4I5QA

Crystal structure and catalytic mechanism for peroplasmic disulfide-bond isomerase dsbc from salmonella enterica serovar typhimurium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein DsbC
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4i5qA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i5qA02
2WFCA 4Q5RA 4GRFA 4GXZA 2YV9A 1A2JA 1UN2A 2BTOT 1YF1A 4IP1A 1X5EA 9GSSA 3GRXA 3VI7A 2VL9A 1KBNA 2R2JA 2AB6A 3IC4A 1XFLA 2FHEA 4J2FA 4Z7XA 5D9VA 2IIYA 1EEJA 1UA5A 1XWCA 4PQIA 3D6IA 5LD0A 4HS1A 2BMXA 3DYRA 3UAPA 1AQXA 1GSYA 3FZAA 3I43A 3CTFA 1THOA 2OACA 3EC3A 3TJFA 2O8VB 1OVNA 3DMLA 5D8IA 1LU4A 1GNWA 2H76A 3UARA 2LJRA 1TI1A 3TKSC 3QDNA 1XOAA 2H72A 4WBJA 4LA1A 5ENUA 2C3QA 1SJ6A 4EE0A 3ZVJA 1WPIA 4F2IA 1I5GA 1G7EA 4ACSA 4XS6A 1OC8A 2AV4A 3QAGA 5J9CA 2FGXA 3DIEA 4OCFA 5ECLB 1WP0A 2HZEB 2LTKA 4NHZA 4WR4A 3VWUA 4RI6A 3DWVA 2H70A 3HVVA 2FA8A 1FW1A 4ZIJA 1R5PA 4POMA 20GSA 3F9UA 4I5QA 1GSFA 1Z6NA 4G2EA 3CRTA 1EV4A 3GYKA 2KUCA 4HQZA 2GLRA 3KEBA 3IK7A 3QMXA 1HNCA 1U3AA 1XW5A 1NW2A 1J08A 3A3TA 4WR5A 2HSHA 1MD4A 5CRHA 2MMAA 2B1LA 2P5QA 2VIMA 1SKWB 1GUMA 2LV3A 5A4UA 3KZQA 2CVKA 3WGXA 4MF6A 1YKAA 4JE1A 4DSSA 4GF0A 6GSVA 2VLVA 1MD3A 4EVMA 3KMNA 1FHEA 4YQMA 1O81A 1O73A 2H66A 3H8QA 2GVPA 4RI7A 5D9TA 2MBTA 1BQ7A 2HT9A 4P3YB 2IPAA 1WE0A 4MZWA 3IRAA 3MWHA 4IW9A 1M99A 2I81A 1FVKA 3KMOA 2CVDA 4EO3A 5ELGA 4F0BA 2GZPA 3IOSA 1X9WB 4K7IA 4NPBA 4K6XA 3TKSA 4NXIA 3RHBA 3WT1A 1OE7A 3LYKA 2WS2A 3APOA 4TR1A 2C0FA 1GH2A 2CZ2A 1H4OA 3HJMA 2EIRA 2H30A 1ZOFA 4FYCA 3VFIA 5ECNB 3GUSA 3M3MA 2JL4A 1JHBA 1PRXA 2KP2A 4IHUA 1UC7A 3Q19A 2N5FA 5INYA 3P2AA 4ZXGA 3TJBA 4KCAA 4TVEA 3A2XA 3QFAC 5ECKB 1RK4A 4MF5A 3APSA 2IMFA 5C04A 3LFLA 3TCOA 3I9V2 1SK2A 4CHSA 4JEDA 5ECQB 1R26A 2CVBA 1TTZA 4IGJA 3F3QA 4BPYA 2GGTA 6GSSA 3VURA 1B48A 5J41A 2HI7A 2PVOC 1XPVA 2H1DA 2VD0A 2H0HA 4OFTA 1J9BA 2RIIA 2ON7A 2TIRA 2FUG2 3C1SA 1GSEA 4TXOA 2LNSA 5J3RA 1DSBA 4KDXA 3FKFA 1CQHA 1V40A 1AUCA 3LJRA 3ZVJD 2VCTA 2G2QA 4TR3A 1SD8A 5B6NA 3GL5A 5DQYA 2OJLA 5B8AA 3LXZA 3ZFLA 3GHAA 3PH9A 2JSZA 1NM3A 5IIZA 1U3IA 3L78A 3J7Yb 1MTCA 2ALBA 3C73A 5CRWA 1V98A 4MP4A 4BWSA 3A2WA 1F6MC 4KNDA 3GKXA 4TR1B 3WGEA 2VL2A 5IO2A 4KSMA 2AYTA 5IOWA 4PNGA 1SK0A 3RPNA 2DJ1A 1ACVA 2LNTA 3GIXA 5F0GA 2IWTA 5ECRB 1PKZA 4FO5A 4EUYA 5DAKB 1HQOA 3O76A 4GSTA 2JZRA 3ZTLA 2VLUA 3EU3A 2MMOA 3KJYA 2YCDA 2HRNA 2JZTA 3UVHA 2XC2A 2LRNA 5AIVA 1WMJA 1V9WA 1SYRA 1EV9A 2RM6A 5AN1A 4V2MA 4TW5A 2LRTA 3FRCA 3G7YA 18GSA 4AJ6A 3ZMKA 2YJHA 2QC7A 2C0GA 2GT6A 2O7KA 4HU7A 2PN8A 5FHIA 2FA4A 1M9AA 5IQYA 3C1RA 2IMEA 3EYTA 2H1AA 1AC1A 1U87A 3DXBA 5KN3A 3RBTA 2MYGA 3UJ1A 3M8NA 1DUGA 1OC9B 5HFKA 2WCIA 1SYXA 4YQUA 1U6TA 4JR4A 4GCIA 4OO4A 1YJ6A 2DIYA 2IFQB 4LL4B 1M7TA 5IMFA 2J9HA 2B5YA 3GH9A 2HYXA 2H73A 2WJUA 2FWGA 2R3XA 4X43A 4YQVA 4MJCA 1WIKA 1EP8A 1S3CA 4IELA 16GSA 5EPFA 4F82A 4GWRA 3TRPA 4ULXA 3W8SA 3IA1A 3HCZA 1RW1A 1M0UA 2EC4A 2ZCTA 1XOBA 2OADA 3TKSE 2JZSA 5G5FA 4G9HA 2H74A 5EVOA 4I97A 4NAXA 3M9JA 4XTSA 2R6KA 5D9XA 1SD9A 4TN8A 3IK9A 3FEUA 4XS4A 2CX4A 1XVWA 2R4VA 3F4RA 2B7JA 3GX0A 4MABA 2DBCA 4POLA 2XBIA 1GLQA 2X8CA 4V2NA 2O87A 4BA7A 3HVXA 1MDIA 3BOAA 3L9VA 4EDZA 1JZRA 3LG6A 3G7JA 2PWJA 4HI7A 4PUFC 2GS3A 3L9SA 3EVIA 4MH3A 3N9JA 3J7Yk 1GRXA 4LLRA 4TKYA 4ZBDA 2H6YA 4XCSA 3L0HA 5EY6A 1SKRB 3HZ4A 4J56E 2OBIA 2VM1A 4K9ZA 1S3DA 2LSTA 4AJ7A 5IMDA 2R37A 3ZMLA 1XBSA 5DBQA 4HDEA 5DAKA 2GSQA 3UL3A 3UBLA 1Y6EA 3DGQA 1A2MA 2C3NA 1XCCA 4IQAA 2E0QA 2YWMA 4KGIA 3ZIJA 2VUPA 4LMWA 4IN0A 4K7OA 1TW9A 5CRGA 2JU5A 3O3TA 2C1YA 1SK1A 4IJIA 2DJ2A 4K8MA 3KTLA 3P7XA 1ZZYA 1PX7A 3G9BA 1VF3A 4ZB6A 3CSIA 3WT2A 3TB2A 4K0GA 5G31A 2LQOA 2L4QA 2GQKA 1G7OA 3I69A 4ZL7A 1ML6A 1USBA 3FY7A 4QQ7A 3KTBA 2H1GA 1OAZA 3PR8A 2LQQA 2GZZA 2YANA 2K18A 3KIJA 4Q5NA 3EINA 3IHQA 2H6ZA 2DJ3A 2YWIA 5F8BA 2K6VA 1HNBA 3DVXA 5GSSA 1XVQA 4MA9A 5G2ZA 1BG5A 4N0ZA 1DE1A 1K3OA 4X0XA 3TJKA 5DQSA 1YDKA 4I6XA 2N5BA 2L4CA 1WOUA 3O6TA 5C00A 3SBCA 3GSTA 3HYPA 2YPMA 3I6AA 5CO3A 2AUVA 3CSHA 4DSQA 1A23A 1YF0A 5CREA 4D73A 2C4JA 4TRXA 2H01A 5HR3A 1JFUA 4ZB9A 1JLWA 4HQSA 1OYJA 1F3AA 3ZLPA 5ID2B 3E3EA 4JRRA 3TKRA 3D5JA 5ID2A 2VCWA 4YAPA 2L59A 2E2MA 2NDOA 3HKRA 4N30A 2GT5A 2HE3A 1GULA 2IL3A 2PBJA 4J57E 19GSA 1FB0A 2CX3A 3EWLA 3V1WA 2FCHA 5IMZA 1TP9A 4OCEA 4PGTA 1F37A 4N10A 1YEPA 1ZMAA 4KX4A 2CZ3A 4KB3A 2I9HA 1FB6A 4NWYA 2C0EA 2ZNMA 3EURA 3ZFBA 4XRAA 5COHA 3BJ5A 4MZBA 4KW6A 3ERFA 4JU5A 2HZFA 1Y25A 1HNAA 4AF2A 2GDRA 4WXTA 3GV1A 2P5RA 1JLVA 2YNXA 3F6DA 2L5LA 3RPPA 5B8BA 1THXA 2X99A 2V32A 4DSRA 1T3BA 2DLXA 3GSSA 1TK5B 4OD7A 2WDUA 2DC5A 4N11A 2I4AA 3TDGA 3S9FA 4IQ1A 3GURA 3HJPA 1TKDB 3GN3A 4HJ2A 2A2RA 3EU4A 4HZ2A 5JWRB 2H71A 2HZEA 5DJLA 3RAZA 5FWGA 5B7CA 1SL0B 2CA8A 14GSA 1K3YA 2MMNA 4F03A 1UVZA 2PU9C 5A5KA 2HFDA 4ECBA 5DVBA 2LKUA 3ISOA 1VRSD 4V2LA 4JBBA 1ZL9A 1XWKA 1A24A 1SL1B 3G7IA 3A5WA 3E9JB 4KUNA 4OO5A 4ISDA 1QK8A 4F0CA 1T8EB 2E7PA 2H1BA 2ZUPA 3VPTA 1T00A 3LORA 2O85A 1ERTA 3UVTA 4MJBA 3VLNA 2E2GA 3IPZA 3KH9A 1B4PA 4ILFA 5H5QA 4IBPA 1HD2A 2HNLA 4LL1B 1SL2B 3N5OA 1TI3A 12GSA 2JADA 5HR0A 1ZYEA 4CW9A 3MSZA 4HJMA 3HA9A 2A4VA 2DJJA 1M2BA 1GTAA 5FT3A 3C7MA 2GSSA 2WULA 1B9YC 2YWNA 3OR5A 1EOHA 2NTOA 3VPQA 1MEKA 3VWXA 1N8JA 1GL8A 1LBKA 1E6BA 2LUSA 4QL7A 1GWCA 2YN1A 1MDKA 2AAWA 5D9WA 2GTUA 3F63A 5J5NA 2PERA 3TGZA 1GUHA 1OKTA 1G6WA 2XBQA 5HQPA 1H75A 1M2DA 4O5RA 3GTUB 1EOGA 4KDUA 1SJIA 3P8WA 2VCZA 4IKHA 3KGKA 4IP6A 4RQRA 5G30A 2IMDA 1YZXA 5ECIB 1BJXA 5HR2A 1I9DA 2C80A 4LMVA 2N5AA 2H0IA 1JZWA 4K1FA 1Z6MA 3PGTA 2H75A 3L4NA 1W89A 3M9KA 1URMA 1XWGA 2GQMA 5ECOB 3ZREA 2YZUA 3WGDA 1Z7PA 2V6OA 4Q5FA 4GQFA 4YAVA 5DJMA 5JCUA 4EL1A 5GZZB 4L5OA 2DJKA 3MNGA 4GLTA 1E2YA 3M1GA 2KHPA 4D73B 2VOCA 5CNWA 3ME8A 1NHYA 1ABAA 1TRVA 4O32A 3KCMA 4V1Ag 1AW9A 1JZOA 4PXOA 3FHKA 1G0TA 2P0GA 4V1Ap 1TK0B 2IY2A 3ZL5A 1PL2A 1TRUA 1M2AA 4HUAA 3BBYA 1ERWA 3UOMA 4POBA 1K0CA 3TRXA 4WF4A 4IS0A 1AQWA 5H5RA 3H4KA 1EGRA 3QAWA 5KN0A 5IPGA 3LEFA 4BWQA 3MDKA 4IVFA 3W8JA 3K8NA 2YV7A 4L0WA 5GSTA 2QSIA 2VL3A 5D73A 2LJKA 4EDYA 2H6XA 2CV4A 5LCZA 3D22A 1WWJA 1GSDA 3ZYWA 3RDWA 3QR6A 4OFNA 3WYWA 4ZILA 1F2EA 2I3YA 4F9ZA 1GSUA 5HFGA 5CP1A 2VM2A 3ME7A 4MMMA 3EE2A 2XPEA 6GSUA 3US3A 1IYHA 4I2UA 3QD9A 1YQ1A 2CQ9A 4FYUA 3DEXA 2YOIA 1X5CA 2DMLA 2AJQB 4RQXA 3UMAA 1BAYA 2NVLA 2OKAA 5IMVA 1K0MA 3HZ8A 2YZHA 2K8VA 1QGVA 3DVWA 2X64A 2QKEA 1A0FA 1GP1A 3TJJA 3CTGA 5GAND 2RUFA 1TU8A 3APQA 1F3BA 2V6KA 5CYYA 4XHMA 4FIWA 2OE0A 1SKSB 1CQGA 3FR6A 2VL2C 3U5RE 2LS5A 1GLPA 1G6YA 4YH2A 2PPTA 11GSA 2P31A 4TOPA 1KTEA 3HXSA 4NHWA 2B3SA 3GKKA 4KE3A 1SJZA 2JACA 1DE2A 2VCVA 5DALB 1RQMA 4MJEA 1JZDA 2L5OA 6GSYA 3TUEA 2MMZA 3E0UA 4MLYA 5F05A 1X0RA 3WD6A 3LGCA 3QOUA 3QFBC 1VGLA 4ZL9A 2YP6A 5CRDA 3IE3A 5AISA 3ZRDA 2DMMA 3GKNA 1M9BA 1PD21 3BD2A 2CT6A 1AXDA 1K0DA 1TU7A 2CAIA 3AY8A 4ZB8A 2YJ7A 1EP7A 4ID0A 5JCWA 1SENA 3BCIA 1GTBA 3UBKA 2TRXA 5EL8A 1FO5A 1R4WA 1EGOA 5J9BA 2V2GA 5KN2A 1TJDA 4X1UA 2GSTA 3SWLA 5H5SA 4Q5QA 4OFMA 5HFIA 2VD1A 3CRUA 4QL9A 1FVJA 1YEXA 4JZQA 1HYUA 4TR4A 4FH8A 4FYBA 2L6DA 4GSNA 3P90A 1T4ZA 1V57A 1YKCA 3GX8A 1O6JA 3D0ZA 3TRQA 4IJ3A 4ZBAA 1K0AA 2G0FA 4MDCA 