4I5QA

Crystal structure and catalytic mechanism for peroplasmic disulfide-bond isomerase dsbc from salmonella enterica serovar typhimurium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein DsbC
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4i5qA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i5qA02
4NAXA 2A2SA 5DDLA 4ZIJA 1M2DA 1B8XA 18GSA 2LS5A 3I6AA 1GSUA 1RK4A 3KZQA 4OFTA 3US3A 4J2FA 3EWLA 3IBHA 4KW6A 1ERWA 2VCWA 1A24A 4BPYA 3N5OA 3S9FA 4NXIA 4P3YB 2B5EA 3ERWA 5A4WA 5DBQA 3GMFA 2FA8A 4TR4A 4MF5A 2IMFA 2IPAA 2C1YA 1W89A 2VM2A 1X9SB 1A8LA 5ENUA 4ECJA 5E4WA 2VOCA 5HFKA 3R2QA 4HZ4A 1ZMAA 1MDJA 2HRFA 1JZDA 1XCCA 1RW1A 4MA9A 5B6NA 3GSSA 2CVKA 3QD9A 3IRAA 3C7MA 2FD3A 4BVXA 3D4MA 3CSJA 3TOTA 2OBKA 1JFUA 1KEBA 1O85A 1EP7A 1PMTA 2GQMA 4IKHA 1GH2A 1OAZA 3L0HA 4N11A 3WYWA 1WPIA 2IY2A 5H5RA 3CRUA 3VWWA 1PN9A 5GAND 3ZIVA 4OMVA 1GL8A 2REMA 2GSQA 1A0RP 2MMNA 2B1KA 4EVMA 4GLTA 2CX3A 2I4AA 3D5JA 1N2AA 3QCPA 1PRXA 1E6BA 4CDOA 2RUFA 5G1LA 3GV1A 3D22A 4NV5A 2LQQA 5ECPB 2C8UA 5D93A 4K8MA 3LSZA 1XPVA 1EV4A 2H19A 1ACVA 2QC7A 6GSVA 3TJKA 4IJ3A 3W6GA 3F0IA 4XRDA 4IQAA 2VCZA 4ECIA 4YAPA 4WF4A 2I81A 3M8NA 1ABAA 1O7UA 2AAWA 3H8QA 4I8BA 1M7TA 2KHPA 5AIXA 3P7XA 5DAKB 3C8EA 5JCWA 3FYGA 1XXUA 4LL4B 3KP9A 3DRNA 4POBA 5CREA 3UVTA 1ZOFA 4D73A 1GLPA 4QQ7A 1GUKA 3QAVA 5F8BA 5DAKA 1ZCPA 2L59A 2B5XA 1PD21 4TXOA 4GWRA 3HHVA 1G7OA 1THOA 2GT5A 4K7IA 3O3TA 4YQMA 4FO5A 2I9HA 3ZVJA 3EVIA 1FB0A 2V32A 2OACA 3IK7A 2YWNA 2L4QA 2H0GA 3QPMA 4TR3A 1NSWA 2E0QA 2VM1A 3NZNA 2LTKA 4KDXA 3KIJA 3W8SA 4GCIA 1YZXA 4MJBA 1FOVA 4NV2A 1EEJA 2HT9A 1XWCA 1ZZYA 3LQ7A 1EP8A 2RLIA 1AQVA 3VWVA 5ID2B 2B6MA 3RDWA 1TRUA 3VWUA 1PL2A 4DVCA 2BTOT 2A4VA 4K7OA 1F2EA 3EINA 4YH2A 1XZOA 2ZUPA 3CSHA 3DVXA 1X5CA 1TJDA 4HU7A 3GUSA 1R5AA 1NHYA 3HZ4A 1XOAA 3FEUA 4Q5NA 1OKDA 4RI6A 1F3AA 1XVWA 2GT6A 2JADA 4OD7A 1PL1A 1R4WA 4CW9A 1HYUA 5CYYA 4V1Ap 4WXTA 1BX9A 1YY7A 3IR4A 3ME7A 1XW5A 1A2JA 3LYKA 1AXDA 4OFMA 1DSBA 1IYIA 1WOUA 3CTFA 5JCGA 4K0GA 5KN3A 1SK1A 2GTUA 3O76A 1J0FA 5G2ZA 2VLTA 4JZQA 2YJ7A 4MZWA 3VI5A 5EPFA 2OJLA 2MBSA 1Z5YE 1ERUA 3GTUB 4JR4A 4PQIA 3FR6A 5KN1A 2FA4A 1QQ2A 1F6MC 3UBKA 2O87A 1JZWA 2VIMA 1AQWA 5ECLB 4MMMA 2K18A 2DBCA 1G0TA 4ILFA 3M3MA 3GA4A 2PERA 4EF0A 1ZL9A 2R37A 4PQ1A 2FY6A 1OC9B 2B1LA 4Z7XA 1DUGA 3NOFA 1XBSA 4I97A 4MABA 1LBKA 3CYNA 1SKSB 1QUWA 2JZRA 3JCML 5INYA 2BMXA 4TN8A 1SL0B 4IHUA 2WULA 2L6DA 3ME8A 2HE3A 4WKWA 4GSSA 1XWKA 1EV9A 4GQCA 2DMMA 2ZCTA 2JZTA 2V6OA 4POMA 3RHBA 1OYJA 4OO5A 4JU5A 3BCIA 2L57A 1GUMA 2WS2A 3TKSC 2KUCA 4O5RA 3I9V2 3AY8A 1EEMA 1T4ZA 4TR0A 4PUAA 4WR4A 1T1VA 2MYGA 1TK0B 2Z9SA 11GSA 2VL2C 2N5BA 2XHFA 2X8CA 2GZZA 2WDUA 4JE1A 4E8EA 2DJKA 2FUG2 1M0UA 1GRXA 1PKZA 3CMIA 1SD9A 4MP4A 5C04A 3PINA 1V57A 1A0FA 6GSXA 1FG4A 1OE7A 2MMAA 1K0NA 2RIIA 3IAM2 1YEXA 5KN2A 3GSTA 2FCHA 2V2GA 3DGQA 5KN0A 1R7HA 3O6TA 3GNJA 3HJPA 2VUPA 1BQ7A 4HJ2A 5CRDA 2X8HA 3UAPA 5EY6A 3IDVA 3KMOA 1XIYA 2HSYA 1M9BA 4NHWA 3GL3A 4ZL7A 1V98A 14GSA 1O81A 4EC0A 2H71A 3L9SA 2WFCA 3GIXA 2TRXA 2JACA 1LJRA 1OVNA 3TRPA 4V1Ag 4I2UA 1YKAA 4BVYA 5ECQB 3H79A 3SWLA 1K0CA 4DSRA 5D96A 3EURA 1R26A 2FWGA 2C0FA 4KCAA 1VF1A 3WGEA 4EUYA 1LU4A 4HOJA 4I6XA 4JR6A 2C0EA 3ZREA 2V41A 2HXKA 1TK5B 2P0GA 4MK3A 1AAZA 3GKMA 5F06A 2P5RA 1ILOA 1XW6A 1S3AA 4MPFA 1PX6A 5DQSA 4IS0A 6GSYA 1O8WA 4RUVA 2VAFA 2DJ1A 4ZXGA 1B9XC 2YV7A 1T7PB 2H6ZA 3DVWA 3VK9A 5GAPD 3WGDA 4L5LA 4TVEA 5JWOB 3D6IA 4IELA 5H5QA 3MNGA 4FYUA 5G31A 4MZCA 4POKA 3APSA 4XS4B 5A4UA 1GTIA 3QOUA 1URMA 3IE3A 4EXJA 3GKXA 2P5QA 4FYBA 1NHOA 3UEMA 3FW2A 4RQXA 2NBSA 4HJMA 2YP6A 7GSSA 3IHQA 1GP1A 4TR1A 2H72A 3TKSE 3FK8A 3KXOA 3L9UA 2G0FA 2L6CA 3KH7A 3ZYWA 2ON7A 2YV9A 1QFNA 4YAVA 1M2BA 1YEPA 5IMDA 4X43A 2IMKA 2B5YA 2V1MA 1TKDB 2KOKA 1VF3A 4LL1B 5COHA 5G5EA 3FRCA 1HQOA 1U88A 3J7Yk 4PUFC 3F4TA 2GSTA 2LRNA 1PSQA 3FZAA 1DBYA 2L5OA 5LNKe 3UMAA 3PGTA 2H6XA 4F82A 3GHAA 3HDCA 5CRGA 4RQRA 1FB6A 1GUHA 3WT1A 22GSA 2F8FA 4TR1B 2DJ2A 2TIRA 2O89A 1XWBA 4KH7A 3UVHA 1H4OA 4KSMA 3UIWA 1PA3A 1WIKA 2LRTA 4TOPA 2H76A 3C1SA 4IP1A 4V2MA 5B7CA 2EIRA 3ED3A 3IOSA 4ZL8A 2C0DA 2PPTA 5HQPA 3TKSA 3DD3A 3GH6A 3GRXA 3CTGA 2YCDA 3BJ5A 4PNFA 4WBJA 1MD4A 4PX1A 2OBIA 1F3BA 4ZB6A 2B7JA 1SJ6A 1ZYEA 4V2NA 5AGYA 2OADA 3TJBA 4MJCA 1V58A 3F3RA 1Y25A 1JZOA 2MZCA 2OE3A 4JEDA 5ELGA 5G5FA 5ID2A 2WRTA 4GSTA 1M9AA 4L5OA 3F9UA 4ECBA 4LA1A 2K8SA 4HU9A 12GSA 2LUSA 4XTSA 2JL4A 1IYHA 2H0IA 2OA7A 3M9JA 2G2QA 1O8XA 3VPTA 4IGJA 3L9VA 5ECKB 1TRSA 4I5QA 1BG5A 3GKNA 4XS4A 1EOGA 4G10A 3EC3A 2FLSA 1TRWA 1ERTA 4IN0A 4XRAA 1A23A 3RPPA 4KSOA 2IJYA 1BEDA 1SD8A 3HY2A 4TXVA 1GLQA 5JWRB 1SK0A 3HJMA 3HD5A 2DSAA 4NWYA 3KMNA 1GULA 1JHBA 4ZL9A 1S3CA 4ML6A 1T3BA 9GSSA 1ML6A 4EE0A 5HR2A 4XIHA 2DIZA 1X5DA 3CBUA 1K0OA 2LV3A 1G6WA 1GSYA 4ULXA 3FZ5A 4OWYA 3HVXA 3KD0A 3GX8A 4G9HA 5F0GA 3U5RE 4PGTA 1T00A 4BL7A 2VL9A 5ABRA 4HUAA 2H6YA 4NHZA 1X9WB 3OR5A 5D9XA 4N0ZA 1JLWA 4ID0A 1WWJA 1X5EA 2H66A 2GSSA 2WZ9A 20GSA 1EOHA 2F9SA 1EGOA 4HQSA 4MH2A 3A3TA 3ZL5A 3ZLPA 4ML1A 3G7JA 1OE8A 1XWAA 4V2LA 2H74A 3IV4A 3PR8A 1U3IA 3EYTA 2M46A 4AF2A 1YDKA 3K8NA 1FO5A 3M0FA 2H1DA 13GSA 2AV4A 1GSQA 1SKRB 3KTBA 2JSYA 1SL1B 5D9TA 2P31A 5IMAA 1GTAA 2MMZA 4BWSA 2LKUA 3F6FA 4MZBA 3TJGA 5B8BA 3ISOA 4KA0A 1OC9A 5HR1A 3U6VA 3I69A 2RM6A 4GRFA 4LMWA 3EMXA 1MTCA 4POLA 1ZGNA 1TDIA 2LJKA 1ERVA 2GQLA 4E8HA 4KB3A 4IW9A 4TW5A 4K9ZA 5F07A 5D8IA 1TK8B 4MLYA 5EL8A 1BYEA 3LGCA 1THXA 2PBJA 3UJ1A 2HLSA 4ZBAA 3KCMA 1AUCA 4NPBA 2PVOC 4K1FA 4KCEA 2VCTA 3IA1A 2C80A 2ON5A 1NM3A 5CAXA 4ZB8A 1T4YA 1TRVA 4IQ1A 2QGVA 2F51A 4K0NA 3FKFA 2CQ9A 2OKAA 2X64A 2FHEA 1UA5A 2GZYA 3E9JB 1MDKA 2F8AA 2WB9A 3LORA 2NTOA 2VCQA 4NMUA 3APQA 4EL1A 3IC4A 2J23A 2L5LA 1WJKA 4WBRD 3GN3A 2LRCA 2JU5A 1QK8A 1TTZA 4ZBDA 3SBCA 5G30A 3ZRDA 3MAKA 1EZKA 2CV4A 3HKRA 4LMVA 1XFLA 1G7EA 4X0XA 2HFDA 5IMZA 4EKZA 2WGRA 3GTUA 4EDYA 3TJJA 5D73A 1ON4A 2K9FA 3KGKA 2YANA 3LYPA 2FNOA 4O92A 2LNTA 3KM6A 1TXXA 2H8LA 3F8UA 4QL9A 1VF4A 4K6XA 2CZ2A 3GFKA 6GSSA 4CHSA 4MJEA 3HCZA 16GSA 2YJHA 1B9YC 1HNAA 3TB2A 1A2MA 4L0UA 5DJLA 2VO4A 2IIYA 2O8VB 2HZFA 1ZYQB 1PQNA 2H01A 3ERGA 2ALBA 3ERFA 4FYCA 2X8GA 5ECIB 2KP1A 1TI3A 5J5NA 4D73B 4PXOA 5AN1A 3RAZA 3LEFA 5JWQB 1E2YA 4HDEA 3H93A 3LXZA 1K0BA 3V1WA 3F3QA 3KJYA 3LWAA 1GNWA 1TI1A 1DE1A 5B6MA 5IO2A 4Q5QA 3CXGA 1Q4JA 1J08A 5DALA 4Q5FA 5B8AA 3ZFBA 3L78A 4G19A 2EC4A 1Z3EA 4H86A 5IOWA 3G9BA 2PUKC 3QAWA 2OE1A 2CAIA 3IK9A 2CT6A 2VCXA 2IMIA 4KUNA 5J41A 2CX4A 2R5GA 2GGTA 2VL2A 3A2WA 3WT2A 1Z6NA 5ELAA 5IOXA 2YOIA 5D9WA 4J56E 3ZFLA 4HI7A 4ISDA 4WF5A 4KDUA 3RHCA 4TXOB 2EIOA 4DSSB 2A2RA 5HFGA 1I9DA 2EIQA 2WJUA 2V6KA 2NVLA 1K0AA 1SYXA 4GXZA 6GSTA 2R2JA 1M2AA 3QAGA 2M72A 1FVKA 1GNEA 1UC7A 4OFNA 1G6YA 2AUVA 3M9KA 2PGTA 5DCGA 4AGSA 3ZITA 1OC8A 3GYKA 3J7Yb 3HA9A 2H1AA 1SU9A 1WE0A 3M1GA 1BAYA 1RQMA 2B3SA 1WP0A 3ZIJA 3ZMLA 2K6VA 2HRNA 4O7HA 5IQYA 5CO3A 3TJFA 1V40A 4K7NA 1WRYA 5AISA 2R4VA 4F2IA 1GWCA 1YF1A 5DVBA 2LEGA 3GX0A 1AQXA 1CQHA 2N5FA 3DMLA 3P90A 3TRXA 2L4CA 3DXBA 1A2LA 4F9ZA 1S3DA 1OKTA 4N0VA 1KTEA 4PURA 3VLNA 4BA7A 1YQ1A 1Z6MA 1CQGA 5HR0A 5A4VA 6GSWA 1AIUA 3TUEA 2VD1A 2NPBA 3D4TA 4MF7A 3G7IA 3VFIA 2LQOA 3A5WA 3GL5A 2H30A 2LNSA 1YF0A 4DSQA 3L4NA 3UL3A 5LD0A 2GLRA 3KEBA 4DEJA 3P8WA 1HD2A 1K3YA 4MH3A 2HSHA 2M80A 5JCUA 5H5SA 3QDNA 2OE0A 1MD3A 4F0BA 2CVDA 2AYTA 4IJIA 3WGXA 1R5PA 3IPZA 3TGZA 2XBIA 3C71A 1QXHA 2H73A 1J9BA 5DJMA 3APOA 3EE2A 1USBA 4XS1A 2YNXA 1C72A 1SYRA 2IFQB 3GKKA 2X99A 2GQKA 5J9BA 3LG6A 3TKQA 4JRRA 4KNDA 1XWGA 1W4VA 4WETA 1JZRA 2FWFA 3C1RA 3FZ9A 4GTUA 5GSTA 2VLVA 4KDYA 1A8YA 2LSTA 3CSIA 2XC2A 5LCZA 5L71A 1B4PA 3F63A 5ECRB 2GSRA 3HVVA 1AC1A 2D2ZA 5CP1A 3I43A 3A2VA 4XS6A 1TOFA 5G1KA 1TW9A 3EMPA 2QSIA 5IO0A 4O32A 2AHEA 3D0ZA 1MDIA 3KP8A 1Z9HA 4KE3A 1X9MB 1HNCA 3CRTA 2DJ0A 4WEYA 2YZHA 2YWIA 4MCUA 4YQUA 5IIZA 2AJQB 2ES7A 2XPEA 2CA8A 4IBPA 2IN3A 3PH9A 2C0GA 2JZSA 3TRQA 3KH9A 4KX4A 3FHKA 2B7KA 5E59A 5IMVA 3VPQA 1VRSD 3LJRA 4MF6A 2VL3A 1NW2A 2YWMA 1EGRA 5FT3A 4TKYA 4N30A 2DJ3A 3TCOA 5FWGA 1TP9A 2JSZA 4ECCA 2IWTA 4TRXA 4Q5RA 1UVZA 2DLXA 3G7YA 2R6KA 3Q18A 19GSA 1GSDA 5CRHA 3F4RA 2H1GA 1K3OA 1U87A 2CZ3A 2F3MA 2C3NA 2I3YA 3P2AA 5IMCA 5FHIA 2YN1A 1U3AA 3ZZXA 2IYJA 1FW1A 3DKSA 1SL2B 2IMDA 3EU4A 2H70A 4HEA2 1JLVA 1SJZA 2IL3A 5IMFA 3E3EA 3W8JA 1OC3A 2GVPA 5ECMB 5CNWA 1XVQA 2LJAA 4X1UA 5IPGA 3QR6A 5EVOA 2H1BA 1XW9A 3DYRA 5KEJA 5GSSA 1BJXA 2PMTA 3MDKA 4J57E 2MBTA 1UN2A 2CAQA 1H75A 3UBLA 4PNGA 4N10A 3F4SA 3TKRA 2NDOA 2HZEB 4AJ8A 4F03A 3D21A 2N5AA 3H1NA 5ECOB 4IVFA 5DCHA 4K2DA 4GF0A 5C00A 3GURA 3UARA 3N9JA 4XCSA 3HJOA 4ZB9A 1SJIA 4FIWA 1K0MA 2ZNMA 2WCIA 4MJAA 2FWEA 3NIVA 5F05A 2E2GA 3FY7A 2YWOA 5A5KA 4OCEA 1F37A 2PWJA 4IP6A 4L8EA 2HZEA 1TU7A 2AB6A 2YPMA 2O85A 2LJRA 3Q74A 4F0CA 5J9CA 3Q19A 2QKEA 4ACSA 4RI7A 2E7PA 1DE2A 2DIYA 3IAS2 1QGVA 2MMOA 2J9HA 4HS1A 2DC5A 2GZPA 1SK2A 1PKWA 5AIVA 4BWQA 5HR3A 1X0RA 3RPNA 1YKCA 3H4KA 4QL7A 4XHMA 1SENA 1B48A 3ZTLA 1M99A 2VD0A 1V9WA 3F6DA 1KBNA 1VGLA 3DIEA 2YZUA 3FR9A 4AJ6A 1N8JA 3BBYA 5ECNB 2K8VA 3EU3A 2C4JA 4PQHA 1KNGA 1TU8A 3LXTA 3BD2A 2KP2A 3FZ4A 3UOMA 3KTLA 3VI7A 4GQFA 1F9MA 3LFLA 1Z7RA 2PVQA 4DSSA 2RM5A 4ZILA 2RUEA 1I5GA 2VLUA 4OO4A 2GDRA 1VF2A 1FHEA 1B4QA 2FWHA 3E0UA 6GSUA 2PN8A 2PU9C 4HQZA 2H75A 3GH9A 3DEXA 4AJ7A 4LLRA 3IXRA 1GSSA 8GSSA 2HNLA 3HYPA 3QFBC 4WR5A 2O7KA 3DWVA 1SKWB 3TDGA 3HZ8A 4GSNA 3C73A 2KLXA 5DALB 5J4UA 3TKPA 3RBTA 2H0HA 5HFIA 3ZVJD 3HXSA 3ZMKA 4G2EA 4MDCA 2C3QA 4YQVA 1YJ6A 2TRCP 5DQYA 5ECHB 4ZBBA 4JBBA 5D9VA 10GSA 4KAEA 5IPHA 3QMXA 1ST9A 2I1UA 3A2XA 3MSZA 2C3TA 3WD6A 1QMVA 1AW9A 1WMJA 2R3XA 2E2MA 2DJJA 1FVJA 1V2AA 1Y6EA 4EO3A 2XPDA 4EDZA 3HVSA 4FH8A 2BJXA 4OCFA 3Q6OA 1EWXA 4KGIA 5CRWA 1XOBA 4MPGA 17GSA 3MWHA 3BOAA 1FAAA 4HZ2A 1GSEA 3BCKA 2HI7A 4L0WA 1O73A 1K3LA 1Z7PA 1HNBA 2DMLA 1PGTA 1Q98A 2CVBA 1O6JA 1PX7A 1GTUA 1U6TA 2VCVA 4I2TA 1T8EB 5J3RA 2IMEA 5ECSA 2IFQA 1K0DA 3QFAC 2XBQA 5IM9A 3VWXA 1GSFA 1MEKA 3TOUA 2FGXA 2HYXA 3VURA 3FR3A 5GZZB 2GS3A 1GTBA
chains in the Genus database with same CATH superfamily
