5EVH A;  2CVB A;  2MZC A;  1OAC A;  2LRC A;  3NV0 A;  4ECC A;  1UVZ A;  1OC3 A;  2J9H A;  2Y74 A;  3ERF A;  3HX8 A;  5HOH A;  1OC8 A;  4RQR A;  2WO0 A;  3TKR A;  4YQV A;  4ZL9 A;  2KXG A;  1WMN A;  1FGM A;  1M2A A;  3P90 A;  3FCS B;  1S3R A;  3JUM A;  3EYT A;  1O6J A;  2OAD A;  5FGO A;  1VF3 A;  3X41 A;  1O7H B;  4MMX B;  4ZL8 A;  2DJ1 A;  4L8O A;  1R5P A;  2WDU A;  2W03 A;  2GQK A;  3FSD A;  2F4Y A;  3BD2 A;  11GS A;  1XWB A;  2Z6B A;  1B2M A;  5G1L A;  1OPY A;  2H6Z A;  1TDI A;  5D93 A;  1I70 A;  4KSM A;  3EU3 A;  3KCH A;  4BWS A;  5IF6 A;  1VF1 A;  1F2E A;  1GMR A;  2C0D A;  4WFO A;  3LGC A;  2R6K A;  1RGL A;  3G7I A;  3HY2 A;  1SKW B;  1IV7 A;  5JPP A;  4XS1 A;  2GT5 A;  1AC1 A;  5F06 A;  4BVX A;  3VLN A;  3HJM A;  2Z77 A;  2YWI A;  1IT8 A;  2H6X A;  4EC0 A;  1PD2 1;  1BRG A;  2JAC A;  3GZR A;  1NSW A;  1W4N A;  4HM1 B;  2W2C A;  1ERT A;  3JCM L;  4X43 A;  2HI7 A;  3AHW A;  4OFN A;  5BVB A;  1CYU A;  2H1G A;  3CNX A;  1F6M C;  1ZOF A;  1XOB A;  3L9S A;  5B8A A;  5CF2 A;  3WMD A;  4ECB A;  4MMZ B;  3D4A A;  1ZYE A;  2IPA A;  5KOW A;  1BRN L;  1MOL A;  3GL3 A;  5BMU A;  3X3Z A;  1AQX A;  4OO4 A;  4E8E A;  3GMF A;  4O5R A;  1K0B A;  1Y25 A;  4I2T A;  1GP1 A;  1AY7 A;  2LRN A;  4GSP A;  5IW9 A;  2L4Q A;  4K2X A;  4POL A;  1RGE A;  3ZML A;  1CQG A;  1I9D A;  1MD3 A;  3DWV A;  3WD6 A;  3FK8 A;  2IMF A;  2WCI A;  3FMW A;  4HM7 B;  4XDW A;  4RI6 A;  5C04 A;  5IMZ A;  4HZ9 B;  4PX1 A;  4Z2U A;  1YZX A;  2BMO B;  4G1M B;  2JDI H;  4CJN A;  1GMP A;  3SLU A;  4OVM A;  3H51 A;  3CME 3;  1FVK A;  4BIR A;  3EB8 A;  4EC6 A;  2LJA A;  4DSS A;  1B8X A;  1T1V A;  5A4V A;  1M2D A;  1HYF A;  4OMV A;  2GZZ A;  3F3R A;  1K41 A;  3K7C A;  5DAL A;  2Z7A A;  3DYR A;  5JPU A;  1LXE A;  5ECR B;  3UBK A;  4MZC A;  6GST A;  3EF8 A;  1MWR A;  3TKS E;  3F3Q A;  3HJP A;  5FHI A;  2GGT A;  4GQC A;  5CNW A;  4Z2T A;  1OE7 A;  2C10 A;  2FGT A;  1WOU A;  4R9K A;  3ERW A;  2G0F A;  4E8H A;  4YKF A;  4IJI A;  4HM2 B;  3KSP A;  4AJ8 A;  1O81 A;  1XWC A;  4QL7 A;  3DGN A;  1SQW A;  3UNL A;  3ZVJ A;  4Q5R A;  4JRR A;  3MWZ A;  1UCJ A;  1FHE A;  2P05 A;  1K28 A;  2O8V B;  4WF4 A;  5A4U A;  3A76 A;  2TRC P;  3LYG A;  2OAC A;  3GX8 A;  3VWW A;  4XHM A;  1A0F A;  1LOX A;  8RNT A;  19GS A;  3BBY A;  2A4V A;  1BSD A;  4ACS A;  1KNG A;  4POK A;  2NDO A;  3HI7 A;  2DML A;  2R37 A;  3HZ4 A;  5AN1 A;  2BIR A;  3VPT A;  4KE3 A;  1W6G A;  3Q2P A;  2G2Q A;  1MGR A;  1KTE A;  1TFK A;  4KSO A;  1QQ2 A;  3K5T A;  2IN3 A;  4QQ7 A;  3M8N A;  6GSY A;  3F4T A;  4TXV A;  1ROA A;  5IQY A;  4HZB B;  5ECS A;  2GBW B;  2DJ3 A;  5H5R A;  2L4V A;  5EPF A;  3E99 A;  4N3V A;  5J9C A;  3J7Y k;  5IMD A;  5KEJ A;  4HM5 B;  1UUG B;  2TRX A;  4HDE A;  1K8A 4;  4TXO A;  4HKV B;  2WS2 A;  2XF3 A;  4HU9 A;  1GLQ A;  2ZDJ A;  2K3D A;  3KII A;  1ACV A;  2LEG A;  4CW9 A;  5A4W A;  1YY7 A;  4JR6 A;  1IQX A;  3JVC A;  3ZLP A;  1RSN A;  1I3I A;  2AHE A;  2XGN A;  4OFM A;  5HFK A;  4EYC A;  3ZG5 A;  1XXU A;  2F8F A;  3F63 A;  1B27 A;  5JWO B;  3DGO A;  2FUG 2;  3FY7 A;  3VWU A;  4IW9 A;  1JNQ A;  3CCS 3;  4BIK A;  3WOF B;  1FZU A;  5EVO A;  2HZF A;  1BSC A;  2XFS A;  2OQE C;  3HVS A;  2CZ3 A;  2CWT A;  1SKR B;  1Q40 B;  1TRQ A;  3RGA A;  1AV4 A;  5JWR B;  2LRT A;  3GAX A;  1B4Q A;  2CZ2 A;  1BNJ A;  2P0X A;  2STD A;  2FY6 A;  3FH1 A;  3IC8 A;  4L8P A;  5ECM B;  2N5B A;  5IPG A;  2OCT A;  2VAF A;  1T3B A;  2OKA A;  4P3Y B;  1X5D A;  4EUY A;  1OCV A;  4FCJ A;  5BIR A;  3HJO A;  4AF2 A;  2CG1 A;  4KND A;  5GZZ B;  1XCC A;  3C7M A;  4LMI A;  1LVN A;  2GQL A;  2LST A;  4NPB A;  1I2G A;  4RNY A;  2QA1 A;  3C8E A;  