3W6GA 4KDYA 1A0RP 1U88A 1DBYA 1ST9A 1GSSA 2OE3A 2FWFA 2REMA 5A4WA 1V58A 3H79A 4MCUA 3CBUA 2QGVA 3QPMA 1GNEA 4ZBBA 2GSRA 2IYJA 3FR9A 1TXXA 1K0OA 5IM9A 1ERVA 2C8UA 1TDIA 3KXOA 3PINA 4PUAA 5DCHA 1VF4A 3JCML 3HHVA 2F8AA 3CYNA 1TRWA 4DVCA 2X8HA 1O85A 2X8GA 5ECMB 5G1LA 4E8EA 2I1UA 3KH7A 4KH7A 4PURA 4GQCA 2B5XA 4TR0A 2LJAA 1Z3EA 1OC9A 2L57A 5ECSA 3M0FA 2HLSA 3IBHA 4NMUA 1BX9A 4ECIA 1J0FA 4OWYA 1ERUA 1OC3A 3IAM2 3DKSA 2WZ9A 2B6MA 4BVYA 2IJYA 2IFQA 2R5GA 3L9UA 3D21A 3R2QA 1EWXA 4EF0A 3KP9A 3ED3A 4O7HA 4MH2A 1KEBA 1XW9A 4K7NA 1GSQA 1W4VA 2DIZA 3ZITA 4O92A 1QMVA 4CDOA 2H0GA 2F51A 4WF5A 1EEMA 2Z9SA 3VWWA 3ZIVA 5D96A 2RUEA 5KN1A 1TRSA 1B4QA 4OMVA 4ECJA 3VI5A 4RUVA 2K8SA 4L0UA 5DALA 1X5DA 2PVQA 3F4SA 4G19A 3GH6A 1PQNA 1FAAA 2TRCP 5L71A 1AAZA 1N2AA 2KOKA 1T1VA 5J4UA 1PX6A 2OA7A 2MZCA 2PUKC 3DD3A 3FYGA 3NOFA 5ECHB 1WJKA 1XWBA 4TXOB 3HY2A 1T4YA 3KP8A 6GSTA 2YWOA 1K0BA 3LWAA 2B7KA 1B8XA 5JWQB 2B1KA 4I8BA 2M80A 3LXTA 2IMKA 1S3AA 4PQ1A 6GSWA 4MPGA 1R5AA 4KSOA 1XXUA 2DSAA 4HEA2 5DDLA 1IYIA 4AJ8A 3GMFA 22GSA 1R7HA 3F4TA 4PX1A 5IOXA 2CAQA 1XZOA 3KD0A 13GSA 5JCGA 1ON4A 2A2SA 5ECPB 3TKQA 2EIOA 3ERGA 3H1NA 3IR4A 2L6CA 3CMIA 3Q6OA 5F07A 5E4WA 7GSSA 2VCQA 1PSQA 3GA4A 3GKMA 4K0NA 1B9XC 2FNOA 2OE1A 1ZCPA 1YY7A 1TK8B 1NSWA 1LJRA 2C0DA 4EC0A 4XS1A 5AIXA 1XWAA 3HDCA 2VLTA 5ABRA 5KEJA 1QQ2A 3NZNA 6GSXA 1Z9HA 2NBSA 2D2ZA 4KAEA 5CAXA 3TJGA 3ERWA 5G1KA 1A8YA 3LYPA 1GTUA 2JSYA 2BJXA 3EMPA 3C8EA 4ML6A 1X9SB 1X9MB 3IAS2 4H86A 2M46A 2J23A 4KCEA 4WBRD 1A2LA 2OBKA 1BYEA 2H8LA 3FZ5A 3MAKA 2DJ0A 3FZ9A 1K0NA 3QAVA 1AIUA 2XHFA 5IMCA 1F9MA 2M72A 1PMTA 5B6MA 4BL7A 3F8UA 4N0VA 2FD3A 1FOVA 2FLSA 5GAPD 3IXRA 4K2DA 2VO4A 2KLXA 3Q74A 1QFNA 4MJAA 4GTUA 4JR6A 3FR3A 3TOUA 1PL1A 3CSJA 3FZ4A 4PNFA 3KM6A 2EIQA 2FWEA 5IO0A 1XW6A 2K9FA 1QXHA 3GTUA 5G5EA 3UEMA 1XIYA 1Q98A 4ZL8A 1O8WA 4HU9A 4NV5A 4HZ4A 4EKZA 2HSYA 1MDJA 5DCGA 2WRTA 4MPFA 5IPHA 2F3MA 3C71A 3F3RA 1A8LA 1Z7RA 3GL3A 4EXJA 5AGYA 1ILOA 1V2AA 5LNKe 4TXVA 2F8FA 2IMIA 4DEJA 1EZKA 3H93A 4DSSB 3QCPA 2HRFA 4XRDA 3RHCA 2B5EA 3LSZA 4XS4B 2LRCA 1ZGNA 3CXGA 1Q4JA 2MBSA 2ON5A 1VF1A 4XIHA 10GSA 1TOFA 2GQLA 5A4VA 3IV4A 4L8EA 3FK8A 5D93A 2PMTA 1GUKA 2VAFA 4PQHA 3LQ7A 2O89A 4WETA 2NPBA 17GSA 1PA3A 4ECCA 5ELAA 3FW2A 3BCKA 3IDVA 2FWHA 3ZZXA 3HVSA 4I2TA 2C3TA 1AQVA 3A2VA 3U6VA 2IN3A 1Z5YE 4MF7A 3TOTA 4BVXA 3D4MA 4MZCA 3HJOA 1OE8A 4GSSA 2RLIA 8GSSA 1BEDA 4POKA 1C72A 3VWVA 1QUWA 1ZYQB 2V41A 2GZYA 2RM5A 1VF2A 3HD5A 3NIVA 5F06A 1T7PB 3TKPA 2V1MA 2ES7A 3Q18A 4MK3A 5E59A 3VK9A 2KP1A 1PKWA 1WRYA 2WB9A 4NV2A 1PN9A 5IMAA 1SU9A 3EMXA 1K3LA 3DRNA 4L5LA 1O8XA 5HR1A 2HXKA 3UIWA 4KA0A 1O7UA 3GNJA 1GTIA 4WKWA 1PGTA 1FG4A 3D4TA 2WGRA 2F9SA 3F0IA 2FY6A 3F6FA 2AHEA 4ML1A 3GFKA 4WEYA 1OKDA 2PGTA 4E8HA 4G10A 5JWOB 2VCXA 1KNGA 2LEGA 4HOJA 2H19A 1NHOA 2XPDA 4AGSA
chains in the Genus database with same CATH superfamily
4BTWA 2C4BA 2WFCA 4Q5RA 4GRFA 4GXZA 2YV9A 2XF3A 1A2JA 1UN2A 1FGOA 6STDA 5BXQA 2BTOT 3KCHA 3H51A 1DYUA 1YF1A 4IP1A 4QWTA 1O7HB 1X5EA 9GSSA 3URPA 3GRXA 3VI7A 2VL9A 1KBNA 2R2JA 4L8OA 3UB1A 1YVBI 2AB6A 3IC4A 1XFLA 2FHEA 4N6V0 3FLJA 4J2FA 4Z7XA 5D9VA 2IIYA 1EEJA 1UA5A 4O8SA 1IDPA 1XWCA 4PQIA 3D6IA 5LD0A 2W9PA 4HS1A 2BMXA 1JBRA 3DYRA 3UAPA 3CCS3 1AQXA 1I3FA 1GSYA 3FZAA 3I43A 3CTFA 4STDA 1THOA 2W56A 2OACA 1RNTA 4HOHA 1VQ63 1LQGC 1T5YA 3EC3A 3OWUA 3WOFB 2IA7A 3TJFA 4HM1B 2O8VB 1OVNA 3VSYA 3DMLA 5D8IA 1EUIC 5DRVA 1LU4A 1GNWA 2H76A 4KT3B 3JUNA 1HKXA 2W03A 3UARA 1GSPA 6RNTA 2LJRA 1W2B2 1VQL3 3T8UA 1TI1A 3TKSC 3QDNA 1XOAA 2H72A 4WBJA 3D5GA 4LA1A 5ENUA 2CK3H 2C3QA 1SJ6A 4USSA 1E97A 5CK6A 4EE0A 3ZVJA 3K0ZA 1WPIA 3U1WA 1WMOA 3CQFA 5KP3A 3G8ZA 1FUWA 4F2IA 2GU3A 1I5GA 2KF6A 3D9RA 4EYCA 1G7EA 4ACSA 4XS6A 1OC8A 2J8XB 4EV5A 1LOXA 2AV4A 3QAGA 5J9CA 2XEPA 2FGXA 3DIEA 4OCFA 5ECLB 2F56A 3BB9A 1QMAA 4K2XA 1BRJA 1WP0A 2HZEB 2LTKA 4NHZA 4WR4A 4ORLA 1N9EA 3A76A 3VWUA 1E3RA 4RI6A 3DWVA 1L5GB 2H70A 3HVVA 2FA8A 2QA1A 1FW1A 4ZIJA 1R5PA 1BNSA 4POMA 20GSA 3F9UA 1KWIA 1FA3A 1VQN3 4I5QA 1GSFA 1Z6NA 4G2EA 3CRTA 1EV4A 3GYKA 3X3ZA 4Z2TA 1JN5A 2KUCA 4HQZA 2GLRA 3KEBA 4CDLA 3IK7A 3QMXA 1HNCA 1U3AA 1XW5A 1NW2A 1I2EA 1J08A 3MHEA 1JJ22 3A3TA 4WR5A 2HSHA 1MD4A 5CRHA 1PY3A 2MMAA 2B1LA 2P5QA 5A0OB 2VIMA 1SKWB 1GUMA 2LV3A 5A4UA 4WYKA 3KZQA 1OF5A 2CVKA 3WGXA 4MF6A 1DMMA 3DGNA 1YKAA 4JE1A 4DSSA 4GF0A 6GSVA 2VLVA 1MD3A 1BSEA 4EVMA 1UUWB 3KMNA 2MF7A 1FHEA 4I4KA 4YQMA 1O81A 1O73A 4G1MB 2H66A 3H8QA 2GVPA 1BSDA 4RI7A 5D9TA 2MBTA 1BQ7A 2HT9A 3D79A 1SJWA 4P3YB 2P38A 1HYFA 2IPAA 1WE0A 4MZWA 1D6YA 1TP6A 3IRAA 3NM7A 3MWHA 4IW9A 3LH4A 1M99A 3KSED 2K3DA 3WA3A 2I81A 1FVKA 3KMOA 2CVDA 1TFOA 4EO3A 5ELGA 4F0BA 4GB5A 2GZPA 4ZM8A 1B2SA 3IOSA 1X9WB 4K7IA 4NPBA 4K6XA 5IEPA 3TKSA 4NXIA 3RHBA 3WT1A 1OE7A 3LYKA 2WS2A 5STDA 3APOA 3CNMA 1SIIA 3NHXA 1MGRA 4TR1A 2C0FA 1GH2A 2CZ2A 1MWRA 3RGAA 1H4OA 3HJMA 2EIRA 2H30A 1ZOFA 4FYCA 3VFIA 5ECNB 3V98A 3GUSA 4R9KA 3M3MA 3AMOB 2JL4A 1C54A 1JHBA 2DKIA 5AI1A 7GSPA 1PRXA 2KP2A 4IHUA 3LOYA 1UC7A 2N5FA 3Q19A 1FGQA 3MSOA 5INYA 2HOHA 3P2AA 4ZXGA 3TJBA 3AMOA 4BVXB 3CMA3 4KCAA 4BTYA 4TVEA 3A2XA 4HSCX 3OWYA 3QFAC 1OPYA 5ECKB 1RK4A 4MF5A 3APSA 2IMFA 5C04A 3LFLA 3TCOA 1B2UA 2CWUA 1RN7A 3I9V2 1SK2A 4CHSA 2W2CA 4JEDA 1BRIA 5ECQB 1R26A 2CVBA 1RGGA 3Q3FA 1TTZA 4IGJA 3F3QA 4BPYA 2GGTA 2CC3A 6GSSA 4XBYA 3VURA 1B48A 5J41A 4N3VA 1IQ8A 2HI7A 2PVOC 1XPVA 3DH2A 2H1DA 2VD0A 1VQQA 1PFPA 3LZAA 2H0HA 3KIIA 1EKMA 1TFKA 3EN8A 1UGHI 4OFTA 1J9BA 5IW9A 4FCZA 3CCU3 2RIIA 2ON7A 2TIRA 2FUG2 1KQS2 4KFDA 3C1SA 1GSEA 4TXOA 2LNSA 5J3RA 1BNJA 3BIRA 1DSBA 4XBTA 4KDXA 1BNRA 3FKFA 1Q40A 1CQHA 3KZTA 1V40A 2CWVA 1AUCA 1PFOA 3LJRA 3ZVJD 2VCTA 2WGQA 4WFOA 1US1A 5FGOA 2G2QA 1LQMB 4TR3A 1SD8A 1BOXA 2Z77A 5B6NA 3GL5A 4BIRA 2XR8B 5DQYA 2OJLA 3FG1A 5B8AA 1K28A 3LXZA 2RNTA 3ZFLA 1FGRA 3VF1A 3GHAA 3GSPA 3PH9A 2HMJB 1JB5A 2JSZA 1SPUA 1NM3A 5IIZA 1U3IA 3L78A 3J7Yb 1MTCA 2ALBA 1JV2B 3C73A 5CRWA 1V98A 4MP4A 4BWSA 2CWTA 1KC84 1F6MC 3A2WA 2OTJ3 4KNDA 3GKXA 4TR1B 3WGEA 2VL2A 5IO2A 1OUNA 4KSMA 2AYTA 5IOWA 4PNGA 4R80A 1SK0A 3RPNA 2DJ1A 4HM7B 1ACVA 2LNTA 4K1VA 3GIXA 3D5IA 1BAOA 5F0GA 4BVYB 2SARA 2IWTA 3S5CA 5ECRB 1PKZA 4FO5A 2R41A 4EUYA 5DAKB 2ML6A 1HQOA 3O76A 4GSTA 1AVLA 2JZRA 4MMZB 3ZTLA 2VLUA 3EU3A 2MMOA 3KJYA 2YCDA 3DGYA 2HRNA 3RGRA 2JZTA 2GU1A 3UVHA 1UUVB 7STDA 2LRNA 2XC2A 3M8CA 2CFGA 5AIVA 1K734 1WMJA 2CFWA 5KP4A 3CPW2 1V9WA 4RBNA 4BIKA 1SYRA 4EIQA 4XDVA 1EV9A 1GOVA 3DZLA 1RNBA 2RM6A 5AN1A 1M3JA 4V2MA 4TW5A 2LRTA 3FRCA 4GSPA 3G7YA 18GSA 4AJ6A 2QEX3 3ZMKA 5IG4A 4HYZA 3IPTA 3K9MC 2YJHA 2QC7A 1MWTA 4N6UA 2C0GA 1GOUA 4LGQA 1RGEA 1ZGXA 2GT6A 1BNEA 2O7KA 4JF8A 4HU7A 2GBWB 2PN8A 5FHIA 1RGLA 4KFFA 1M9AA 2FA4A 1ROVA 5IQYA 4LZIA 3C1RA 2KF4A 2IMEA 3EYTA 2XRXB 2H1AA 3CCR3 1AC1A 1U87A 1RLSA 3DXBA 5KN3A 2CW9A 3RBTA 2MYGA 1BRSA 3UJ1A 3M8NA 1DUGA 1OC9B 3FG3A 5HFKA 1UW1A 1MOLA 2QA2A 1NNVA 2WCIA 3EC9A 1SYXA 5KOXA 4YQUA 2BNGA 1JN5B 1U6TA 1B2MA 5AIHA 4JR4A 4GCIA 1GD4A 1M1K4 4OO4A 5AYRB 1YJ6A 1CQSA 2DIYA 3NV0A 4O2HA 2IFQB 1PU4A 4LL4B 1GMRA 2Y74A 3SX1A 1M7TA 5IMFA 2J9HA 2OTL3 1TU5A 2B5YA 3GH9A 1MNLA 2HYXA 2H73A 2WJUA 