4NAXA 2A2SA 1BNGA 1GD3A 5DDLA 4ZIJA 1M2DA 1X1YA 4HM6B 1B8XA 3F7XA 4HBRA 4WFOA 18GSA 2LS5A 1TFKA 2XSHB 3I6AA 2D1WA 1GSUA 3U97A 1RK4A 3KZQA 2OOVA 4OFTA 3US3A 2WGQA 1STDA 4J2FA 2F4YA 3EWLA 3IBHA 3CCV3 4KW6A 1ERWA 1WNHA 2VCWA 1A24A 4BPYA 3WOEB 1FOHA 3N5OA 1GSPA 1OF5B 5ELUA 3S9FA 3T0UA 3ZFZA 2X49A 1EA2A 4NXIA 4P3YB 2B5EA 3ERWA 2W56A 5A4WA 4HKVB 2LYXA 5DBQA 3EHCA 1C54A 3GMFA 1LQGC 2FA8A 1OUNA 1BOXA 4TR4A 4MF5A 2QEX3 4O8SA 2IMFA 2IPAA 2C1YA 1W89A 2VM2A 1X9SB 3AMOB 4O2HA 4H61A 1A8LA 5ENUA 3RNTA 4ECJA 2DKHA 5E4WA 1FGQA 4N6V0 2VOCA 5HFKA 1IK3A 1IT7A 3R2QA 3QRDA 4HZ4A 2V1LA 3GZRA 1B3SA 1K8A4 2K54A 2HSMA 1ZMAA 1MDJA 2KF3A 2HRFA 1JZDA 1XCCA 1RW1A 4MA9A 5B6NA 1DE3A 3EPTA 4Z2TA 3GSSA 2CVKA 3QD9A 4EIQA 3IRAA 1IDPA 3C7MA 2FD3A 4BVXA 3D4MA 3RDEA 3D3LA 3CSJA 3TOTA 2OBKA 1IVUA 1OF5A 1JFUA 3N9HA 4MMXB 1KEBA 1RGFA 1EP7A 1O85A 3PYJA 1PMTA 3ROBA 3GWRA 4AKYA 4CPKA 4R9LA 2GQMA 4IKHA 1GH2A 1OAZA 4HJLB 3L0HA 4N11A 1CQSA 2HRAA 3WYWA 1WPIA 2IY2A 1GS3A 5LC7A 5H5RA 3EC9A 3CRUA 3VWWA 1PN9A 5GAND 1O7WB 3ZIVA 4OMVA 1GL8A 2REMA 1NO3A 2GSQA 4BIKA 1A0RP 2MMNA 2B1KA 4EVMA 2W9QA 2GBXB 3OXAA 1Q824 4GLTA 5STDA 2CX3A 2I4AA 4WYKA 3DM8A 3D5JA 1N2AA 3QCPA 1PRXA 4N6MA 2CX0A 1V74A 1E6BA 4CDOA 2RUFA 5G1LA 3GV1A 3D22A 3JUMA 4NV5A 2LQQA 5ECPB 3WHOA 2C8UA 3X3XA 5D93A 3CCJ3 2ML6A 1T5YA 3NBRA 4K8MA 3LSZA 1XPVA 1EV4A 2H19A 3LTDA 1I2FA 1ACVA 5IEPA 3MKIA 1M3JA 4GB5A 2QC7A 6GSVA 3LXUX 3TJKA 3BLZA 4IJ3A 3W6GA 1VQL3 3UB1A 3F0IA 4XRDA 4IQAA 2UUGC 2VCZA 4ECIA 4YAPA 4WF4A 1RN7A 1LQMB 4OUQA 1TU5A 4J9AA 2F99A 1SJWA 2I81A 3M8NA 3Q2PA 4JRFA 1ASKA 2OWPA 1US1A 1ABAA 1DVCA 3OWYA 1O7UA 2AAWA 3H8QA 1STFI 1WQLB 4I8BA 1M7TA 2KHPA 5AIXA 3P7XA 4K90B 1K28A 5DAKB 3C8EA 1LOYA 1A90A 4GHOA 5AIIA 4R1KA 3LZAA 5JCWA 3FYGA 3JUQA 1XXUA 4LL4B 3KP9A 3DRNA 4POBA 5CREA 3UVTA 1ZS7A 1ZOFA 4D73A 1BSDA 1VQO3 1GLPA 3ALAA 1IT8A 3KSED 1B2SA 4EIPA 4QQ7A 1GUKA 3QAVA 5F8BA 5DAKA 3HVNA 1ZCPA 1VQN3 5IF6A 2L59A 2B5XA 1PD21 4TXOA 4GWRA 3HHVA 4LEHA 1G7OA 1THOA 2GT5A 1N5PA 3IC8A 1JN5B 4K7IA 1RKYA 3O3TA 4YQMA 3I0YA 4FO5A 2I9HA 3ZVJA 3EVIA 2FXTA 1FB0A 4IT7A 2XFTA 2V32A 2OACA 4G0IA 3IK7A 2YWNA 4A5PA 2L4QA 2H0GA 3QPMA 6STDA 4TR3A 1NSWA 2E0QA 2VM1A 3NZNA 1C7HA 2LTKA 4KDXA 1UI7A 3KIJA 3LTCA 3W8SA 4GCIA 1X1XA 1YZXA 4MJDA 4MJBA 2C4BA 1FOVA 4BTXA 1A2PA 1NWWA 1VQQA 4NV2A 1EEJA 4HM3B 2HT9A 3NXJA 1XWCA 1ZZYA 3FMWA 3LQ7A 4FMAA 1EP8A 2RLIA 1YIJ3 1BAOA 4NREA 1AQVA 3VWVA 2UGIA 5ID2B 3G8ZA 1B20A 4XB5A 1OACA 3DXOA 2B6MA 3RDWA 3HX8A 1TRUA 1A2VA 2STDA 5A0OB 5EVHA 3VWUA 1PL2A 4DVCA 1RN1A 2A4VA 2BTOT 4K7OA 3B4PA 1F2EA 1Q7Y4 4G0KA 2F56A 3EINA 4YH2A 1XZOA 2ZUPA 5AIHA 3CSHA 3DVXA 3S28A 2F5WA 4HM4B 1X5CA 1TJDA 4H3UA 2KF5A 4HU7A 2ZA4A 2RGQA 3GUSA 1GMQA 4AKZA 1R5AA 1NHYA 3HZ4A 3Q3FA 1XOAA 1RRLA 3FEUA 4Q5NA 1OKDA 1O7PB 4RI6A 1F3AA 1IU7A 1XVWA 2GT6A 1UUGB 5JPUA 2JADA 4OD7A 4R80A 2OOVC 1R4WA 1PL1A 4KFFA 4CW9A 1HYUA 5CYYA 4RNZA 5KP4A 3DZLA 3SX1A 4V1Ap 4WXTA 4HAAA 1JB5A 2BMRB 1BX9A 1YY7A 3UJMA 3IR4A 1XW5A 4L8OA 4OK0A 3ME7A 1A2JA 3LYKA 1AXDA 4OFMA 1DSBA 4OVMA 3J7Yd 1IYIA 1WOUA 3CTFA 2F86B 5JCGA 4K0GA 3KSPA 5KN3A 2X4AA 1SK1A 4K2XA 2GTUA 4MNNA 3O76A 1MOLA 1KC84 1J0FA 5G2ZA 2VLTA 4JZQA 2CFDA 1I3IA 2A15A 2YJ7A 4MZWA 3VI5A 3KE7A 1A67A 5EPFA 1VZZA 5CK6A 2OJLA 2MBSA 1Z5YE 1ERUA 3GTUB 4JR4A 4PQIA 3FR6A 5KN1A 3NQZA 1K41A 2FA4A 2R0PA 4IPBA 1F6MC 1QQ2A 2L1SA 2O87A 3UBKA 1B2UA 1IQYA 1JZWA 2VIMA 1AQWA 1ZYPA 5ECLB 4MMMA 1YJN3 2K18A 2DBCA 5BVBA 1G0TA 4ILFA 3M3MA 3HK4A 3GA4A 2PERA 4EF0A 1ZL9A 2R37A 3KZTA 4PQ1A 2FY6A 3MG2A 1OC9B 3LMLA 2HOHA 1RGEA 2B1LA 4Z7XA 1RGHA 1DUGA 1X1WA 5IG3A 3NOFA 1XBSA 4I97A 4MABA 2CG1A 1LBKA 3CYNA 3FKAA 1SKSB 3G6E3 1QUWA 2JZRA 5M1AA 3JCML 5INYA 2BMXA 3UL6A 4TN8A 4BL3A 1SL0B 1DVDA 1SIHA 1JKGA 4IHUA 2WULA 2L6DA 3EE1A 4HM8B 3ME8A 1N9JA 2HE3A 4WKWA 1PY3A 4GSSA 1XWKA 1EV9A 3OX9A 1M1XB 4GQCA 2P38A 3OW22 2DMMA 2ZCTA 3D5GA 2JZTA 2V6OA 4N6LA 4POMA 3RHBA 1BNJA 2E2TA 3N54B 3SOYA 1OYJA 4OO5A 2W2CA 4JU5A 3EN1B 4BL2A 3BCIA 3FGYA 2L57A 1GUMA 1I0VA 2WS2A 4LSOA 3D79A 4DKIA 4EYCA 2KUCA 4O5RA 3TKSC 3K63A 3I9V2 3AY8A 1EEMA 5EEOA 1T4ZA 3IMAB 4TR0A 2OCTA 3PS8A 4PUAA 4WR4A 1K9M4 1T1VA 2MYGA 1TK0B 3DGNA 2Z9SA 11GSA 1AV4A 2VL2C 2N5BA 2XHFA 1RCKA 2X8CA 1GY6A 1BSCA 2BMOB 2GZZA 2WDUA 4JE1A 3MWZA 4E8EA 2DJKA 2FUG2 1M0UA 1GRXA 1PKZA 3CMIA 1SD9A 1OCVA 4MP4A 5C04A 1EG9B 3PINA 4HM2B 1V57A 1MGWA 1J2BA 1W2B2 1N5HA 1A0FA 4LGQA 6GSXA 1FG4A 1OE7A 2MMAA 1K0NA 4O5QA 2RIIA 2AAEA 2XEPA 3IAM2 1YEXA 3D4AA 1O7GB 5KN2A 4XBXA 3GSTA 2FCHA 1Q40B 2V2GA 3DGQA 5KN0A 1R7HA 3O6TA 3GNJA 3HJPA 3F14A 2VUPA 2K0MA 1BQ7A 4HJ2A 5CRDA 4RNYA 4XDWA 2X8HA 3UAPA 1BRHA 5EY6A 3IDVA 2ZHXB 3KMOA 1XIYA 2HSYA 1M9BA 4NHWA 1PN0A 3GL3A 1QVF2 2Z6BA 4ZL7A 1V98A 14GSA 1G96A 1O81A 4EC0A 2H71A 3L9SA 2WFCA 3GIXA 2TRXA 2JACA 1LJRA 3LH4A 1OVNA 3TRPA 4V1Ag 4I2UA 2CC3A 1YKAA 1W6CA 4BVYA 5ECQB 1MWSA 3H79A 3SWLA 3OWSA 1K0CA 2QA2A 3JUOA 4DSRA 5D96A 3EURA 1R26A 2FWGA 2C0FA 5D82A 4KCAA 3DGOA 1VF1A 3WGEA 4EUYA 4BL7B 1LU4A 4HM5B 4HOJA 4I6XA 4JR6A 1X1UA 2C0EA 3ZREA 1HU9A 4K61A 2V41A 2HXKA 1TK5B 2QIYA 2P0GA 2GU3A 4MK3A 3BNBA 1AAZA 3GKMA 5F06A 2P5RA 1ILOA 1FGMA 1XW6A 1S3AA 1NU3A 1QAKA 4MPFA 1PX6A 5DQSA 2HMOB 4IS0A 1UGHI 5IG4A 6GSYA 1O8WA 4RUVA 2VAFA 3B4OA 1GMPA 2DJ1A 4ZXGA 1TTOA 1B9XC 1BRNL 2YV7A 4Z2UA 1T7PB 3PCRA 2H6ZA 4XM4A 3DVWA 3VK9A 5GAPD 3WGDA 4L5LA 4TVEA 3FG1A 1UW1A 3KCHA 5JWOB 3D6IA 4IELA 4BVYB 1SPUA 5H5QA 3MNGA 4FYUA 5G31A 1YI23 4MZCA 4POKA 3APSA 4XS4B 2J8XB 5A4UA 1GTIA 3QOUA 1PFOA 1URMA 1M1K4 2MF7A 3IE3A 4EXJA 4L8PA 3GKXA 2P5QA 4FYBA 1NHOA 3H51A 3UEMA 3FW2A 1RLSA 4RQXA 4KFEA 2NBSA 4HJMA 2YP6A 7GSSA 3IHQA 1GP1A 3CC73 2CFWA 4TR1A 2H72A 4KF9A 3EN8A 3TKSE 4FCMA 3FK8A 3KXOA 3L9UA 2G0FA 2L6CA 3KH7A 3ZYWA 2ON7A 2YV9A 1QFNA 4YAVA 3I563 3LOYA 1M2BA 3KIIA 3Q1CA 1YEPA 1UGIA 5IMDA 1RGLA 4X43A 2IMKA 5D81A 2B5YA 2V1MA 1TKDB 2KOKA 2R0CA 7STDA 1TIJA 5CLKA 1VF3A 4N3VA 4LL1B 1TRPA 2LQVA 5COHA 1BGSA 2P0MA 5G5EA 2RSXA 3FRCA 1HQOA 1U88A 1FGRA 3J7Yk 4PUFC 3F4TA 3FZWA 4CY6A 2GSTA 2LRNA 3SOAA 1PSQA 2BHMA 3FZAA 1DBYA 2L5OA 5LNKe 3UMAA 3PGTA 2H6XA 4F82A 3GHAA 4EW5A 3HDCA 4L7KA 2KF6A 5CRGA 4RQRA 1FB6A 1GUHA 3WT1A 1AR0A 3F8XA 4QWTA 22GSA 2JQ5A 2F8FA 1RGGA 3NBJA 3FG3A 4TR1B 3CC43 1RNTA 2YX9A 2DJ2A 4CDLA 1XG8A 2TIRA 1D6ZA 3F9SA 1XWBA 2O89A 1EKMA 1BRGA 4KH7A 3UVHA 1H4OA 4KSMA 3UIWA 1PA3A 1WIKA 2LRTA 1VQ93 5AEUB 4TOPA 2KCDA 3AGNA 1ZYNA 2H76A 1W2ZA 3C1SA 2AADA 4IP1A 4HM7B 4V2MA 5B7CA 3O8YA 2EIRA 3EX9A 1ZX2A 3ED3A 3IOSA 4ZL8A 2C0DA 2PPTA 2MC8A 5HQPA 3TKSA 3DD3A 3GH6A 3GRXA 1ZGXA 4KZ1A 3CTGA 2YCDA 3BJ5A 4PNFA 4WBJA 2IUKA 1MD4A 4LYLB 4PX1A 2YFJB 2OBIA 1F8NA 1F3BA 3GAXA 4ZB6A 2B7JA 1OHPA 2KRTA 7RNTA 1SJ6A 1B21A 1ZYEA 4V2NA 5AGYA 2OADA 3TJBA 1R4CA 4MJCA 1V58A 3WMDA 3F3RA 1Y25A 1JZOA 2MZCA 1HYFA 2OE3A 4JEDA 5ELGA 5G5FA 5ID2A 2WRTA 1MWTA 4GSTA 2Y73A 1IQ8A 1M9AA 4L5OA 3F9UA 4ECBA 5HGRA 4LA1A 2K8SA 4HU9A 12GSA 2LUSA 1ROAA 4XTSA 1O7HB 2JL4A 1IYHA 2H0IA 2Z7AA 1Z1SA 1W5ZA 4ZM8A 1ISKA 2OA7A 3Q90A 3M9JA 2G2QA 1W6GA 1O8XA 3VPTA 3JUPA 1W01A 4IGJA 2HMJB 2IMJA 4U13A 3L9VA 2XRXB 5ECKB 1TRSA 2SARA 4I5QA 1BG5A 2CK3H 5EQLA 3GKNA 5KP1A 4XS4A 1EOGA 4G10A 3A76A 3EC3A 1BUQA 3DY5A 2FLSA 1TRWA 3E99A 2P09A 1ERTA 1TP6A 4IN0A 4XBYA 1MWUA 4XRAA 1GD4A 1A23A 1B2XA 4HZ9B 3RPPA 4KSOA 3CD63 4HM0B 4HYZA 2IJYA 3NM7A 6GSPA 1BEDA 1SD8A 1IV9A 3V99A 2CIUA 1ROVA 3HY2A 4TXVA 1GLQA 1BVIA 5JWRB 1SK0A 2R41A 3HJMA 3HD5A 2DSAA 1UCJA 4NWYA 4O02B 1BNIA 3KMNA 1GULA 4Q53A 1JHBA 1Q40A 4ZL9A 1ZO2A 1S3CA 4ML6A 1T3BA 2WGOA 9GSSA 3HOHA 4EV2A 1ML6A 2BMQB 4EE0A 5HR2A 4XIHA 2DIZA 1X5DA 3CBUA 1K0OA 2LV3A 1G6WA 1GSYA 1RN4A 4ULXA 5BRTA 3FZ5A 4OWYA 3HVXA 3KD0A 3GX8A 5DREA 4LZIA 1DETA 4G9HA 5F0GA 9RNTA 3V92A 4FR9A 3U5RE 4PGTA 1T00A 4BL7A 2KXGA 4EC6A 3MYDA 2VL9A 5ABRA 4HUAA 2H6YA 4NHZA 1X9WB 3OR5A 5D9XA 4N0ZA 1JLWA 4ID0A 4YKGA 1WWJA 1X5EA 2H66A 2GSSA 2WZ9A 3G4S3 3PCSA 20GSA 1EOHA 2F9SA 1EGOA 4HQSA 3FLJA 2XSOB 4FMBA 3ECFA 5RNTA 1I2GA 3A3TA 4MH2A 3ZL5A 1QJGA 2UZ8A 5FGOA 1W6YA 3ZLPA 2OTL3 4ML1A 1AVKA 3G7JA 1OE8A 3CMA3 1XWAA 4V2LA 2H74A 3IV4A 3PR8A 1U3IA 1FUWA 3EYTA 2M46A 2OQEA 4AF2A 2XF3A 5AI1A 1YDKA 1BRJA 2RBIA 1Y4KA 1VQ83 5FW5A 3DGYA 3K8NA 1FO5A 3M0FA 2H1DA 3NQYA 13GSA 2PNCA 2F5MA 2BNGA 2GU1A 5GSPA 2AV4A 1GSQA 5LC6A 1SKRB 3KTBA 3CXC2 2JSYA 2W0QA 1KD14 1SL1B 5D9TA 1GOUA 1M3IA 2P31A 5IMAA 2P0XA 1GTAA 5IW9A 2MMZA 1TRQA 4BWSA 4STDA 2LKUA 3F6FA 4MZBA 3TJGA 2K3DA 5B8BA 3ISOA 2QA43 4KA0A 2SBLA 1OC9A 5HR1A 3S27A 3U6VA 3I69A 2RM6A 4GRFA 4LMWA 3SXXA 3EMXA 4K1VA 1MTCA 4POLA 1ZGNA 1TDIA 2LJKA 1ERVA 1OGZA 1RJOA 2GQLA 4BVXB 3EF8A 4E8HA 4KB3A 4IW9A 4TW5A 5BXQA 2ZL8A 4K9ZA 5D8IA 5F07A 1TK8B 1DYUA 4MLYA 5EL8A 1BYEA 1RRHA 3LGCA 1THXA 2PBJA 3UJ1A 2HLSA 1VQ43 3V98A 4ZBAA 3KCMA 1AUCA 4NPBA 4KFDA 2W9PA 2PVOC 4K1FA 3WOFB 3WA3A 4KCEA 3SVAA 2VCTA 2O3OA 3IA1A 1NNVA 1DMNA 3PZWA 2C80A 1NB3I 2ON5A 1NM3A 1O7MB 3S67A 1LXEA 5CAXA 3GRDA 4XDVA 4ZB8A 4N6OB 1T4YA 1UCLA 3B7CA 1BSEA 2IA7A 1TRVA 1EQKA 4IQ1A 2XH9A 2F51A 2QGVA 3MYTA 4K0NA 3FKFA 2CQ9A 3CCU3 2OKAA 2X64A 2FHEA 1UA5A 2GZYA 3E9JB 1MDKA 4LMIA 2F8AA 2WB9A 3LORA 2NTOA 4BIRA 2VCQA 4NMUA 1D6UA 3APQA 1LRAA 4EL1A 3IC4A 2J23A 2B1XB 2L5LA 1WJKA 2ML5A 4WBRD 3GN3A 2FGTA 4ORLA 2LRCA 2JU5A 1QK8A 1TTZA 2CWUA 1MNLA 3NBBA 4ZBDA 3SBCA 5M19A 5G30A 3ZRDA 3LW9A 3MAKA 3URPA 1EZKA 2CV4A 3JUNA 3HKRA 2XFSA 4LMVA 1XFLA 1Q42A 1G7EA 4X0XA 5DRVA 2HFDA 1L5GB 1AQZA 5IMZA 2CG0A 3CNXA 4EKZA 3LTBA 2WGRA 3GTUA 1SQWA 4EDYA 3S5CA 3TJJA 5D73A 2QGUA 3UL5A 1ON4A 2K9FA 3KGKA 2YANA 5CF2A 3LYPA 2FNOA 4O92A 2LNTA 3ZG5A 3IJEB 3KM6A 1TXXA 3KFQC 2H8LA 3AMOA 1VQK3 3F8UA 4QL9A 4N6UA 1VF4A 1HKXA 3CCS3 1JBRA 4K6XA 2CZ2A 1BRIA 4HZBB 1VQ63 3GFKA 3AHSA 5AYRB 6GSSA 5IG5A 2A2PA 1ULIB 4CHSA 3SEDA 4MJEA 4RNTA 3HCZA 1GY5A 16GSA 2YJHA 1B9YC 3NV0A 1HNAA 3TB2A 1UUWB 1E3VA 1A2MA 4L0UA 3VGNA 3OWUA 5DJLA 4FCZA 4R4KA 1JN5A 2ZDJA 2IIYA 2VO4A 4RZMA 4O5UA 2O8VB 2HZFA 3LYGA 2CFLA 1ZYQB 1Q7HA 1UCKA 1PQNA 2HMLB 2H01A 3ERGA 4WHAA 2ALBA 3KKGA 3ERFA 4FYCA 3EJVA 4R9KA 4HVNA 2X8GA 1LNHA 5ECIB 2KP1A 1PYLA 1CH0A 1TI3A 5J5NA 4D73B 4PXOA 8CHOA 5AN1A 3RAZA 3AGOA 3BIRA 3LEFA 5JWQB 1E2YA 2Y74A 1AVLA 4N6NB 4HDEA 3H93A 3LXZA 1K0BA 3V1WA 3L0RA 3CCR3 3F3QA 3KJYA 1B2ZA 3LWAA 1BU4A 1GNWA 3FH1A 1TI1A 1RSNA 3A5IA 4X4JA 3HI7A 4I4KA 3CCL3 1JBTA 1DE1A 2YFLB 3NHXA 5B6MA 5IO2A 1FYSA 4FMCA 4Q5QA 1M904 4K5RA 3CXGA 1Q4JA 1J08A 5DALA 5KP3A 3FSDA 1GY7A 3QK9A 3NV0B 4Q5FA 2FNQA 5B8AA 3ZFBA 3L78A 2GSPA 4G19A 2EC4A 1Z3EA 4H86A 5IOWA 3G9BA 2PUKC 3QAWA 2OE1A 1UCIA 2CAIA 3IK9A 2CT6A 2VCXA 2IMIA 4KUNA 1YIT3 5J41A 2CX4A 2R5GA 3G713 2GGTA 2VL2A 3A2WA 3WT2A 1Z6NA 5ELAA 1JB4A 1YVBI 5D83A 5IOXA 2YOIA 4O3VA 5D9WA 2P05A 4J56E 3ZFLA 1BNFA 1G02A 4HI7A 4Z2RA 1SARA 4ISDA 4WF5A 3CME3 4KDUA 3RHCA 4TXOB 2EIOA 4DSSB 1BSAA 1BSBA 2A2RA 5HFGA 1I9DA 5KOWA 2EIQA 2WJUA 2V6KA 3F40A 4G1MB 2NVLA 2CHCA 1K0AA 1S5AA 1SYXA 4GXZA 2OQEC 2M7OA 3RGAA 6GSTA 2R2JA 1FGTA 1M2AA 4GSPA 3QAGA 2M72A 1FVKA 1GNEA 1UC7A 2WOHA 4OFNA 1G6YA 2AUVA 1QMAA 3M9KA 2PGTA 1MWRA 4PTSA 5DCGA 3GZBA 4AGSA 1OC8A 3GYKA 3ZITA 3J7Yb 3HA9A 2H1AA 1SU9A 1WE0A 3M1GA 1CEWI 1BAYA 4RBNA 1RQMA 2B3SA 1WP0A 3ZIJA 3FG4A 3ZMLA 2K6VA 3JVCA 1BNEA 2HRNA 4O7HA 1R4YA 1O7NB 1GMRA 5IQYA 5CO3A 1OH0A 4HSCX 1V40A 3TJFA 1WRYA 4K7NA 5AISA 2R4VA 4F2IA 1GWCA 1NJI4 1YF1A 5DVBA 2E2UA 4MEIA 2LEGA 3GX0A 1D6YA 3EB8A 1AQXA 1CQHA 2N5FA 3DMLA 3P90A 1YHQ3 3TRXA 2CFGA 2L4CA 3DXBA 4JF8A 1A2LA 4F9ZA 1GOVA 1S3DA 1OKTA 3X3YA 4N0VA 5JBSA 1KTEA 4PURA 2CX1A 1YGEA 3VLNA 4BA7A 3ER7A 1YQ1A 1Z6MA 1KSIA 1CQGA 4WYKB 4ICYA 3FF0A 1OGXA 5HR0A 5A4VA 2W56B 1AIUA 6GSWA 3TUEA 1BANA 2VD1A 5IEOA 2NPBA 1N8QA 3D4TA 4MF7A 3G7IA 3VFIA 2GEXA 1CYVA 5IERA 1CYUA 3G16A 1I0XA 1QAFA 2LQOA 3A5WA 3GL5A 2H30A 2LNSA 1YF0A 4USSA 1GOYA 2I9WA 3L4NA 4DSQA 3UL3A 5LD0A 2GLRA 3KEBA 3F7SA 4DEJA 3P8WA 3CU3A 3DH2A 8RNTA 1JBSA 1HD2A 2GBWB 1K3YA 4MH3A 2HSHA 2M80A 5JCUA 5H5SA 3QDNA 3DGLA 1TFOA 5AIFA 2OE0A 1MD3A 4F0BA 2CVDA 2CWVA 2AYTA 4IJIA 3WGXA 1QALA 1R5PA 3N8BA 5CXOA 3IPZA 3TGZA 2XBIA 3C71A 5BU4A 1QXHA 1ULJB 1PU4A 1J9BA 2H73A 5DJMA 3APOA 5TGNA 3EE2A 1USBA 4XS1A 2YNXA 1C72A 2CH9A 1IYYA 1SYRA 2IFQB 1HZ1A 3SYUA 3GKKA 2X99A 2GQKA 5J9BA 3LG6A 3TKQA 4JRRA 1DMMA 4KNDA 1XWGA 1W4VA 4WETA 1JZRA 2FWFA 3C1RA 3R3EA 3WDGB 4J5GA 2YFIB 3FZ9A 3OV4A 1JNQA 2A4HA 2C10A 4GTUA 5GSTA 2VLVA 4KDYA 1A8YA 1IVXA 2LSTA 3CSIA 2XC2A 5LCZA 4MMYB 5L71A 1TUHA 1B4PA 3U1WA 3F63A 3DUKA 5ECRB 5IG0A 2GSRA 3HVVA 1BRKA 2JDIH 1AC1A 2D2ZA 3K0ZA 5CP1A 1E97A 2OTJ3 3I43A 1N8R4 3A2VA 4XS6A 1TOFA 5G1KA 1TW9A 3EMPA 4NHFA 3DMCA 2QSIA 5IO0A 4O32A 3FF2A 2AHEA 3D0ZA 1LNIA 1MDIA 3H3HA 3KP8A 1WMOA 1Z9HA 4KE3A 1X9MB 3K5TA 1HNCA 3CRTA 3GSPA 2DJ0A 4WEYA 2YZHA 2YWIA 1KQS2 4MCUA 4YQUA 5IIZA 2AJQB 