3FEU A;  4JE1 A;  3MYT A;  3L4N A;  1NWW A;  1VGL A;  2KP1 A;  4BVY B;  4F9Z A;  3GUR A;  1UCL A;  1DVC A;  3FG4 A;  1VQ4 3;  4N6U A;  1BG5 A;  2B3S A;  2CW9 A;  4HM6 B;  4I8B A;  2CV4 A;  3ZRE A;  3IPT A;  1Z6M A;  2FLS A;  2I1U A;  5J41 A;  1KD1 4;  2VOC A;  3HHV A;  1YF1 A;  3CCR 3;  5G5F A;  1A2P A;  3ZFL A;  1UDI I;  4IT7 A;  3FYG A;  1FA3 A;  3GKK A;  18GS A;  2CIU A;  4MEI A;  2F9S A;  1RN7 A;  1K0O A;  2KLX A;  2HRA A;  3LT8 A;  1RGG A;  1TRW A;  1TUH A;  2H8L A;  3MHE A;  3S5C A;  4KH7 A;  4XCS A;  1V98 A;  3KXO A;  4LA1 A;  1FUW A;  1Z5Y E;  1VQM 3;  20GS A;  3MSZ A;  1M1X B;  1WQL B;  1PYL A;  3VWX A;  1F3A A;  2L57 A;  7STD A;  1G96 A;  2ZCT A;  1E6B A;  1BUJ A;  4GL6 A;  2FWE A;  5CXO A;  8CHO A;  1MWU A;  3KD0 A;  4RI7 A;  5IMA A;  1OF5 B;  4GHO A;  4FIW A;  2IL3 A;  2GQM A;  3CU3 A;  1UI8 A;  3CXC 2;  4Q53 A;  1VQ6 3;  4YKG A;  3I55 3;  4K1V A;  4OFT A;  2DJJ A;  4PUA A;  4EIP A;  3G8Z A;  1FB6 A;  1HNA A;  5DVB A;  2MF7 A;  2R3X A;  4R9L A;  2Z76 A;  1MGW A;  3FZA A;  4CY8 A;  2B1K A;  2OWP A;  3B8L A;  4LMW A;  2I81 A;  3M0F A;  5D73 A;  3IV4 A;  2GXF A;  4HM3 B;  5HR3 A;  1N9E A;  2X64 A;  4G10 A;  2M80 A;  2QEX 3;  1PX6 A;  3SX1 A;  2PVQ A;  3DUK A;  2WGQ A;  1B48 A;  1Z9H A;  3EWL A;  1V74 A;  3KCM A;  1LRA A;  4ZBA A;  1EEJ A;  5CRH A;  3TRX A;  4MP4 A;  5G1K A;  3APS A;  2PBJ A;  4WXT A;  2WOF A;  1MDK A;  1W6Y A;  4N6V 0;  2XPE A;  3G4S 3;  3ERG A;  4K5R A;  5DJL A;  2X8G A;  5AIG A;  3PPU A;  1K3L A;  5DAK A;  4EKZ A;  4N11 A;  1PN9 A;  4J8T A;  3TGZ A;  5BRT A;  1N2A A;  3N9J A;  4LSO A;  5IEO A;  2QA2 A;  2HMO B;  1YI2 3;  3D79 A;  1RGC A;  3V98 A;  1QFN A;  2MC8 A;  1M9G A;  1EUI C;  4XS4 A;  3LFL A;  5IG5 A;  3M9J A;  4HAA A;  2P38 A;  3LSZ A;  3H1N A;  1VQO 3;  4JU5 A;  1ZYQ B;  1ZMA A;  1XWA A;  5JBS A;  4MK3 A;  9GSS A;  3GTU B;  2ZL8 A;  1NDO B;  2IMJ A;  2IUK A;  5D9V A;  2HZE A;  2UZ8 A;  4GQF A;  1ULJ B;  3B4P A;  5KN2 A;  2BJX A;  1WNH A;  1FOV A;  3AMO A;  1KEB A;  1QMV A;  3D0Z A;  2NTO A;  3A5I A;  1Z7R A;  4WET A;  1ZS7 A;  3LXT A;  4PQI A;  4OK0 A;  3JUO A;  1J0F A;  3RHB A;  1X9S B;  1UCK A;  4IEL A;  1W00 A;  4I97 A;  5HFG A;  1M0U A;  2CWU A;  4WEY A;  1EP8 A;  2GEY A;  2XBI A;  1URM A;  5HR1 A;  3URP A;  5ELU A;  2AAD A;  3JUQ A;  3PIN A;  3S29 A;  2JL4 A;  1BRK A;  3KMO A;  2WUL A;  1Q4J A;  2LV3 A;  1DE2 A;  3QOU A;  1NM3 A;  2O85 A;  1WWJ A;  4NMU A;  3EN1 B;  4D73 B;  2XH9 A;  1W4V A;  1PN0 A;  3I56 3;  3ECF A;  3EC3 A;  5CRD A;  2OE1 A;  4F82 A;  1GTB A;  1O7W B;  3T8N A;  1UI7 A;  2ON5 A;  4BPY A;  1Y4K A;  3TKS C;  1JHB A;  1U88 A;  1F9M A;  1JZO A;  4LMV A;  1EV9 A;  3CCM 3;  2L6D A;  1GY6 A;  2YX9 A;  1EQK A;  3KTB A;  1LOV A;  2IMD A;  5GAP D;  3WA2 X;  1UUV B;  4HJL B;  2DJK A;  3NBR A;  2GBX B;  3TJK A;  1M90 4;  4MJE A;  3BNC A;  1O8X A;  4TR1 B;  2X4A A;  3Q3F A;  1N5H A;  1TU7 A;  3B7C A;  3RGR A;  2HXK A;  2GTU A;  2I4A A;  1Z6N A;  2IUJ A;  3DXO A;  2FWH A;  3NV0 B;  4OUQ A;  3RBT A;  3G0K A;  1BNG A;  2LTK A;  1A23 A;  4IVF A;  4DVC A;  2QA4 3;  2MBS A;  4IP6 A;  3HVX A;  2B1L A;  5CYY A;  3WGE A;  3WHO A;  1FOH A;  4Q5F A;  1TW9 A;  2BO9 B;  4HQZ A;  4EXJ A;  3IRA A;  1M9B A;  1R5A A;  2QC7 A;  5AYR B;  3OWU A;  1I2F A;  1X9M B;  4I4K A;  4TR3 A;  3MIX A;  3HZ8 A;  2P5Q A;  4G19 A;  3FGY A;  1USB A;  3TKQ A;  4MCU A;  3BB9 A;  1PMT A;  1XW5 A;  3EU4 A;  3UB1 A;  2MMO A;  1RRH A;  3AY8 A;  2OE3 A;  3SBC A;  1X1Y A;  1BGS A;  9RNT A;  3KZQ A;  3Q18 A;  3HCZ A;  5DRE A;  3SED A;  5ELA A;  4MA9 A;  4YH2 A;  1IU7 A;  3S28 A;  3CCQ 3;  1YKC A;  2FCH A;  1G7O A;  1GNW A;  1XOA