3H3HA 2FWGA 2RFRA 2R3XA 1UI8A 2FNQA 4X43A 4YQVA 4MJCA 1VQ93 1WIKA 1EP8A 2BIRA 1S3CA 4IELA 16GSA 1GY6A 5EPFA 4F82A 4GWRA 3TRPA 4ULXA 3DGMA 3NM2A 1K8A4 2UX0A 3W8SA 3IA1A 1W01A 3NXJA 3B4OA 1FGTA 3HCZA 1RW1A 1M0UA 5CF1A 2EC4A 2ZCTA 1XOBA 1JBTA 2OADA 3TKSE 1RSNA 2JZSA 5G5FA 4G9HA 2H74A 5EVOA 4I97A 4LSOA 3G713 3M9JA 2E2VA 4NAXA 1GY5A 4XTSA 2R6KA 5D9XA 3AGNA 1SD9A 2YFJB 1Z1SA 4OUQA 4TN8A 3IK9A 2INXA 3FEUA 4XS4A 2CX4A 1XVWA 2R4VA 1LVNA 1QJGA 2B7JA 3F4RA 3GX0A 4MABA 2DBCA 1JKGB 4POLA 2XBIA 1GLQA 2HMMB 2X8CA 4V2NA 2O87A 1FYSA 4BA7A 4HM0B 2Z6BA 3HVXA 3CXC2 3F8HA 2CFKA 3EN1B 1MDIA 3BOAA 3L9VA 4EDZA 1JZRA 2F5MA 3LG6A 3G7JA 1FUSA 2PWJA 4HI7A 4PUFC 2GS3A 3L9SA 5CF2A 3SYUA 3EVIA 4MH3A 3N9JA 1I3IA 3J7Yk 1OHPA 1GRXA 4LLRA 1IQYA 4TKYA 5KP1A 4HAAA 4ZBDA 6GSPA 4FMDA 2H6YA 4XCSA 3L0HA 5EY6A 4EIPA 3DMCA 1SKRB 3HZ4A 1M9GA 4J56E 2OBIA 2VM1A 4K9ZA 1S3DA 2LSTA 4AJ7A 5IMDA 2R37A 3ZMLA 1XBSA 5DBQA 3CCJ3 4HDEA 5DAKA 1NU3A 2GSQA 2ZA4A 3UL3A 3LMLA 4KVHA 3UBLA 1Y6EA 3DGQA 1BUQA 3T0UA 3JUQA 1A2MA 2BMQB 1XCCA 3J7Yd 2C3NA 4BL3A 4IQAA 2E0QA 1YHQ3 2YWMA 4KGIA 3ZIJA 2VUPA 4LMWA 4IN0A 3CC23 1YI23 4K7OA 1TW9A 5CRGA 1J2BA 4RNTA 4YKGA 3GWRA 5JBSA 2JU5A 2ML5A 3O3TA 2C1YA 1SK1A 4IJIA 2DJ2A 4K8MA 3KTLA 3P7XA 1ZZYA 1PX7A 4WWUC 3G9BA 1VF3A 3D3LA 4ZB6A 3CSIA 3WT2A 1GYBA 3TB2A 4K0GA 2D1WA 1RMSA 2LQOA 5G31A 2L4QA 2GQKA 5ELJA 1G7OA 3NQYA 3I69A 4ZL7A 1ML6A 3OX9A 3U97A 1USBA 3FY7A 4QQ7A 3KTBA 5IEOA 2H1GA 1OAZA 3PR8A 2LQQA 2GZZA 1W02A 2YANA 2K18A 3KIJA 4Q5NA 3LXUX 1LOVA 2KAAA 3EINA 3IHQA 3FF0A 2H6ZA 5TGNA 2DJ3A 2YWIA 5F8BA 2K6VA 3B7CA 1HNBA 1VZZA 2C10A 3DVXA 2GXFA 5GSPA 5GSSA 4O3VA 1XVQA 3CNXA 4MA9A 1KD14 1D6ZA 5G2ZA 1UCLA 1BG5A 4N0ZA 1DE1A 4MEIA 1K3OA 4X0XA 4BL7B 3TJKA 5DQSA 1YDKA 4I6XA 1T2IA 3CC73 2N5BA 4BU4A 2L4CA 1WOUA 3O6TA 2B1XB 5C00A 1W5ZA 3SBCA 3GSTA 3HYPA 2YPMA 2BO9B 3I6AA 2BMRB 5CO3A 1BANA 3G6E3 2AUVA 1IVUA 3CSHA 4DSQA 1A23A 1VQ73 1YF0A 5CREA 4D73A 2C4JA 5DREA 2GEXA 4TRXA 2H01A 5HR3A 1JFUA 4LMIA 4ZB9A 4O5QA 4N6TA 1JLWA 4HQSA 3ER7A 1RGHA 2X4AA 1RCLA 1OYJA 1F3AA 1ZX2A 3ZLPA 3GZRA 1AVKA 5ID2B 1O7WB 3E3EA 3IMAB 1BSBA 1UGIA 4JRRA 3AHWA 3TKRA 1PN0A 3D5JA 5ID2A 3S67A 1IV9A 2XGLA 2VCWA 4YAPA 5CXOA 1U8CB 1LXEA 2L59A 2E2MA 3UL6A 3EHCA 2NDOA 3HKRA 4N30A 7RNTA 4R9LA 1W4NA 2GT5A 2HE3A 4G0IA 1GULA 3BU4A 2IL3A 2PBJA 4J57E 4JRFA 19GSA 1FB0A 2CX3A 3EWLA 3V1WA 2HRKA 2FCHA 5IMZA 1TP9A 2MC8A 4OCEA 1B2ZA 4PGTA 1CYVA 1F37A 4N10A 1YEPA 3LT9A 1O7NB 1ZMAA 4KX4A 2WGOA 2WOHA 3ZG5A 2CZ3A 1XG8A 4KB3A 3JUOA 1BVIA 2I9HA 1FB6A 4RNYA 4NWYA 2C0EA 2ZNMA 3EURA 3ZFBA 1WMNA 1TRQA 4X2OA 4XRAA 3BJ5A 4MZBA 2BHMA 5COHA 4KW6A 3ERFA 4JU5A 2HZFA 5IG0A 1GOYA 3NBRA 1Y25A 1HNAA 4AF2A 2GDRA 4WXTA 3GV1A 1GMPA 5IENA 2P5RA 1JLVA 2YNXA 3F6DA 2L5LA 2Z76A 3RPPA 3HIGA 5B8BA 1THXA 2X99A 2V32A 4DSRA 4Z2UA 1BSCA 1RGCA 1T3BA 1DMNA 2DLXA 3GSSA 1I2FA 4KFEA 4OD7A 1TK5B 2WDUA 2DC5A 2L1SA 2BU4A 2LQVA 1A67A 4N11A 1JRQA 2I4AA 3TDGA 1IYYA 3S9FA 4IQ1A 5EVHA 3GURA 3HJPA 2D42A 1JBSA 1TKDB 3GN3A 1X1UA 4HJ2A 2Q07A 2A2RA 2SBLA 3EU4A 4HZ2A 5JWRB 4GL6A 2H71A 2HZEA 2F4YA 2OQEA 5DJLA 3RAZA 5FWGA 5B7CA 1SL0B 1NB3I 2CA8A 1DVCA 14GSA 1K3YA 2MMNA 4FQUA 4F03A 1UVZA 1LRAA 1YNVX 4N6MA 2KXGA 2PU9C 5A5KA 2HFDA 4ECBA 2XGNA 4CPKA 3CCQ3 3CCE3 1IVWA 4HBRA 5DVBA 1RGKA 2LKUA 3ISOA 1VRSD 4V2LA 4JBBA 1ZL9A 1XWKA 1A24A 1SL1B 1MGWA 1OGZA 1YIJ3 3G7IA 3A5WA 3E9JB 4NHFA 4KUNA 4OO5A 1N5PA 4ISDA 1QK8A 1Q9EA 4WP5A 4F0CA 1T8EB 2E7PA 2H1BA 2ZUPA 3VPTA 2OOVC 1T00A 3X3YA 3LORA 2CG0A 2O85A 1ERTA 3UVTA 1TUHA 1A2VA 1X1YA 1UDII 3N9HA 4MJBA 3VLNA 2R0CA 2E2GA 3IPZA 3KH9A 1B4PA 4ILFA 5H5QA 4IBPA 1HD2A 4IT7A 2HNLA 4LL1B 1SL2B 3N5OA 3AHSA 1TI3A 1B20A 4G0KA 12GSA 2JADA 5HR0A 1ZYEA 4CW9A 3MSZA 4HJMA 1G96A 3HA9A 4EBGA 4H3UA 3OXAA 2A4VA 3G16A 2DJJA 4ICYA 1MWSA 1M2BA 1GTAA 1FOHA 5FT3A 3C7MA 5BRTA 3G0KA 2GSSA 2WULA 2W9QA 2K54A 1B9YC 2YWNA 3JUPA 3OR5A 1RGFA 1EOHA 2K0MA 2NTOA 3VPQA 1RKYA 1MEKA 4KF9A 1N8JA 3VWXA 1GL8A 1LBKA 1Q7Y4 1E6BA 2LUSA 4QL7A 1S5AA 1GWCA 2YN1A 2QGUA 4K61A 4WHAA 2GSPA 1MDKA 1UCJA 3LTDA 1GS3A 2AAWA 5D9WA 2GTUA 4CY6A 3F63A 5J5NA 2PERA 3MYDA 4N6LA 3A5IA 3TGZA 1GUHA 2F98A 1OKTA 1BU4A 4TX4A 1G6WA 2XBQA 5HQPA 5BU4A 1H75A 1M2DA 4O5RA 3GTUB 1LNHA 1EOGA 2FGTA 1E3VA 4KDUA 1SJIA 1RDSA 1MWUA 5AYSC 4FR9A 3P8WA 2VCZA 2YFIB 3GZXB 3CME3 3DGOA 4IKHA 3F14A 3KGKA 3GZBA 4IP6A 2X49A 4RQRA 3PYJA 5G30A 1GMQA 2HMNB 3F7SA 3RNTA 2IMDA 1YZXA 4MMYB 5ECIB 1QAKA 2Y73A 3EQQB 1BJXA 2W56B 1NDOB 5HR2A 1OF5B 1IV7A 4BL2A 1I9DA 2C80A 4LMVA 2N5AA 4OK0A 1KSIA 3Q1CA 2H0IA 1K9M4 1JZWA 3HK4A 1OHOA 4K1FA 1Z6MA 3PGTA 2H75A 3L4NA 4H61A 1W89A 1N5HA 4AKZA 2YFLB 3LTAA 3M9KA 1URMA 1XWGA 2GQMA 5ECOB 3ZREA 2YZUA 3IJEB 3WGDA 3FKAA 3SVAA 1Z7PA 3O8YA 3KE7A 2V6OA 4GQFA 4Q5FA 4YAVA 1RGAA 3EB8A 5DJMA 5JCUA 1BIRA 3ALAA 4EL1A 5GZZB 3MPHA 2AAEA 4L5OA 3ZFZA 3CCM3 2DJKA 3BNBA 3MNGA 3FG4A 4GLTA 1E2YA 1RN1A 3M1GA 3X41A 4NREA 2KHPA 4R4KA 4D73B 4LEHA 2VOCA 1TIJA 1RCKA 2XFTA 5CNWA 3ME8A 3NQZA 1FW7A 1NHYA 1ABAA 1TRVA 4O32A 1UUGB 2JDIH 3KCMA 4V1Ag 4XM4A 2W6JH 2LYXA 1AW9A 5D83A 1JZOA 4PXOA 3LYGA 3HOHA 3FZWA 3SLUA 3FHKA 3EX9A 1G0TA 1GD3A 2P0GA 4V1Ap 1TK0B 2IY2A 1X1XA 4N6OB 3ZL5A 1PL2A 1TRUA 1M2AA 4XBXA 1WQLB 3BBYA 1ERWA 4HUAA 3UOMA 4POBA 1K0CA 1Y4KA 3TRXA 4WF4A 3EBYA 3T8NA 4IS0A 4WYKB 1AQWA 5H5RA 3H4KA 1EGRA 3D4AA 3QAWA 1OGXA 5KN0A 5IPGA 3LT8A 3LEFA 4BWQA 5AIFA 3MDKA 4IVFA 2BMOB 1BNGA 3W8JA 1EA2A 3K8NA 1FGMA 2YV7A 2M7OA 4L0WA 2DKHA 5IG3A 5GSTA 3PPUA 2PNCA 2QSIA 2GBXB 3GRDA 2VL3A 4Q53A 5D73A 2R0GA 2LJKA 4EDYA 2H6XA 2KF5A 2CV4A 5LCZA 3D22A 1WWJA 4HM3B 4K1UA 1GSDA 3ZYWA 3RDWA 3WA2X 3QR6A 3MKIA 4OFNA 2OWPA 3WYWA 2KRTA 4ZILA 4OVMA 1F2EA 2I3YA 4F9ZA 1GSUA 5HFGA 4EC6A 1LOWA 5CP1A 1WTHA 1T2HA 3NBJA 1DE3A 2VM2A 4R1KA 3ME7A 4MMMA 4FMBA 3EE2A 2XPEA 3DGLA 3IC8A 1UCKA 6GSUA 3US3A 1O7PB 1IYHA 4I2UA 4HZBB 1YQ1A 4FCMA 3QD9A 4Z2RA 2CQ9A 1VQ53 2F5WA 4FYUA 3DEXA 3MWZA 2YOIA 3GAXA 1X5CA 2DMLA 2AJQB 1M3IA 4PEJA 4RQXA 3UMAA 1BAYA 1JKGA 3X40A 2NVLA 2OKAA 1VQO3 1K0MA 5IMVA 1BRHA 3HZ8A 2YZHA 3N8BA 2K8VA 4HM8B 1SQWA 1QGVA 3DVWA 2X64A 2QKEA 2O3OA 1A0FA 1FZUA 5LC7A 3BLZA 1I8VA 1GP1A 3UNLA 3TJJA 3CTGA 5GAND 3SXXA 2RUFA 1TU8A 3APQA 4J5GA 3SOAA 1F3BA 3LW9A 2V6KA 5CYYA 2CHCA 3OW22 4XHMA 1AV4A 4FIWA 2OE0A 3HZPA 1SKSB 1CQGA 2FXTA 1YIT3 3FR6A 2VL2C 3U5RE 2LS5A 3QRDA 1GLPA 1TTOA 1G6YA 1ZYPA 4YH2A 9RNTA 3EBTA 1IT8A 5G2GA 2PPTA 11GSA 2P31A 2STDA 4TOPA 1KTEA 3HXSA 4NHWA 5M18A 2B3SA 2PZVA 3GKKA 4KE3A 1SJZA 2JACA 1DE2A 2IUKA 3NUVA 5AEUB 2VCVA 5DALB 1DETA 1RQMA 4MJEA 1JZDA 2L5OA 3WHOA 1Q40B 6GSYA 3TUEA 2MMZA 1QALA 2HRAA 3E0UA 4MLYA 2F99A 8RNTA 5F05A 2V1LA 3GZYB 1X0RA 3WD6A 3LGCA 3QOUA 2B24B 1RTUA 3QFBC 1EG9B 1VGLA 4HM6B 4ZL9A 2YP6A 5CRDA 3IE3A 5AISA 4U13A 2DMMA 5EQLA 1W00A 3GKNA 3ZRDA 1M9BA 1PD21 2GEYA 3KKGA 4FCJA 2CT6A 3BD2A 1AXDA 1K0DA 4HJLB 1TU7A 2CAIA 3AY8A 4ZB8A 2YJ7A 5IERA 1DVDA 1BNIA 2L4VA 3PXMA 2KF3A 1EP7A 1TRPA 2UGIA 4ID0A 3HI7A 5JCWA 1SENA 3BCIA 1GTBA 3UBKA 5CLKA 3STDA 2TRXA 5EL8A 1FO5A 1R4WA 1EGOA 5J9BA 2RCDA 2V2GA 1R4YA 1M904 1C7HA 5KN2A 1TJDA 1I2GA 4X1UA 2XH9A 5M1AA 3LTCA 5AIIA 2GSTA 3SWLA 5H5SA 4Q5QA 4OFMA 5HFIA 2VD1A 3CRUA 