2ES7A 2XPEA 2CA8A 3CPOA 3MIXA 4IBPA 2IN3A 3PH9A 2C0GA 1UDII 2JZSA 5BMUA 5CF1A 3TRQA 3KH9A 4KX4A 3FHKA 2B7KA 2RFRA 5E59A 5IMVA 1U8CB 3VPQA 2C11A 1VRSD 4KVHA 3LJRA 2W6JH 1RGCA 1S3RA 1W02A 4MF6A 2R0GA 2VL3A 1NW2A 3K7CA 1MGRA 1YNVX 2YWMA 1EGRA 5FT3A 1VQ73 5JPPA 1W00A 4TKYA 2HMMB 4N30A 2DJ3A 5AEWB 5AYSC 1JB2A 3SLUA 3TCOA 3MSOA 2B24B 1I3FA 5FWGA 1TP9A 1RGAA 2JSZA 4ECCA 1S723 1SIIA 2D42A 4GL6A 1BRSA 2DKIA 3CCQ3 4XBTA 2IWTA 1JV2B 4TRXA 4Q5RA 3WA2X 4J5KA 2E2VA 1UVZA 1FA3A 2DLXA 3G7YA 2UX0A 2R6KA 3Q18A 19GSA 1K734 5AIGA 1GSDA 3PPUA 5CRHA 4EBGA 3F4RA 2H1GA 1LOXA 1K3OA 3FCSB 3NX0A 3X40A 1U87A 2CZ3A 1B2MA 1YVSA 2F3MA 2C3NA 2I3YA 3P2AA 5IMCA 5FHIA 2YN1A 2Q07A 1U3AA 3ZZXA 2INXA 2IYJA 4CCVA 3GZXB 1FW1A 3DKSA 1SL2B 1Q864 2RCDA 3BNDA 3MHEA 2GXFA 2IMDA 3EU4A 2H70A 4HEA2 1JLVA 1SJZA 2IL3A 3VF1A 4EV5A 1IVVA 1YJ93 3E3EA 5IMFA 3W8JA 3G0KA 1OC3A 2Z77A 1DMQA 2GVPA 5ECMB 4BU4A 4J8TA 5CNWA 1XVQA 2LJAA 3AHWA 2GEYA 4X1UA 5IPGA 3QR6A 5EVOA 2CFKA 3EBTA 2H1BA 1XW9A 4CJNA 2CW9A 3DYRA 1I2EA 3D9RA 5KEJA 5GSSA 1BJXA 2PMTA 3MDKA 4J57E 3IHGA 5G2GA 4BTWA 2MBTA 1UN2A 3K9MC 2CAQA 1H75A 3UBLA 4FMDA 1LOVA 1BUJA 1JKGB 1AY7A 4PNGA 1WMNA 4N10A 4WP5A 1I8VA 2O9UX 3F4SA 3TKRA 2NDOA 2HZEB 4AJ8A 4F03A 3D21A 3CCE3 2N5AA 3H1NA 5ECOB 4IVFA 5DCHA 1YGWA 4K2DA 2CWTA 3STDA 4GF0A 5C00A 3GURA 1Q9EA 2RNTA 3UARA 1UUVB 5IENA 3N9JA 4XCSA 3HJOA 4ZB9A 2PZVA 1SJIA 2WO0A 2IUJA 3I553 1NDOB 1K0MA 2ZNMA 4FIWA 2WCIA 4MJAA 2FWEA 3NIVA 5F05A 2E2GA 4TX4A 3B8LA 2BU4A 3D5IA 3UNLA 3FY7A 2YWOA 5A5KA 4OCEA 1F37A 4FCJA 2PWJA 4IP6A 4L8EA 2HZEA 1T2IA 1TU7A 1RGKA 1BIRA 3ZG0A 2Z76A 2AB6A 1IQXA 2YPMA 1E3RA 2CKFB 1U5OA 2O85A 1KWIA 2L4VA 2LJRA 3X42A 3Q74A 1Q814 4F0CA 5J9CA 3Q19A 2QKEA 1FUSA 2HMKB 4RI7A 4ACSA 2E7PA 4X2OA 3LT8A 3T8UA 1N9EA 2BO9B 1DE2A 2DIYA 3IAS2 1QGVA 2MMOA 2J9HA 4HS1A 1JJ22 4K1UA 4X2HA 2DC5A 3BNCA 4N6TA 2GZPA 1SK2A 3CCM3 1PKWA 5AIVA 2F98A 4BWQA 5HR3A 3HIIA 1RCLA 1X0RA 1WTHA 3PXMA 3RPNA 3X3ZA 3F8HA 1FZUA 1YKCA 3H4KA 4QL7A 4XHMA 1SENA 1B48A 2QA1A 3MPHA 2W04A 3ZTLA 4CY8A 1M99A 2VD0A 1V9WA 3F6DA 1KBNA 1VGLA 3DIEA 1FGOA 4BTYA 2YZUA 1M9GA 3FR9A 4AJ6A 1JRQA 1N8JA 3BBYA 3VSYA 5ECNB 2K8VA 3EU3A 2C4JA 1BNSA 1KNGA 1TU8A 3LXTA 3NUVA 3BD2A 4PQHA 2KP2A 3FZ4A 3UOMA 3KTLA 3HIGA 3VI7A 3MG3A 5BIRA 4GQFA 1F9MA 3BB9A 3LFLA 1Z7RA 2PVQA 4MMZB 4G0LA 4DSSA 2RM5A 4ZILA 1T2HA 3EQQB 1EUIC 1NB5I 4K5SA 2RUEA 1UI8A 1I5GA 2VLUA 4OO4A 2GDRA 1VF2A 1FHEA 3LTAA 1B4QA 2FWHA 3M8CA 3E0UA 2PN8A 2PU9C 4HQZA 6GSUA 2WOFA 2R4IA 2H75A 3GH9A 4HOHA 3DEXA 2HMNB 1WMPA 4AJ7A 4LLRA 3IXRA 2XGLA 2W03A 1BNRA 1B27A 2KAAA 1GSSA 1OHSA 3DGMA 4WWUC 8GSSA 2HNLA 3HYPA 1IV7A 1OPYA 3QFBC 4WR5A 2O7KA 3DWVA 1SKWB 3TDGA 3HZ8A 4GSNA 3C73A 2KLXA 5DALB 1W4NA 5J4UA 1RNBA 3TKPA 3RBTA 2H0HA 2HRKA 5HFIA 3ZVJD 1VQ53 3HXSA 3MG1A 3ZMKA 4G2EA 3CQFA 4MDCA 3LT9A 4YKFA 2C3QA 2BT3A 4YQVA 1YJ6A 2TRCP 5DQYA 5ECHB 4ZBBA 4PEJA 3WODG 4JBBA 5D9VA 10GSA 3BU4A 4KAEA 5IPHA 3QMXA 3A5EA 1ST9A 5KOXA 2I1UA 3A2XA 3MSZA 2C3TA 3WD6A 1FUTA 3PGBA 1QMVA 1AW9A 1WMJA 1PFPA 4IIAA 5M18A 2E2MA 2DJJA 2R3XA 1FVJA 1V2AA 3IPTA 1Y6EA 4EO3A 1RHLA 2XPDA 4EDZA 3HVSA 4FH8A 2BJXA 4OCFA 1RDSA 1I70A 3Q6OA 1EWXA 2XGNA 4KGIA 5CRWA 1XOBA 4MPGA 3WR2A 4EXRA 3BNEA 1IVWA 1A2KA 3CC23 1RTUA 17GSA 1RMSA 3MWHA 3BOAA 5I97A 1FAAA 1GSEA 4HZ2A 1YJW3 3BCKA 4FQUA 2KF4A 2HI7A 4KT3B 3HZPA 5HOHA 3RGRA 4L0WA 3T8NA 1O73A 3NM2A 1Z7PA 1LOWA 1K3LA 3CNMA 7GSPA 1HNBA 3X41A 1PGTA 1Q98A 2DMLA 1VQM3 2CVBA 4AEQA 2BIRA 1O6JA 3EBYA 3GZYB 1PX7A 1QVG2 1GTUA 6RNTA 1U6TA 1LVNA 2VCVA 4I2TA 1T8EB 1FW7A 5ELJA 2IMEA 5J3RA 2XR8B 5ECSA 2IFQA 1K0DA 3QFAC 3S29A 1GYBA 2XBQA 5IM9A 1OHOA 3VWXA 1GSFA 1MEKA 3TOUA 2FGXA 1VQP3 2HYXA 4HM1B 3KN4A 3VURA 3FR3A 5GZZB 3CPW2 1W7CA 2GS3A 1GTBA
chains in the Genus database with same CATH topology
4NAXA 2A2SA 5DDLA 4ZIJA 1M2DA 1B8XA 18GSA 2LS5A 3I6AA 1GSUA 1RK4A 3KZQA 4OFTA 3US3A 4J2FA 3EWLA 3IBHA 4KW6A 1ERWA 2VCWA 1A24A 4BPYA 1FOHA 3N5OA 3S9FA 2X49A 4NXIA 4P3YB 2B5EA 3ERWA 5A4WA 5DBQA 3GMFA 2FA8A 4TR4A 4MF5A 2IMFA 2IPAA 2C1YA 1W89A 2VM2A 1X9SB 1A8LA 5ENUA 4ECJA 2DKHA 5E4WA 2VOCA 5HFKA 3R2QA 4HZ4A 2HSMA 1ZMAA 1MDJA 2HRFA 1JZDA 1XCCA 1RW1A 4MA9A 5B6NA 3EPTA 4Z2TA 3GSSA 2CVKA 3QD9A 4EIQA 3IRAA 3C7MA 2FD3A 4BVXA 3D4MA 3CSJA 3TOTA 2OBKA 1JFUA 1KEBA 1O85A 1EP7A 1PMTA 2GQMA 4IKHA 1GH2A 1OAZA 3L0HA 4N11A 2HRAA 3WYWA 1WPIA 2IY2A 5H5RA 3CRUA 3VWWA 1PN9A 5GAND 3ZIVA 4OMVA 1GL8A 2REMA 2GSQA 1A0RP 2MMNA 2B1KA 4EVMA 4GLTA 2CX3A 2I4AA 3D5JA 1N2AA 3QCPA 1PRXA 1E6BA 4CDOA 2RUFA 5G1LA 3GV1A 3D22A 4NV5A 2LQQA 5ECPB 2C8UA 5D93A 4K8MA 3LSZA 1XPVA 1EV4A 2H19A 1ACVA 2QC7A 6GSVA 3TJKA 4IJ3A 3W6GA 3F0IA 4XRDA 4IQAA 2VCZA 4ECIA 4YAPA 4WF4A 2I81A 3M8NA 1ABAA 1O7UA 2AAWA 3H8QA 4I8BA 1M7TA 2KHPA 5AIXA 3P7XA 5DAKB 3C8EA 5JCWA 3FYGA 1XXUA 4LL4B 3KP9A 3DRNA 4POBA 5CREA 3UVTA 1ZOFA 4D73A 1GLPA 4EIPA 4QQ7A 1GUKA 3QAVA 5F8BA 5DAKA 1ZCPA 2L59A 2B5XA 1PD21 4TXOA 4GWRA 3HHVA 1G7OA 1THOA 2GT5A 3IC8A 4K7IA 3O3TA 4YQMA 4FO5A 2I9HA 3ZVJA 3EVIA 1FB0A 2V32A 2OACA 4G0IA 3IK7A 2YWNA 4A5PA 2L4QA 2H0GA 3QPMA 4TR3A 1NSWA 2E0QA 2VM1A 3NZNA 2LTKA 4KDXA 3KIJA 3W8SA 4GCIA 1YZXA 4MJBA 1FOVA 4NV2A 1EEJA 2HT9A 1XWCA 1ZZYA 3FMWA 3LQ7A 1EP8A 2RLIA 1AQVA 3VWVA 5ID2B 2B6MA 3RDWA 1TRUA 3VWUA 1PL2A 4DVCA 2BTOT 2A4VA 4K7OA 1F2EA 4G0KA 3EINA 4YH2A 1XZOA 2ZUPA 3CSHA 3DVXA 1X5CA 1TJDA 4HU7A 3GUSA 1R5AA 1NHYA 3HZ4A 1XOAA 4Q5NA 3FEUA 1OKDA 4RI6A 1F3AA 1XVWA 2GT6A 2JADA 4OD7A 1PL1A 1R4WA 4CW9A 1HYUA 5CYYA 4V1Ap 4WXTA 1BX9A 1YY7A 3IR4A 3ME7A 1XW5A 1A2JA 3LYKA 1AXDA 4OFMA 1DSBA 1IYIA 1WOUA 3CTFA 5JCGA 4K0GA 5KN3A 2X4AA 1SK1A 4K2XA 2GTUA 4MNNA 3O76A 1J0FA 5G2ZA 2VLTA 4JZQA 2YJ7A 4MZWA 3VI5A 5EPFA 2OJLA 2MBSA 1Z5YE 1ERUA 3GTUB 4JR4A 4PQIA 3FR6A 5KN1A 2FA4A 2R0PA 1QQ2A 1F6MC 3UBKA 2O87A 1JZWA 2VIMA 1AQWA 1ZYPA 5ECLB 4MMMA 2K18A 2DBCA 1G0TA 4ILFA 3M3MA 3GA4A 2PERA 4EF0A 1ZL9A 2R37A 4PQ1A 2FY6A 1OC9B 2B1LA 4Z7XA 1DUGA 3NOFA 1XBSA 4I97A 4MABA 1LBKA 3CYNA 1SKSB 1QUWA 2JZRA 3JCML 5INYA 2BMXA 4TN8A 1SL0B 4IHUA 2WULA 2L6DA 3ME8A 2HE3A 4WKWA 4GSSA 1XWKA 1EV9A 4GQCA 2DMMA 2ZCTA 2JZTA 2V6OA 4POMA 3RHBA 1OYJA 4OO5A 4JU5A 3BCIA 2L57A 1GUMA 2WS2A 3TKSC 2KUCA 4O5RA 3I9V2 3AY8A 1EEMA 1T4ZA 4TR0A 4PUAA 4WR4A 1T1VA 2MYGA 1TK0B 2Z9SA 11GSA 2VL2C 2N5BA 2XHFA 2X8CA 2GZZA 2WDUA 4JE1A 4E8EA 2DJKA 2FUG2 1M0UA 1GRXA 1PKZA 3CMIA 1SD9A 4MP4A 5C04A 3PINA 1V57A 1A0FA 6GSXA 1FG4A 1OE7A 2MMAA 1K0NA 4O5QA 2RIIA 3IAM2 1YEXA 5KN2A 3GSTA 2FCHA 2V2GA 3DGQA 5KN0A 1R7HA 3O6TA 3GNJA 3HJPA 2VUPA 1BQ7A 4HJ2A 5CRDA 2X8HA 3UAPA 5EY6A 3IDVA 3KMOA 1XIYA 2HSYA 1M9BA 4NHWA 1PN0A 3GL3A 4ZL7A 1V98A 14GSA 1O81A 4EC0A 2H71A 3L9SA 2WFCA 3GIXA 2TRXA 2JACA 1LJRA 1OVNA 3TRPA 4V1Ag 4I2UA 1YKAA 4BVYA 5ECQB 3H79A 3SWLA 2QA2A 1K0CA 4DSRA 5D96A 3EURA 1R26A 2FWGA 2C0FA 4KCAA 1VF1A 3WGEA 4EUYA 4BL7B 1LU4A 4HOJA 4I6XA 4JR6A 2C0EA 3ZREA 2V41A 2HXKA 1TK5B 2P0GA 4MK3A 1AAZA 3GKMA 5F06A 2P5RA 1ILOA 1XW6A 1S3AA 4MPFA 1PX6A 5DQSA 4IS0A 6GSYA 1O8WA 4RUVA 2VAFA 2DJ1A 4ZXGA 1B9XC 2YV7A 4Z2UA 1T7PB 2H6ZA 3DVWA 3VK9A 5GAPD 3WGDA 4L5LA 4TVEA 5JWOB 3D6IA 4IELA 4BVYB 5H5QA 3MNGA 4FYUA 5G31A 4MZCA 4POKA 3APSA 4XS4B 5A4UA 1GTIA 3QOUA 1URMA 3IE3A 4EXJA 3GKXA 2P5QA 4FYBA 1NHOA 3UEMA 3FW2A 4RQXA 2NBSA 4HJMA 2YP6A 7GSSA 3IHQA 1GP1A 4TR1A 2H72A 4KF9A 3TKSE 3FK8A 3KXOA 3L9UA 2G0FA 2L6CA 3KH7A 3ZYWA 2ON7A 2YV9A 1QFNA 4YAVA 1M2BA 1YEPA 5IMDA 4X43A 2IMKA 2B5YA 2V1MA 1TKDB 2KOKA 2R0CA 1VF3A 4LL1B 5COHA 5G5EA 3FRCA 1HQOA 1U88A 3J7Yk 4PUFC 3F4TA 4CY6A 2GSTA 2LRNA 1PSQA 3FZAA 1DBYA 2L5OA 5LNKe 3UMAA 3PGTA 2H6XA 4F82A 3GHAA 3HDCA 5CRGA 4RQRA 1FB6A 1GUHA 3WT1A 22GSA 2F8FA 4TR1B 2DJ2A 2TIRA 2O89A 1XWBA 4KH7A 3UVHA 1H4OA 4KSMA 3UIWA 1PA3A 1WIKA 2LRTA 4TOPA 1ZYNA 2H76A 3C1SA 4IP1A 4V2MA 5B7CA 2EIRA 3ED3A 3IOSA 4ZL8A 2C0DA 2PPTA 5HQPA 3TKSA 3DD3A 3GH6A 3GRXA 3CTGA 2YCDA 3BJ5A 4PNFA 4WBJA 1MD4A 4PX1A 2OBIA 1F3BA 4ZB6A 2B7JA 1SJ6A 1ZYEA 4V2NA 5AGYA 2OADA 3TJBA 4MJCA 1V58A 3F3RA 1Y25A 1JZOA 2MZCA 2OE3A 4JEDA 5ELGA 5G5FA 5ID2A 2WRTA 4GSTA 1M9AA 4L5OA 3F9UA 4ECBA 4LA1A 2K8SA 4HU9A 12GSA 2LUSA 4XTSA 2JL4A 1IYHA 2H0IA 2OA7A 3M9JA 2G2QA 1O8XA 3VPTA 4IGJA 3L9VA 5ECKB 1TRSA 4I5QA 1BG5A 3GKNA 4XS4A 1EOGA 4G10A 3EC3A 2FLSA 1TRWA 1ERTA 4IN0A 4XRAA 1A23A 3RPPA 4KSOA 2IJYA 1BEDA 1SD8A 3HY2A 4TXVA 5JWRB 1GLQA 1SK0A 3HJMA 3HD5A 2DSAA 4NWYA 3KMNA 1GULA 1JHBA 4ZL9A 1S3CA 4ML6A 1T3BA 9GSSA 1ML6A 4EE0A 5HR2A 4XIHA 2DIZA 1X5DA 3CBUA 1K0OA 2LV3A 1G6WA 1GSYA 4ULXA 5BRTA 3FZ5A 4OWYA 3HVXA 3KD0A 3GX8A 4G9HA 5F0GA 3U5RE 4PGTA 1T00A 4BL7A 3MYDA 2VL9A 5ABRA 4HUAA 2H6YA 4NHZA 1X9WB 3OR5A 5D9XA 4N0ZA 1JLWA 4ID0A 4YKGA 1WWJA 1X5EA 2H66A 2GSSA 2WZ9A 20GSA 1EOHA 2F9SA 1EGOA 4HQSA 4MH2A 3A3TA 3ZL5A 2UZ8A 3ZLPA 4ML1A 3G7JA 1OE8A 1XWAA 4V2LA 2H74A 3IV4A 3PR8A 1U3IA 3EYTA 2M46A 4AF2A 1YDKA 3K8NA 1FO5A 3M0FA 2H1DA 13GSA 2AV4A 1GSQA 1SKRB 3KTBA 2JSYA 1SL1B 5D9TA 2P31A 5IMAA 1GTAA 2MMZA 4BWSA 2LKUA 3F6FA 4MZBA 3TJGA 5B8BA 3ISOA 4KA0A 1OC9A 5HR1A 3U6VA 3I69A 2RM6A 4GRFA 4LMWA 3EMXA 1MTCA 4POLA 1ZGNA 1TDIA 2LJKA 1ERVA 2GQLA 4BVXB 4E8HA 4KB3A 4IW9A 4TW5A 4K9ZA 5F07A 5D8IA 1TK8B 4MLYA 5EL8A 1BYEA 3LGCA 1THXA 2PBJA 3UJ1A 2HLSA 4ZBAA 3KCMA 1AUCA 4NPBA 2PVOC 4K1FA 4KCEA 2VCTA 3IA1A 2C80A 2ON5A 1NM3A 5CAXA 4ZB8A 1T4YA 1TRVA 4IQ1A 2QGVA 2F51A 4K0NA 3FKFA 2CQ9A 2OKAA 2X64A 2FHEA 1UA5A 2GZYA 3E9JB 1MDKA 2F8AA 2WB9A 3LORA 2NTOA 2VCQA 4NMUA 3APQA 4EL1A 3IC4A 2J23A 2L5LA 1WJKA 4WBRD 3GN3A 2LRCA 2JU5A 1QK8A 1TTZA 4ZBDA 3SBCA 5G30A 3ZRDA 3LW9A 3MAKA 1EZKA 2CV4A 3HKRA 4LMVA 1XFLA 1G7EA 4X0XA 2HFDA 5IMZA 4EKZA 2WGRA 3GTUA 4EDYA 3TJJA 5D73A 1ON4A 2K9FA 3KGKA 2YANA 3LYPA 2FNOA 4O92A 2LNTA 3KM6A 1TXXA 2H8LA 3F8UA 4QL9A 1VF4A 4K6XA 2CZ2A 3GFKA 6GSSA 2A2PA 4CHSA 4MJEA 3HCZA 16GSA 2YJHA 1B9YC 1HNAA 3TB2A 1A2MA 4L0UA 5DJLA 2VO4A 2IIYA 4O5UA 2O8VB 2HZFA 1ZYQB 1PQNA 2H01A 3ERGA 2ALBA 3ERFA 4FYCA 2X8GA 5ECIB 2KP1A 1TI3A 5J5NA 4D73B 4PXOA 5AN1A 3RAZA 3LEFA 5JWQB 1E2YA 4HDEA 3H93A 3LXZA 1K0BA 3V1WA 3F3QA 3KJYA 3LWAA 1GNWA 1TI1A 3A5IA 4X4JA 1DE1A 5B6MA 5IO2A 4Q5QA 4K5RA 3CXGA 1Q4JA 1J08A 5DALA 4Q5FA 5B8AA 3ZFBA 3L78A 4G19A 2EC4A 1Z3EA 4H86A 5IOWA 3G9BA 2PUKC 3QAWA 2OE1A 2CAIA 3IK9A 2CT6A 2VCXA 2IMIA 4KUNA 5J41A 2CX4A 2R5GA 2GGTA 2VL2A 3A2WA 3WT2A 1Z6NA 5ELAA 5IOXA 2YOIA 5D9WA 4J56E 3ZFLA 4HI7A 4Z2RA 4ISDA 4WF5A 4KDUA 3RHCA 4TXOB 2EIOA 4DSSB 2A2RA 5HFGA 1I9DA 5KOWA 2EIQA 2WJUA 2V6KA 2NVLA 1K0AA 1SYXA 4GXZA 6GSTA 2R2JA 1M2AA 3QAGA 2M72A 1FVKA 1GNEA 1UC7A 4OFNA 1G6YA 2AUVA 3M9KA 2PGTA 4PTSA 5DCGA 4AGSA 1OC8A 3GYKA 3ZITA 3J7Yb 3HA9A 2H1AA 1SU9A 1WE0A 3M1GA 1BAYA 1RQMA 2B3SA 1WP0A 3ZIJA 3ZMLA 2K6VA 2HRNA 4O7HA 5IQYA 5CO3A 3TJFA 1V40A 4K7NA 1WRYA 5AISA 2R4VA 4F2IA 1GWCA 1YF1A 5DVBA 2LEGA 3GX0A 1AQXA 1CQHA 2N5FA 3DMLA 3P90A 3TRXA 2L4CA 3DXBA 1A2LA 4F9ZA 1S3DA 1OKTA 4N0VA 1KTEA 4PURA 3VLNA 4BA7A 1YQ1A 1Z6MA 1CQGA 4ICYA 5HR0A 5A4VA 6GSWA 1AIUA 3TUEA 2VD1A 2NPBA 3D4TA 4MF7A 3G7IA 3VFIA 2LQOA 3A5WA 3GL5A 2H30A 2LNSA 1YF0A 4USSA 3L4NA 4DSQA 3UL3A 5LD0A 2GLRA 3KEBA 4DEJA 3P8WA 1HD2A 1K3YA 4MH3A 2HSHA 2M80A 5JCUA 5H5SA 3QDNA 2OE0A 1MD3A 4F0BA 2CVDA 2AYTA 4IJIA 3WGXA 1R5PA 3IPZA 3TGZA 2XBIA 3C71A 1QXHA 2H73A 1J9BA 5DJMA 3APOA 3EE2A 1USBA 4XS1A 2YNXA 1C72A 1SYRA 2IFQB 3GKKA 2X99A 2GQKA 5J9BA 3LG6A 3TKQA 4JRRA 4KNDA 1XWGA 1W4VA 4WETA 1JZRA 2FWFA 3C1RA 3R3EA 3FZ9A 2A4HA 4GTUA 5GSTA 2VLVA 4KDYA 1A8YA 2LSTA 3CSIA 2XC2A 5LCZA 5L71A 