A;  1EV4 A;  3ZIJ A;  1FGQ A;  2LQQ A;  3OR5 A;  3F9S A;  2AV4 A;  1A2V A;  2C1Y A;  5GSP A;  2CAI A;  5AIS A;  4N10 A;  1RHL A;  3EQQ B;  1T00 A;  2GZP A;  1UN2 A;  3HZP A;  4BVX B;  1UC7 A;  4NHF A;  2IY2 A;  1QUW A;  2H74 A;  1LQM B;  4BTW A;  1PKW A;  1IQY A;  1YIT 3;  1PX7 A;  1IV9 A;  1OVN A;  1ZGX A;  5IG0 A;  2VLV A;  1ERW A;  2L1S A;  3UEM A;  2VCZ A;  3GH9 A;  1JN5 A;  4AEQ A;  3D5J A;  3KTL A;  2L59 A;  1SYR A;  4ISD A;  4KX4 A;  1Q9E A;  2YAN A;  3CYN A;  3PXM A;  4IS0 A;  3E3E A;  5ABR A;  2A15 A;  2B5X A;  2K18 A;  2XGL A;  1BRJ A;  4EF0 A;  4FH8 A;  4OWY A;  2F86 B;  2ML6 A;  5IER A;  1K9M 4;  3ME7 A;  3T0U A;  3H4K A;  2UUG C;  1XVQ A;  4EIQ A;  1BJX A;  1GTA A;  2DJ0 A;  2O3O A;  2FA4 A;  2IFQ A;  2XPD A;  2L6C A;  1MTC A;  4H3U A;  3A2V A;  2KF4 A;  4XRD A;  6GSV A;  1ZZY A;  3CRT A;  5DCH A;  5E59 A;  3WOE B;  2E2T A;  5M1A A;  2OQE A;  1RNB A;  2VM2 A;  4WR4 A;  3CNM A;  2CC3 A;  3D22 A;  3FZ9 A;  4ZBD A;  4TOP A;  4PEJ A;  3WOD G;  2H76 A;  1CYV A;  3VI5 A;  1I0V A;  2OOV C;  4CDL A;  1SKS B;  4DSS B;  3EVI A;  1MNL A;  4WBJ A;  1RW1 A;  2H1D A;  2RGQ A;  4AKZ A;  5ECP B;  1AVK A;  1CQS A;  3BU4 A;  4XIH A;  5DAL B;  1B9X C;  1I8V A;  3W6G A;  4QWT A;  4GSS A;  5D8I A;  2RFR A;  3IC4 A;  4WWU C;  5LC6 A;  1NO3 A;  1NB5 I;  3LYP A;  2BMX A;  1JBS A;  1VQK 3;  3FKA A;  4KUN A;  3W8J A;  1Q98 A;  4GRF A;  1AQZ A;  2VL2 C;  2KF6 A;  1MD4 A;  3R3E A;  1S72 3;  2RUF A;  1ZYN A;  4GF0 A;  4MJC A;  5D96 A;  4EDY A;  2ZA4 A;  1XBS A;  3DGQ A;  4KFF A;  1MDI A;  3WGX A;  1BRH A;  1KSI A;  3GKN A;  1RMS A;  2OJL A;  3F6F A;  2ES7 A;  3FR6 A;  1ABA A;  5HR2 A;  2WRT A;  1OAZ A;  3RAZ A;  1TP9 A;  5COH A;  1NU3 A;  4F2I A;  3HA9 A;  4YAV A;  2YNX A;  3FLJ A;  1YJ9 3;  4NHZ A;  4WKW A;  2IMI A;  4J57 E;  1ISK A;  3Q1C A;  2LNS A;  3QAV A;  3TOT A;  4BTX A;  1T5Y A;  5I97 A;  2HRN A;  2OA7 A;  3V92 A;  5IEN A;  4XDV A;  5IM9 A;  1JFU A;  1RJO A;  3E0U A;  4MF7 A;  2B1X B;  3F0I A;  1TJD A;  1FYS A;  3J7Y b;  2K6V A;  4XBT A;  4KB3 A;  2YJ7 A;  3TDG A;  3IHQ A;  4Z2R A;  1SK2 A;  4IJ3 A;  1V9W A;  2C8U A;  3WDG B;  1LJR A;  3IBH A;  3WGD A;  2V32 A;  5ECQ B;  2H19 A;  1U6T A;  2K54 A;  4PUF C;  5ECI B;  4MH2 A;  1IQ8 A;  4HJ2 A;  4XS6 A;  2FNQ A;  2HLS A;  4KF9 A;  4TXO B;  5F0G A;  1JKG A;  4L7K A;  1W2Z A;  3US3 A;  5EQL A;  2Z9S A;  1GD4 A;  3DXB A;  4YQU A;  3LZA A;  3GIX A;  1ZL9 A;  2E2M A;  5JCW A;  3UMA A;  1LOY A;  1AQV A;  3IOS A;  1SEN A;  5TGN A;  1T2I A;  1UW1 A;  3I69 A;  2F51 A;  1G6Y A;  2YOI A;  4OO5 A;  4NRE A;  4G9H A;  1SK1 A;  1PRX A;  1B20 A;  5FW5 A;  1THO A;  1O7G B;  3FKF A;  3MAK A;  3CC7 3;  3FZ4 A;  22GS A;  1W2B 2;  2DKI A;  4LL4 B;  2OTL 3;  4PGT A;  1NHY A;  3G6E 3;  3CCU 3;  4MMM A;  3VK9 A;  4PNG A;  3WT2 A;  3SXX A;  3EN8 A;  3S9F A;  3D4M A;  4K0N A;  3L9V A;  1T8E B;  5AIX A;  2DC5 A;  1V57 A;  2VUP A;  4V2N A;  1DMN A;  2YV9 A;  4WYK B;  3EC9 A;  2C4B A;  3GA4 A;  4MJA A;  3GRD A;  1I3F A;  1U8C B;  5JWQ B;  4CY6 A;  4ML6 A;  3LT9 A;  3DGL A;  3SYU A;  1VQL 3;  2J23 A;  2H01 A;  4I6X A;  3GV1 A;  3QAW A;  4HU7 A;  4MAB A;  4ID0 A;  2HMJ B;  2CHC A;  1ON4 A;  3LWA A;  5CAX A;  4J56 E;  1W02 A;  5DCG A;  3F7X A;  1TU5 A;  3KH9 A;  2GEX A;  3U97 A;  2CAQ A;  3KMN A;  1RKY A;  1DUG A;  4JZQ A;  4PNF A;  3TJG A;  1NNV A;  1GUL A;  3PS8 A;  2EIO A;  1NJI 4;  2NVL A;  3HVV A;  4GB5 A;  5A0O B;  2LS5 A;  5IOW A;  1IT7 A;  4G0I A;  1X1U A;  6RNT A;  2O87 A;  2MMZ A;  4JF8 A;  1WRY A;  1O8W A;  1EGR A;  1V58 A;  1L5G B;  2DMM A;  4LGQ A;  3DIE A;  2ZUP A;  2KRT A;  4IIA A;  5HFI A;  4BL3 A;  4N6O