4QL9A 1FVJA 1BRGA 1YEXA 4J8TA 1HYUA 2A4HA 4FH8A 4FYBA 3F7XA 2L6DA 4JZQA 4GSNA 4TR4A 3P90A 1T4ZA 1YJ93 2CG1A 1V57A 1Q864 1YKCA 3DM8A 3GX8A 1O6JA 1A2KA 3D0ZA 3TRQA 4IJ3A 4ZBAA 1K0AA 3VGNA 2G0FA 4FMAA 3DUKA 4J9AA 4MDCA 5M19A 3W6GA 5IF6A 1IK3A 4KDYA 1A0RP 1U88A 1B27A 3N54B 4EV2A 1DBYA 2P0MA 1ST9A 3V92A 1GSSA 2OE3A 2FWFA 2REMA 3EPTA 5A4WA 1V58A 3H79A 4MCUA 3X3XA 3CBUA 1N9JA 4HVNA 2QGVA 3QPMA 1GNEA 4ZBBA 1V74A 2GSRA 2IYJA 1IU7A 3FR9A 1TXXA 5AEWB 3MG3A 1K0OA 5BVBA 5IM9A 2KCDA 1ERVA 2C8UA 1TDIA 3KXOA 3PINA 3CCL3 4PUAA 5DCHA 1VF4A 1JNQA 1IVVA 3AGOA 3JCML 2W0QA 4K90B 2F8AA 3HHVA 5BMUA 3CYNA 1TRWA 5D81A 3I553 4DVCA 5BIRA 3G4S3 2QIYA 1STDA 2X8HA 1O85A 1YGEA 2X8GA 5ECMB 5G1LA 1Q824 4FMCA 4E8EA 2Z7AA 2I1UA 5HOHA 3KH7A 3FMWA 4KH7A 4PURA 3MG1A 3QK9A 4GQCA 2B5XA 4TR0A 2LJAA 1Z3EA 3IHGA 1M1XB 1OC9A 2L57A 5ECSA 3M0FA 1JB4A 2HLSA 3IBHA 4NMUA 1RRHA 1BX9A 4ECIA 2AADA 1AQZA 1J0FA 4OWYA 4BTXA 2IMJA 1ERUA 1OC3A 5JPUA 3F9SA 1BRKA 3IAM2 3FH1A 2CIUA 3BNCA 3DKSA 2W04A 2WZ9A 4X4JA 1OCVA 2B6MA 4BVYA 2IJYA 1ZO2A 3NV0B 2IFQA 1UI7A 2R5GA 3L9UA 3D21A 3R2QA 3KSPA 3ZG0A 3FF2A 1EWXA 4EF0A 3KP9A 3ED3A 4HM2B 4O7HA 4MH2A 4MJDA 3PS8A 1KEBA 1XW9A 4K7NA 1GSQA 1W4VA 1NJI4 2DIZA 3ZITA 4O92A 1QMVA 4CDOA 2H0GA 1RJOA 2F51A 1N8QA 4AKYA 4WF5A 1EEMA 2Z9SA 3VWWA 3ZIVA 5D96A 2RUEA 5KN1A 1O7GB 1TRSA 1B4QA 4OMVA 4ECJA 3VI5A 1GY7A 4RUVA 2K8SA 4O5UA 4L0UA 3UJMA 5DALA 1B2XA 2CFDA 1VQ43 1S3RA 1X5DA 2PVQA 3F4SA 2WOFA 4HKVB 1VQK3 4G19A 3GH6A 1PQNA 1FAAA 2TRCP 5L71A 1AAZA 1N2AA 2KOKA 1T1VA 1ASKA 5J4UA 1PX6A 5ELUA 2OA7A 2MZCA 4RNZA 2PUKC 3DD3A 4EW5A 3HX8A 1CEWI 2OCTA 3FYGA 3RDEA 3NOFA 5ECHB 1WJKA 1XWBA 4TXOB 3HY2A 2ZHXB 1T4YA 3KP8A 4K5SA 2O9UX 1QAFA 6GSTA 2P0XA 2YWOA 2E2UA 3MYTA 3Q90A 1K0BA 3LWAA 2B7KA 1B8XA 3BNEA 5JWQB 1VQ83 2B1KA 4I8BA 2M80A 1CYUA 3LXTA 2IMKA 1S3AA 4PQ1A 6GSWA 5KOWA 4MPGA 1R5AA 3X42A 2XFSA 4KSOA 3F40A 2R0PA 1W2ZA 4K5RA 2QA43 3Q2PA 1XXUA 2DSAA 4HEA2 5DDLA 1IYIA 4AJ8A 3GMFA 2A2PA 1YJN3 22GSA 1R7HA 3F4TA 4PX1A 5IOXA 2CAQA 5D82A 2HMLB 3MIXA 3JVCA 5IG5A 1VQM3 1XZOA 3KD0A 2ZL8A 13GSA 3K7CA 5JCGA 1ON4A 2JQ5A 1Q814 2A2SA 5ECPB 3TKQA 2EIOA 3ERGA 3H1NA 1U5OA 2UUGC 3IR4A 1I70A 1NO3A 3CPOA 2L6CA 3CMIA 3Q6OA 5F07A 5E4WA 7GSSA 2VCQA 1PSQA 3GA4A 5HGRA 3GKMA 4XB5A 4HZ9B 4K0NA 1B9XC 2FNOA 2OE1A 1HU9A 1ZCPA 1YY7A 1D6UA 1TK8B 2HMKB 4GHOA 1NSWA 5LC6A 1LJRA 4CCVA 2C0DA 4EC0A 4XS1A 5AIXA 1XWAA 3HDCA 2VLTA 5ABRA 5KEJA 1QQ2A 3NZNA 3EF8A 6GSXA 1Z9HA 2NBSA 2D2ZA 4J5KA 2IUJA 1W6CA 1WMPA 4KAEA 5CAXA 4O02B 3ERWA 4N6NB 3TJGA 3EJVA 1BSAA 5G1KA 1UCIA 1A8YA 3E99A 2I9WA 5I97A 3LYPA 2A15A 1GTUA 2JSYA 2BJXA 3FGYA 3EMPA 3C8EA 1IT7A 3WDGB 1AR0A 4ML6A 1X9SB 1QVG2 1X9MB 3WR2A 3IAS2 4H86A 4MNNA 1IVXA 3UL5A 1RHLA 2M46A 1ULIB 4AEQA 2J23A 3PGBA 4KCEA 4WBRD 1IQXA 1A2LA 1BUJA 2OBKA 1BYEA 2H8LA 3ROBA 1A90A 3FZ5A 3MAKA 1G02A 3I0YA 2DJ0A 3FZ9A 1K0NA 3QAVA 3L0RA 1RN4A 1AIUA 2XHFA 4LYLB 5IMCA 1F9MA 2CH9A 2M72A 1PMTA 5B6MA 5JPPA 4BL7A 3F8UA 4N0VA 1NWWA 3NX0A 2FD3A 3NBBA 1FOVA 2R4IA 2FLSA 5GAPD 3IXRA 4K2DA 3PZWA 2VO4A 2KLXA 3Q74A 2WO0A 1QFNA 4MJAA 4GTUA 3S28A 4JR6A 2C11A 1HZ1A 2CFLA 3DXOA 4CY8A 3FR3A 3TOUA 1PL1A 3CSJA 3FZ4A 4PNFA 1ROAA 2P05A 3KM6A 2EIQA 2FWEA 1B21A 4X2HA 5IO0A 3EE1A 3HIIA 4HM5B 1VQP3 1XW6A 2K9FA 1QXHA 3GTUA 5G5EA 1R4CA 5FW5A 3CC43 3UEMA 1XIYA 1Q98A 4ZL8A 1YVSA 1K41A 1FUTA 3PCRA 3DY5A 1O8WA 4HU9A 1W7CA 2E2TA 4NV5A 1I0XA 3KFQC 4HZ4A 3S29A 4EKZA 3BNDA 4PTSA 5AIGA 2CX0A 2HSYA 1MDJA 8CHOA 1Q7HA 1I0VA 1RRLA 3WMDA 2ZDJA 2XSHB 5DCGA 1W6GA 2WRTA 4MPFA 2RBIA 5IPHA 1NB5I 2F3MA 3C71A 3F3RA 1A8LA 1Z7RA 3GL3A 4EXRA 2P09A 4EXJA 1LOYA 3PCSA 5AGYA 1ILOA 1V2AA 4L7KA 5LNKe 2F8FA 2IMIA 3K5TA 4TXVA 4IPBA 4DEJA 1EZKA 3H93A 4DSSB 3QCPA 4DKIA 2HRFA 3KN4A 4XRDA 1ZS7A 3RHCA 2B5EA 3LSZA 3A5EA 4XS4B 1YJW3 2HSMA 2LRCA 1ZGNA 3CXGA 2CX1A 1Q4JA 2MBSA 2ON5A 1VF1A 4XIHA 3R3EA 10GSA 1TOFA 2GQLA 5A4VA 4HM4B 3SOYA 3IV4A 4IIAA 4A5PA 4L8EA 3FK8A 5D93A 1A2PA 2PMTA 1GUKA 4MMXB 2VAFA 4PQHA 3FCSB 3LQ7A 2O89A 1AY7A 4WETA 2NPBA 1O7MB 17GSA 1PA3A 4XDWA 4ECCA 4KZ1A 5ELAA 3B4PA 1SIHA 3FW2A 3BCKA 3FSDA 3K63A 3IDVA 3HVNA 2FWHA 3ZZXA 1BRNL 3HVSA 3ECFA 4I2TA 2C3TA 1AQVA 3A2VA 1QVF2 3U6VA 2UZ8A 1CH0A 2IN3A 1YGWA 3MG2A 1W6YA 3WODG 1Z5YE 2CKFB 4MF7A 3TOTA 3OWSA 2F86B 4G0LA 3D4MA 4BVXA 4MZCA 2OOVA 3HJOA 1OE8A 4GSSA 4CJNA 2RLIA 8GSSA 2RGQA 1BEDA 4POKA 1C72A 3VWVA 2BT3A 1F8NA 1QUWA 1ZYQB 3JUMA 2V41A 1ISKA 2GZYA 2RM5A 1VF2A 3HD5A 3NIVA 5F06A 1T7PB 3TKPA 2V1MA 1N8R4 2ES7A 3S27A 3Q18A 5RNTA 4MK3A 1X1WA 5E59A 3VK9A 1OH0A 2OQEC 2KP1A 1PKWA 3CCV3 1WRYA 2WB9A 1JB2A 4NV2A 1PN9A 2RSXA 5IMAA 4YKFA 1SU9A 1LNIA 3WOEB 3V99A 3EMXA 3F8XA 1K3LA 1STFI 1BGSA 3DRNA 1S723 4RZMA 4L5LA 1O8XA 5HR1A 2HXKA 3UIWA 1WNHA 4KA0A 1O7UA 3GNJA 1GTIA 4WKWA 1PGTA 3LTBA 1FG4A 1SARA 3CU3A 1OHSA 3I563 1EQKA 4L8PA 2XSOB 3D4TA 2WGRA 2F9SA 1BNFA 3F0IA 2FY6A 3F6FA 3B8LA 2AHEA 4ML1A 2YX9A 3GFKA 1B3SA 4WEYA 1OKDA 1OACA 5EEOA 1ULJB 3CD63 2PGTA 4E8HA 3SEDA 4G10A 5JWOB 1DMQA 2VCXA 1KNGA 2LEGA 4HOJA 2H19A 1PYLA 1ZYNA 1Q42A 1NHOA 2HMOB 3OV4A 2XPDA 4AGSA
chains in the Genus database with same CATH topology
2WFCA 4Q5RA 4GRFA 4GXZA 2YV9A 1A2JA 1UN2A 2BTOT 1YF1A 4IP1A 1X5EA 9GSSA 3GRXA 3VI7A 2VL9A 1KBNA 2R2JA 2AB6A 3IC4A 1XFLA 2FHEA 4J2FA 4Z7XA 5D9VA 2IIYA 1EEJA 1UA5A 1XWCA 4PQIA 3D6IA 5LD0A 4HS1A 2BMXA 3DYRA 3UAPA 1AQXA 1GSYA 3FZAA 3I43A 3CTFA 1THOA 2OACA 3EC3A 3TJFA 2O8VB 1OVNA 3DMLA 5D8IA 1LU4A 1GNWA 2H76A 3UARA 2LJRA 1TI1A 3TKSC 3QDNA 1XOAA 2H72A 4WBJA 4LA1A 5ENUA 2C3QA 1SJ6A 4USSA 4EE0A 3ZVJA 1WPIA 4F2IA 1I5GA 1G7EA 4ACSA 4XS6A 1OC8A 2AV4A 3QAGA 5J9CA 2FGXA 3DIEA 4OCFA 5ECLB 4K2XA 1WP0A 2HZEB 2LTKA 4NHZA 4WR4A 3VWUA 4RI6A 3DWVA 2H70A 3HVVA 2FA8A 2QA1A 1FW1A 4ZIJA 1R5PA 4POMA 20GSA 3F9UA 4I5QA 1GSFA 1Z6NA 4G2EA 3CRTA 1EV4A 3GYKA 4Z2TA 2KUCA 4HQZA 2GLRA 3KEBA 3IK7A 3QMXA 1HNCA 1U3AA 1XW5A 1NW2A 1J08A 3A3TA 4WR5A 2HSHA 1MD4A 5CRHA 2MMAA 2B1LA 2P5QA 2VIMA 1SKWB 1GUMA 2LV3A 5A4UA 3KZQA 2CVKA 3WGXA 4MF6A 1YKAA 4JE1A 4DSSA 4GF0A 6GSVA 2VLVA 1MD3A 4EVMA 3KMNA 1FHEA 4YQMA 1O81A 1O73A 2H66A 3H8QA 2GVPA 4RI7A 5D9TA 2MBTA 1BQ7A 2HT9A 4P3YB 2IPAA 1WE0A 4MZWA 3IRAA 3MWHA 4IW9A 1M99A 2I81A 1FVKA 3KMOA 2CVDA 4EO3A 5ELGA 4F0BA 2GZPA 3IOSA 1X9WB 4K7IA 4NPBA 4K6XA 3TKSA 4NXIA 3RHBA 3WT1A 1OE7A 3LYKA 2WS2A 3APOA 4TR1A 2C0FA 1GH2A 2CZ2A 1H4OA 3HJMA 2EIRA 2H30A 1ZOFA 4FYCA 3VFIA 5ECNB 3GUSA 3M3MA 2JL4A 1JHBA 2DKIA 1PRXA 2KP2A 4IHUA 1UC7A 3Q19A 2N5FA 5INYA 3P2AA 4ZXGA 3TJBA 4BVXB 4KCAA 4TVEA 3A2XA 3QFAC 5ECKB 1RK4A 4MF5A 3APSA 2IMFA 5C04A 3LFLA 3TCOA 3I9V2 1SK2A 4CHSA 4JEDA 5ECQB 1R26A 2CVBA 1TTZA 4IGJA 3F3QA 4BPYA 2GGTA 6GSSA 3VURA 1B48A 5J41A 2HI7A 2PVOC 1XPVA 2H1DA 2VD0A 2H0HA 4OFTA 1J9BA 2RIIA 2ON7A 2TIRA 2FUG2 3C1SA 1GSEA 4TXOA 2LNSA 5J3RA 1DSBA 4KDXA 3FKFA 1CQHA 1V40A 1AUCA 3LJRA 3ZVJD 2VCTA 2G2QA 4TR3A 1SD8A 5B6NA 3GL5A 5DQYA 2OJLA 5B8AA 3LXZA 3ZFLA 3GHAA 3PH9A 2JSZA 1NM3A 5IIZA 1U3IA 3L78A 3J7Yb 1MTCA 2ALBA 3C73A 5CRWA 1V98A 4MP4A 4BWSA 3A2WA 1F6MC 4KNDA 3GKXA 4TR1B 3WGEA 2VL2A 5IO2A 4KSMA 2AYTA 5IOWA 4PNGA 1SK0A 3RPNA 2DJ1A 1ACVA 2LNTA 3GIXA 5F0GA 4BVYB 2IWTA 5ECRB 1PKZA 4FO5A 