1B4PA 3F63A 5ECRB 2GSRA 3HVVA 1AC1A 2D2ZA 5CP1A 3I43A 3A2VA 4XS6A 1TOFA 5G1KA 1TW9A 3EMPA 2QSIA 5IO0A 4O32A 2AHEA 3D0ZA 1MDIA 3KP8A 1Z9HA 4KE3A 1X9MB 1HNCA 3CRTA 2DJ0A 4WEYA 2YZHA 2YWIA 4MCUA 4YQUA 5IIZA 2AJQB 2ES7A 2XPEA 2CA8A 3MIXA 4IBPA 2IN3A 3PH9A 2C0GA 2JZSA 5BMUA 3TRQA 3KH9A 4KX4A 3FHKA 2B7KA 5E59A 5IMVA 3VPQA 1VRSD 3LJRA 4MF6A 2R0GA 2VL3A 1NW2A 2YWMA 1EGRA 5FT3A 4TKYA 4N30A 2DJ3A 3TCOA 5FWGA 1TP9A 2JSZA 4ECCA 2DKIA 2IWTA 4TRXA 4Q5RA 1UVZA 2DLXA 3G7YA 2R6KA 3Q18A 19GSA 1GSDA 3PPUA 5CRHA 3F4RA 2H1GA 1K3OA 1U87A 2CZ3A 2F3MA 2C3NA 2I3YA 3P2AA 5IMCA 5FHIA 2YN1A 1U3AA 3ZZXA 2IYJA 1FW1A 3DKSA 1SL2B 2IMDA 3EU4A 2H70A 4HEA2 1JLVA 1SJZA 2IL3A 5IMFA 3E3EA 3W8JA 1OC3A 2GVPA 5ECMB 5CNWA 1XVQA 2LJAA 4X1UA 5IPGA 3QR6A 5EVOA 2H1BA 1XW9A 3DYRA 5KEJA 5GSSA 1BJXA 2PMTA 3MDKA 4J57E 3IHGA 2MBTA 1UN2A 2CAQA 1H75A 3UBLA 4PNGA 4N10A 3F4SA 3TKRA 2NDOA 2HZEB 4AJ8A 4F03A 3D21A 2N5AA 3H1NA 5ECOB 4IVFA 5DCHA 4K2DA 4GF0A 5C00A 3GURA 3UARA 3N9JA 4XCSA 3HJOA 4ZB9A 1SJIA 4FIWA 1K0MA 2ZNMA 2WCIA 4MJAA 2FWEA 3NIVA 5F05A 2E2GA 3FY7A 2YWOA 5A5KA 4OCEA 1F37A 2PWJA 4IP6A 4L8EA 2HZEA 1TU7A 2AB6A 2YPMA 2O85A 2LJRA 3Q74A 4F0CA 5J9CA 3Q19A 2QKEA 4ACSA 4RI7A 2E7PA 1DE2A 2DIYA 3IAS2 1QGVA 2MMOA 2J9HA 4HS1A 2DC5A 2GZPA 1SK2A 1PKWA 5AIVA 4BWQA 5HR3A 1X0RA 3RPNA 1YKCA 3H4KA 4QL7A 4XHMA 1SENA 1B48A 2QA1A 3ZTLA 4CY8A 1M99A 2VD0A 1V9WA 3F6DA 1KBNA 1VGLA 3DIEA 2YZUA 3FR9A 4AJ6A 1N8JA 3BBYA 5ECNB 2K8VA 3EU3A 2C4JA 4PQHA 1KNGA 1TU8A 3LXTA 3BD2A 2KP2A 3FZ4A 3UOMA 3KTLA 3VI7A 4GQFA 1F9MA 3LFLA 1Z7RA 2PVQA 4G0LA 4DSSA 2RM5A 4ZILA 4K5SA 2RUEA 1I5GA 2VLUA 4OO4A 2GDRA 1VF2A 1FHEA 1B4QA 2FWHA 3E0UA 6GSUA 2PN8A 2PU9C 4HQZA 2H75A 3GH9A 3DEXA 4AJ7A 4LLRA 3IXRA 1GSSA 8GSSA 2HNLA 3HYPA 3QFBC 4WR5A 2O7KA 3DWVA 1SKWB 3TDGA 3HZ8A 4GSNA 3C73A 2KLXA 5DALB 5J4UA 3TKPA 3RBTA 2H0HA 2HRKA 5HFIA 3ZVJD 3HXSA 3ZMKA 4G2EA 4MDCA 4YKFA 2C3QA 4YQVA 1YJ6A 2TRCP 5DQYA 5ECHB 4ZBBA 4JBBA 5D9VA 10GSA 4KAEA 5IPHA 3QMXA 1ST9A 5KOXA 2I1UA 3A2XA 3MSZA 2C3TA 3WD6A 1QMVA 1AW9A 1WMJA 2R3XA 2E2MA 2DJJA 1FVJA 1V2AA 1Y6EA 4EO3A 2XPDA 4EDZA 3HVSA 4FH8A 2BJXA 4OCFA 3Q6OA 1EWXA 4KGIA 5CRWA 1XOBA 4MPGA 17GSA 3MWHA 3BOAA 1FAAA 4HZ2A 1GSEA 3BCKA 4FQUA 2HI7A 4L0WA 1O73A 1K3LA 1Z7PA 1HNBA 2DMLA 1PGTA 1Q98A 2CVBA 1O6JA 1PX7A 1GTUA 1U6TA 2VCVA 4I2TA 1T8EB 5J3RA 2IMEA 5ECSA 2IFQA 1K0DA 3QFAC 2XBQA 5IM9A 3VWXA 1GSFA 1MEKA 3TOUA 2FGXA 2HYXA 3VURA 3FR3A 5GZZB 2GS3A 1GTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAX A;  2A2S A;  5DDL A;  4ZIJ A;  1M2D A;  1B8X A;  18GS A;  2LS5 A;  3I6A A;  1GSU A;  1RK4 A;  3KZQ A;  4OFT A;  3US3 A;  4J2F A;  3EWL A;  3IBH A;  4KW6 A;  1ERW A;  2VCW A;  1A24 A;  4BPY A;  3N5O A;  3S9F A;  4NXI A;  4P3Y B;  2B5E A;  3ERW A;  5A4W A;  5DBQ A;  3GMF A;  2FA8 A;  4TR4 A;  4MF5 A;  2IMF A;  2IPA A;  2C1Y A;  1W89 A;  2VM2 A;  1X9S B;  1A8L A;  5ENU A;  4ECJ A;  5E4W A;  2VOC A;  5HFK A;  3R2Q A;  4HZ4 A;  1ZMA A;  1MDJ A;  2HRF A;  1JZD A;  1XCC A;  1RW1 A;  4MA9 A;  5B6N A;  3GSS A;  2CVK A;  3QD9 A;  3IRA A;  3C7M A;  2FD3 A;  4BVX A;  3D4M A;  3CSJ A;  3TOT A;  2OBK A;  1JFU A;  1KEB A;  1O85 A;  1EP7 A;  1PMT A;  2GQM A;  4IKH A;  1GH2 A;  1OAZ A;  3L0H A;  4N11 A;  3WYW A;  1WPI A;  2IY2 A;  5H5R A;  3CRU A;  3VWW A;  1PN9 A;  5GAN D;  3ZIV A;  4OMV A;  1GL8 A;  2REM A;  2GSQ A;  1A0R P;  2MMN A;  2B1K A;  4EVM A;  4GLT A;  2CX3 A;  2I4A A;  3D5J A;  1N2A A;  3QCP A;  1PRX A;  1E6B A;  4CDO A;  2RUF A;  5G1L A;  3GV1 A;  3D22 A;  4NV5 A;  2LQQ A;  5ECP B;  2C8U A;  5D93 A;  4K8M A;  3LSZ A;  1XPV A;  1EV4 A;  2H19 A;  1ACV A;  2QC7 A;  6GSV A;  3TJK A;  4IJ3 A;  3W6G A;  3F0I A;  4XRD A;  4IQA A;  2VCZ A;  4ECI A;  4YAP A;  4WF4 A;  2I81 A;  3M8N A;  1ABA A;  1O7U A;  2AAW A;  3H8Q A;  4I8B A;  1M7T A;  2KHP A;  5AIX A;  3P7X A;  5DAK B;  3C8E A;  5JCW A;  3FYG A;  1XXU A;  4LL4 B;  3KP9 A;  3DRN A;  4POB A;  5CRE A;  3UVT A;  1ZOF A;  4D73 A;  1GLP A;  4QQ7 A;  1GUK A;  3QAV A;  5F8B A;  5DAK A;  1ZCP A;  2L59 A;  2B5X A;  1PD2 1;  4TXO A;  4GWR A;  3HHV A;  1G7O A;  1THO A;  2GT5 A;  4K7I A;  3O3T A;  4YQM A;  4FO5 A;  2I9H A;  3ZVJ A;  3EVI A;  1FB0 A;  2V32 A;  2OAC A;  3IK7 A;  2YWN A;  2L4Q A;  2H0G A;  3QPM A;  4TR3 A;  1NSW A;  2E0Q A;  2VM1 A;  3NZN A;  2LTK A;  4KDX A;  3KIJ A;  3W8S A;  4GCI A;  1YZX A;  4MJB A;  1FOV A;  4NV2 A;  1EEJ A;  2HT9 A;  1XWC A;  1ZZY A;  3LQ7 A;  1EP8 A;  2RLI A;  1AQV A;  3VWV A;  5ID2 B;  2B6M A;  3RDW A;  1TRU A;  3VWU A;  1PL2 A;  4DVC A;  2BTO T;  2A4V A;  4K7O A;  1F2E A;  3EIN A;  4YH2 A;  1XZO A;  2ZUP A;  3CSH A;  3DVX A;  1X5C A;  1TJD A;  4HU7 A;  3GUS A;  1R5A A;  1NHY A;  3HZ4 A;  1XOA A;  3FEU A;  4Q5N A;  1OKD A;  4RI6 A;  1F3A A;  1XVW A;  2GT6 A;  2JAD A;  4OD7 A;  1PL1 A;  1R4W A;  4CW9 A;  1HYU A;  5CYY A;  4V1A p;  4WXT A;  1BX9 A;  1YY7 A;  3IR4 A;  3ME7 A;  1XW5 A;  1A2J A;  3LYK A;  1AXD A;  4OFM A;  1DSB A;  1IYI A;  1WOU A;  3CTF A;  5JCG A;  4K0G A;  5KN3 A;  1SK1 A;  2GTU A;  3O76 A;  1J0F A;  5G2Z A;  2VLT A;  4JZQ A;  2YJ7 A;  4MZW A;  3VI5 A;  5EPF A;  2OJL A;  2MBS A;  1Z5Y E;  1ERU A;  3GTU B;  4JR4 A;  4PQI A;  3FR6 A;  5KN1 A;  2FA4 A;  1QQ2 A;  1F6M C;  3UBK A;  2O87 A;  1JZW A;  2VIM A;  1AQW A;  5ECL B;  4MMM A;  2K18 A;  2DBC A;  1G0T A;  4ILF A;  3M3M A;  3GA4 A;  2PER A;  4EF0 A;  1ZL9 A;  2R37 A;  4PQ1 A;  2FY6 A;  1OC9 B;  2B1L A;  4Z7X A;  1DUG A;  3NOF A;  1XBS A;  4I97 A;  4MAB A;  1LBK A;  3CYN A;  1SKS B;  1QUW A;  2JZR A;  3JCM L;  5INY A;  2BMX A;  4TN8 A;  1SL0 B;  4IHU A;  2WUL A;  2L6D A;  3ME8 A;  2HE3 A;  4WKW A;  4GSS A;  1XWK A;  1EV9 A;  4GQC A;  2DMM A;  2ZCT A;  2JZT A;  2V6O A;  4POM A;  3RHB A;  1OYJ A;  4OO5 A;  4JU5 A;  3BCI A;  2L57 A;  1GUM A;  2WS2 A;  3TKS C;  2KUC A;  4O5R A;  3I9V 2;  3AY8 A;  1EEM A;  1T4Z A;  4TR0 A;  4PUA A;  4WR4 A;  1T1V A;  2MYG A;  1TK0 B;  2Z9S A;  11GS A;  2VL2 C;  2N5B A;  2XHF A;  2X8C A;  2GZZ A;  2WDU A;  4JE1 A;  4E8E A;  2DJK A;  2FUG 2;  1M0U A;  1GRX A;  1PKZ A;  3CMI A;  1SD9 A;  4MP4 A;  5C04 A;  3PIN A;  1V57 A;  1A0F A;  6GSX A;  1FG4 A;  1OE7 A;  2MMA A;  1K0N A;  2RII A;  3IAM 2;  1YEX A;  5KN2 A;  3GST A;  2FCH A;  2V2G A;  3DGQ A;  5KN0 A;  1R7H A;  3O6T A;  3GNJ A;  3HJP A;  2VUP A;  1BQ7 A;  4HJ2 A;  5CRD A;  2X8H A;  3UAP A;  5EY6 A;  3IDV A;  3KMO A;  1XIY A;  2HSY A;  1M9B A;  4NHW A;  3GL3 A;  4ZL7 A;  1V98 A;  14GS A;  1O81 A;  4EC0 A;  2H71 A;  3L9S A;  2WFC A;  3GIX A;  2TRX A;  2JAC A;  1LJR A;  1OVN A;  3TRP A;  4V1A g;  4I2U A;  1YKA A;  4BVY A;  5ECQ B;  3H79 A;  3SWL A;  1K0C A;  4DSR A;  5D96 A;  3EUR A;  1R26 A;  2FWG A;  2C0F A;  4KCA A;  1VF1 A;  3WGE A;  4EUY A;  1LU4 A;  4HOJ A;  4I6X A;  4JR6 A;  2C0E A;  3ZRE A;  2V41 A;  2HXK A;  1TK5 B;  2P0G A;  4MK3 A;  1AAZ A;  3GKM A;  5F06 A;  2P5R A;  1ILO A;  1XW6 A;  1S3A A;  4MPF A;  1PX6 A;  5DQS A;  4IS0 A;  6GSY A;  1O8W A;  4RUV A;  2VAF A;  2DJ1 A;  4ZXG A;  1B9X C;  2YV7 A;  1T7P B;  2H6Z A;  3DVW A;  3VK9 A;  5GAP D;  3WGD A;  4L5L A;  4TVE A;  5JWO B;  3D6I A;  4IEL A;  5H5Q A;  3MNG A;  4FYU A;  5G31 A;  4MZC A;  4POK A;  3APS A;  4XS4 B;  5A4U A;  1GTI A;  3QOU A;  1URM A;  3IE3 A;  4EXJ A;  3GKX A;  2P5Q A;  4FYB A;  1NHO A;  3UEM A;  3FW2 A;  4RQX A;  2NBS A;  4HJM A;  2YP6 A;  7GSS A;  3IHQ A;  1GP1 A;  4TR1 A;  2H72 A;  3TKS E;  3FK8 A;  3KXO A;  3L9U A;  2G0F A;  2L6C A;  3KH7 A;  3ZYW A;  2ON7 A;  2YV9 A;  1QFN A;  4YAV A;  1M2B A;  1YEP A;  5IMD A;  4X43 A;  2IMK A;  2B5Y A;  2V1M A;  1TKD B;  2KOK A;  1VF3 A;  4LL1 B;  5COH A;  5G5E A;  3FRC A;  1HQO A;  1U88 A;  3J7Y k;  4PUF C;  3F4T A;  2GST A;  2LRN A;  1PSQ A;  3FZA A;  1DBY A;  2L5O A;  5LNK e;  3UMA A;  3PGT A;  2H6X A;  4F82 A;  3GHA A;  3HDC A;  5CRG A;  4RQR A;  1FB6 A;  1GUH A;  3WT1 A;  22GS A;  2F8F A;  4TR1 B;  2DJ2 A;  2TIR A;  2O89 A;  1XWB A;  4KH7 A;  3UVH A;  1H4O A;  4KSM A;  3UIW A;  1PA3 A;  1WIK A;  2LRT A;  4TOP A;  2H76 A;  3C1S A;  4IP1 A;  4V2M A;  5B7C A;  2EIR A;  3ED3 A;  3IOS A;  4ZL8 A;  2C0D A;  2PPT A;  5HQP A;  3TKS A;  3DD3 A;  3GH6 A;  3GRX A;  3CTG A;  2YCD A;  3BJ5 A;  4PNF A;  4WBJ A;  1MD4 A;  4PX1 A;  2OBI A;  1F3B A;  4ZB6 A;  2B7J A;  1SJ6 A;  1ZYE A;  4V2N A;  5AGY A;  2OAD A;  3TJB A;  4MJC A;  1V58 A;  3F3R A;  1Y25 A;  1JZO A;  2MZC A;  2OE3 A;  4JED A;  5ELG A;  5G5F A;  5ID2 A;  2WRT A;  4GST A;  1M9A A;  4L5O A;  3F9U A;  4ECB A;  4LA1 A;  2K8S A;  4HU9 A;  12GS A;  2LUS A;  4XTS A;  2JL4 A;  1IYH A;  2H0I A;  2OA7 A;  3M9J A;  2G2Q A;  1O8X A;  3VPT A;  4IGJ A;  3L9V A;  5ECK B;  1TRS A;  4I5Q A;  1BG5 A;  3GKN A;  4XS4 A;  1EOG A;  4G10 A;  3EC3 A;  2FLS A;  1TRW A;  1ERT A;  4IN0 A;  4XRA A;  1A23 A;  3RPP A;  4KSO A;  2IJY A;  1BED A;  1SD8 A;  3HY2 A;  4TXV A;  1GLQ A;  5JWR B;  1SK0 A;  3HJM A;  3HD5 A;  2DSA A;  4NWY A;  3KMN A;  1GUL A;  1JHB A;  4ZL9 A;  1S3C A;  4ML6 A;  1T3B A;  9GSS A;  1ML6 A;  4EE0 A;  5HR2 A;  4XIH A;  2DIZ A;  1X5D A;  3CBU A;  1K0O A;  2LV3 A;  1G6W A;  1GSY A;  4ULX A;  3FZ5 A;  4OWY A;  3HVX A;  3KD0 A;  3GX8 A;  4G9H A;  5F0G A;  3U5R E;  4PGT A;  1T00 A;  4BL7 A;  2VL9 A;  5ABR A;  4HUA A;  2H6Y A;  4NHZ A;  1X9W B;  3OR5 A;  5D9X A;  4N0Z A;  1JLW A;  4ID0 A;  1WWJ A;  1X5E A;  2H66 A;  2GSS A;  2WZ9 A;  20GS A;  1EOH A;  2F9S A;  1EGO A;  4HQS A;  4MH2 A;  3A3T A;  3ZL5 A;  3ZLP A;  4ML1 A;  3G7J A;  1OE8 A;  1XWA A;  4V2L A;  2H74 A;  3IV4 A;  3PR8 A;  1U3I A;  3EYT A;  2M46 A;  4AF2 A;  1YDK A;  3K8N A;  1FO5 A;  3M0F A;  2H1D A;  13GS A;  2AV4 A;  1GSQ A;  1SKR B;  3KTB A;  2JSY A;  1SL1 B;  5D9T A;  2P31 A;  5IMA A;  1GTA A;  2MMZ A;  4BWS A;  2LKU A;  3F6F A;  4MZB A;  3TJG A;  5B8B A;  3ISO A;  4KA0 A;  1OC9 A;  5HR1 A;  3U6V A;  3I69 A;  2RM6 A;  4GRF A;  4LMW A;  3EMX A;  1MTC A;  4POL A;  1ZGN A;  1TDI A;  2LJK A;  1ERV A;  2GQL A;  4E8H A;  4KB3 A;  4IW9 A;  4TW5 A;  4K9Z A;  5F07 A;  5D8I A;  1TK8 B;  4MLY A;  5EL8 A;  1BYE A;  3LGC A;  1THX A;  2PBJ A;  3UJ1 A;  2HLS A;  4ZBA A;  3KCM A;  1AUC A;  4NPB A;  2PVO C;  4K1F A;  4KCE A;  2VCT A;  3IA1 A;  2C80 A;  2ON5 A;  1NM3 A;  5CAX A;  4ZB8 A;  1T4Y A;  1TRV A;  4IQ1 A;  2QGV A;  2F51 A;  4K0N A;  3FKF A;  2CQ9 A;  2OKA A;  2X64 A;  2FHE A;  1UA5 A;  2GZY A;  3E9J B;  1MDK A;  2F8A A;  2WB9 A;  3LOR A;  2NTO A;  2VCQ A;  4NMU A;  3APQ A;  4EL1 A;  3IC4 A;  2J23 A;  2L5L A;  1WJK A;  4WBR D;  3GN3 A;  2LRC A;  2JU5 A;  1QK8 A;  1TTZ A;  4ZBD A;  3SBC A;  5G30 A;  3ZRD A;  3MAK A;  1EZK A;  2CV4 A;  3HKR A;  4LMV A;  1XFL A;  1G7E A;  4X0X A;  2HFD A;  5IMZ A;  4EKZ A;  2WGR A;  3GTU A;  4EDY A;  3TJJ A;  5D73 A;  1ON4 A;  2K9F A;  3KGK A;  2YAN A;  3LYP A;  2FNO A;  4O92 A;  2LNT A;  3KM6 A;  1TXX A;  2H8L A;  3F8U A;  4QL9 A;  1VF4 A;  4K6X A;  2CZ2 A;  3GFK A;  6GSS A;  4CHS A;  4MJE A;  3HCZ A;  16GS A;  2YJH A;  1B9Y C;  1HNA A;  3TB2 A;  1A2M A;  4L0U A;  5DJL A;  2VO4 A;  2IIY A;  2O8V B;  2HZF A;  1ZYQ B;  1PQN A;  2H01 A;  3ERG A;  2ALB A;  3ERF A;  4FYC A;  2X8G A;  5ECI B;  2KP1 A;  1TI3 A;  5J5N A;  4D73 B;  4PXO A;  5AN1 A;  3RAZ A;  3LEF A;  5JWQ B;  1E2Y A;  4HDE A;  3H93 A;  3LXZ A;  1K0B A;  