B;  4KGI A;  2KAA A;  4U13 A;  1SPU A;  3TJB A;  1H75 A;  2X49 A;  2F99 A;  2B6M A;  1R4C A;  5AI1 A;  3NIV A;  4ULX A;  2E0Q A;  1SK0 A;  4IHU A;  4L8E A;  5A5K A;  4HI7 A;  1CQH A;  2P31 A;  3TJJ A;  3LJR A;  1JZD A;  3EMX A;  5FWG A;  3C73 A;  2GSQ A;  1G02 A;  2M7O A;  2LJK A;  4KW6 A;  3ZFB A;  4ZB9 A;  2FGX A;  2YWN A;  1XWG A;  2HSY A;  2O9U X;  3NQY A;  1YJN 3;  1B2S A;  5CO3 A;  4O3V A;  4FCM A;  3VUR A;  1WJK A;  4NAX A;  4FMB A;  5M18 A;  2YCD A;  1VRS D;  1A2M A;  2EIQ A;  3LYK A;  1GTU A;  2VD0 A;  3MNG A;  4PXO A;  3KZT A;  4WR5 A;  3OWS A;  1SU9 A;  2IMK A;  2VD1 A;  2A4H A;  2R4V A;  1GS3 A;  3M9K A;  2X8C A;  3VWV A;  3KKG A;  4FR9 A;  4N6N B;  2XSO B;  3BCK A;  4L0W A;  1IK3 A;  2YV7 A;  4NHW A;  2GLR A;  4H61 A;  1G6W A;  1YNV X;  5E4W A;  3AGO A;  4WP5 A;  3P8W A;  1T2H A;  2QSI A;  3MYD A;  3ZYW A;  5IO0 A;  1IVV A;  3GH6 A;  5EEO A;  4KFE A;  3D3L A;  4TR4 A;  2H66 A;  2L5L A;  4BL7 A;  3KEB A;  10GS A;  2B5Y A;  4HQS A;  2CG0 A;  3QK9 A;  1SD8 A;  1Q82 4;  4HUA A;  4CPK A;  4PTS A;  1YEP A;  3ZL5 A;  4RNT A;  2MMA A;  1O73 A;  3CC2 3;  3X3Y A;  4FMA A;  1F37 A;  3MSO A;  1BNI A;  4XM4 A;  1JJ2 2;  1AIU A;  3O6T A;  5C00 A;  5DAK B;  3QR6 A;  1QAF A;  3QD9 A;  3WYW A;  2CQ9 A;  1C54 A;  1RK4 A;  3G7Y A;  1WE0 A;  3HD5 A;  1A90 A;  3MDK A;  7GSP A;  5AIF A;  5IG3 A;  5ECH B;  1Q40 A;  4TW5 A;  1AW9 A;  3CCV 3;  2OTJ 3;  4ZB6 A;  4HBR A;  1GY5 A;  4K1F A;  4J5K A;  3JUP A;  6GSP A;  4TVE A;  3EE1 A;  2H71 A;  1GTI A;  1TK8 B;  2DIY A;  1W7C A;  1BU4 A;  1YGW A;  2CX3 A;  1GSD A;  2BNG A;  1A67 A;  4Q5N A;  3ROB A;  5KP1 A;  2GT6 A;  2VCV A;  3A5E A;  2HFD A;  3HOH A;  13GS A;  2YWM A;  2W56 B;  1THX A;  4XBX A;  4WHA A;  4IBP A;  2YJH A;  1YF0 A;  1W6C A;  5IOX A;  5KN3 A;  1BAY A;  1BSE A;  1OC9 A;  3H93 A;  3LTD A;  1SL2 B;  3CMA 3;  3KIJ A;  1FW7 A;  3GZX B;  5H5Q A;  4F0C A;  1K0N A;  3I43 A;  5ID2 A;  3UAP A;  2O89 A;  1TRP A;  2PZV A;  1PKZ A;  4PUR A;  5ECL B;  3S27 A;  1JBR A;  2XEP A;  3Q6O A;  1JB5 A;  3D21 A;  4KFD A;  2K0M A;  2CA8 A;  1U3A A;  1ASK A;  2YWO A;  5IEP A;  1N5P A;  4MF6 A;  1IVW A;  1SIH A;  1A8L A;  3N54 B;  3LQ7 A;  3IJE B;  3GX0 A;  3UJM A;  2WOH A;  5D83 A;  2XBQ A;  4K7I A;  4V2L A;  4MPG A;  1GSQ A;  2XFT A;  1VF4 A;  2V2G A;  3IR4 A;  2VCW A;  2CFD A;  3VGN A;  1TI3 A;  3HXS A;  4ZBB A;  3DM8 A;  1GLP A;  5G30 A;  4JED A;  3QAG A;  4JRF A;  1NW2 A;  2C80 A;  2PPT A;  5HR0 A;  4ILF A;  1W89 A;  2RUE A;  1Z3E A;  4HVN A;  2QGV A;  3TKP A;  3G9B A;  2P09 A;  1RNT A;  4O2H A;  1Q7Y 4;  1XIY A;  1WTH A;  5B6M A;  3FR3 A;  1N8R 4;  3GKX A;  4HZ4 A;  1BUQ A;  5J5N A;  2FNO A;  5B8B A;  5INY A;  4N30 A;  2FWF A;  2GVP A;  3PGT A;  1SYX A;  2HYX A;  4CDO A;  1Q81 4;  2AUV A;  3CSH A;  2WGO A;  4IKH A;  1EWX A;  1GOU A;  1GUH A;  5CF1 A;  2KOK A;  1LNH A;  3APQ A;  3NUV A;  8GSS A;  4O32 A;  3U1W A;  1YDK A;  1U5O A;  1B2X A;  1FUT A;  3FG3 A;  1R4W A;  2EC4 A;  3V1W A;  4I5Q A;  1BVI A;  3K8N A;  4GWR A;  4IPB A;  2VIM A;  3CBU A;  3EX9 A;  1G7E A;  1RCK A;  1GWC A;  1X5E A;  1GSS A;  3QDN A;  3DGM A;  1QVF 2;  2VL2 A;  2A2P A;  1D6Y A;  5CLK A;  2DKH A;  3QFA C;  3EBY A;  4A5P A;  1RN1 A;  1K3O A;  2P0G A;  3CRU A;  2SAR A;  5CRE A;  3U5R E;  1XFL A;  3X3X A;  2W6J H;  1YVS A;  4EE0 A;  4RUV A;  4K1U A;  3Q90 A;  1C72 A; 
#chains in the Genus database with same CATH homology