4EUYA 5DAKB 1HQOA 3O76A 4GSTA 2JZRA 3ZTLA 2VLUA 3EU3A 2MMOA 3KJYA 2YCDA 2HRNA 2JZTA 3UVHA 2XC2A 2LRNA 5AIVA 1WMJA 1V9WA 1SYRA 4EIQA 1EV9A 2RM6A 5AN1A 4V2MA 4TW5A 2LRTA 3FRCA 3G7YA 18GSA 4AJ6A 3ZMKA 2YJHA 2QC7A 2C0GA 2GT6A 2O7KA 4HU7A 2PN8A 5FHIA 2FA4A 1M9AA 5IQYA 3C1RA 2IMEA 3EYTA 2H1AA 1AC1A 1U87A 3DXBA 5KN3A 3RBTA 2MYGA 3UJ1A 3M8NA 1DUGA 1OC9B 5HFKA 2QA2A 2WCIA 1SYXA 5KOXA 4YQUA 1U6TA 4JR4A 4GCIA 4OO4A 1YJ6A 2DIYA 2IFQB 4LL4B 1M7TA 5IMFA 2J9HA 2B5YA 3GH9A 2HYXA 2H73A 2WJUA 2FWGA 2R3XA 4X43A 4YQVA 4MJCA 1WIKA 1EP8A 1S3CA 4IELA 16GSA 5EPFA 4F82A 4GWRA 3TRPA 4ULXA 3W8SA 3IA1A 3HCZA 1RW1A 1M0UA 2EC4A 2ZCTA 1XOBA 2OADA 3TKSE 2JZSA 5G5FA 4G9HA 2H74A 5EVOA 4I97A 4NAXA 3M9JA 4XTSA 2R6KA 5D9XA 1SD9A 4TN8A 3IK9A 3FEUA 4XS4A 2CX4A 1XVWA 2R4VA 3F4RA 2B7JA 3GX0A 4MABA 2DBCA 4POLA 2XBIA 1GLQA 2X8CA 4V2NA 2O87A 4BA7A 3HVXA 1MDIA 3BOAA 3L9VA 4EDZA 1JZRA 3LG6A 3G7JA 2PWJA 4HI7A 4PUFC 2GS3A 3L9SA 3EVIA 4MH3A 3N9JA 3J7Yk 1GRXA 4LLRA 4TKYA 4ZBDA 2H6YA 4XCSA 3L0HA 5EY6A 4EIPA 1SKRB 3HZ4A 4J56E 2OBIA 2VM1A 4K9ZA 1S3DA 2LSTA 4AJ7A 5IMDA 2R37A 3ZMLA 1XBSA 5DBQA 4HDEA 5DAKA 2GSQA 3UL3A 3UBLA 1Y6EA 3DGQA 1A2MA 2C3NA 1XCCA 4IQAA 2E0QA 2YWMA 4KGIA 3ZIJA 2VUPA 4LMWA 4IN0A 4K7OA 1TW9A 5CRGA 4YKGA 2JU5A 3O3TA 2C1YA 1SK1A 4IJIA 2DJ2A 4K8MA 3KTLA 3P7XA 1ZZYA 1PX7A 3G9BA 1VF3A 4ZB6A 3CSIA 3WT2A 3TB2A 4K0GA 5G31A 2LQOA 2L4QA 2GQKA 1G7OA 3I69A 4ZL7A 1ML6A 1USBA 3FY7A 4QQ7A 3KTBA 2H1GA 1OAZA 3PR8A 2LQQA 2GZZA 2YANA 2K18A 3KIJA 4Q5NA 3EINA 3IHQA 2H6ZA 2DJ3A 2YWIA 5F8BA 2K6VA 1HNBA 3DVXA 5GSSA 1XVQA 4MA9A 5G2ZA 1BG5A 4N0ZA 1DE1A 1K3OA 4X0XA 4BL7B 3TJKA 5DQSA 1YDKA 4I6XA 2N5BA 2L4CA 1WOUA 3O6TA 5C00A 3SBCA 3GSTA 3HYPA 2YPMA 3I6AA 5CO3A 2AUVA 3CSHA 4DSQA 1A23A 1YF0A 5CREA 4D73A 2C4JA 4TRXA 2H01A 5HR3A 1JFUA 4ZB9A 4O5QA 1JLWA 4HQSA 2X4AA 1OYJA 1F3AA 3ZLPA 5ID2B 3E3EA 4JRRA 3TKRA 1PN0A 3D5JA 5ID2A 2VCWA 4YAPA 2L59A 2E2MA 2NDOA 3HKRA 4N30A 2GT5A 2HE3A 4G0IA 1GULA 2IL3A 2PBJA 4J57E 19GSA 1FB0A 2CX3A 3EWLA 3V1WA 2HRKA 2FCHA 5IMZA 1TP9A 4OCEA 4PGTA 1F37A 4N10A 1YEPA 1ZMAA 4KX4A 2CZ3A 4KB3A 2I9HA 1FB6A 4NWYA 2C0EA 2ZNMA 3EURA 3ZFBA 4XRAA 5COHA 3BJ5A 4MZBA 4KW6A 3ERFA 4JU5A 2HZFA 1Y25A 1HNAA 4AF2A 2GDRA 4WXTA 3GV1A 2P5RA 1JLVA 2YNXA 3F6DA 2L5LA 3RPPA 5B8BA 1THXA 2X99A 2V32A 4DSRA 4Z2UA 1T3BA 2DLXA 3GSSA 1TK5B 4OD7A 2WDUA 2DC5A 4N11A 2I4AA 3TDGA 3S9FA 4IQ1A 3GURA 3HJPA 1TKDB 3GN3A 4HJ2A 2A2RA 3EU4A 4HZ2A 5JWRB 2H71A 2HZEA 5DJLA 3RAZA 5FWGA 5B7CA 1SL0B 2CA8A 14GSA 1K3YA 2MMNA 4FQUA 4F03A 1UVZA 2PU9C 5A5KA 2HFDA 4ECBA 5DVBA 2LKUA 3ISOA 1VRSD 4V2LA 4JBBA 1ZL9A 1XWKA 1A24A 1SL1B 3G7IA 3A5WA 3E9JB 4KUNA 4OO5A 4ISDA 1QK8A 4F0CA 1T8EB 2E7PA 2H1BA 2ZUPA 3VPTA 1T00A 3LORA 2O85A 1ERTA 3UVTA 4MJBA 3VLNA 2R0CA 2E2GA 3IPZA 3KH9A 1B4PA 4ILFA 5H5QA 4IBPA 1HD2A 2HNLA 4LL1B 1SL2B 3N5OA 1TI3A 4G0KA 12GSA 2JADA 5HR0A 1ZYEA 4CW9A 3MSZA 4HJMA 3HA9A 2A4VA 2DJJA 4ICYA 1M2BA 1GTAA 1FOHA 5FT3A 3C7MA 5BRTA 2GSSA 2WULA 1B9YC 2YWNA 3OR5A 1EOHA 2NTOA 3VPQA 1MEKA 4KF9A 1N8JA 3VWXA 1GL8A 1LBKA 1E6BA 2LUSA 4QL7A 1GWCA 2YN1A 1MDKA 2AAWA 5D9WA 2GTUA 4CY6A 3F63A 5J5NA 2PERA 3MYDA 3A5IA 3TGZA 1GUHA 1OKTA 1G6WA 2XBQA 5HQPA 1H75A 1M2DA 4O5RA 3GTUB 1EOGA 4KDUA 1SJIA 3P8WA 2VCZA 4IKHA 3KGKA 4IP6A 2X49A 4RQRA 5G30A 2IMDA 1YZXA 5ECIB 1BJXA 5HR2A 1I9DA 2C80A 4LMVA 2N5AA 2H0IA 1JZWA 4K1FA 1Z6MA 3PGTA 2H75A 3L4NA 1W89A 3M9KA 1URMA 1XWGA 2GQMA 5ECOB 3ZREA 2YZUA 3WGDA 1Z7PA 2V6OA 4Q5FA 4GQFA 4YAVA 5DJMA 5JCUA 4EL1A 5GZZB 4L5OA 2DJKA 3MNGA 4GLTA 1E2YA 3M1GA 2KHPA 4D73B 2VOCA 5CNWA 3ME8A 1NHYA 1ABAA 1TRVA 4O32A 3KCMA 4V1Ag 1AW9A 1JZOA 4PXOA 3FHKA 1G0TA 2P0GA 4V1Ap 1TK0B 2IY2A 3ZL5A 1PL2A 1TRUA 1M2AA 4HUAA 3BBYA 1ERWA 3UOMA 4POBA 1K0CA 3TRXA 4WF4A 4IS0A 1AQWA 5H5RA 3H4KA 1EGRA 3QAWA 5KN0A 5IPGA 3LEFA 4BWQA 3MDKA 4IVFA 3W8JA 3K8NA 2YV7A 4L0WA 2DKHA 5GSTA 3PPUA 2QSIA 2VL3A 5D73A 2R0GA 2LJKA 4EDYA 2H6XA 2CV4A 5LCZA 3D22A 1WWJA 1GSDA 3ZYWA 3RDWA 3QR6A 4OFNA 3WYWA 4ZILA 1F2EA 2I3YA 4F9ZA 1GSUA 5HFGA 5CP1A 2VM2A 3ME7A 4MMMA 3EE2A 2XPEA 3IC8A 6GSUA 3US3A 1IYHA 4I2UA 3QD9A 1YQ1A 4Z2RA 2CQ9A 4FYUA 3DEXA 2YOIA 1X5CA 2DMLA 2AJQB 4RQXA 3UMAA 1BAYA 2NVLA 2OKAA 5IMVA 1K0MA 3HZ8A 2YZHA 2K8VA 1QGVA 3DVWA 2X64A 2QKEA 1A0FA 1GP1A 3TJJA 3CTGA 5GAND 2RUFA 1TU8A 3APQA 1F3BA 3LW9A 2V6KA 5CYYA 4XHMA 4FIWA 2OE0A 1SKSB 1CQGA 3FR6A 2VL2C 3U5RE 2LS5A 1GLPA 1G6YA 1ZYPA 4YH2A 2PPTA 11GSA 2P31A 4TOPA 1KTEA 3HXSA 4NHWA 2B3SA 3GKKA 4KE3A 1SJZA 2JACA 1DE2A 2VCVA 5DALB 1RQMA 4MJEA 1JZDA 2L5OA 6GSYA 3TUEA 2MMZA 2HRAA 3E0UA 4MLYA 5F05A 1X0RA 3WD6A 3LGCA 3QOUA 3QFBC 1VGLA 4ZL9A 2YP6A 5CRDA 3IE3A 5AISA 3ZRDA 2DMMA 3GKNA 1M9BA 1PD21 3BD2A 2CT6A 1AXDA 1K0DA 1TU7A 2CAIA 3AY8A 4ZB8A 2YJ7A 1EP7A 4ID0A 5JCWA 1SENA 3BCIA 1GTBA 3UBKA 2TRXA 5EL8A 1FO5A 1R4WA 1EGOA 5J9BA 2V2GA 5KN2A 1TJDA 4X1UA 2GSTA 3SWLA 5H5SA 4Q5QA 4OFMA 5HFIA 2VD1A 3CRUA 4QL9A 1FVJA 1YEXA 4JZQA 1HYUA 4TR4A 2A4HA 4FH8A 4FYBA 2L6DA 4GSNA 3P90A 1T4ZA 1V57A 1YKCA 3GX8A 1O6JA 3D0ZA 3TRQA 4IJ3A 4ZBAA 1K0AA 2G0FA 4MDCA 3W6GA 4KDYA 1A0RP 1U88A 1DBYA 1ST9A 1GSSA 2OE3A 2FWFA 2REMA 3EPTA 5A4WA 1V58A 3H79A 4MCUA 3CBUA 2QGVA 3QPMA 1GNEA 4ZBBA 2GSRA 2IYJA 3FR9A 1TXXA 1K0OA 5IM9A 1ERVA 2C8UA 1TDIA 3KXOA 3PINA 4PUAA 5DCHA 1VF4A 3JCML 3HHVA 2F8AA 5BMUA 3CYNA 1TRWA 4DVCA 2X8HA 1O85A 2X8GA 5ECMB 5G1LA 4E8EA 2I1UA 3KH7A 3FMWA 4KH7A 4PURA 4GQCA 2B5XA 4TR0A 2LJAA 1Z3EA 3IHGA 1OC9A 2L57A 5ECSA 3M0FA 2HLSA 3IBHA 4NMUA 1BX9A 4ECIA 1J0FA 4OWYA 1ERUA 1OC3A 3IAM2 3DKSA 2WZ9A 4X4JA 2B6MA 4BVYA 2IJYA 2IFQA 2R5GA 3L9UA 3D21A 3R2QA 1EWXA 4EF0A 3KP9A 3ED3A 4O7HA 4MH2A 1KEBA 1XW9A 4K7NA 1GSQA 1W4VA 2DIZA 3ZITA 4O92A 1QMVA 4CDOA 2H0GA 2F51A 4WF5A 1EEMA 2Z9SA 3VWWA 3ZIVA 5D96A 2RUEA 5KN1A 1TRSA 1B4QA 4OMVA 4ECJA 3VI5A 4RUVA 2K8SA 4O5UA 4L0UA 5DALA 1X5DA 2PVQA 3F4SA 4G19A 3GH6A 1PQNA 1FAAA 2TRCP 5L71A 1AAZA 1N2AA 2KOKA 1T1VA 5J4UA 1PX6A 2OA7A 2MZCA 2PUKC 3DD3A 3FYGA 3NOFA 5ECHB 1WJKA 1XWBA 4TXOB 3HY2A 1T4YA 4K5SA 3KP8A 6GSTA 2YWOA 1K0BA 3LWAA 2B7KA 1B8XA 5JWQB 2B1KA 4I8BA 2M80A 3LXTA 2IMKA 1S3AA 4PQ1A 6GSWA 5KOWA 4MPGA 1R5AA 4KSOA 2R0PA 4K5RA 1XXUA 2DSAA 4HEA2 5DDLA 1IYIA 4AJ8A 3GMFA 2A2PA 22GSA 1R7HA 3F4TA 4PX1A 5IOXA 2CAQA 3MIXA 1XZOA 3KD0A 13GSA 5JCGA 1ON4A 2A2SA 5ECPB 3TKQA 2EIOA 3ERGA 3H1NA 3IR4A 2L6CA 3CMIA 3Q6OA 5F07A 5E4WA 7GSSA 2VCQA 1PSQA 3GA4A 3GKMA 4K0NA 1B9XC 2FNOA 2OE1A 1ZCPA 1YY7A 1TK8B 1NSWA 1LJRA 2C0DA 4EC0A 4XS1A 5AIXA 1XWAA 3HDCA 2VLTA 5ABRA 5KEJA 1QQ2A 3NZNA 6GSXA 1Z9HA 2NBSA 2D2ZA 4KAEA 5CAXA 3TJGA 3ERWA 5G1KA 1A8YA 3LYPA 1GTUA 2JSYA 2BJXA 3EMPA 3C8EA 4ML6A 1X9SB 1X9MB 3IAS2 4H86A 4MNNA 2M46A 2J23A 4KCEA 4WBRD 1A2LA 2OBKA 1BYEA 2H8LA 3FZ5A 3MAKA 2DJ0A 3FZ9A 1K0NA 3QAVA 1AIUA 2XHFA 5IMCA 1F9MA 2M72A 1PMTA 5B6MA 4BL7A 3F8UA 4N0VA 2FD3A 1FOVA 2FLSA 5GAPD 3IXRA 4K2DA 2VO4A 2KLXA 3Q74A 1QFNA 4MJAA 4GTUA 4JR6A 4CY8A 3FR3A 3TOUA 1PL1A 3CSJA 3FZ4A 4PNFA 3KM6A 2EIQA 2FWEA 5IO0A 1XW6A 2K9FA 1QXHA 3GTUA 5G5EA 3UEMA 1XIYA 1Q98A 4ZL8A 1O8WA 4HU9A 4NV5A 4HZ4A 4EKZA 4PTSA 2HSYA 1MDJA 5DCGA 2WRTA 4MPFA 5IPHA 2F3MA 3C71A 3F3RA 1A8LA 1Z7RA 3GL3A 4EXJA 5AGYA 1ILOA 1V2AA 5LNKe 4TXVA 2F8FA 