3V1W A;  3F3Q A;  3KJY A;  3LWA A;  1GNW A;  1TI1 A;  1DE1 A;  5B6M A;  5IO2 A;  4Q5Q A;  3CXG A;  1Q4J A;  1J08 A;  5DAL A;  4Q5F A;  5B8A A;  3ZFB A;  3L78 A;  4G19 A;  2EC4 A;  1Z3E A;  4H86 A;  5IOW A;  3G9B A;  2PUK C;  3QAW A;  2OE1 A;  2CAI A;  3IK9 A;  2CT6 A;  2VCX A;  2IMI A;  4KUN A;  5J41 A;  2CX4 A;  2R5G A;  2GGT A;  2VL2 A;  3A2W A;  3WT2 A;  1Z6N A;  5ELA A;  5IOX A;  2YOI A;  5D9W A;  4J56 E;  3ZFL A;  4HI7 A;  4ISD A;  4WF5 A;  4KDU A;  3RHC A;  4TXO B;  2EIO A;  4DSS B;  2A2R A;  5HFG A;  1I9D A;  2EIQ A;  2WJU A;  2V6K A;  2NVL A;  1K0A A;  1SYX A;  4GXZ A;  6GST A;  2R2J A;  1M2A A;  3QAG A;  2M72 A;  1FVK A;  1GNE A;  1UC7 A;  4OFN A;  1G6Y A;  2AUV A;  3M9K A;  2PGT A;  5DCG A;  4AGS A;  3ZIT A;  1OC8 A;  3GYK A;  3J7Y b;  3HA9 A;  2H1A A;  1SU9 A;  1WE0 A;  3M1G A;  1BAY A;  1RQM A;  2B3S A;  1WP0 A;  3ZIJ A;  3ZML A;  2K6V A;  2HRN A;  4O7H A;  5IQY A;  5CO3 A;  3TJF A;  1V40 A;  4K7N A;  1WRY A;  5AIS A;  2R4V A;  4F2I A;  1GWC A;  1YF1 A;  5DVB A;  2LEG A;  3GX0 A;  1AQX A;  1CQH A;  2N5F A;  3DML A;  3P90 A;  3TRX A;  2L4C A;  3DXB A;  1A2L A;  4F9Z A;  1S3D A;  1OKT A;  4N0V A;  1KTE A;  4PUR A;  3VLN A;  4BA7 A;  1YQ1 A;  1Z6M A;  1CQG A;  5HR0 A;  5A4V A;  6GSW A;  1AIU A;  3TUE A;  2VD1 A;  2NPB A;  3D4T A;  4MF7 A;  3G7I A;  3VFI A;  2LQO A;  3A5W A;  3GL5 A;  2H30 A;  2LNS A;  1YF0 A;  4DSQ A;  3L4N A;  3UL3 A;  5LD0 A;  2GLR A;  3KEB A;  4DEJ A;  3P8W A;  1HD2 A;  1K3Y A;  4MH3 A;  2HSH A;  2M80 A;  5JCU A;  5H5S A;  3QDN A;  2OE0 A;  1MD3 A;  4F0B A;  2CVD A;  2AYT A;  4IJI A;  3WGX A;  1R5P A;  3IPZ A;  3TGZ A;  2XBI A;  3C71 A;  1QXH A;  2H73 A;  1J9B A;  5DJM A;  3APO A;  3EE2 A;  1USB A;  4XS1 A;  2YNX A;  1C72 A;  1SYR A;  2IFQ B;  3GKK A;  2X99 A;  2GQK A;  5J9B A;  3LG6 A;  3TKQ A;  4JRR A;  4KND A;  1XWG A;  1W4V A;  4WET A;  1JZR A;  2FWF A;  3C1R A;  3FZ9 A;  4GTU A;  5GST A;  2VLV A;  4KDY A;  1A8Y A;  2LST A;  3CSI A;  2XC2 A;  5LCZ A;  5L71 A;  1B4P A;  3F63 A;  5ECR B;  2GSR A;  3HVV A;  1AC1 A;  2D2Z A;  5CP1 A;  3I43 A;  3A2V A;  4XS6 A;  1TOF A;  5G1K A;  1TW9 A;  3EMP A;  2QSI A;  5IO0 A;  4O32 A;  2AHE A;  3D0Z A;  1MDI A;  3KP8 A;  1Z9H A;  4KE3 A;  1X9M B;  1HNC A;  3CRT A;  2DJ0 A;  4WEY A;  2YZH A;  2YWI A;  4MCU A;  4YQU A;  5IIZ A;  2AJQ B;  2ES7 A;  2XPE A;  2CA8 A;  4IBP A;  2IN3 A;  3PH9 A;  2C0G A;  2JZS A;  3TRQ A;  3KH9 A;  4KX4 A;  3FHK A;  2B7K A;  5E59 A;  5IMV A;  3VPQ A;  1VRS D;  3LJR A;  4MF6 A;  2VL3 A;  1NW2 A;  2YWM A;  1EGR A;  5FT3 A;  4TKY A;  4N30 A;  2DJ3 A;  3TCO A;  5FWG A;  1TP9 A;  2JSZ A;  4ECC A;  2IWT A;  4TRX A;  4Q5R A;  1UVZ A;  2DLX A;  3G7Y A;  2R6K A;  3Q18 A;  19GS A;  1GSD A;  5CRH A;  3F4R A;  2H1G A;  1K3O A;  1U87 A;  2CZ3 A;  2F3M A;  2C3N A;  2I3Y A;  3P2A A;  5IMC A;  5FHI A;  2YN1 A;  1U3A A;  3ZZX A;  2IYJ A;  1FW1 A;  3DKS A;  1SL2 B;  2IMD A;  3EU4 A;  2H70 A;  4HEA 2;  1JLV A;  1SJZ A;  2IL3 A;  5IMF A;  3E3E A;  3W8J A;  1OC3 A;  2GVP A;  5ECM B;  5CNW A;  1XVQ A;  2LJA A;  4X1U A;  5IPG A;  3QR6 A;  5EVO A;  2H1B A;  1XW9 A;  3DYR A;  5KEJ A;  5GSS A;  1BJX A;  2PMT A;  3MDK A;  4J57 E;  2MBT A;  1UN2 A;  2CAQ A;  1H75 A;  3UBL A;  4PNG A;  4N10 A;  3F4S A;  3TKR A;  2NDO A;  2HZE B;  4AJ8 A;  4F03 A;  3D21 A;  2N5A A;  3H1N A;  5ECO B;  4IVF A;  5DCH A;  4K2D A;  4GF0 A;  5C00 A;  3GUR A;  3UAR A;  3N9J A;  4XCS A;  3HJO A;  4ZB9 A;  1SJI A;  4FIW A;  1K0M A;  2ZNM A;  2WCI A;  4MJA A;  2FWE A;  3NIV A;  5F05 A;  2E2G A;  3FY7 A;  2YWO A;  5A5K A;  4OCE A;  1F37 A;  2PWJ A;  4IP6 A;  4L8E A;  2HZE A;  1TU7 A;  2AB6 A;  2YPM A;  2O85 A;  2LJR A;  3Q74 A;  4F0C A;  5J9C A;  3Q19 A;  2QKE A;  4ACS A;  4RI7 A;  2E7P A;  1DE2 A;  2DIY A;  3IAS 2;  1QGV A;  2MMO A;  2J9H A;  4HS1 A;  2DC5 A;  2GZP A;  1SK2 A;  1PKW A;  5AIV A;  4BWQ A;  5HR3 A;  1X0R A;  3RPN A;  1YKC A;  3H4K A;  4QL7 A;  4XHM A;  1SEN A;  1B48 A;  3ZTL A;  1M99 A;  2VD0 A;  1V9W A;  3F6D A;  1KBN A;  1VGL A;  3DIE A;  2YZU A;  3FR9 A;  4AJ6 A;  1N8J A;  3BBY A;  5ECN B;  2K8V A;  3EU3 A;  2C4J A;  4PQH A;  1KNG A;  1TU8 A;  3LXT A;  3BD2 A;  2KP2 A;  3FZ4 A;  3UOM A;  3KTL A;  3VI7 A;  4GQF A;  1F9M A;  3LFL A;  1Z7R A;  2PVQ A;  4DSS A;  2RM5 A;  4ZIL A;  2RUE A;  1I5G A;  2VLU A;  4OO4 A;  2GDR A;  1VF2 A;  1FHE A;  1B4Q A;  2FWH A;  3E0U A;  6GSU A;  2PN8 A;  2PU9 C;  4HQZ A;  2H75 A;  3GH9 A;  3DEX A;  4AJ7 A;  4LLR A;  3IXR A;  1GSS A;  8GSS A;  2HNL A;  3HYP A;  3QFB C;  4WR5 A;  2O7K A;  3DWV A;  1SKW B;  3TDG A;  3HZ8 A;  4GSN A;  3C73 A;  2KLX A;  5DAL B;  5J4U A;  3TKP A;  3RBT A;  2H0H A;  5HFI A;  3ZVJ D;  3HXS A;  3ZMK A;  4G2E A;  4MDC A;  2C3Q A;  4YQV A;  1YJ6 A;  2TRC P;  5DQY A;  5ECH B;  4ZBB A;  4JBB A;  5D9V A;  10GS A;  4KAE A;  5IPH A;  3QMX A;  1ST9 A;  2I1U A;  3A2X A;  3MSZ A;  2C3T A;  3WD6 A;  1QMV A;  1AW9 A;  1WMJ A;  2R3X A;  2E2M A;  2DJJ A;  1FVJ A;  1V2A A;  1Y6E A;  4EO3 A;  2XPD A;  4EDZ A;  3HVS A;  4FH8 A;  2BJX A;  4OCF A;  3Q6O A;  1EWX A;  4KGI A;  5CRW A;  1XOB A;  4MPG A;  17GS A;  3MWH A;  3BOA A;  1FAA A;  4HZ2 A;  1GSE A;  3BCK A;  2HI7 A;  4L0W A;  1O73 A;  1K3L A;  1Z7P A;  1HNB A;  2DML A;  1PGT A;  1Q98 A;  2CVB A;  1O6J A;  1PX7 A;  1GTU A;  1U6T A;  2VCV A;  4I2T A;  1T8E B;  5J3R A;  2IME A;  5ECS A;  2IFQ A;  1K0D A;  3QFA C;  2XBQ A;  5IM9 A;  3VWX A;  1GSF A;  1MEK A;  3TOU A;  2FGX A;  2HYX A;  3VUR A;  3FR3 A;  5GZZ B;  2GS3 A;  1GTB A; 
#chains in the Genus database with same CATH topology
 4NAX A;  2A2S A;  1BNG A;  1GD3 A;  5DDL A;  4ZIJ A;  1M2D A;  1X1Y A;  4HM6 B;  1B8X A;  3F7X A;  4HBR A;  4WFO A;  18GS A;  2LS5 A;  1TFK A;  2XSH B;  3I6A A;  2D1W A;  1GSU A;  3U97 A;  1RK4 A;  3KZQ A;  2OOV A;  4OFT A;  3US3 A;  2WGQ A;  1STD A;  4J2F A;  2F4Y A;  3EWL A;  3IBH A;  3CCV 3;  4KW6 A;  1ERW A;  1WNH A;  2VCW A;  1A24 A;  4BPY A;  3WOE B;  1FOH A;  3N5O A;  1GSP A;  1OF5 B;  5ELU A;  3S9F A;  3T0U A;  3ZFZ A;  2X49 A;  1EA2 A;  4NXI A;  4P3Y B;  2B5E A;  3ERW A;  2W56 A;  5A4W A;  4HKV B;  2LYX A;  5DBQ A;  3EHC A;  1C54 A;  3GMF A;  1LQG C;  2FA8 A;  1OUN A;  1BOX A;  4TR4 A;  4MF5 A;  2QEX 3;  4O8S A;  2IMF A;  2IPA A;  2C1Y A;  1W89 A;  2VM2 A;  1X9S B;  3AMO B;  4O2H A;  4H61 A;  1A8L A;  5ENU A;  3RNT A;  4ECJ A;  2DKH A;  5E4W A;  1FGQ A;  4N6V 0;  2VOC A;  5HFK A;  1IK3 A;  1IT7 A;  3R2Q A;  3QRD A;  4HZ4 A;  2V1L A;  3GZR A;  1B3S A;  1K8A 4;  2K54 A;  2HSM A;  1ZMA A;  1MDJ A;  2KF3 A;  2HRF A;  1JZD A;  1XCC A;  1RW1 A;  4MA9 A;  5B6N A;  1DE3 A;  3EPT A;  4Z2T A;  3GSS A;  2CVK A;  3QD9 A;  4EIQ A;  3IRA A;  1IDP A;  3C7M A;  2FD3 A;  4BVX A;  3D4M A;  3RDE A;  3D3L A;  3CSJ A;  3TOT A;  2OBK A;  1IVU A;  1OF5 A;  1JFU A;  3N9H A;  4MMX B;  1KEB A;  1RGF A;  1EP7 A;  1O85 A;  3PYJ A;  1PMT A;  3ROB A;  3GWR A;  4AKY A;  4CPK A;  4R9L A;  2GQM A;  4IKH A;  1GH2 A;  1OAZ A;  4HJL B;  3L0H A;  4N11 A;  1CQS A;  2HRA A;  3WYW A;  1WPI A;  2IY2 A;  1GS3 A;  5LC7 A;  5H5R A;  3EC9 A;  3CRU A;  3VWW A;  1PN9 A;  5GAN D;  1O7W B;  3ZIV A;  4OMV A;  1GL8 A;  2REM A;  1NO3 A;  2GSQ A;  4BIK A;  1A0R P;  2MMN A;  2B1K A;  4EVM A;  2W9Q A;  2GBX B;  3OXA A;  1Q82 4;  4GLT A;  5STD A;  2CX3 A;  2I4A A;  4WYK A;  3DM8 A;  3D5J A;  1N2A A;  3QCP A;  1PRX A;  4N6M A;  2CX0 A;  1V74 A;  1E6B A;  4CDO A;  2RUF A;  5G1L A;  3GV1 A;  3D22 A;  3JUM A;  4NV5 A;  2LQQ A;  5ECP B;  3WHO A;  2C8U A;  3X3X A;  5D93 A;  3CCJ 3;  2ML6 A;  1T5Y A;  3NBR A;  4K8M A;  3LSZ A;  1XPV A;  1EV4 A;  2H19 A;  3LTD A;  1I2F A;  1ACV A;  5IEP A;  3MKI A;  1M3J A;  4GB5 A;  2QC7 A;  6GSV A;  3LXU X;  3TJK A;  3BLZ A;  4IJ3 A;  3W6G A;  1VQL 3;  3UB1 A;  3F0I A;  4XRD A;  4IQA A;  2UUG C;  2VCZ A;  4ECI A;  4YAP A;  4WF4 A;  1RN7 A;  1LQM B;  4OUQ A;  1TU5 A;  4J9A A;  2F99 A;  1SJW A;  2I81 A;  3M8N A;  3Q2P A;  4JRF A;  1ASK A;  2OWP A;  1US1 A;  1ABA A;  1DVC A;  3OWY A;  1O7U A;  2AAW A;  3H8Q A;  1STF I;  1WQL B;  4I8B A;  1M7T A;  2KHP A;  5AIX A;  3P7X A;  4K90 B;  1K28 A;  5DAK B;  3C8E A;  1LOY A;  1A90 A;  4GHO A;  5AII A;  4R1K A;  3LZA A;  5JCW A;  3FYG A;  3JUQ A;  1XXU A;  4LL4 B;  3KP9 A;  3DRN A;  4POB A;  5CRE A;  3UVT A;  1ZS7 A;  1ZOF A;  4D73 A;  1BSD A;  1VQO 3;  1GLP A;  3ALA A;  1IT8 A;  3KSE D;  1B2S A;  4EIP A;  4QQ7 A;  1GUK A;  3QAV A;  5F8B A;  5DAK A;  3HVN A;  1ZCP A;  1VQN 3;  5IF6 A;  2L59 A;  2B5X A;  1PD2 1;  4TXO A;  4GWR A;  3HHV A;  4LEH A;  1G7O A;  1THO A;  2GT5 A;  1N5P A;  3IC8 A;  1JN5 B;  4K7I A;  1RKY A;  3O3T A;  4YQM A;  3I0Y A;  4FO5 A;  2I9H A;  3ZVJ A;  3EVI A;  2FXT A;  1FB0 A;  4IT7 A;  2XFT A;  2V32 A;  2OAC A;  4G0I A;  3IK7 A;  2YWN A;  4A5P A;  2L4Q A;  2H0G A;  3QPM A;  6STD A;  4TR3 A;  1NSW A;  2E0Q A;  2VM1 A;  3NZN A;  1C7H A;  2LTK A;  4KDX A;  1UI7 A;  3KIJ A;  3LTC A;  3W8S A;  4GCI A;  1X1X A;  1YZX A;  4MJD A;  4MJB A;  2C4B A;  1FOV A;  4BTX A;  1A2P A;  1NWW A;  1VQQ A;  4NV2 A;  1EEJ A;  4HM3 B;  2HT9 A;  3NXJ A;  1XWC A;  1ZZY A;  3FMW A;  3LQ7 A;  4FMA A;  1EP8 A;  2RLI A;  1YIJ 3;  1BAO A;  4NRE A;  1AQV A;  3VWV A;  2UGI A;  5ID2 B;  3G8Z A;  1B20 A;  4XB5 A;  1OAC A;  3DXO A;  2B6M A;  3RDW A;  3HX8 A;  1TRU A;  1A2V A;  2STD A;  5A0O B;  5EVH A;  3VWU A;  1PL2 A;  4DVC A;  1RN1 A;  2A4V A;  2BTO T;  4K7O A;  3B4P A;  1F2E A;  1Q7Y 4;  4G0K A;  2F56 A;  3EIN A;  4YH2 A;  1XZO A;  2ZUP A;  5AIH A;  3CSH A;  3DVX A;  3S28 A;  2F5W A;  4HM4 B;  1X5C A;  1TJD A;  4H3U A;  2KF5 A;  4HU7 A;  2ZA4 A;  2RGQ A;  3GUS A;  1GMQ A;  4AKZ A;  1R5A A;  1NHY A;  3HZ4 A;  3Q3F A;  1XOA A;  1RRL A;  3FEU A;  4Q5N A;  1OKD A;  1O7P B;  4RI6 A;  1F3A A;  1IU7 A;  1XVW A;  2GT6 A;  1UUG B;  5JPU A;  2JAD A;  4OD7 A;  4R80 A;  2OOV C;  1R4W A;  1PL1 A;  4KFF A;  4CW9 A;  1HYU A;  5CYY A;  4RNZ A;  5KP4 A;  3DZL A;  3SX1 A;  4V1A p;  4WXT A;  4HAA A;  1JB5 A;  2BMR B;  1BX9 A;  1YY7 A;  3UJM A;  3IR4 A;  1XW5 A;  4L8O A;  4OK0 A;  3ME7 A;  1A2J A;  3LYK A;  1AXD A;  4OFM A;  1DSB A;  4OVM A;  3J7Y d;  1IYI A;  1WOU A;  3CTF A;  2F86 B;  5JCG A;  4K0G A;  3KSP A;  5KN3 A;  2X4A A;  1SK1 A;  4K2X A;  2GTU A;  4MNN A;  3O76 A;  1MOL A;  1KC8 4;  1J0F A;  5G2Z A;  2VLT A;  4JZQ A;  2CFD A;  1I3I A;  2A15 A;  2YJ7 A;  4MZW A;  3VI5 A;  3KE7 A;  1A67 A;  5EPF A;  1VZZ A;  5CK6 A;  2OJL A;  2MBS A;  1Z5Y E;  1ERU A;  3GTU B;  4JR4 A;  4PQI A;  3FR6 A;  5KN1 A;  3NQZ A;  1K41 A;  2FA4 A;  2R0P A;  4IPB A;  1F6M C;  1QQ2 A;  2L1S A;  2O87 A;  3UBK A;  1B2U A;  1IQY A;  1JZW A;  2VIM A;  1AQW A;  1ZYP A;  5ECL B;  4MMM A;  1YJN 3;  2K18 A;  2DBC A;  5BVB A;  1G0T A;  4ILF A;  3M3M A;  3HK4 A;  3GA4 A;  2PER A;  4EF0 A;  1ZL9 A;  2R37 A;  3KZT A;  4PQ1 A;  2FY6 A;  3MG2 A;  1OC9 B;  3LML A;  2HOH A;  1RGE A;  2B1L A;  4Z7X A;  1RGH A;  1DUG A;  1X1W A;  5IG3 A;  3NOF A;  1XBS A;  4I97 A;  4MAB A;  2CG1 A;  1LBK A;  3CYN A;  3FKA A;  1SKS B;  3G6E 3;  1QUW A;  2JZR A;  5M1A A;  3JCM L;  5INY A;  2BMX A;  3UL6 A;  4TN8 A;  4BL3 A;  1SL0 B;  1DVD A;  1SIH A;  1JKG A;  4IHU A;  2WUL A;  2L6D A;  3EE1 A;  4HM8 B;  3ME8 A;  1N9J A;  2HE3 A;  