 2C3N A;  1GSF A;  3IXR A;  1ST9 A;  3HYP A;  2H6Y A;  2AJQ B;  5G5E A;  3FHK A;  3DKS A;  1GSU A;  3QMX A;  4L5L A;  2H1B A;  2GSS A;  1XVW A;  1PL1 A;  2VO4 A;  4HJM A;  3C1S A;  2I3Y A;  4O7H A;  3IK7 A;  2IIY A;  3H79 A;  1BQ7 A;  1V40 A;  2PVO C;  2MMN A;  3APO A;  1SJZ A;  5GSS A;  1B4P A;  2IWT A;  4O5Q A;  2DJ2 A;  2D2Z A;  1LBK A;  1OKT A;  2F3M A;  2ALB A;  4MJB A;  4MPF A;  4N0V A;  3ZVJ D;  3IPZ A;  3L9U A;  1A0R P;  5B7C A;  4EDZ A;  2JZR A;  1K0C A;  2PN8 A;  1S3D A;  3GN3 A;  2HE3 A;  4X4J A;  5IMC A;  3PR8 A;  2R0P A;  5DDL A;  5G31 A;  2BTO T;  2L4C A;  3H8Q A;  2N5F A;  4PQ1 A;  1FG4 A;  1E2Y A;  4D73 A;  3A5W A;  3I9V 2;  3RPP A;  1N8J A;  1DSB A;  1AUC A;  2GSR A;  1HD2 A;  3DRN A;  1DBY A;  4MH3 A;  1PQN A;  1JZR A;  2C4J A;  4FYU A;  3UAR A;  2F8A A;  3ZIV A;  4V1A p;  3GYK A;  1SJ6 A;  1GUK A;  1K0M A;  1OKD A;  1XWK A;  3IHG A;  3QFB C;  1GRX A;  1SL1 B;  1GSE A;  3GL5 A;  3UOM A;  6GSX A;  2VL3 A;  1FVJ A;  2H0I A;  4TN8 A;  4K7O A;  1WMJ A;  2IYJ A;  2FWG A;  4IN0 A;  2H30 A;  1Y6E A;  4DSR A;  4AJ7 A;  1MDJ A;  2RII A;  4EL1 A;  2IJY A;  2RLI A;  1TU8 A;  1J08 A;  4JBB A;  1TRV A;  3HKR A;  4G2E A;  3WT1 A;  1S3C A;  4XTS A;  2LUS A;  2CVK A;  4OD7 A;  3D4T A;  1ML6 A;  4PQH A;  2H0G A;  3P2A A;  3IE3 A;  1FO5 A;  1X5C A;  3Q19 A;  3FRC A;  3BJ5 A;  3ZIT A;  2HNL A;  2GDR A;  4L5O A;  1SD9 A;  2E2G A;  4WF5 A;  3E9J B;  3LW9 A;  1EEM A;  3UIW A;  2KUC A;  4J2F A;  2VL9 A;  1TOF A;  6GSU A;  1EOG A;  4ZL7 A;  1EGO A;  3DD3 A;  2LJR A;  4O5U A;  1BED A;  1YKA A;  5DBQ A;  1OE8 A;  3EE2 A;  1YJ6 A;  4F03 A;  4AGS A;  3IA1 A;  1FB0 A;  2H70 A;  4MZW A;  2C0F A;  1YQ1 A;  3TJF A;  3KM6 A;  3DVX A;  2KHP A;  4NXI A;  1GH2 A;  1WIK A;  1TRS A;  4GTU A;  2OE0 A;  3F4S A;  3RHC A;  3F8U A;  2XC2 A;  3TUE A;  1BYE A;  3U6V A;  5J3R A;  2CVD A;  2XHF A;  4IQA A;  3QPM A;  3ZZX A;  6GSW A;  1RQM A;  4CHS A;  3L78 A;  2FHE A;  3LXZ A;  2VCQ A;  5DJM A;  2E7P A;  1QXH A;  1A2L A;  5ELG A;  2A2R A;  3IK9 A;  5GAN D;  2RM5 A;  12GS A;  2K8V A;  2VCX A;  1OYJ A;  3M3M A;  1XW6 A;  1AQW A;  4ZIL A;  2DBC A;  3VI7 A;  3TOU A;  2N5A A;  1FW1 A;  2IME A;  4NV5 A;  1G0T A;  1HNC A;  3DEX A;  2HRF A;  4ECJ A;  2H73 A;  5G2Z A;  1XW9 A;  4O92 A;  3FZ5 A;  4KAE A;  3TRP A;  1DE1 A;  3LOR A;  4MF5 A;  3A2W A;  4KCA A;  1GSY A;  1PA3 A;  5JCG A;  1XPV A;  4Z7X A;  3UBL A;  4MDC A;  3F6D A;  4ECI A;  1T4Y A;  3G7J A;  4ZB8 A;  1YEX A;  4G0K A;  1WP0 A;  3C71 A;  4ML1 A;  2OBI A;  5CRG A;  3CSJ A;  1TK5 B;  1NHO A;  1IYI A;  1MEK A;  2AB6 A;  1LU4 A;  3TCO A;  5IIZ A;  2OBK A;  3TB2 A;  1VF2 A;  4BL7 B;  5LNK e;  3CSI A;  3O76 A;  3SWL A;  3PH9 A;  2FD3 A;  4FYB A;  3UVH A;  5GST A;  2CX4 A;  5CRW A;  2V41 A;  1TKD B;  1S3A A;  1T4Z A;  1HYU A;  4IP1 A;  3KGK A;  2NBS A;  4POM A;  5EL8 A;  5FT3 A;  2H1A A;  3Q74 A;  2PWJ A;  3EUR A;  2ZNM A;  1PL2 A;  1GUM A;  3O3T A;  4YAP A;  2ON7 A;  2H75 A;  3TKS A;  4FO5 A;  4N0Z A;  1TK0 B;  2KP2 A;  4NWY A;  3KH7 A;  2MYG A;  2YPM A;  4GLT A;  4F0B A;  2X99 A;  4KDY A;  2M46 A;  2LKU A;  3GKM A;  1OC9 B;  2R2J A;  1JLW A;  2V6K A;  2GST A;  2H72 A;  4LL1 B;  2B5E A;  2LQO A;  5ECO B;  3GRX A;  5H5S A;  5ID2 B;  2YZU A;  5F8B A;  2YZH A;  1K3Y A;  4X1U A;  1O7U A;  2HSH A;  1M2B A;  2WZ9 A;  1O85 A;  2DIZ A;  4X0X A;  3LEF A;  1ERV A;  4KDX A;  4MLY A;  2CT6 A;  1U87 A;  1T7P B;  2V6O A;  3F4R A;  2JSZ A;  4JR4 A;  3RDW A;  4NV2 A;  2FA8 A;  4AJ6 A;  3GSS A;  4DSQ A;  2X8H A;  2WB9 A;  2GZY A;  3MWH A;  2YP6 A;  2I9H A;  4XS4 B;  1EOH A;  1SJI A;  5D9X A;  3ZRD A;  4OCE A;  4KDU A;  2O7K A;  2H0H A;  4TRX A;  1JZW A;  5JCU A;  4K9Z A;  3EPT A;  4K7N A;  4YQM A;  4MNN A;  2EIR A;  4G0L A;  4OCF A;  3IAS 2;  2HSM A;  2HZE B;  2V1M A;  4TR0 A;  3I6A A;  1IYH A;  3C1R A;  3CTF A;  3F9U A;  4BVY A;  4V2M A;  