2IMIA 4DEJA 1EZKA 3H93A 4DSSB 3QCPA 2HRFA 4XRDA 3RHCA 2B5EA 3LSZA 4XS4B 2HSMA 2LRCA 1ZGNA 3CXGA 1Q4JA 2MBSA 4XIHA 2ON5A 1VF1A 3R3EA 10GSA 1TOFA 2GQLA 5A4VA 3IV4A 4A5PA 4L8EA 3FK8A 5D93A 2PMTA 1GUKA 2VAFA 4PQHA 3LQ7A 2O89A 4WETA 2NPBA 17GSA 1PA3A 4ECCA 5ELAA 3FW2A 3BCKA 3IDVA 2FWHA 3ZZXA 3HVSA 4I2TA 2C3TA 1AQVA 3A2VA 3U6VA 2UZ8A 2IN3A 1Z5YE 4MF7A 3TOTA 4G0LA 4BVXA 3D4MA 4MZCA 3HJOA 1OE8A 4GSSA 2RLIA 8GSSA 1BEDA 4POKA 1C72A 3VWVA 1QUWA 1ZYQB 2V41A 2GZYA 2RM5A 1VF2A 3HD5A 3NIVA 5F06A 1T7PB 3TKPA 2V1MA 2ES7A 3Q18A 4MK3A 5E59A 3VK9A 2KP1A 1PKWA 1WRYA 2WB9A 4NV2A 1PN9A 5IMAA 4YKFA 1SU9A 3EMXA 1K3LA 3DRNA 4L5LA 1O8XA 5HR1A 2HXKA 3UIWA 4KA0A 1O7UA 3GNJA 1GTIA 4WKWA 1PGTA 1FG4A 3D4TA 2WGRA 2F9SA 3F0IA 2FY6A 3F6FA 2AHEA 4ML1A 3GFKA 4WEYA 1OKDA 2PGTA 4E8HA 4G10A 5JWOB 2VCXA 1KNGA 2LEGA 4HOJA 2H19A 1ZYNA 1NHOA 2XPDA 4AGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WFC A;  4Q5R A;  4GRF A;  4GXZ A;  2YV9 A;  1A2J A;  1UN2 A;  2BTO T;  1YF1 A;  4IP1 A;  1X5E A;  9GSS A;  3GRX A;  3VI7 A;  2VL9 A;  1KBN A;  2R2J A;  2AB6 A;  3IC4 A;  1XFL A;  2FHE A;  4J2F A;  4Z7X A;  5D9V A;  2IIY A;  1EEJ A;  1UA5 A;  1XWC A;  4PQI A;  3D6I A;  5LD0 A;  4HS1 A;  2BMX A;  3DYR A;  3UAP A;  1AQX A;  1GSY A;  3FZA A;  3I43 A;  3CTF A;  1THO A;  2OAC A;  3EC3 A;  3TJF A;  2O8V B;  1OVN A;  3DML A;  5D8I A;  1LU4 A;  1GNW A;  2H76 A;  3UAR A;  2LJR A;  1TI1 A;  3TKS C;  3QDN A;  1XOA A;  2H72 A;  4WBJ A;  4LA1 A;  5ENU A;  2C3Q A;  1SJ6 A;  4EE0 A;  3ZVJ A;  1WPI A;  4F2I A;  1I5G A;  1G7E A;  4ACS A;  4XS6 A;  1OC8 A;  2AV4 A;  3QAG A;  5J9C A;  2FGX A;  3DIE A;  4OCF A;  5ECL B;  1WP0 A;  2HZE B;  2LTK A;  4NHZ A;  4WR4 A;  3VWU A;  4RI6 A;  3DWV A;  2H70 A;  3HVV A;  2FA8 A;  1FW1 A;  4ZIJ A;  1R5P A;  4POM A;  20GS A;  3F9U A;  4I5Q A;  1GSF A;  1Z6N A;  4G2E A;  3CRT A;  1EV4 A;  3GYK A;  2KUC A;  4HQZ A;  2GLR A;  3KEB A;  3IK7 A;  3QMX A;  1HNC A;  1U3A A;  1XW5 A;  1NW2 A;  1J08 A;  3A3T A;  4WR5 A;  2HSH A;  1MD4 A;  5CRH A;  2MMA A;  2B1L A;  2P5Q A;  2VIM A;  1SKW B;  1GUM A;  2LV3 A;  5A4U A;  3KZQ A;  2CVK A;  3WGX A;  4MF6 A;  1YKA A;  4JE1 A;  4DSS A;  4GF0 A;  6GSV A;  2VLV A;  1MD3 A;  4EVM A;  3KMN A;  1FHE A;  4YQM A;  1O81 A;  1O73 A;  2H66 A;  3H8Q A;  2GVP A;  4RI7 A;  5D9T A;  2MBT A;  1BQ7 A;  2HT9 A;  4P3Y B;  2IPA A;  1WE0 A;  4MZW A;  3IRA A;  3MWH A;  4IW9 A;  1M99 A;  2I81 A;  1FVK A;  3KMO A;  2CVD A;  4EO3 A;  5ELG A;  4F0B A;  2GZP A;  3IOS A;  1X9W B;  4K7I A;  4NPB A;  4K6X A;  3TKS A;  4NXI A;  3RHB A;  3WT1 A;  1OE7 A;  3LYK A;  2WS2 A;  3APO A;  4TR1 A;  2C0F A;  1GH2 A;  2CZ2 A;  1H4O A;  3HJM A;  2EIR A;  2H30 A;  1ZOF A;  4FYC A;  3VFI A;  5ECN B;  3GUS A;  3M3M A;  2JL4 A;  1JHB A;  1PRX A;  2KP2 A;  4IHU A;  1UC7 A;  3Q19 A;  2N5F A;  5INY A;  3P2A A;  4ZXG A;  3TJB A;  4KCA A;  4TVE A;  3A2X A;  3QFA C;  5ECK B;  1RK4 A;  4MF5 A;  3APS A;  2IMF A;  5C04 A;  3LFL A;  3TCO A;  3I9V 2;  1SK2 A;  4CHS A;  4JED A;  5ECQ B;  1R26 A;  2CVB A;  1TTZ A;  4IGJ A;  3F3Q A;  4BPY A;  2GGT A;  6GSS A;  3VUR A;  1B48 A;  5J41 A;  2HI7 A;  2PVO C;  1XPV A;  2H1D A;  2VD0 A;  2H0H A;  4OFT A;  1J9B A;  2RII A;  2ON7 A;  2TIR A;  2FUG 2;  3C1S A;  1GSE A;  4TXO A;  2LNS A;  5J3R A;  1DSB A;  4KDX A;  3FKF A;  1CQH A;  1V40 A;  1AUC A;  3LJR A;  3ZVJ D;  2VCT A;  2G2Q A;  4TR3 A;  1SD8 A;  5B6N A;  3GL5 A;  5DQY A;  2OJL A;  5B8A A;  3LXZ A;  3ZFL A;  3GHA A;  3PH9 A;  2JSZ A;  1NM3 A;  5IIZ A;  1U3I A;  3L78 A;  3J7Y b;  1MTC A;  2ALB A;  3C73 A;  5CRW A;  1V98 A;  4MP4 A;  4BWS A;  3A2W A;  1F6M C;  4KND A;  3GKX A;  4TR1 B;  3WGE A;  2VL2 A;  5IO2 A;  4KSM A;  2AYT A;  5IOW A;  4PNG A;  1SK0 A;  3RPN A;  2DJ1 A;  1ACV A;  2LNT A;  3GIX A;  5F0G A;  2IWT A;  5ECR B;  1PKZ A;  4FO5 A;  4EUY A;  5DAK B;  1HQO A;  3O76 A;  4GST A;  2JZR A;  3ZTL A;  2VLU A;  3EU3 A;  2MMO A;  3KJY A;  2YCD A;  2HRN A;  2JZT A;  3UVH A;  2XC2 A;  2LRN A;  5AIV A;  1WMJ A;  1V9W A;  1SYR A;  1EV9 A;  2RM6 A;  5AN1 A;  4V2M A;  4TW5 A;  2LRT A;  3FRC A;  3G7Y A;  18GS A;  4AJ6 A;  3ZMK A;  2YJH A;  2QC7 A;  2C0G A;  2GT6 A;  2O7K A;  4HU7 A;  2PN8 A;  5FHI A;  2FA4 A;  1M9A A;  5IQY A;  3C1R A;  2IME A;  3EYT A;  2H1A A;  1AC1 A;  1U87 A;  3DXB A;  5KN3 A;  3RBT A;  2MYG A;  3UJ1 A;  3M8N A;  1DUG A;  1OC9 B;  5HFK A;  2WCI A;  1SYX A;  4YQU A;  1U6T A;  4JR4 A;  4GCI A;  4OO4 A;  1YJ6 A;  2DIY A;  2IFQ B;  4LL4 B;  1M7T A;  5IMF A;  2J9H A;  2B5Y A;  3GH9 A;  2HYX A;  2H73 A;  2WJU A;  2FWG A;  2R3X A;  4X43 A;  4YQV A;  4MJC A;  1WIK A;  1EP8 A;  1S3C A;  4IEL A;  16GS A;  5EPF A;  4F82 A;  4GWR A;  3TRP A;  4ULX A;  3W8S A;  3IA1 A;  3HCZ A;  1RW1 A;  1M0U A;  2EC4 A;  2ZCT A;  1XOB A;  2OAD A;  3TKS E;  2JZS A;  5G5F A;  4G9H A;  2H74 A;  5EVO A;  4I97 A;  4NAX A;  3M9J A;  4XTS A;  2R6K A;  5D9X A;  1SD9 A;  4TN8 A;  3IK9 A;  3FEU A;  4XS4 A;  2CX4 A;  1XVW A;  2R4V A;  3F4R A;  2B7J A;  3GX0 A;  4MAB A;  2DBC A;  4POL A;  2XBI A;  1GLQ A;  2X8C A;  4V2N A;  2O87 A;  4BA7 A;  3HVX A;  1MDI A;  3BOA A;  3L9V A;  4EDZ A;  1JZR A;  3LG6 A;  3G7J A;  2PWJ A;  4HI7 A;  4PUF C;  2GS3 A;  3L9S A;  3EVI A;  4MH3 A;  3N9J A;  3J7Y k;  1GRX A;  4LLR A;  4TKY A;  4ZBD A;  2H6Y A;  4XCS A;  3L0H A;  5EY6 A;  1SKR B;  3HZ4 A;  4J56 E;  2OBI A;  2VM1 A;  4K9Z A;  1S3D A;  2LST A;  4AJ7 A;  5IMD A;  2R37 A;  3ZML A;  1XBS A;  5DBQ A;  4HDE A;  5DAK A;  2GSQ A;  3UL3 A;  3UBL A;  1Y6E A;  3DGQ A;  1A2M A;  2C3N A;  1XCC A;  4IQA A;  2E0Q A;  2YWM A;  4KGI A;  3ZIJ A;  2VUP A;  4LMW A;  4IN0 A;  4K7O A;  1TW9 A;  5CRG A;  2JU5 A;  3O3T A;  2C1Y A;  1SK1 A;  4IJI A;  2DJ2 A;  4K8M A;  3KTL A;  3P7X A;  1ZZY A;  1PX7 A;  3G9B A;  1VF3 A;  4ZB6 A;  3CSI A;  3WT2 A;  3TB2 A;  4K0G A;  5G31 A;  2LQO A;  2L4Q A;  2GQK A;  1G7O A;  3I69 A;  4ZL7 A;  1ML6 A;  1USB A;  3FY7 A;  4QQ7 A;  3KTB A;  2H1G A;  1OAZ A;  3PR8 A;  2LQQ A;  2GZZ A;  2YAN A;  2K18 A;  3KIJ A;  4Q5N A;  3EIN A;  3IHQ A;  2H6Z A;  2DJ3 A;  2YWI A;  5F8B A;  2K6V A;  1HNB A;  3DVX A;  5GSS A;  1XVQ A;  4MA9 A;  5G2Z A;  1BG5 A;  4N0Z A;  1DE1 A;  1K3O A;  4X0X A;  3TJK A;  5DQS A;  1YDK A;  4I6X A;  2N5B A;  2L4C A;  1WOU A;  3O6T A;  5C00 A;  3SBC A;  3GST A;  3HYP A;  2YPM A;  3I6A A;  5CO3 A;  2AUV A;  3CSH A;  4DSQ A;  1A23 A;  1YF0 A;  5CRE A;  4D73 A;  2C4J A;  4TRX A;  2H01 A;  5HR3 A;  1JFU A;  4ZB9 A;  1JLW A;  4HQS A;  1OYJ A;  1F3A A;  3ZLP A;  5ID2 B;  3E3E A;  4JRR A;  3TKR A;  3D5J A;  5ID2 A;  2VCW A;  4YAP A;  2L59 A;  2E2M A;  2NDO A;  3HKR A;  4N30 A;  2GT5 A;  2HE3 A;  1GUL A;  2IL3 A;  2PBJ A;  4J57 E;  19GS A;  1FB0 A;  2CX3 A;  3EWL A;  3V1W A;  2FCH A;  5IMZ A;  1TP9 A;  4OCE A;  4PGT A;  1F37 A;  4N10 A;  1YEP A;  1ZMA A;  4KX4 A;  2CZ3 A;  4KB3 A;  2I9H A;  1FB6 A;  4NWY A;  2C0E A;  2ZNM A;  3EUR A;  3ZFB A;  4XRA A;  5COH A;  3BJ5 A;  4MZB A;  4KW6 A;  3ERF A;  4JU5 A;  2HZF A;  1Y25 A;  1HNA A;  4AF2 A;  2GDR A;  4WXT A;  3GV1 A;  