4WKW A;  1PY3 A;  4GSS A;  1XWK A;  1EV9 A;  3OX9 A;  1M1X B;  4GQC A;  2P38 A;  3OW2 2;  2DMM A;  2ZCT A;  3D5G A;  2JZT A;  2V6O A;  4N6L A;  4POM A;  3RHB A;  1BNJ A;  2E2T A;  3N54 B;  3SOY A;  1OYJ A;  4OO5 A;  2W2C A;  4JU5 A;  3EN1 B;  4BL2 A;  3BCI A;  3FGY A;  2L57 A;  1GUM A;  1I0V A;  2WS2 A;  4LSO A;  3D79 A;  4DKI A;  4EYC A;  2KUC A;  4O5R A;  3TKS C;  3K63 A;  3I9V 2;  3AY8 A;  1EEM A;  5EEO A;  1T4Z A;  3IMA B;  4TR0 A;  2OCT A;  3PS8 A;  4PUA A;  4WR4 A;  1K9M 4;  1T1V A;  2MYG A;  1TK0 B;  3DGN A;  2Z9S A;  11GS A;  1AV4 A;  2VL2 C;  2N5B A;  2XHF A;  1RCK A;  2X8C A;  1GY6 A;  1BSC A;  2BMO B;  2GZZ A;  2WDU A;  4JE1 A;  3MWZ A;  4E8E A;  2DJK A;  2FUG 2;  1M0U A;  1GRX A;  1PKZ A;  3CMI A;  1SD9 A;  1OCV A;  4MP4 A;  5C04 A;  1EG9 B;  3PIN A;  4HM2 B;  1V57 A;  1MGW A;  1J2B A;  1W2B 2;  1N5H A;  1A0F A;  4LGQ A;  6GSX A;  1FG4 A;  1OE7 A;  2MMA A;  1K0N A;  4O5Q A;  2RII A;  2AAE A;  2XEP A;  3IAM 2;  1YEX A;  3D4A A;  1O7G B;  5KN2 A;  4XBX A;  3GST A;  2FCH A;  1Q40 B;  2V2G A;  3DGQ A;  5KN0 A;  1R7H A;  3O6T A;  3GNJ A;  3HJP A;  3F14 A;  2VUP A;  2K0M A;  1BQ7 A;  4HJ2 A;  5CRD A;  4RNY A;  4XDW A;  2X8H A;  3UAP A;  1BRH A;  5EY6 A;  3IDV A;  2ZHX B;  3KMO A;  1XIY A;  2HSY A;  1M9B A;  4NHW A;  1PN0 A;  3GL3 A;  1QVF 2;  2Z6B A;  4ZL7 A;  1V98 A;  14GS A;  1G96 A;  1O81 A;  4EC0 A;  2H71 A;  3L9S A;  2WFC A;  3GIX A;  2TRX A;  2JAC A;  1LJR A;  3LH4 A;  1OVN A;  3TRP A;  4V1A g;  4I2U A;  2CC3 A;  1YKA A;  1W6C A;  4BVY A;  5ECQ B;  1MWS A;  3H79 A;  3SWL A;  3OWS A;  1K0C A;  2QA2 A;  3JUO A;  4DSR A;  5D96 A;  3EUR A;  1R26 A;  2FWG A;  2C0F A;  5D82 A;  4KCA A;  3DGO A;  1VF1 A;  3WGE A;  4EUY A;  4BL7 B;  1LU4 A;  4HM5 B;  4HOJ A;  4I6X A;  4JR6 A;  1X1U A;  2C0E A;  3ZRE A;  1HU9 A;  4K61 A;  2V41 A;  2HXK A;  1TK5 B;  2QIY A;  2P0G A;  2GU3 A;  4MK3 A;  3BNB A;  1AAZ A;  3GKM A;  5F06 A;  2P5R A;  1ILO A;  1FGM A;  1XW6 A;  1S3A A;  1NU3 A;  1QAK A;  4MPF A;  1PX6 A;  5DQS A;  2HMO B;  4IS0 A;  1UGH I;  5IG4 A;  6GSY A;  1O8W A;  4RUV A;  2VAF A;  3B4O A;  1GMP A;  2DJ1 A;  4ZXG A;  1TTO A;  1B9X C;  1BRN L;  2YV7 A;  4Z2U A;  1T7P B;  3PCR A;  2H6Z A;  4XM4 A;  3DVW A;  3VK9 A;  5GAP D;  3WGD A;  4L5L A;  4TVE A;  3FG1 A;  1UW1 A;  3KCH A;  5JWO B;  3D6I A;  4IEL A;  4BVY B;  1SPU A;  5H5Q A;  3MNG A;  4FYU A;  5G31 A;  1YI2 3;  4MZC A;  4POK A;  3APS A;  4XS4 B;  2J8X B;  5A4U A;  1GTI A;  3QOU A;  1PFO A;  1URM A;  1M1K 4;  2MF7 A;  3IE3 A;  4EXJ A;  4L8P A;  3GKX A;  2P5Q A;  4FYB A;  1NHO A;  3H51 A;  3UEM A;  3FW2 A;  1RLS A;  4RQX A;  4KFE A;  2NBS A;  4HJM A;  2YP6 A;  7GSS A;  3IHQ A;  1GP1 A;  3CC7 3;  2CFW A;  4TR1 A;  2H72 A;  4KF9 A;  3EN8 A;  3TKS E;  4FCM A;  3FK8 A;  3KXO A;  3L9U A;  2G0F A;  2L6C A;  3KH7 A;  3ZYW A;  2ON7 A;  2YV9 A;  1QFN A;  4YAV A;  3I56 3;  3LOY A;  1M2B A;  3KII A;  3Q1C A;  1YEP A;  1UGI A;  5IMD A;  1RGL A;  4X43 A;  2IMK A;  5D81 A;  2B5Y A;  2V1M A;  1TKD B;  2KOK A;  2R0C A;  7STD A;  1TIJ A;  5CLK A;  1VF3 A;  4N3V A;  4LL1 B;  1TRP A;  2LQV A;  5COH A;  1BGS A;  2P0M A;  5G5E A;  2RSX A;  3FRC A;  1HQO A;  1U88 A;  1FGR A;  3J7Y k;  4PUF C;  3F4T A;  3FZW A;  4CY6 A;  2GST A;  2LRN A;  3SOA A;  1PSQ A;  2BHM A;  3FZA A;  1DBY A;  2L5O A;  5LNK e;  3UMA A;  3PGT A;  2H6X A;  4F82 A;  3GHA A;  4EW5 A;  3HDC A;  4L7K A;  2KF6 A;  5CRG A;  4RQR A;  1FB6 A;  1GUH A;  3WT1 A;  1AR0 A;  3F8X A;  4QWT A;  22GS A;  2JQ5 A;  2F8F A;  1RGG A;  3NBJ A;  3FG3 A;  4TR1 B;  3CC4 3;  1RNT A;  2YX9 A;  2DJ2 A;  4CDL A;  1XG8 A;  2TIR A;  1D6Z A;  3F9S A;  1XWB A;  2O89 A;  1EKM A;  1BRG A;  4KH7 A;  3UVH A;  1H4O A;  4KSM A;  3UIW A;  1PA3 A;  1WIK A;  2LRT A;  1VQ9 3;  5AEU B;  4TOP A;  2KCD A;  3AGN A;  1ZYN A;  2H76 A;  1W2Z A;  3C1S A;  2AAD A;  4IP1 A;  4HM7 B;  4V2M A;  5B7C A;  3O8Y A;  2EIR A;  3EX9 A;  1ZX2 A;  3ED3 A;  3IOS A;  4ZL8 A;  2C0D A;  2PPT A;  2MC8 A;  5HQP A;  3TKS A;  3DD3 A;  3GH6 A;  3GRX A;  1ZGX A;  4KZ1 A;  3CTG A;  2YCD A;  3BJ5 A;  4PNF A;  4WBJ A;  2IUK A;  1MD4 A;  4LYL B;  4PX1 A;  2YFJ B;  2OBI A;  1F8N A;  1F3B A;  3GAX A;  4ZB6 A;  2B7J A;  1OHP A;  2KRT A;  7RNT A;  1SJ6 A;  1B21 A;  1ZYE A;  4V2N A;  5AGY A;  2OAD A;  3TJB A;  1R4C A;  4MJC A;  1V58 A;  3WMD A;  3F3R A;  1Y25 A;  1JZO A;  2MZC A;  1HYF A;  2OE3 A;  4JED A;  5ELG A;  5G5F A;  5ID2 A;  2WRT A;  1MWT A;  4GST A;  2Y73 A;  1IQ8 A;  1M9A A;  4L5O A;  3F9U A;  4ECB A;  5HGR A;  4LA1 A;  2K8S A;  4HU9 A;  12GS A;  2LUS A;  1ROA A;  4XTS A;  1O7H B;  2JL4 A;  1IYH A;  2H0I A;  2Z7A A;  1Z1S A;  1W5Z A;  4ZM8 A;  1ISK A;  2OA7 A;  3Q90 A;  3M9J A;  2G2Q A;  1W6G A;  1O8X A;  3VPT A;  3JUP A;  1W01 A;  4IGJ A;  2HMJ B;  2IMJ A;  4U13 A;  3L9V A;  2XRX B;  5ECK B;  1TRS A;  2SAR A;  4I5Q A;  1BG5 A;  2CK3 H;  5EQL A;  3GKN A;  5KP1 A;  4XS4 A;  1EOG A;  4G10 A;  3A76 A;  3EC3 A;  1BUQ A;  3DY5 A;  2FLS A;  1TRW A;  3E99 A;  2P09 A;  1ERT A;  1TP6 A;  4IN0 A;  4XBY A;  1MWU A;  4XRA A;  1GD4 A;  1A23 A;  1B2X A;  4HZ9 B;  3RPP A;  4KSO A;  3CD6 3;  4HM0 B;  4HYZ A;  2IJY A;  3NM7 A;  6GSP A;  1BED A;  1SD8 A;  1IV9 A;  3V99 A;  2CIU A;  1ROV A;  3HY2 A;  4TXV A;  1GLQ A;  1BVI A;  5JWR B;  1SK0 A;  2R41 A;  3HJM A;  3HD5 A;  2DSA A;  1UCJ A;  4NWY A;  4O02 B;  1BNI A;  3KMN A;  1GUL A;  4Q53 A;  1JHB A;  1Q40 A;  4ZL9 A;  1ZO2 A;  1S3C A;  4ML6 A;  1T3B A;  2WGO A;  9GSS A;  3HOH A;  4EV2 A;  1ML6 A;  2BMQ B;  4EE0 A;  5HR2 A;  4XIH A;  2DIZ A;  1X5D A;  3CBU A;  1K0O A;  2LV3 A;  1G6W A;  1GSY A;  1RN4 A;  4ULX A;  5BRT A;  3FZ5 A;  4OWY A;  3HVX A;  3KD0 A;  3GX8 A;  5DRE A;  4LZI A;  1DET A;  4G9H A;  5F0G A;  9RNT A;  3V92 A;  4FR9 A;  3U5R E;  4PGT A;  1T00 A;  4BL7 A;  2KXG A;  4EC6 A;  3MYD A;  2VL9 A;  5ABR A;  4HUA A;  2H6Y A;  4NHZ A;  1X9W B;  3OR5 A;  5D9X A;  4N0Z A;  1JLW A;  4ID0 A;  4YKG A;  1WWJ A;  1X5E A;  2H66 A;  2GSS A;  2WZ9 A;  3G4S 3;  3PCS A;  20GS A;  1EOH A;  2F9S A;  1EGO A;  4HQS A;  3FLJ A;  2XSO B;  4FMB A;  3ECF A;  5RNT A;  1I2G A;  3A3T A;  4MH2 A;  3ZL5 A;  1QJG A;  2UZ8 A;  5FGO A;  1W6Y A;  3ZLP A;  2OTL 3;  4ML1 A;  1AVK A;  3G7J A;  1OE8 A;  3CMA 3;  1XWA A;  4V2L A;  2H74 A;  3IV4 A;  3PR8 A;  1U3I A;  1FUW A;  3EYT A;  2M46 A;  2OQE A;  4AF2 A;  2XF3 A;  5AI1 A;  1YDK A;  1BRJ A;  2RBI A;  1Y4K A;  1VQ8 3;  5FW5 A;  3DGY A;  3K8N A;  1FO5 A;  3M0F A;  2H1D A;  3NQY A;  13GS A;  2PNC A;  2F5M A;  2BNG A;  2GU1 A;  5GSP A;  2AV4 A;  1GSQ A;  5LC6 A;  1SKR B;  3KTB A;  3CXC 2;  2JSY A;  2W0Q A;  1KD1 4;  1SL1 B;  5D9T A;  1GOU A;  1M3I A;  2P31 A;  5IMA A;  2P0X A;  1GTA A;  5IW9 A;  2MMZ A;  1TRQ A;  4BWS A;  4STD A;  2LKU A;  3F6F A;  4MZB A;  3TJG A;  2K3D A;  5B8B A;  3ISO A;  2QA4 3;  4KA0 A;  2SBL A;  1OC9 A;  5HR1 A;  3S27 A;  3U6V A;  3I69 A;  2RM6 A;  4GRF A;  4LMW A;  3SXX A;  3EMX A;  4K1V A;  1MTC A;  4POL A;  1ZGN A;  1TDI A;  2LJK A;  1ERV A;  1OGZ A;  1RJO A;  2GQL A;  4BVX B;  3EF8 A;  4E8H A;  4KB3 A;  4IW9 A;  4TW5 A;  5BXQ A;  2ZL8 A;  4K9Z A;  5D8I A;  5F07 A;  1TK8 B;  1DYU A;  4MLY A;  5EL8 A;  1BYE A;  1RRH A;  3LGC A;  1THX A;  2PBJ A;  3UJ1 A;  2HLS A;  1VQ4 3;  3V98 A;  4ZBA A;  3KCM A;  1AUC A;  4NPB A;  4KFD A;  2W9P A;  2PVO C;  4K1F A;  3WOF B;  3WA3 A;  4KCE A;  3SVA A;  2VCT A;  2O3O A;  3IA1 A;  1NNV A;  1DMN A;  3PZW A;  2C80 A;  1NB3 I;  2ON5 A;  1NM3 A;  1O7M B;  3S67 A;  1LXE A;  5CAX A;  3GRD A;  4XDV A;  4ZB8 A;  4N6O B;  1T4Y A;  1UCL A;  3B7C A;  1BSE A;  2IA7 A;  1TRV A;  1EQK A;  4IQ1 A;  2XH9 A;  2F51 A;  2QGV A;  3MYT A;  4K0N A;  3FKF A;  2CQ9 A;  3CCU 3;  2OKA A;  2X64 A;  2FHE A;  1UA5 A;  2GZY A;  3E9J B;  1MDK A;  4LMI A;  2F8A A;  2WB9 A;  3LOR A;  2NTO A;  4BIR A;  2VCQ A;  4NMU A;  1D6U A;  3APQ A;  1LRA A;  4EL1 A;  3IC4 A;  2J23 A;  2B1X B;  2L5L A;  1WJK A;  2ML5 A;  4WBR D;  3GN3 A;  2FGT A;  4ORL A;  2LRC A;  2JU5 A;  1QK8 A;  1TTZ A;  2CWU A;  1MNL A;  3NBB A;  4ZBD A;  3SBC A;  5M19 A;  5G30 A;  3ZRD A;  3LW9 A;  3MAK A;  3URP A;  1EZK A;  2CV4 A;  3JUN A;  3HKR A;  2XFS A;  4LMV A;  1XFL A;  1Q42 A;  1G7E A;  4X0X A;  5DRV A;  2HFD A;  1L5G B;  1AQZ A;  5IMZ A;  2CG0 A;  3CNX A;  4EKZ A;  3LTB A;  2WGR A;  3GTU A;  1SQW A;  4EDY A;  3S5C A;  3TJJ A;  5D73 A;  2QGU A;  3UL5 A;  1ON4 A;  2K9F A;  3KGK A;  2YAN A;  5CF2 A;  3LYP A;  2FNO A;  4O92 A;  2LNT A;  3ZG5 A;  3IJE B;  3KM6 A;  1TXX A;  3KFQ C;  2H8L A;  3AMO A;  1VQK 3;  3F8U A;  4QL9 A;  4N6U A;  1VF4 A;  1HKX A;  3CCS 3;  1JBR A;  4K6X A;  2CZ2 A;  1BRI A;  4HZB B;  1VQ6 3;  3GFK A;  3AHS A;  5AYR B;  6GSS A;  5IG5 A;  2A2P A;  1ULI B;  4CHS A;  3SED A;  4MJE A;  4RNT A;  3HCZ A;  1GY5 A;  16GS A;  2YJH A;  1B9Y C;  3NV0 A;  1HNA A;  3TB2 A;  1UUW B;  1E3V A;  1A2M A;  4L0U A;  3VGN A;  3OWU A;  5DJL A;  4FCZ A;  4R4K A;  1JN5 A;  2ZDJ A;  2IIY A;  2VO4 A;  4RZM A;  4O5U A;  2O8V B;  2HZF A;  3LYG A;  2CFL A;  1ZYQ B;  1Q7H A;  1UCK A;  1PQN A;  2HML B;  2H01 A;  3ERG A;  4WHA A;  2ALB A;  3KKG A;  3ERF A;  4FYC A;  3EJV A;  4R9K A;  4HVN A;  2X8G A;  1LNH A;  5ECI B;  2KP1 A;  1PYL A;  1CH0 A;  1TI3 A;  5J5N A;  4D73 B;  4PXO A;  8CHO A;  5AN1 A;  3RAZ A;  3AGO A;  3BIR A;  3LEF A;  5JWQ B;  1E2Y A;  2Y74 A;  1AVL A;  4N6N B;  4HDE A;  3H93 A;  3LXZ A;  1K0B A;  3V1W A;  3L0R A;  3CCR 3;  3F3Q A;  3KJY A;  1B2Z A;  3LWA A;  1BU4 A;  1GNW A;  3FH1 A;  1TI1 A;  1RSN A;  3A5I A;  4X4J A;  3HI7 A;  4I4K A;  3CCL 3;  1JBT A;  1DE1 A;  2YFL B;  3NHX A;  5B6M A;  5IO2 A;  1FYS A;  4FMC A;  4Q5Q A;  1M90 4;  4K5R A;  3CXG A;  1Q4J A;  1J08 A;  5DAL A;  5KP3 A;  3FSD A;  1GY7 A;  3QK9 A;  3NV0 B;  4Q5F A;  2FNQ A;  5B8A A;  3ZFB A;  3L78 A;  2GSP A;  4G19 A;  2EC4 A;  1Z3E A;  4H86 A;  5IOW A;  3G9B A;  2PUK C;  3QAW A;  2OE1 A;  1UCI A;  2CAI A;  3IK9 A;  2CT6 A;  2VCX A;  2IMI A;  4KUN A;  1YIT 3;  5J41 A;  2CX4 A;  2R5G A;  3G71 3;  2GGT A;  2VL2 A;  3A2W A;  3WT2 A;  1Z6N A;  5ELA A;  1JB4 A;  1YVB I;  5D83 A;  5IOX A;  2YOI A;  4O3V A;  5D9W A;  2P05 A;  4J56 E;  3ZFL A;  1BNF A;  1G02 A;  4HI7 A;  4Z2R A;  1SAR A;  4ISD A;  4WF5 A;  3CME 3;  4KDU A;  3RHC A;  4TXO B;  2EIO A;  4DSS B;  1BSA A;  1BSB A;  2A2R A;  5HFG A;  1I9D A;  5KOW A;  2EIQ A;  2WJU A;  2V6K A;  3F40 A;  4G1M B;  2NVL A;  2CHC A;  1K0A A;  1S5A A;  1SYX A;  4GXZ A;  2OQE C;  2M7O A;  3RGA A;  6GST A;  2R2J A;  1FGT A;  1M2A A;  4GSP A;  3QAG A;  2M72 A;  1FVK A;  1GNE A;  1UC7 A;  2WOH A;  4OFN A;  1G6Y A;  2AUV A;  1QMA A;  3M9K A;  2PGT A;  1MWR A;  4PTS A;  5DCG A;  3GZB A;  4AGS A;  1OC8 A;  3GYK A;  3ZIT A;  3J7Y b;  3HA9 A;  2H1A A;  1SU9 A;  1WE0 A;  3M1G A;  1CEW I;  1BAY A;  4RBN A;  1RQM A;  2B3S A;  1WP0 A;  3ZIJ A;  3FG4 A;  3ZML A;  2K6V A;  3JVC A;  1BNE A;  2HRN A;  4O7H A;  1R4Y A;  1O7N B;  1GMR A;  5IQY A;  5CO3 A;  1OH0 A;  4HSC X;  1V40 A;  3TJF A;  1WRY A;  4K7N A;  5AIS A;  2R4V A;  4F2I A;  1GWC A;  1NJI 4;  1YF1 A;  5DVB A;  2E2U A;  4MEI A;  2LEG A;  3GX0 A;  1D6Y A;  3EB8 A;  1AQX A;  1CQH A;  2N5F A;  3DML A;  3P90 A;  1YHQ 3;  3TRX A;  2CFG A;  2L4C A;  3DXB A;  4JF8 