4MZB A;  2PER A;  1QGV A;  4FQU A;  3DVW A;  3NOF A;  4POB A;  1F3B A;  3IDV A;  4L0U A;  1TI1 A;  2C0G A;  5DQY A;  5IMF A;  3RPN A;  3ZTL A;  3VPQ A;  2VLT A;  3FW2 A;  2R0C A;  3EMP A;  1TTZ A;  2HT9 A;  3CXG A;  1M7T A;  2WGR A;  1A2J A;  1FAA A;  1K0D A;  2A2S A;  4K6X A;  4EO3 A;  5ECN B;  4DEJ A;  1R26 A;  2PUK C;  2HRK A;  4Q5Q A;  3NZN A;  1K0A A;  5LD0 A;  2L5O A;  2LNT A;  4GCI A;  1EP7 A;  3GHA A;  5KOX A;  3VFI A;  2PU9 C;  2JZT A;  3DML A;  16GS A;  1AAZ A;  3R2Q A;  2VCT A;  3GST A;  3GUS A;  4GST A;  2TIR A;  4GXZ A;  5ECK B;  5CP1 A;  2R0G A;  3ED3 A;  3UL3 A;  3A3T A;  4K0G A;  1U3I A;  4USS A;  4QL9 A;  5D9W A;  3HDC A;  2AAW A;  1H4O A;  4ICY A;  1ERU A;  3TRQ A;  4WBR D;  5ENU A;  4H86 A;  5IMV A;  5IPH A;  2R5G A;  2M72 A;  2B7J A;  4HZ2 A;  3FR9 A;  4ZXG A;  5LCZ A;  1TXX A;  1V2A A;  4K5S A;  4I2U A;  5KN0 A;  4HS1 A;  1HNB A;  5AGY A;  17GS A;  3UJ1 A;  3CTG A;  4HEA 2;  1HQO A;  1I5G A;  5IO2 A;  1X9W B;  3KJY A;  2P5R A;  5AIV A;  3ZMK A;  2PMT A;  4ZIJ A;  5F07 A;  4GSN A;  6GSS A;  4IGJ A;  1WPI A;  1GL8 A;  1M9A A;  2K9F A;  2K8S A;  2VM1 A;  5F05 A;  3W8S A;  4XRA A;  4BA7 A;  3QCP A;  1XZO A;  2VLU A;  1A8Y A;  1EZK A;  2JAD A;  2C3T A;  1KBN A;  4K8M A;  4FYC A;  5L71 A;  3GTU A;  1QK8 A;  7GSS A;  4RQX A;  3N5O A;  3GNJ A;  4KA0 A;  1ZGN A;  3D6I A;  4EVM A;  3LG6 A;  1PGT A;  2DSA A;  3KP8 A;  1TRU A;  4TKY A;  5KN1 A;  3IAM 2;  1ZYP A;  1ZCP A;  2IFQ B;  4K2D A;  4KCE A;  2DLX A;  2C0E A;  2YN1 A;  4BWQ A;  1R7H A;  3CMI A;  1AXD A;  3M1G A;  3KP9 A;  4IQ1 A;  1B9Y C;  2B7K A;  3ME8 A;  3P7X A;  1SL0 B;  2AYT A;  1PSQ A;  3BCI A;  5EY6 A;  3EIN A;  3A2X A;  5HQP A;  3BOA A;  1ILO A;  2REM A;  1X0R A;  2JU5 A;  1GNE A;  2NPB A;  2QKE A;  1JLV A;  1Z7P A;  5D9T A;  3L0H A;  2JSY A;  1J9B A;  2WJU A;  2MBT A;  3GFK A;  2WFC A;  5DQS A;  1A24 A;  5B6N A;  1BX9 A;  4HOJ A;  1M99 A;  2PGT A;  2JZS A;  14GS A;  4V1A g;  2C3Q A;  3UVT A;  4LLR A;  2RM6 A;  1UA5 A;  4TR1 A;  2GS3 A;  3ISO A;  5J9B A;  5J4U A;  2CVB A;  2MZC A;  2LRC A;  4ECC A;  1UVZ A;  1OC3 A;  2J9H A;  3ERF A;  1OC8 A;  4RQR A;  4YQV A;  3TKR A;  4ZL9 A;  1M2A A;  3P90 A;  3EYT A;  1O6J A;  2OAD A;  1VF3 A;  4ZL8 A;  2DJ1 A;  1R5P A;  2WDU A;  2GQK A;  11GS A;  3BD2 A;  1XWB A;  5G1L A;  2H6Z A;  1TDI A;  5D93 A;  4KSM A;  3EU3 A;  4BWS A;  1VF1 A;  1F2E A;  2C0D A;  3LGC A;  2R6K A;  3G7I A;  3HY2 A;  1SKW B;  4XS1 A;  2GT5 A;  1AC1 A;  5F06 A;  4BVX A;  3VLN A;  3HJM A;  2YWI A;  2H6X A;  4EC0 A;  1PD2 1;  2JAC A;  1NSW A;  1ERT A;  3JCM L;  4X43 A;  2HI7 A;  4OFN A;  2H1G A;  1F6M C;  1ZOF A;  1XOB A;  3L9S A;  5B8A A;  4ECB A;  1ZYE A;  2IPA A;  5KOW A;  3GL3 A;  5BMU A;  1AQX A;  4OO4 A;  4E8E A;  3GMF A;  4O5R A;  1K0B A;  1Y25 A;  4I2T A;  1GP1 A;  2LRN A;  2L4Q A;  4K2X A;  4POL A;  3ZML A;  1CQG A;  1I9D A;  1MD3 A;  3DWV A;  3WD6 A;  3FK8 A;  2IMF A;  2WCI A;  3FMW A;  4RI6 A;  5C04 A;  5IMZ A;  4PX1 A;  4Z2U A;  1YZX A;  1FVK A;  2LJA A;  4DSS A;  1B8X A;  1T1V A;  5A4V A;  1M2D A;  4OMV A;  2GZZ A;  3F3R A;  5DAL A;  3DYR A;  5ECR B;  3UBK A;  4MZC A;  6GST A;  3TKS E;  3F3Q A;  3HJP A;  5FHI A;  2GGT A;  5CNW A;  4GQC A;  4Z2T A;  1OE7 A;  1WOU A;  3ERW A;  2G0F A;  4E8H A;  4YKF A;  4IJI A;  4AJ8 A;  1O81 A;  4QL7 A;  1XWC A;  3ZVJ A;  4Q5R A;  4JRR A;  1FHE A;  2O8V B;  4WF4 A;  5A4U A;  2TRC P;  2OAC A;  3GX8 A;  3VWW A;  4XHM A;  1A0F A;  19GS A;  3BBY A;  2A4V A;  4ACS A;  1KNG A;  4POK A;  2NDO A;  5AN1 A;  2DML A;  2R37 A;  3HZ4 A;  3VPT A;  4KE3 A;  2G2Q A;  1KTE A;  4KSO A;  1QQ2 A;  2IN3 A;  4QQ7 A;  6GSY A;  