2P5R A;  1JLV A;  2YNX A;  3F6D A;  2L5L A;  3RPP A;  5B8B A;  1THX A;  2X99 A;  2V32 A;  4DSR A;  1T3B A;  2DLX A;  3GSS A;  1TK5 B;  4OD7 A;  2WDU A;  2DC5 A;  4N11 A;  2I4A A;  3TDG A;  3S9F A;  4IQ1 A;  3GUR A;  3HJP A;  1TKD B;  3GN3 A;  4HJ2 A;  2A2R A;  3EU4 A;  4HZ2 A;  5JWR B;  2H71 A;  2HZE A;  5DJL A;  3RAZ A;  5FWG A;  5B7C A;  1SL0 B;  2CA8 A;  14GS A;  1K3Y A;  2MMN A;  4F03 A;  1UVZ A;  2PU9 C;  5A5K A;  2HFD A;  4ECB A;  5DVB A;  2LKU A;  3ISO A;  1VRS D;  4V2L A;  4JBB A;  1ZL9 A;  1XWK A;  1A24 A;  1SL1 B;  3G7I A;  3A5W A;  3E9J B;  4KUN A;  4OO5 A;  4ISD A;  1QK8 A;  4F0C A;  1T8E B;  2E7P A;  2H1B A;  2ZUP A;  3VPT A;  1T00 A;  3LOR A;  2O85 A;  1ERT A;  3UVT A;  4MJB A;  3VLN A;  2E2G A;  3IPZ A;  3KH9 A;  1B4P A;  4ILF A;  5H5Q A;  4IBP A;  1HD2 A;  2HNL A;  4LL1 B;  1SL2 B;  3N5O A;  1TI3 A;  12GS A;  2JAD A;  5HR0 A;  1ZYE A;  4CW9 A;  3MSZ A;  4HJM A;  3HA9 A;  2A4V A;  2DJJ A;  1M2B A;  1GTA A;  5FT3 A;  3C7M A;  2GSS A;  2WUL A;  1B9Y C;  2YWN A;  3OR5 A;  1EOH A;  2NTO A;  3VPQ A;  1MEK A;  3VWX A;  1N8J A;  1GL8 A;  1LBK A;  1E6B A;  2LUS A;  4QL7 A;  1GWC A;  2YN1 A;  1MDK A;  2AAW A;  5D9W A;  2GTU A;  3F63 A;  5J5N A;  2PER A;  3TGZ A;  1GUH A;  1OKT A;  1G6W A;  2XBQ A;  5HQP A;  1H75 A;  1M2D A;  4O5R A;  3GTU B;  1EOG A;  4KDU A;  1SJI A;  3P8W A;  2VCZ A;  4IKH A;  3KGK A;  4IP6 A;  4RQR A;  5G30 A;  2IMD A;  1YZX A;  5ECI B;  1BJX A;  5HR2 A;  1I9D A;  2C80 A;  4LMV A;  2N5A A;  2H0I A;  1JZW A;  4K1F A;  1Z6M A;  3PGT A;  2H75 A;  3L4N A;  1W89 A;  3M9K A;  1URM A;  1XWG A;  2GQM A;  5ECO B;  3ZRE A;  2YZU A;  3WGD A;  1Z7P A;  2V6O A;  4Q5F A;  4GQF A;  4YAV A;  5DJM A;  5JCU A;  4EL1 A;  5GZZ B;  4L5O A;  2DJK A;  3MNG A;  4GLT A;  1E2Y A;  3M1G A;  2KHP A;  4D73 B;  2VOC A;  5CNW A;  3ME8 A;  1NHY A;  1ABA A;  1TRV A;  4O32 A;  3KCM A;  4V1A g;  1AW9 A;  1JZO A;  4PXO A;  3FHK A;  1G0T A;  2P0G A;  4V1A p;  1TK0 B;  2IY2 A;  3ZL5 A;  1PL2 A;  1TRU A;  1M2A A;  4HUA A;  3BBY A;  1ERW A;  3UOM A;  4POB A;  1K0C A;  3TRX A;  4WF4 A;  4IS0 A;  1AQW A;  5H5R A;  3H4K A;  1EGR A;  3QAW A;  5KN0 A;  5IPG A;  3LEF A;  4BWQ A;  3MDK A;  4IVF A;  3W8J A;  3K8N A;  2YV7 A;  4L0W A;  5GST A;  2QSI A;  2VL3 A;  5D73 A;  2LJK A;  4EDY A;  2H6X A;  2CV4 A;  5LCZ A;  3D22 A;  1WWJ A;  1GSD A;  3ZYW A;  3RDW A;  3QR6 A;  4OFN A;  3WYW A;  4ZIL A;  1F2E A;  2I3Y A;  4F9Z A;  1GSU A;  5HFG A;  5CP1 A;  2VM2 A;  3ME7 A;  4MMM A;  3EE2 A;  2XPE A;  6GSU A;  3US3 A;  1IYH A;  4I2U A;  3QD9 A;  1YQ1 A;  2CQ9 A;  4FYU A;  3DEX A;  2YOI A;  1X5C A;  2DML A;  2AJQ B;  4RQX A;  3UMA A;  1BAY A;  2NVL A;  2OKA A;  5IMV A;  1K0M A;  3HZ8 A;  2YZH A;  2K8V A;  1QGV A;  3DVW A;  2X64 A;  2QKE A;  1A0F A;  1GP1 A;  3TJJ A;  3CTG A;  5GAN D;  2RUF A;  1TU8 A;  3APQ A;  1F3B A;  2V6K A;  5CYY A;  4XHM A;  4FIW A;  2OE0 A;  1SKS B;  1CQG A;  3FR6 A;  2VL2 C;  3U5R E;  2LS5 A;  1GLP A;  1G6Y A;  4YH2 A;  2PPT A;  11GS A;  2P31 A;  4TOP A;  1KTE A;  3HXS A;  4NHW A;  2B3S A;  3GKK A;  4KE3 A;  1SJZ A;  2JAC A;  1DE2 A;  2VCV A;  5DAL B;  1RQM A;  4MJE A;  1JZD A;  2L5O A;  6GSY A;  3TUE A;  2MMZ A;  3E0U A;  4MLY A;  5F05 A;  1X0R A;  3WD6 A;  3LGC A;  3QOU A;  3QFB C;  1VGL A;  4ZL9 A;  2YP6 A;  5CRD A;  3IE3 A;  5AIS A;  3ZRD A;  2DMM A;  3GKN A;  1M9B A;  1PD2 1;  3BD2 A;  2CT6 A;  1AXD A;  1K0D A;  1TU7 A;  2CAI A;  3AY8 A;  4ZB8 A;  2YJ7 A;  1EP7 A;  4ID0 A;  5JCW A;  1SEN A;  3BCI A;  1GTB A;  3UBK A;  2TRX A;  5EL8 A;  1FO5 A;  1R4W A;  1EGO A;  5J9B A;  2V2G A;  5KN2 A;  1TJD A;  4X1U A;  2GST A;  3SWL A;  5H5S A;  4Q5Q A;  4OFM A;  5HFI A;  2VD1 A;  3CRU A;  4QL9 A;  1FVJ A;  1YEX A;  4JZQ A;  1HYU A;  4TR4 A;  4FH8 A;  4FYB A;  2L6D A;  4GSN A;  3P90 A;  1T4Z A;  1V57 A;  1YKC A;  3GX8 A;  1O6J A;  3D0Z A;  3TRQ A;  4IJ3 A;  4ZBA A;  1K0A A;  2G0F A;  4MDC A;  3W6G A;  4KDY A;  1A0R P;  1U88 A;  1DBY A;  1ST9 A;  1GSS A;  2OE3 A;  2FWF A;  2REM A;  5A4W A;  1V58 A;  3H79 A;  4MCU A;  3CBU A;  2QGV A;  3QPM A;  1GNE A;  4ZBB A;  2GSR A;  2IYJ A;  3FR9 A;  1TXX A;  1K0O A;  5IM9 A;  1ERV A;  2C8U A;  1TDI A;  3KXO A;  3PIN A;  4PUA A;  5DCH A;  1VF4 A;  3JCM L;  3HHV A;  2F8A A;  3CYN A;  1TRW A;  4DVC A;  2X8H A;  1O85 A;  2X8G A;  5ECM B;  5G1L A;  4E8E A;  2I1U A;  3KH7 A;  4KH7 A;  4PUR A;  4GQC A;  2B5X A;  4TR0 A;  2LJA A;  1Z3E A;  1OC9 A;  2L57 A;  5ECS A;  3M0F A;  2HLS A;  3IBH A;  4NMU A;  1BX9 A;  4ECI A;  1J0F A;  4OWY A;  1ERU A;  1OC3 A;  3IAM 2;  3DKS A;  2WZ9 A;  2B6M A;  4BVY A;  2IJY A;  2IFQ A;  2R5G A;  3L9U A;  3D21 A;  3R2Q A;  1EWX A;  4EF0 A;  3KP9 A;  3ED3 A;  4O7H A;  4MH2 A;  1KEB A;  1XW9 A;  4K7N A;  1GSQ A;  1W4V A;  2DIZ A;  3ZIT A;  4O92 A;  1QMV A;  4CDO A;  2H0G A;  2F51 A;  4WF5 A;  1EEM A;  2Z9S A;  3VWW A;  3ZIV A;  5D96 A;  2RUE A;  5KN1 A;  1TRS A;  1B4Q A;  4OMV A;  4ECJ A;  3VI5 A;  4RUV A;  2K8S A;  4L0U A;  5DAL A;  1X5D A;  2PVQ A;  3F4S A;  4G19 A;  3GH6 A;  1PQN A;  1FAA A;  2TRC P;  5L71 A;  1AAZ A;  1N2A A;  2KOK A;  1T1V A;  5J4U A;  1PX6 A;  2OA7 A;  2MZC A;  2PUK C;  3DD3 A;  3FYG A;  3NOF A;  5ECH B;  1WJK A;  1XWB A;  4TXO B;  3HY2 A;  1T4Y A;  3KP8 A;  6GST A;  2YWO A;  1K0B A;  3LWA A;  2B7K A;  1B8X A;  5JWQ B;  2B1K A;  4I8B A;  2M80 A;  3LXT A;  2IMK A;  1S3A A;  4PQ1 A;  6GSW A;  4MPG A;  1R5A A;  4KSO A;  1XXU A;  2DSA A;  4HEA 2;  5DDL A;  1IYI A;  4AJ8 A;  3GMF A;  22GS A;  1R7H A;  3F4T A;  4PX1 A;  5IOX A;  2CAQ A;  1XZO A;  3KD0 A;  13GS A;  5JCG A;  1ON4 A;  2A2S A;  5ECP B;  3TKQ A;  2EIO A;  3ERG A;  3H1N A;  3IR4 A;  2L6C A;  3CMI A;  3Q6O A;  5F07 A;  5E4W A;  7GSS A;  2VCQ A;  1PSQ A;  3GA4 A;  3GKM A;  4K0N A;  1B9X C;  2FNO A;  2OE1 A;  1ZCP A;  1YY7 A;  1TK8 B;  1NSW A;  1LJR A;  2C0D A;  4EC0 A;  4XS1 A;  5AIX A;  1XWA A;  3HDC A;  2VLT A;  5ABR A;  5KEJ A;  1QQ2 A;  3NZN A;  6GSX A;  1Z9H A;  2NBS A;  2D2Z A;  4KAE A;  5CAX A;  3TJG A;  3ERW A;  5G1K A;  1A8Y A;  3LYP A;  1GTU A;  2JSY A;  2BJX A;  3EMP A;  3C8E A;  4ML6 A;  1X9S B;  1X9M B;  3IAS 2;  4H86 A;  2M46 A;  2J23 A;  4KCE A;  4WBR D;  1A2L A;  2OBK A;  1BYE A;  2H8L A;  3FZ5 A;  3MAK A;  2DJ0 A;  3FZ9 A;  1K0N A;  3QAV A;  1AIU A;  2XHF A;  5IMC A;  1F9M A;  2M72 A;  1PMT A;  5B6M A;  4BL7 A;  3F8U A;  4N0V A;  2FD3 A;  1FOV A;  2FLS A;  5GAP D;  3IXR A;  4K2D A;  2VO4 A;  2KLX A;  3Q74 A;  1QFN A;  4MJA A;  4GTU A;  4JR6 A;  3FR3 A;  3TOU A;  1PL1 A;  3CSJ A;  3FZ4 A;  4PNF A;  3KM6 A;  2EIQ A;  2FWE A;  5IO0 A;  1XW6 A;  2K9F A;  1QXH A;  3GTU A;  5G5E A;  3UEM A;  1XIY A;  1Q98 A;  4ZL8 A;  1O8W A;  4HU9 A;  4NV5 A;  4HZ4 A;  4EKZ A;  2HSY A;  1MDJ A;  5DCG A;  2WRT A;  4MPF A;  5IPH A;  2F3M A;  3C71 A;  3F3R A;  1A8L A;  1Z7R A;  3GL3 A;  4EXJ A;  5AGY A;  1ILO A;  1V2A A;  5LNK e;  4TXV A;  2F8F A;  2IMI A;  4DEJ A;  1EZK A;  3H93 A;  4DSS B;  3QCP A;  2HRF A;  4XRD A;  3RHC A;  2B5E A;  3LSZ A;  4XS4 B;  2LRC A;  1ZGN A;  