A;  1A2L A;  4F9Z A;  1GOV A;  1S3D A;  1OKT A;  3X3Y A;  4N0V A;  5JBS A;  1KTE A;  4PUR A;  2CX1 A;  1YGE A;  3VLN A;  4BA7 A;  3ER7 A;  1YQ1 A;  1Z6M A;  1KSI A;  1CQG A;  4WYK B;  4ICY A;  3FF0 A;  1OGX A;  5HR0 A;  5A4V A;  2W56 B;  1AIU A;  6GSW A;  3TUE A;  1BAN A;  2VD1 A;  5IEO A;  2NPB A;  1N8Q A;  3D4T A;  4MF7 A;  3G7I A;  3VFI A;  2GEX A;  1CYV A;  5IER A;  1CYU A;  3G16 A;  1I0X A;  1QAF A;  2LQO A;  3A5W A;  3GL5 A;  2H30 A;  2LNS A;  1YF0 A;  4USS A;  1GOY A;  2I9W A;  3L4N A;  4DSQ A;  3UL3 A;  5LD0 A;  2GLR A;  3KEB A;  3F7S A;  4DEJ A;  3P8W A;  3CU3 A;  3DH2 A;  8RNT A;  1JBS A;  1HD2 A;  2GBW B;  1K3Y A;  4MH3 A;  2HSH A;  2M80 A;  5JCU A;  5H5S A;  3QDN A;  3DGL A;  1TFO A;  5AIF A;  2OE0 A;  1MD3 A;  4F0B A;  2CVD A;  2CWV A;  2AYT A;  4IJI A;  3WGX A;  1QAL A;  1R5P A;  3N8B A;  5CXO A;  3IPZ A;  3TGZ A;  2XBI A;  3C71 A;  5BU4 A;  1QXH A;  1ULJ B;  1PU4 A;  1J9B A;  2H73 A;  5DJM A;  3APO A;  5TGN A;  3EE2 A;  1USB A;  4XS1 A;  2YNX A;  1C72 A;  2CH9 A;  1IYY A;  1SYR A;  2IFQ B;  1HZ1 A;  3SYU A;  3GKK A;  2X99 A;  2GQK A;  5J9B A;  3LG6 A;  3TKQ A;  4JRR A;  1DMM A;  4KND A;  1XWG A;  1W4V A;  4WET A;  1JZR A;  2FWF A;  3C1R A;  3R3E A;  3WDG B;  4J5G A;  2YFI B;  3FZ9 A;  3OV4 A;  1JNQ A;  2A4H A;  2C10 A;  4GTU A;  5GST A;  2VLV A;  4KDY A;  1A8Y A;  1IVX A;  2LST A;  3CSI A;  2XC2 A;  5LCZ A;  4MMY B;  5L71 A;  1TUH A;  1B4P A;  3U1W A;  3F63 A;  3DUK A;  5ECR B;  5IG0 A;  2GSR A;  3HVV A;  1BRK A;  2JDI H;  1AC1 A;  2D2Z A;  3K0Z A;  5CP1 A;  1E97 A;  2OTJ 3;  3I43 A;  1N8R 4;  3A2V A;  4XS6 A;  1TOF A;  5G1K A;  1TW9 A;  3EMP A;  4NHF A;  3DMC A;  2QSI A;  5IO0 A;  4O32 A;  3FF2 A;  2AHE A;  3D0Z A;  1LNI A;  1MDI A;  3H3H A;  3KP8 A;  1WMO A;  1Z9H A;  4KE3 A;  1X9M B;  3K5T A;  1HNC A;  3CRT A;  3GSP A;  2DJ0 A;  4WEY A;  2YZH A;  2YWI A;  1KQS 2;  4MCU A;  4YQU A;  5IIZ A;  2AJQ B;  2ES7 A;  2XPE A;  2CA8 A;  3CPO A;  3MIX A;  4IBP A;  2IN3 A;  3PH9 A;  2C0G A;  1UDI I;  2JZS A;  5BMU A;  5CF1 A;  3TRQ A;  3KH9 A;  4KX4 A;  3FHK A;  2B7K A;  2RFR A;  5E59 A;  5IMV A;  1U8C B;  3VPQ A;  2C11 A;  1VRS D;  4KVH A;  3LJR A;  2W6J H;  1RGC A;  1S3R A;  1W02 A;  4MF6 A;  2R0G A;  2VL3 A;  1NW2 A;  3K7C A;  1MGR A;  1YNV X;  2YWM A;  1EGR A;  5FT3 A;  1VQ7 3;  5JPP A;  1W00 A;  4TKY A;  2HMM B;  4N30 A;  2DJ3 A;  5AEW B;  5AYS C;  1JB2 A;  3SLU A;  3TCO A;  3MSO A;  2B24 B;  1I3F A;  5FWG A;  1TP9 A;  1RGA A;  2JSZ A;  4ECC A;  1S72 3;  1SII A;  2D42 A;  4GL6 A;  1BRS A;  2DKI A;  3CCQ 3;  4XBT A;  2IWT A;  1JV2 B;  4TRX A;  4Q5R A;  3WA2 X;  4J5K A;  2E2V A;  1UVZ A;  1FA3 A;  2DLX A;  3G7Y A;  2UX0 A;  2R6K A;  3Q18 A;  19GS A;  1K73 4;  5AIG A;  1GSD A;  3PPU A;  5CRH A;  4EBG A;  3F4R A;  2H1G A;  1LOX A;  1K3O A;  3FCS B;  3NX0 A;  3X40 A;  1U87 A;  2CZ3 A;  1B2M A;  1YVS A;  2F3M A;  2C3N A;  2I3Y A;  3P2A A;  5IMC A;  5FHI A;  2YN1 A;  2Q07 A;  1U3A A;  3ZZX A;  2INX A;  2IYJ A;  4CCV A;  3GZX B;  1FW1 A;  3DKS A;  1SL2 B;  1Q86 4;  2RCD A;  3BND A;  3MHE A;  2GXF A;  2IMD A;  3EU4 A;  2H70 A;  4HEA 2;  1JLV A;  1SJZ A;  2IL3 A;  3VF1 A;  4EV5 A;  1IVV A;  1YJ9 3;  3E3E A;  5IMF A;  3W8J A;  3G0K A;  1OC3 A;  2Z77 A;  1DMQ A;  2GVP A;  5ECM B;  4BU4 A;  4J8T A;  5CNW A;  1XVQ A;  2LJA A;  3AHW A;  2GEY A;  4X1U A;  5IPG A;  3QR6 A;  5EVO A;  2CFK A;  3EBT A;  2H1B A;  1XW9 A;  4CJN A;  2CW9 A;  3DYR A;  1I2E A;  3D9R A;  5KEJ A;  5GSS A;  1BJX A;  2PMT A;  3MDK A;  4J57 E;  3IHG A;  5G2G A;  4BTW A;  2MBT A;  1UN2 A;  3K9M C;  2CAQ A;  1H75 A;  3UBL A;  4FMD A;  1LOV A;  1BUJ A;  1JKG B;  1AY7 A;  4PNG A;  1WMN A;  4N10 A;  4WP5 A;  1I8V A;  2O9U X;  3F4S A;  3TKR A;  2NDO A;  2HZE B;  4AJ8 A;  4F03 A;  3D21 A;  3CCE 3;  2N5A A;  3H1N A;  5ECO B;  4IVF A;  5DCH A;  1YGW A;  4K2D A;  2CWT A;  3STD A;  4GF0 A;  5C00 A;  3GUR A;  1Q9E A;  2RNT A;  3UAR A;  1UUV B;  5IEN A;  3N9J A;  4XCS A;  3HJO A;  4ZB9 A;  2PZV A;  1SJI A;  2WO0 A;  2IUJ A;  3I55 3;  1NDO B;  1K0M A;  2ZNM A;  4FIW A;  2WCI A;  4MJA A;  2FWE A;  3NIV A;  5F05 A;  2E2G A;  4TX4 A;  3B8L A;  2BU4 A;  3D5I A;  3UNL A;  3FY7 A;  2YWO A;  5A5K A;  4OCE A;  1F37 A;  4FCJ A;  2PWJ A;  4IP6 A;  4L8E A;  2HZE A;  1T2I A;  1TU7 A;  1RGK A;  1BIR A;  3ZG0 A;  2Z76 A;  2AB6 A;  1IQX A;  2YPM A;  1E3R A;  2CKF B;  1U5O A;  2O85 A;  1KWI A;  2L4V A;  2LJR A;  3X42 A;  3Q74 A;  1Q81 4;  4F0C A;  5J9C A;  3Q19 A;  2QKE A;  1FUS A;  2HMK B;  4RI7 A;  4ACS A;  2E7P A;  4X2O A;  3LT8 A;  3T8U A;  1N9E A;  2BO9 B;  1DE2 A;  2DIY A;  3IAS 2;  1QGV A;  2MMO A;  2J9H A;  4HS1 A;  1JJ2 2;  4K1U A;  4X2H A;  2DC5 A;  3BNC A;  4N6T A;  2GZP A;  1SK2 A;  3CCM 3;  1PKW A;  5AIV A;  2F98 A;  4BWQ A;  5HR3 A;  3HII A;  1RCL A;  1X0R A;  1WTH A;  3PXM A;  3RPN A;  3X3Z A;  3F8H A;  1FZU A;  1YKC A;  3H4K A;  4QL7 A;  4XHM A;  1SEN A;  1B48 A;  2QA1 A;  3MPH A;  2W04 A;  3ZTL A;  4CY8 A;  1M99 A;  2VD0 A;  1V9W A;  3F6D A;  1KBN A;  1VGL A;  3DIE A;  1FGO A;  4BTY A;  2YZU A;  1M9G A;  3FR9 A;  4AJ6 A;  1JRQ A;  1N8J A;  3BBY A;  3VSY A;  5ECN B;  2K8V A;  3EU3 A;  2C4J A;  1BNS A;  1KNG A;  1TU8 A;  3LXT A;  3NUV A;  3BD2 A;  4PQH A;  2KP2 A;  3FZ4 A;  3UOM A;  3KTL A;  3HIG A;  3VI7 A;  3MG3 A;  5BIR A;  4GQF A;  1F9M A;  3BB9 A;  3LFL A;  1Z7R A;  2PVQ A;  4MMZ B;  4G0L A;  4DSS A;  2RM5 A;  4ZIL A;  1T2H A;  3EQQ B;  1EUI C;  1NB5 I;  4K5S A;  2RUE A;  1UI8 A;  1I5G A;  2VLU A;  4OO4 A;  2GDR A;  1VF2 A;  1FHE A;  3LTA A;  1B4Q A;  2FWH A;  3M8C A;  3E0U A;  2PN8 A;  2PU9 C;  4HQZ A;  6GSU A;  2WOF A;  2R4I A;  2H75 A;  3GH9 A;  4HOH A;  3DEX A;  2HMN B;  1WMP A;  4AJ7 A;  4LLR A;  3IXR A;  2XGL A;  2W03 A;  1BNR A;  1B27 A;  2KAA A;  1GSS A;  1OHS A;  3DGM A;  4WWU C;  8GSS A;  2HNL A;  3HYP A;  1IV7 A;  1OPY A;  3QFB C;  4WR5 A;  2O7K A;  3DWV A;  1SKW B;  3TDG A;  3HZ8 A;  4GSN A;  3C73 A;  2KLX A;  5DAL B;  1W4N A;  5J4U A;  1RNB A;  3TKP A;  3RBT A;  2H0H A;  2HRK A;  5HFI A;  3ZVJ D;  1VQ5 3;  3HXS A;  3MG1 A;  3ZMK A;  4G2E A;  3CQF A;  4MDC A;  3LT9 A;  4YKF A;  2C3Q A;  2BT3 A;  4YQV A;  1YJ6 A;  2TRC P;  5DQY A;  5ECH B;  4ZBB A;  4PEJ A;  3WOD G;  4JBB A;  5D9V A;  10GS A;  3BU4 A;  4KAE A;  5IPH A;  3QMX A;  3A5E A;  1ST9 A;  5KOX A;  2I1U A;  3A2X A;  3MSZ A;  2C3T A;  3WD6 A;  1FUT A;  3PGB A;  1QMV A;  1AW9 A;  1WMJ A;  1PFP A;  4IIA A;  5M18 A;  2E2M A;  2DJJ A;  2R3X A;  1FVJ A;  1V2A A;  3IPT A;  1Y6E A;  4EO3 A;  1RHL A;  2XPD A;  4EDZ A;  3HVS A;  4FH8 A;  2BJX A;  4OCF A;  1RDS A;  1I70 A;  3Q6O A;  1EWX A;  2XGN A;  4KGI A;  5CRW A;  1XOB A;  4MPG A;  3WR2 A;  4EXR A;  3BNE A;  1IVW A;  1A2K A;  3CC2 3;  1RTU A;  17GS A;  1RMS A;  3MWH A;  3BOA A;  5I97 A;  1FAA A;  1GSE A;  4HZ2 A;  1YJW 3;  3BCK A;  4FQU A;  2KF4 A;  2HI7 A;  4KT3 B;  3HZP A;  5HOH A;  3RGR A;  4L0W A;  3T8N A;  1O73 A;  3NM2 A;  1Z7P A;  1LOW A;  1K3L A;  3CNM A;  7GSP A;  1HNB A;  3X41 A;  1PGT A;  1Q98 A;  2DML A;  1VQM 3;  2CVB A;  4AEQ A;  2BIR A;  1O6J A;  3EBY A;  3GZY B;  1PX7 A;  1QVG 2;  1GTU A;  6RNT A;  1U6T A;  1LVN A;  2VCV A;  4I2T A;  1T8E B;  1FW7 A;  5ELJ A;  2IME A;  5J3R A;  2XR8 B;  5ECS A;  2IFQ A;  1K0D A;  3QFA C;  3S29 A;  1GYB A;  2XBQ A;  5IM9 A;  1OHO A;  3VWX A;  1GSF A;  1MEK A;  3TOU A;  2FGX A;  1VQP 3;  2HYX A;  4HM1 B;  3KN4 A;  3VUR A;  3FR3 A;  5GZZ B;  3CPW 2;  1W7C A;  2GS3 A;  1GTB A; 
#chains in the Genus database with same CATH homology
 4NAX A;  2A2S A;  5DDL A;  4ZIJ A;  1M2D A;  1B8X A;  18GS A;  2LS5 A;  3I6A A;  1GSU A;  1RK4 A;  3KZQ A;  4OFT A;  3US3 A;  4J2F A;  3EWL A;  3IBH A;  4KW6 A;  1ERW A;  2VCW A;  1A24 A;  4BPY A;  1FOH A;  3N5O A;  3S9F A;  2X49 A;  4NXI A;  4P3Y B;  2B5E A;  3ERW A;  5A4W A;  5DBQ A;  3GMF A;  2FA8 A;  4TR4 A;  4MF5 A;  2IMF A;  2IPA A;  2C1Y A;  1W89 A;  2VM2 A;  1X9S B;  1A8L A;  5ENU A;  4ECJ A;  2DKH A;  5E4W A;  2VOC A;  5HFK A;  3R2Q A;  4HZ4 A;  2HSM A;  1ZMA A;  1MDJ A;  2HRF A;  1JZD A;  1XCC A;  1RW1 A;  4MA9 A;  5B6N A;  3EPT A;  4Z2T A;  3GSS A;  2CVK A;  3QD9 A;  4EIQ A;  3IRA A;  3C7M A;  2FD3 A;  4BVX A;  3D4M A;  3CSJ A;  3TOT A;  2OBK A;  1JFU A;  1KEB A;  1O85 A;  1EP7 A;  1PMT A;  2GQM A;  4IKH A;  1GH2 A;  1OAZ A;  3L0H A;  4N11 A;  2HRA A;  3WYW A;  1WPI A;  2IY2 A;  5H5R A;  3CRU A;  3VWW A;  1PN9 A;  5GAN D;  3ZIV A;  4OMV A;  1GL8 A;  2REM A;  2GSQ A;  1A0R P;  2MMN A;  2B1K A;  4EVM A;  4GLT A;  2CX3 A;  2I4A A;  3D5J A;  1N2A A;  3QCP A;  1PRX A;  1E6B A;  4CDO A;  2RUF A;  5G1L A;  3GV1 A;  3D22 A;  4NV5 A;  2LQQ A;  5ECP B;  2C8U A;  5D93 A;  4K8M A;  3LSZ A;  1XPV A;  1EV4 A;  2H19 A;  1ACV A;  2QC7 A;  6GSV A;  3TJK A;  4IJ3 A;  3W6G A;  3F0I A;  4XRD A;  4IQA A;  2VCZ A;  4ECI A;  4YAP A;  4WF4 A;  2I81 A;  3M8N A;  1ABA A;  1O7U A;  2AAW A;  3H8Q A;  4I8B A;  1M7T A;  2KHP A;  5AIX A;  3P7X A;  5DAK B;  3C8E A;  5JCW A;  3FYG A;  1XXU A;  4LL4 B;  3KP9 A;  3DRN A;  4POB A;  5CRE A;  3UVT A;  1ZOF A;  4D73 A;  1GLP A;  4EIP A;  4QQ7 A;  1GUK A;  3QAV A;  5F8B A;  5DAK A;  1ZCP A;  2L59 A;  2B5X A;  1PD2 1;  4TXO A;  4GWR A;  3HHV A;  1G7O A;  1THO A;  2GT5 A;  3IC8 A;  4K7I A;  3O3T A;  4YQM A;  4FO5 A;  2I9H A;  3ZVJ A;  3EVI A;  1FB0 A;  2V32 A;  2OAC A;  4G0I A;  3IK7 A;  2YWN A;  4A5P A;  2L4Q A;  2H0G A;  3QPM A;  4TR3 A;  1NSW A;  2E0Q A;  2VM1 A;  3NZN A;  2LTK A;  4KDX A;  3KIJ A;  3W8S A;  4GCI A;  1YZX A;  4MJB A;  1FOV A;  4NV2 A;  1EEJ A;  2HT9 A;  1XWC A;  1ZZY A;  3FMW A;  3LQ7 A;  1EP8 A;  2RLI A;  1AQV A;  3VWV A;  5ID2 B;  2B6M A;  3RDW A;  1TRU A;  3VWU A;  1PL2 A;  4DVC A;  2BTO T;  2A4V A;  4K7O A;  1F2E A;  4G0K A;  3EIN A;  4YH2 A;  1XZO A;  2ZUP A;  3CSH A;  3DVX A;  1X5C A;  1TJD A;  4HU7 A;  3GUS A;  1R5A A;  1NHY A;  3HZ4 A;  1XOA A;  4Q5N A;  3FEU A;  1OKD A;  4RI6 A;  1F3A A;  1XVW A;  2GT6 A;  2JAD A;  4OD7 A;  1PL1 A;  1R4W A;  4CW9 A;  1HYU A;  5CYY A;  4V1A p;  4WXT A;  1BX9 A;  1YY7 A;  3IR4 A;  3ME7 A;  1XW5 A;  1A2J A;  3LYK A;  1AXD A;  4OFM A;  1DSB A;  1IYI A;  1WOU A;  3CTF A;  5JCG A;  4K0G A;  5KN3 A;  2X4A A;  1SK1 A;  4K2X A;  2GTU A;  4MNN A;  3O76 A;  1J0F A;  5G2Z A;  2VLT A;  4JZQ A;  2YJ7 A;  4MZW A;  3VI5 A;  5EPF A;  2OJL A;  2MBS A;  1Z5Y E;  1ERU A;  3GTU B;  4JR4 A;  4PQI A;  3FR6 A;  5KN1 A;  2FA4 A;  2R0P A;  1QQ2 A;  1F6M C;  3UBK A;  2O87 A;  1JZW A;  2VIM A;  1AQW A;  1ZYP A;  5ECL B;  4MMM A;  2K18 A;  2DBC A;  1G0T A;  4ILF A;  3M3M A;  3GA4 A;  2PER A;  4EF0 A;  1ZL9 A;  2R37 A;  4PQ1 A;  2FY6 A;  1OC9 B;  2B1L A;  4Z7X A;  1DUG A;  3NOF A;  1XBS A;  4I97 A;  4MAB A;  1LBK A;  3CYN A;  1SKS B;  1QUW A;  2JZR A;  3JCM L;  5INY A;  2BMX A;  4TN8 A;  1SL0 B;  4IHU A;  2WUL A;  2L6D A;  3ME8 A;  2HE3 A;  4WKW A;  4GSS A;  1XWK A;  1EV9 A;  4GQC A;  2DMM A;  2ZCT A;  2JZT A;  2V6O A;  4POM A;  3RHB A;  1OYJ A;  4OO5 A;  4JU5 A;  3BCI A;  2L57 A;  1GUM A;  2WS2 A;  3TKS C;  2KUC A;  4O5R A;  3I9V 2;  3AY8 A;  1EEM A;  1T4Z A;  4TR0 A;  4PUA A;  4WR4 A;  1T1V A;  2MYG A;  1TK0 B;  2Z9S A;  11GS A;  2VL2 C;  2N5B A;  2XHF A;  2X8C A;  2GZZ A;  2WDU A;  4JE1 