3M8N A;  3F4T A;  4TXV A;  5IQY A;  5ECS A;  2DJ3 A;  5H5R A;  5EPF A;  5J9C A;  3J7Y k;  5IMD A;  5KEJ A;  2TRX A;  4HDE A;  4TXO A;  2WS2 A;  4HU9 A;  1GLQ A;  1ACV A;  2LEG A;  4CW9 A;  5A4W A;  1YY7 A;  4JR6 A;  3ZLP A;  2AHE A;  4OFM A;  5HFK A;  2F8F A;  1XXU A;  3F63 A;  5JWO B;  2FUG 2;  3FY7 A;  3VWU A;  4IW9 A;  5EVO A;  2HZF A;  3HVS A;  2CZ3 A;  1SKR B;  5JWR B;  2LRT A;  1B4Q A;  2CZ2 A;  2FY6 A;  3IC8 A;  5ECM B;  2N5B A;  5IPG A;  2VAF A;  1T3B A;  2OKA A;  4P3Y B;  1X5D A;  4EUY A;  3HJO A;  4AF2 A;  4KND A;  5GZZ B;  1XCC A;  3C7M A;  2GQL A;  2LST A;  4NPB A;  2QA1 A;  3C8E A;  3FEU A;  4JE1 A;  3L4N A;  1VGL A;  2KP1 A;  4BVY B;  4F9Z A;  3GUR A;  1BG5 A;  2B3S A;  4I8B A;  2CV4 A;  3ZRE A;  1Z6M A;  2FLS A;  2I1U A;  5J41 A;  2VOC A;  3HHV A;  1YF1 A;  5G5F A;  3ZFL A;  3FYG A;  3GKK A;  18GS A;  2F9S A;  1K0O A;  2KLX A;  2HRA A;  1TRW A;  2H8L A;  4KH7 A;  4XCS A;  1V98 A;  3KXO A;  4LA1 A;  1Z5Y E;  20GS A;  3MSZ A;  3VWX A;  1F3A A;  2L57 A;  2ZCT A;  1E6B A;  2FWE A;  5IMA A;  3KD0 A;  4RI7 A;  4FIW A;  2IL3 A;  2GQM A;  4YKG A;  4OFT A;  2DJJ A;  4PUA A;  4EIP A;  1FB6 A;  1HNA A;  5DVB A;  2R3X A;  3FZA A;  4CY8 A;  2B1K A;  4LMW A;  2I81 A;  3M0F A;  5D73 A;  3IV4 A;  5HR3 A;  2X64 A;  4G10 A;  2M80 A;  1PX6 A;  2PVQ A;  1B48 A;  1Z9H A;  3EWL A;  3KCM A;  4ZBA A;  1EEJ A;  5CRH A;  3TRX A;  4MP4 A;  5G1K A;  3APS A;  2PBJ A;  4WXT A;  1MDK A;  2XPE A;  3ERG A;  4K5R A;  5DJL A;  2X8G A;  3PPU A;  1K3L A;  5DAK A;  4EKZ A;  4N11 A;  1PN9 A;  3TGZ A;  5BRT A;  1N2A A;  3N9J A;  2QA2 A;  1QFN A;  4XS4 A;  3LFL A;  3M9J A;  3LSZ A;  3H1N A;  4JU5 A;  1ZYQ B;  1ZMA A;  1XWA A;  4MK3 A;  9GSS A;  3GTU B;  5D9V A;  2HZE A;  2UZ8 A;  4GQF A;  5KN2 A;  2BJX A;  1FOV A;  1KEB A;  1QMV A;  3D0Z A;  2NTO A;  3A5I A;  1Z7R A;  4WET A;  3LXT A;  4PQI A;  1J0F A;  3RHB A;  1X9S B;  4IEL A;  4I97 A;  5HFG A;  1M0U A;  4WEY A;  1EP8 A;  2XBI A;  1URM A;  5HR1 A;  3PIN A;  2JL4 A;  3KMO A;  2WUL A;  1Q4J A;  2LV3 A;  1DE2 A;  3QOU A;  1NM3 A;  2O85 A;  1WWJ A;  4NMU A;  4D73 B;  1W4V A;  5CRD A;  1PN0 A;  3EC3 A;  2OE1 A;  4F82 A;  1GTB A;  2ON5 A;  4BPY A;  3TKS C;  1JHB A;  1U88 A;  1F9M A;  1JZO A;  4LMV A;  1EV9 A;  2L6D A;  3KTB A;  2IMD A;  5GAP D;  2DJK A;  3TJK A;  4MJE A;  1O8X A;  4TR1 B;  2X4A A;  1TU7 A;  2HXK A;  2GTU A;  2I4A A;  1Z6N A;  2FWH A;  3RBT A;  2LTK A;  1A23 A;  4IVF A;  4DVC A;  2MBS A;  4IP6 A;  3HVX A;  2B1L A;  5CYY A;  3WGE A;  1FOH A;  4Q5F A;  1TW9 A;  4HQZ A;  4EXJ A;  3IRA A;  1M9B A;  1R5A A;  2QC7 A;  1X9M B;  4TR3 A;  3MIX A;  3HZ8 A;  2P5Q A;  4G19 A;  1USB A;  3TKQ A;  4MCU A;  1PMT A;  1XW5 A;  3EU4 A;  2MMO A;  3AY8 A;  2OE3 A;  3SBC A;  3Q18 A;  3KZQ A;  3HCZ A;  5ELA A;  4MA9 A;  4YH2 A;  1YKC A;  2FCH A;  1G7O A;  1GNW A;  1XOA A;  1EV4 A;  3ZIJ A;  2LQQ A;  3OR5 A;  2AV4 A;  2C1Y A;  2CAI A;  5AIS A;  4N10 A;  1T00 A;  2GZP A;  1UN2 A;  4BVX B;  1UC7 A;  2IY2 A;  1QUW A;  2H74 A;  1PKW A;  1PX7 A;  1OVN A;  2VLV A;  1ERW A;  3UEM A;  2VCZ A;  3GH9 A;  3D5J A;  3KTL A;  2L59 A;  1SYR A;  4ISD A;  4KX4 A;  2YAN A;  3CYN A;  4IS0 A;  3E3E A;  5ABR A;  2B5X A;  2K18 A;  4EF0 A;  4FH8 A;  4OWY A;  3ME7 A;  3H4K A;  1XVQ A;  4EIQ A;  1BJX A;  1GTA A;  2DJ0 A;  2FA4 A;  2IFQ A;  2XPD A;  2L6C A;  1MTC A;  3A2V A;  4XRD A;  6GSV A;  1ZZY A;  3CRT A;  5DCH A;  5E59 A;  2VM2 A;  4WR4 A;  3D22 A;  3FZ9 A;  4ZBD A;  4TOP A;  2H76 A;  3VI5 A;  1SKS B;  4DSS B;  3EVI A;  4WBJ A;  1RW1 A;  2H1D A;  5ECP B;  4XIH A;  5DAL B;  1B9X C;  3W6G A;  4GSS A;  5D8I A;  3IC4 A;  3LYP A;  2BMX A;  4KUN A;  3W8J A;  1Q98 A;  4GRF A;  2VL2 C;  1MD4 A;  3R3E A;  2RUF A;  1ZYN A;  4GF0 A;  4MJC A;  5D96 A;  4EDY A;  1XBS A;  3DGQ A;  1MDI A;  3WGX A;  3GKN A;  2OJL A;  3F6F A;  2ES7 A;  3FR6 A;  1ABA A;  5HR2 A;  2WRT A;  1OAZ A;  3RAZ A;  1TP9 A;  5COH A;  4F2I A;  3HA9 A;  4YAV A;  2YNX A;  4NHZ A;  4WKW A;  2IMI A;  4J57 E;  2LNS A;  3QAV A;  3TOT A;  2HRN A;  2OA7 A;  5IM9 A;  1JFU A;  3E0U A;  4MF7 A;  3F0I A;  1TJD A;  3J7Y b;  2K6V A;  4KB3 A;  2YJ7 A;  3TDG A;  3IHQ A;  4Z2R A;  1SK2 A;  4IJ3 A;  1V9W A;  2C8U A;  1LJR A;  3WGD A;  3IBH A;  2V32 A;  5ECQ B;  2H19 A;  1U6T A;  4PUF C;  5ECI B;  4MH2 A;  4HJ2 A;  4XS6 A;  2HLS A;  4KF9 A;  4TXO B;  5F0G A;  3US3 A;  2Z9S A;  3DXB A;  4YQU A;  3GIX A;  1ZL9 A;  2E2M A;  5JCW A;  3UMA A;  3IOS A;  1AQV A;  1SEN A;  3I69 A;  2F51 A;  1G6Y A;  2YOI A;  4OO5 A;  4G9H A;  1SK1 A;  1PRX A;  1THO A;  3FKF A;  3MAK A;  3FZ4 A;  22GS A;  4LL4 B;  2DKI A;  4PGT A;  1NHY A;  4MMM A;  3VK9 A;  4PNG A;  3WT2 A;  3S9F A;  3D4M A;  4K0N A;  3L9V A;  1T8E B;  5AIX A;  2DC5 A;  1V57 A;  2VUP A;  4V2N A;  2YV9 A;  4MJA A;  3GA4 A;  5JWQ B;  4CY6 A;  4ML6 A;  2J23 A;  2H01 A;  4I6X A;  3GV1 A;  3QAW A;  4HU7 A;  4MAB A;  4ID0 A;  1ON4 A;  3LWA A;  5CAX A;  4J56 E;  5DCG A;  3KH9 A;  2CAQ A;  3KMN A;  1DUG A;  4JZQ A;  4PNF A;  3TJG A;  1GUL A;  2EIO A;  2NVL A;  3HVV A;  2LS5 A;  5IOW A;  4G0I A;  2O87 A;  2MMZ A;  1WRY A;  1O8W A;  1EGR A;  1V58 A;  2DMM A;  3DIE A;  2ZUP A;  5HFI A;  4KGI A;  3TJB A;  1H75 A;  2X49 A;  2B6M A;  3NIV A;  4ULX A;  2E0Q A;  1SK0 A;  4IHU A;  4L8E A;  5A5K A;  4HI7 A;  1CQH A;  2P31 A;  3TJJ A;  3LJR A;  1JZD A;  3EMX A;  5FWG A;  3C73 A;  2GSQ A;  2LJK A;  4KW6 A;  3ZFB A;  4ZB9 A;  2FGX A;  2YWN A;  1XWG A;  2HSY A;  5CO3 A;  3VUR A;  1WJK A;  4NAX A;  2YCD A;  1VRS D;  1A2M A;  2EIQ A;  3LYK A;  1GTU A;  2VD0 A;  3MNG A;  4PXO A;  4WR5 A;  1SU9 A;  2IMK A;  2VD1 A;  2A4H A;  2R4V A;  3M9K A;  2X8C A;  3VWV A;  3BCK A;  4L0W A;  2YV7 A;  4NHW A;  2GLR A;  1G6W A;  5E4W A;  3P8W A;  2QSI A;  3MYD A;  3ZYW A;  5IO0 A;  3GH6 A;  4TR4 A;  2H66 A;  2L5L A;  4BL7 A;  3KEB A;  10GS A;  2B5Y A;  4HQS A;  1SD8 A;  4HUA A;  4PTS A;  1YEP A;  3ZL5 A;  2MMA A;  1O73 A;  1F37 A;  3O6T A;  1AIU A;  5C00 A;  5DAK B;  3QR6 A;  3QD9 A;  3WYW A;  2CQ9 A;  3G7Y A;  1RK4 A;  1WE0 A;  3HD5 A;  3MDK A;  5ECH B;  4TW5 A;  1AW9 A;  4ZB6 A;  4K1F A;  4TVE A;  2H71 A;  1GTI A;  1TK8 B;  2DIY A;  2CX3 A;  1GSD A;  4Q5N A;  2GT6 A;  2VCV A;  2HFD A;  13GS A;  2YWM A;  1THX A;  4IBP A;  2YJH A;  1YF0 A;  5IOX A;  5KN3 A;  1BAY A;  1OC9 A;  3H93 A;  1SL2 B;  3KIJ A;  5H5Q A;  4F0C A;  1K0N A;  3I43 A;  5ID2 A;  3UAP A;  2O89 A;  1PKZ A;  4PUR A;  5ECL B;  3Q6O A;  3D21 A;  2CA8 A;  1U3A A;  2YWO A;  4MF6 A;  1A8L A;  3LQ7 A;  3GX0 A;  2XBQ A;  4K7I A;  4V2L A;  4MPG A;  1GSQ A;  1VF4 A;  2V2G A;  3IR4 A;  2VCW A;  4ZBB A;  1TI3 A;  3HXS A;  1GLP A;  5G30 A;  4JED A;  3QAG A;  1NW2 A;  2C80 A;  2PPT A;  5HR0 A;  4ILF A;  1W89 A;  2RUE A;  1Z3E A;  2QGV A;  3TKP A;  3G9B A;  1XIY A;  5B6M A;  3FR3 A;  3GKX A;  4HZ4 A;  5J5N A;  2FNO A;  5B8B A;  5INY A;  4N30 A;  2FWF A;  2GVP A;  3PGT A;  1SYX A;  2HYX A;  4CDO A;  2AUV A;  3CSH A;  4IKH A;  1EWX A;  1GUH A;  2KOK A;  3APQ A;  8GSS A;  4O32 A;  1YDK A;  1R4W A;  2EC4 A;  3V1W A;  4I5Q A;  3K8N A;  4GWR A;  3CBU A;  2VIM A;  1G7E A;  1GWC A;  1X5E A;  1GSS A;  3QDN A;  2VL2 A;  2A2P A;  2DKH A;  3QFA C;  4A5P A;  1K3O A;  2P0G A;  3CRU A;  5CRE A;  3U5R E;  1XFL A;  4EE0 A;  4RUV A;  1C72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...