A;  4E8E A;  2DJK A;  2FUG 2;  1M0U A;  1GRX A;  1PKZ A;  3CMI A;  1SD9 A;  4MP4 A;  5C04 A;  3PIN A;  1V57 A;  1A0F A;  6GSX A;  1FG4 A;  1OE7 A;  2MMA A;  1K0N A;  4O5Q A;  2RII A;  3IAM 2;  1YEX A;  5KN2 A;  3GST A;  2FCH A;  2V2G A;  3DGQ A;  5KN0 A;  1R7H A;  3O6T A;  3GNJ A;  3HJP A;  2VUP A;  1BQ7 A;  4HJ2 A;  5CRD A;  2X8H A;  3UAP A;  5EY6 A;  3IDV A;  3KMO A;  1XIY A;  2HSY A;  1M9B A;  4NHW A;  1PN0 A;  3GL3 A;  4ZL7 A;  1V98 A;  14GS A;  1O81 A;  4EC0 A;  2H71 A;  3L9S A;  2WFC A;  3GIX A;  2TRX A;  2JAC A;  1LJR A;  1OVN A;  3TRP A;  4V1A g;  4I2U A;  1YKA A;  4BVY A;  5ECQ B;  3H79 A;  3SWL A;  2QA2 A;  1K0C A;  4DSR A;  5D96 A;  3EUR A;  1R26 A;  2FWG A;  2C0F A;  4KCA A;  1VF1 A;  3WGE A;  4EUY A;  4BL7 B;  1LU4 A;  4HOJ A;  4I6X A;  4JR6 A;  2C0E A;  3ZRE A;  2V41 A;  2HXK A;  1TK5 B;  2P0G A;  4MK3 A;  1AAZ A;  3GKM A;  5F06 A;  2P5R A;  1ILO A;  1XW6 A;  1S3A A;  4MPF A;  1PX6 A;  5DQS A;  4IS0 A;  6GSY A;  1O8W A;  4RUV A;  2VAF A;  2DJ1 A;  4ZXG A;  1B9X C;  2YV7 A;  4Z2U A;  1T7P B;  2H6Z A;  3DVW A;  3VK9 A;  5GAP D;  3WGD A;  4L5L A;  4TVE A;  5JWO B;  3D6I A;  4IEL A;  4BVY B;  5H5Q A;  3MNG A;  4FYU A;  5G31 A;  4MZC A;  4POK A;  3APS A;  4XS4 B;  5A4U A;  1GTI A;  3QOU A;  1URM A;  3IE3 A;  4EXJ A;  3GKX A;  2P5Q A;  4FYB A;  1NHO A;  3UEM A;  3FW2 A;  4RQX A;  2NBS A;  4HJM A;  2YP6 A;  7GSS A;  3IHQ A;  1GP1 A;  4TR1 A;  2H72 A;  4KF9 A;  3TKS E;  3FK8 A;  3KXO A;  3L9U A;  2G0F A;  2L6C A;  3KH7 A;  3ZYW A;  2ON7 A;  2YV9 A;  1QFN A;  4YAV A;  1M2B A;  1YEP A;  5IMD A;  4X43 A;  2IMK A;  2B5Y A;  2V1M A;  1TKD B;  2KOK A;  2R0C A;  1VF3 A;  4LL1 B;  5COH A;  5G5E A;  3FRC A;  1HQO A;  1U88 A;  3J7Y k;  4PUF C;  3F4T A;  4CY6 A;  2GST A;  2LRN A;  1PSQ A;  3FZA A;  1DBY A;  2L5O A;  5LNK e;  3UMA A;  3PGT A;  2H6X A;  4F82 A;  3GHA A;  3HDC A;  5CRG A;  4RQR A;  1FB6 A;  1GUH A;  3WT1 A;  22GS A;  2F8F A;  4TR1 B;  2DJ2 A;  2TIR A;  2O89 A;  1XWB A;  4KH7 A;  3UVH A;  1H4O A;  4KSM A;  3UIW A;  1PA3 A;  1WIK A;  2LRT A;  4TOP A;  1ZYN A;  2H76 A;  3C1S A;  4IP1 A;  4V2M A;  5B7C A;  2EIR A;  3ED3 A;  3IOS A;  4ZL8 A;  2C0D A;  2PPT A;  5HQP A;  3TKS A;  3DD3 A;  3GH6 A;  3GRX A;  3CTG A;  2YCD A;  3BJ5 A;  4PNF A;  4WBJ A;  1MD4 A;  4PX1 A;  2OBI A;  1F3B A;  4ZB6 A;  2B7J A;  1SJ6 A;  1ZYE A;  4V2N A;  5AGY A;  2OAD A;  3TJB A;  4MJC A;  1V58 A;  3F3R A;  1Y25 A;  1JZO A;  2MZC A;  2OE3 A;  4JED A;  5ELG A;  5G5F A;  5ID2 A;  2WRT A;  4GST A;  1M9A A;  4L5O A;  3F9U A;  4ECB A;  4LA1 A;  2K8S A;  4HU9 A;  12GS A;  2LUS A;  4XTS A;  2JL4 A;  1IYH A;  2H0I A;  2OA7 A;  3M9J A;  2G2Q A;  1O8X A;  3VPT A;  4IGJ A;  3L9V A;  5ECK B;  1TRS A;  4I5Q A;  1BG5 A;  3GKN A;  4XS4 A;  1EOG A;  4G10 A;  3EC3 A;  2FLS A;  1TRW A;  1ERT A;  4IN0 A;  4XRA A;  1A23 A;  3RPP A;  4KSO A;  2IJY A;  1BED A;  1SD8 A;  3HY2 A;  4TXV A;  5JWR B;  1GLQ A;  1SK0 A;  3HJM A;  3HD5 A;  2DSA A;  4NWY A;  3KMN A;  1GUL A;  1JHB A;  4ZL9 A;  1S3C A;  4ML6 A;  1T3B A;  9GSS A;  1ML6 A;  4EE0 A;  5HR2 A;  4XIH A;  2DIZ A;  1X5D A;  3CBU A;  1K0O A;  2LV3 A;  1G6W A;  1GSY A;  4ULX A;  5BRT A;  3FZ5 A;  4OWY A;  3HVX A;  3KD0 A;  3GX8 A;  4G9H A;  5F0G A;  3U5R E;  4PGT A;  1T00 A;  4BL7 A;  3MYD A;  2VL9 A;  5ABR A;  4HUA A;  2H6Y A;  4NHZ A;  1X9W B;  3OR5 A;  5D9X A;  4N0Z A;  1JLW A;  4ID0 A;  4YKG A;  1WWJ A;  1X5E A;  2H66 A;  2GSS A;  2WZ9 A;  20GS A;  1EOH A;  2F9S A;  1EGO A;  4HQS A;  4MH2 A;  3A3T A;  3ZL5 A;  2UZ8 A;  3ZLP A;  4ML1 A;  3G7J A;  1OE8 A;  1XWA A;  4V2L A;  2H74 A;  3IV4 A;  3PR8 A;  1U3I A;  3EYT A;  2M46 A;  4AF2 A;  1YDK A;  3K8N A;  1FO5 A;  3M0F A;  2H1D A;  13GS A;  2AV4 A;  1GSQ A;  1SKR B;  3KTB A;  2JSY A;  1SL1 B;  5D9T A;  2P31 A;  5IMA A;  1GTA A;  2MMZ A;  4BWS A;  2LKU A;  3F6F A;  4MZB A;  3TJG A;  5B8B A;  3ISO A;  4KA0 A;  1OC9 A;  5HR1 A;  3U6V A;  3I69 A;  2RM6 A;  4GRF A;  4LMW A;  3EMX A;  1MTC A;  4POL A;  1ZGN A;  1TDI A;  2LJK A;  1ERV A;  2GQL A;  4BVX B;  4E8H A;  4KB3 A;  4IW9 A;  4TW5 A;  4K9Z A;  5F07 A;  5D8I A;  1TK8 B;  4MLY A;  5EL8 A;  1BYE A;  3LGC A;  1THX A;  2PBJ A;  3UJ1 A;  2HLS A;  4ZBA A;  3KCM A;  1AUC A;  4NPB A;  2PVO C;  4K1F A;  4KCE A;  2VCT A;  3IA1 A;  2C80 A;  2ON5 A;  1NM3 A;  5CAX A;  4ZB8 A;  1T4Y A;  1TRV A;  4IQ1 A;  2QGV A;  2F51 A;  4K0N A;  3FKF A;  2CQ9 A;  2OKA A;  2X64 A;  2FHE A;  1UA5 A;  2GZY A;  3E9J B;  1MDK A;  2F8A A;  2WB9 A;  3LOR A;  2NTO A;  2VCQ A;  4NMU A;  3APQ A;  4EL1 A;  3IC4 A;  2J23 A;  2L5L A;  1WJK A;  4WBR D;  3GN3 A;  2LRC A;  2JU5 A;  1QK8 A;  1TTZ A;  4ZBD A;  3SBC A;  5G30 A;  3ZRD A;  3LW9 A;  3MAK A;  1EZK A;  2CV4 A;  3HKR A;  4LMV A;  1XFL A;  1G7E A;  4X0X A;  2HFD A;  5IMZ A;  4EKZ A;  2WGR A;  3GTU A;  4EDY A;  3TJJ A;  5D73 A;  1ON4 A;  2K9F A;  3KGK A;  2YAN A;  3LYP A;  2FNO A;  4O92 A;  2LNT A;  3KM6 A;  1TXX A;  2H8L A;  3F8U A;  4QL9 A;  1VF4 A;  4K6X A;  2CZ2 A;  3GFK A;  6GSS A;  2A2P A;  4CHS A;  4MJE A;  3HCZ A;  16GS A;  2YJH A;  1B9Y C;  1HNA A;  3TB2 A;  1A2M A;  4L0U A;  5DJL A;  2VO4 A;  2IIY A;  4O5U A;  2O8V B;  2HZF A;  1ZYQ B;  1PQN A;  2H01 A;  3ERG A;  2ALB A;  3ERF A;  4FYC A;  2X8G A;  5ECI B;  2KP1 A;  1TI3 A;  5J5N A;  4D73 B;  4PXO A;  5AN1 A;  3RAZ A;  3LEF A;  5JWQ B;  1E2Y A;  4HDE A;  3H93 A;  3LXZ A;  1K0B A;  3V1W A;  3F3Q A;  3KJY A;  3LWA A;  1GNW A;  1TI1 A;  3A5I A;  4X4J A;  1DE1 A;  5B6M A;  5IO2 A;  4Q5Q A;  4K5R A;  3CXG A;  1Q4J A;  1J08 A;  5DAL A;  4Q5F A;  5B8A A;  3ZFB A;  3L78 A;  4G19 A;  2EC4 A;  1Z3E A;  4H86 A;  5IOW A;  3G9B A;  2PUK C;  3QAW A;  2OE1 A;  2CAI A;  3IK9 A;  2CT6 A;  2VCX A;  2IMI A;  4KUN A;  5J41 A;  2CX4 A;  2R5G A;  2GGT A;  2VL2 A;  3A2W A;  3WT2 A;  1Z6N A;  5ELA A;  5IOX A;  2YOI A;  5D9W A;  4J56 E;  3ZFL A;  4HI7 A;  4Z2R A;  4ISD A;  4WF5 A;  4KDU A;  3RHC A;  4TXO B;  2EIO A;  4DSS B;  2A2R A;  5HFG A;  1I9D A;  5KOW A;  2EIQ A;  2WJU A;  2V6K A;  2NVL A;  1K0A A;  1SYX A;  4GXZ A;  6GST A;  2R2J A;  1M2A A;  3QAG A;  2M72 A;  1FVK A;  1GNE A;  1UC7 A;  4OFN A;  1G6Y A;  2AUV A;  3M9K A;  2PGT A;  4PTS A;  5DCG A;  4AGS A;  1OC8 A;  3GYK A;  3ZIT A;  3J7Y b;  3HA9 A;  2H1A A;  1SU9 A;  1WE0 A;  3M1G A;  1BAY A;  1RQM A;  2B3S A;  1WP0 A;  3ZIJ A;  3ZML A;  2K6V A;  2HRN A;  4O7H A;  5IQY A;  5CO3 A;  3TJF A;  1V40 A;  4K7N A;  1WRY A;  5AIS A;  2R4V A;  4F2I A;  1GWC A;  1YF1 A;  5DVB A;  2LEG A;  3GX0 A;  1AQX A;  1CQH A;  2N5F A;  3DML A;  3P90 A;  3TRX A;  2L4C A;  3DXB A;  1A2L A;  4F9Z A;  1S3D A;  1OKT A;  4N0V A;  1KTE A;  4PUR A;  3VLN A;  4BA7 A;  1YQ1 A;  1Z6M A;  1CQG A;  4ICY A;  5HR0 A;  5A4V A;  6GSW A;  1AIU A;  3TUE A;  2VD1 A;  2NPB A;  3D4T A;  4MF7 A;  3G7I A;  3VFI A;  2LQO A;  3A5W A;  3GL5 A;  2H30 A;  2LNS A;  1YF0 A;  4USS A;  3L4N A;  4DSQ A;  3UL3 A;  5LD0 A;  2GLR A;  3KEB A;  4DEJ A;  3P8W A;  1HD2 A;  1K3Y A;  4MH3 A;  2HSH A;  2M80 A;  5JCU A;  5H5S A;  3QDN A;  2OE0 A;  1MD3 A;  4F0B A;  2CVD A;  2AYT A;  4IJI A;  3WGX A;  1R5P A;  3IPZ A;  3TGZ A;  2XBI A;  3C71 A;  1QXH A;  2H73 A;  1J9B A;  5DJM A;  3APO A;  3EE2 A;  1USB A;  4XS1 A;  2YNX A;  1C72 A;  1SYR A;  2IFQ B;  3GKK A;  2X99 A;  2GQK A;  5J9B A;  3LG6 A;  3TKQ A;  4JRR A;  4KND A;  1XWG A;  1W4V A;  4WET A;  1JZR A;  2FWF A;  3C1R A;  3R3E A;  3FZ9 A;  2A4H A;  4GTU A;  5GST A;  2VLV A;  4KDY A;  1A8Y A;  2LST A;  3CSI A;  2XC2 A;  5LCZ A;  5L71 A;  1B4P A;  3F63 A;  5ECR B;  2GSR A;  3HVV A;  1AC1 A;  2D2Z A;  5CP1 A;  3I43 A;  3A2V A;  4XS6 A;  1TOF A;  5G1K A;  1TW9 A;  3EMP A;  2QSI A;  5IO0 A;  4O32 A;  2AHE A;  3D0Z A;  1MDI A;  3KP8 A;  1Z9H A;  4KE3 A;  1X9M B;  1HNC A;  3CRT A;  2DJ0 A;  4WEY A;  2YZH A;  2YWI A;  4MCU A;  4YQU A;  5IIZ A;  2AJQ B;  2ES7 A;  2XPE A;  2CA8 A;  3MIX A;  4IBP A;  2IN3 A;  3PH9 A;  2C0G A;  2JZS A;  5BMU A;  3TRQ A;  3KH9 A;  4KX4 A;  3FHK A;  2B7K A;  5E59 A;  5IMV A;  3VPQ A;  1VRS D;  3LJR A;  4MF6 A;  2R0G A;  2VL3 A;  1NW2 A;  2YWM A;  1EGR A;  5FT3 A;  4TKY A;  4N30 A;  2DJ3 A;  3TCO A;  5FWG A;  1TP9 A;  2JSZ A;  4ECC A;  2DKI A;  2IWT A;  4TRX A;  4Q5R A;  1UVZ A;  2DLX A;  3G7Y A;  2R6K A;  3Q18 A;  19GS A;  1GSD A;  3PPU A;  5CRH A;  3F4R A;  2H1G A;  1K3O A;  1U87 A;  2CZ3 A;  2F3M A;  2C3N A;  2I3Y A;  3P2A A;  5IMC A;  5FHI A;  2YN1 A;  1U3A A;  3ZZX A;  2IYJ A;  1FW1 A;  3DKS A;  1SL2 B;  2IMD A;  3EU4 A;  2H70 A;  4HEA 2;  1JLV A;  1SJZ A;  2IL3 A;  5IMF A;  3E3E A;  3W8J A;  1OC3 A;  2GVP A;  5ECM B;  5CNW A;  1XVQ A;  2LJA A;  4X1U A;  5IPG A;  3QR6 A;  5EVO A;  2H1B A;  1XW9 A;  3DYR A;  5KEJ A;  5GSS A;  1BJX A;  2PMT A;  3MDK A;  4J57 E;  3IHG A;  2MBT A;  1UN2 A;  2CAQ A;  1H75 A;  3UBL A;  4PNG A;  4N10 A;  3F4S A;  3TKR A;  2NDO A;  2HZE B;  4AJ8 A;  4F03 A;  3D21 A;  2N5A A;  3H1N A;  5ECO B;  4IVF A;  5DCH A;  4K2D A;  4GF0 A;  5C00 A;  3GUR A;  3UAR A;  3N9J A;  4XCS A;  3HJO A;  4ZB9 A;  1SJI A;  4FIW A;  1K0M A;  2ZNM A;  2WCI A;  4MJA A;  2FWE A;  3NIV A;  5F05 A;  2E2G A;  3FY7 A;  2YWO A;  5A5K A;  4OCE A;  1F37 A;  2PWJ A;  4IP6 A;  4L8E A;  2HZE A;  1TU7 A;  2AB6 A;  2YPM A;  2O85 A;  2LJR A;  3Q74 A;  4F0C A;  5J9C A;  3Q19 A;  2QKE A;  4ACS A;  4RI7 A;  2E7P A;  1DE2 A;  2DIY A;  3IAS 2;  1QGV A;  2MMO A;  2J9H A;  4HS1 A;  2DC5 A;  2GZP A;  1SK2 A;  1PKW A;  5AIV A;  4BWQ A;  5HR3 A;  1X0R A;  3RPN A;  1YKC A;  3H4K A;  4QL7 A;  4XHM A;  1SEN A;  1B48 A;  2QA1 A;  3ZTL A;  4CY8 A;  1M99 A;  2VD0 A;  1V9W A;  3F6D A;  1KBN A;  1VGL A;  3DIE A;  2YZU A;  3FR9 A;  4AJ6 A;  1N8J A;  3BBY A;  5ECN B;  2K8V A;  3EU3 A;  2C4J A;  4PQH A;  1KNG A;  1TU8 A;  3LXT A;  3BD2 A;  2KP2 A;  3FZ4 A;  3UOM A;  3KTL A;  3VI7 A;  4GQF A;  1F9M A;  3LFL A;  1Z7R A;  2PVQ A;  4G0L A;  4DSS A;  2RM5 A;  4ZIL A;  4K5S A;  2RUE A;  1I5G A;  2VLU A;  4OO4 A;  2GDR A;  1VF2 A;  1FHE A;  1B4Q A;  2FWH A;  3E0U A;  6GSU A;  2PN8 A;  2PU9 C;  4HQZ A;  2H75 A;  3GH9 A;  3DEX A;  4AJ7 A;  4LLR A;  3IXR A;  1GSS A;  8GSS A;  2HNL A;  3HYP A;  3QFB C;  4WR5 A;  2O7K A;  3DWV A;  1SKW B;  3TDG A;  3HZ8 A;  4GSN A;  3C73 A;  2KLX A;  5DAL B;  5J4U A;  3TKP A;  3RBT A;  2H0H A;  2HRK A;  5HFI A;  3ZVJ D;  3HXS A;  3ZMK A;  4G2E A;  4MDC A;  4YKF A;  2C3Q A;  4YQV A;  1YJ6 A;  2TRC P;  5DQY A;  5ECH B;  4ZBB A;  4JBB A;  5D9V A;  10GS A;  4KAE A;  5IPH A;  3QMX A;  1ST9 A;  5KOX A;  2I1U A;  3A2X A;  3MSZ A;  2C3T A;  3WD6 A;  1QMV A;  1AW9 A;  1WMJ A;  2R3X A;  2E2M A;  2DJJ A;  1FVJ A;  1V2A A;  1Y6E A;  4EO3 A;  2XPD A;  4EDZ A;  3HVS A;  4FH8 A;  2BJX A;  4OCF A;  3Q6O A;  1EWX A;  4KGI A;  5CRW A;  1XOB A;  4MPG A;  17GS A;  3MWH A;  3BOA A;  1FAA A;  4HZ2 A;  1GSE A;  3BCK A;  4FQU A;  2HI7 A;  4L0W A;  1O73 A;  1K3L A;  1Z7P A;  1HNB A;  2DML A;  1PGT A;  1Q98 A;  2CVB A;  1O6J A;  1PX7 A;  1GTU A;  1U6T A;  2VCV A;  4I2T A;  1T8E B;  5J3R A;  2IME A;  5ECS A;  2IFQ A;  1K0D A;  3QFA C;  2XBQ A;  5IM9 A;  3VWX A;  1GSF A;  1MEK A;  3TOU A;  2FGX A;  2HYX A;  3VUR A;  3FR3 A;  5GZZ B;  2GS3 A;  1GTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...