3CXG A;  1Q4J A;  2MBS A;  2ON5 A;  1VF1 A;  4XIH A;  10GS A;  1TOF A;  2GQL A;  5A4V A;  3IV4 A;  4L8E A;  3FK8 A;  5D93 A;  2PMT A;  1GUK A;  2VAF A;  4PQH A;  3LQ7 A;  2O89 A;  4WET A;  2NPB A;  17GS A;  1PA3 A;  4ECC A;  5ELA A;  3FW2 A;  3BCK A;  3IDV A;  2FWH A;  3ZZX A;  3HVS A;  4I2T A;  2C3T A;  1AQV A;  3A2V A;  3U6V A;  2IN3 A;  1Z5Y E;  4MF7 A;  3TOT A;  4BVX A;  3D4M A;  4MZC A;  3HJO A;  1OE8 A;  4GSS A;  2RLI A;  8GSS A;  1BED A;  4POK A;  1C72 A;  3VWV A;  1QUW A;  1ZYQ B;  2V41 A;  2GZY A;  2RM5 A;  1VF2 A;  3HD5 A;  3NIV A;  5F06 A;  1T7P B;  3TKP A;  2V1M A;  2ES7 A;  3Q18 A;  4MK3 A;  5E59 A;  3VK9 A;  2KP1 A;  1PKW A;  1WRY A;  2WB9 A;  4NV2 A;  1PN9 A;  5IMA A;  1SU9 A;  3EMX A;  1K3L A;  3DRN A;  4L5L A;  1O8X A;  5HR1 A;  2HXK A;  3UIW A;  4KA0 A;  1O7U A;  3GNJ A;  1GTI A;  4WKW A;  1PGT A;  1FG4 A;  3D4T A;  2WGR A;  2F9S A;  3F0I A;  2FY6 A;  3F6F A;  2AHE A;  4ML1 A;  3GFK A;  4WEY A;  1OKD A;  2PGT A;  4E8H A;  4G10 A;  5JWO B;  2VCX A;  1KNG A;  2LEG A;  4HOJ A;  2H19 A;  1NHO A;  2XPD A;  4AGS A; 
#chains in the Genus database with same CATH topology
 4BTW A;  2C4B A;  2WFC A;  4Q5R A;  4GRF A;  4GXZ A;  2YV9 A;  2XF3 A;  1A2J A;  1UN2 A;  1FGO A;  6STD A;  5BXQ A;  2BTO T;  3KCH A;  3H51 A;  1DYU A;  1YF1 A;  4IP1 A;  4QWT A;  1O7H B;  1X5E A;  9GSS A;  3URP A;  3GRX A;  3VI7 A;  2VL9 A;  1KBN A;  2R2J A;  4L8O A;  3UB1 A;  1YVB I;  2AB6 A;  3IC4 A;  1XFL A;  2FHE A;  4N6V 0;  3FLJ A;  4J2F A;  4Z7X A;  5D9V A;  2IIY A;  1EEJ A;  1UA5 A;  4O8S A;  1IDP A;  1XWC A;  4PQI A;  3D6I A;  5LD0 A;  2W9P A;  4HS1 A;  2BMX A;  1JBR A;  3DYR A;  3UAP A;  3CCS 3;  1AQX A;  1I3F A;  1GSY A;  3FZA A;  3I43 A;  3CTF A;  4STD A;  1THO A;  2W56 A;  2OAC A;  1RNT A;  4HOH A;  1VQ6 3;  1LQG C;  1T5Y A;  3EC3 A;  3OWU A;  3WOF B;  2IA7 A;  3TJF A;  4HM1 B;  2O8V B;  1OVN A;  3VSY A;  3DML A;  5D8I A;  1EUI C;  5DRV A;  1LU4 A;  1GNW A;  2H76 A;  4KT3 B;  3JUN A;  1HKX A;  2W03 A;  3UAR A;  1GSP A;  6RNT A;  2LJR A;  1W2B 2;  1VQL 3;  3T8U A;  1TI1 A;  3TKS C;  3QDN A;  1XOA A;  2H72 A;  4WBJ A;  3D5G A;  4LA1 A;  5ENU A;  2CK3 H;  2C3Q A;  1SJ6 A;  4USS A;  1E97 A;  5CK6 A;  4EE0 A;  3ZVJ A;  3K0Z A;  1WPI A;  3U1W A;  1WMO A;  3CQF A;  5KP3 A;  3G8Z A;  1FUW A;  4F2I A;  2GU3 A;  1I5G A;  2KF6 A;  3D9R A;  4EYC A;  1G7E A;  4ACS A;  4XS6 A;  1OC8 A;  2J8X B;  4EV5 A;  1LOX A;  2AV4 A;  3QAG A;  5J9C A;  2XEP A;  2FGX A;  3DIE A;  4OCF A;  5ECL B;  2F56 A;  3BB9 A;  1QMA A;  4K2X A;  1BRJ A;  1WP0 A;  2HZE B;  2LTK A;  4NHZ A;  4WR4 A;  4ORL A;  1N9E A;  3A76 A;  3VWU A;  1E3R A;  4RI6 A;  3DWV A;  1L5G B;  2H70 A;  3HVV A;  2FA8 A;  2QA1 A;  1FW1 A;  4ZIJ A;  1R5P A;  1BNS A;  4POM A;  20GS A;  3F9U A;  1KWI A;  1FA3 A;  1VQN 3;  4I5Q A;  1GSF A;  1Z6N A;  4G2E A;  3CRT A;  1EV4 A;  3GYK A;  3X3Z A;  4Z2T A;  1JN5 A;  2KUC A;  4HQZ A;  2GLR A;  3KEB A;  4CDL A;  3IK7 A;  3QMX A;  1HNC A;  1U3A A;  1XW5 A;  1NW2 A;  1I2E A;  1J08 A;  3MHE A;  1JJ2 2;  3A3T A;  4WR5 A;  2HSH A;  1MD4 A;  5CRH A;  1PY3 A;  2MMA A;  2B1L A;  2P5Q A;  5A0O B;  2VIM A;  1SKW B;  1GUM A;  2LV3 A;  5A4U A;  4WYK A;  3KZQ A;  1OF5 A;  2CVK A;  3WGX A;  4MF6 A;  1DMM A;  3DGN A;  1YKA A;  4JE1 A;  4DSS A;  4GF0 A;  6GSV A;  2VLV A;  1MD3 A;  1BSE A;  4EVM A;  1UUW B;  3KMN A;  2MF7 A;  1FHE A;  4I4K A;  4YQM A;  1O81 A;  1O73 A;  4G1M B;  2H66 A;  3H8Q A;  2GVP A;  1BSD A;  4RI7 A;  5D9T A;  2MBT A;  1BQ7 A;  2HT9 A;  3D79 A;  1SJW A;  4P3Y B;  2P38 A;  1HYF A;  2IPA A;  1WE0 A;  4MZW A;  1D6Y A;  1TP6 A;  3IRA A;  3NM7 A;  3MWH A;  4IW9 A;  3LH4 A;  1M99 A;  3KSE D;  2K3D A;  3WA3 A;  2I81 A;  1FVK A;  3KMO A;  2CVD A;  1TFO A;  4EO3 A;  5ELG A;  4F0B A;  4GB5 A;  2GZP A;  4ZM8 A;  1B2S A;  3IOS A;  1X9W B;  4K7I A;  4NPB A;  4K6X A;  5IEP A;  3TKS A;  4NXI A;  3RHB A;  3WT1 A;  1OE7 A;  3LYK A;  2WS2 A;  5STD A;  3APO A;  3CNM A;  1SII A;  3NHX A;  1MGR A;  4TR1 A;  2C0F A;  1GH2 A;  2CZ2 A;  1MWR A;  3RGA A;  1H4O A;  3HJM A;  2EIR A;  2H30 A;  1ZOF A;  4FYC A;  3VFI A;  5ECN B;  3V98 A;  3GUS A;  4R9K A;  3M3M A;  3AMO B;  2JL4 A;  1C54 A;  1JHB A;  2DKI A;  5AI1 A;  7GSP A;  1PRX A;  2KP2 A;  4IHU A;  3LOY A;  1UC7 A;  2N5F A;  3Q19 A;  1FGQ A;  3MSO A;  5INY A;  2HOH A;  3P2A A;  4ZXG A;  3TJB A;  3AMO A;  4BVX B;  3CMA 3;  4KCA A;  4BTY A;  4TVE A;  3A2X A;  4HSC X;  3OWY A;  3QFA C;  1OPY A;  5ECK B;  1RK4 A;  4MF5 A;  3APS A;  2IMF A;  5C04 A;  3LFL A;  3TCO A;  1B2U A;  2CWU A;  1RN7 A;  3I9V 2;  1SK2 A;  4CHS A;  2W2C A;  4JED A;  1BRI A;  5ECQ B;  1R26 A;  2CVB A;  1RGG A;  3Q3F A;  1TTZ A;  4IGJ A;  3F3Q A;  4BPY A;  2GGT A;  2CC3 A;  6GSS A;  4XBY A;  3VUR A;  1B48 A;  5J41 A;  4N3V A;  1IQ8 A;  2HI7 A;  2PVO C;  1XPV A;  3DH2 A;  2H1D A;  2VD0 A;  1VQQ A;  1PFP A;  3LZA A;  2H0H A;  3KII A;  1EKM A;  1TFK A;  3EN8 A;  1UGH I;  4OFT A;  1J9B A;  5IW9 A;  4FCZ A;  3CCU 3;  2RII A;  2ON7 A;  2TIR A;  2FUG 2;  1KQS 2;  4KFD A;  3C1S A;  1GSE A;  4TXO A;  2LNS A;  5J3R A;  1BNJ A;  3BIR A;  1DSB A;  4XBT A;  4KDX A;  1BNR A;  3FKF A;  1Q40 A;  1CQH A;  3KZT A;  1V40 A;  2CWV A;  1AUC A;  1PFO A;  3LJR A;  3ZVJ D;  2VCT A;  2WGQ A;  4WFO A;  1US1 A;  5FGO A;  2G2Q A;  1LQM B;  4TR3 A;  1SD8 A;  1BOX A;  2Z77 A;  5B6N A;  3GL5 A;  4BIR A;  2XR8 B;  5DQY A;  2OJL A;  3FG1 A;  5B8A A;  1K28 A;  3LXZ A;  2RNT A;  3ZFL A;  1FGR A;  3VF1 A;  3GHA A;  3GSP A;  3PH9 A;  2HMJ B;  1JB5 A;  2JSZ A;  1SPU A;  1NM3 A;  5IIZ A;  1U3I A;  3L78 A;  3J7Y b;  1MTC A;  2ALB A;  1JV2 B;  3C73 A;  5CRW A;  1V98 A;  4MP4 A;  4BWS A;  2CWT A;  1KC8 4;  1F6M C;  3A2W A;  2OTJ 3;  4KND A;  3GKX A;  4TR1 B;  3WGE A;  2VL2 A;  5IO2 A;  1OUN A;  4KSM A;  2AYT A;  5IOW A;  4PNG A;  4R80 A;  1SK0 A;  3RPN A;  2DJ1 A;  4HM7 B;  1ACV A;  2LNT A;  4K1V A;  3GIX A;  3D5I A;  1BAO A;  5F0G A;  4BVY B;  2SAR A;  2IWT A;  3S5C A;  5ECR B;  1PKZ A;  4FO5 A;  2R41 A;  4EUY A;  5DAK B;  2ML6 A;  1HQO A;  3O76 A;  4GST A;  1AVL A;  2JZR A;  4MMZ B;  3ZTL A;  2VLU A;  3EU3 A;  2MMO A;  3KJY A;  2YCD A;  3DGY A;  2HRN A;  3RGR A;  2JZT A;  2GU1 A;  3UVH A;  1UUV B;  7STD A;  2LRN A;  2XC2 A;  3M8C A;  2CFG A;  5AIV A;  1K73 4;  1WMJ A;  2CFW A;  5KP4 A;  3CPW 2;  1V9W A;  4RBN A;  4BIK A;  1SYR A;  4EIQ A;  4XDV A;  1EV9 A;  1GOV A;  3DZL A;  1RNB A;  2RM6 A;  5AN1 A;  1M3J A;  4V2M A;  4TW5 A;  2LRT A;  3FRC A;  4GSP A;  3G7Y A;  18GS A;  4AJ6 A;  2QEX 3;  3ZMK A;  5IG4 A;  4HYZ A;  3IPT A;  3K9M C;  2YJH A;  2QC7 A;  1MWT A;  4N6U A;  2C0G A;  1GOU A;  4LGQ A;  1RGE A;  1ZGX A;  2GT6 A;  1BNE A;  2O7K A;  4JF8 A;  4HU7 A;  2GBW B;  2PN8 A;  5FHI A;  1RGL A;  4KFF A;  1M9A A;  2FA4 A;  1ROV A;  5IQY A;  4LZI A;  3C1R A;  2KF4 A;  2IME A;  3EYT A;  2XRX B;  2H1A A;  3CCR 3;  1AC1 A;  1U87 A;  1RLS A;  3DXB A;  5KN3 A;  2CW9 A;  3RBT A;  2MYG A;  1BRS A;  3UJ1 A;  3M8N A;  1DUG A;  1OC9 B;  3FG3 A;  5HFK A;  1UW1 A;  1MOL A;  2QA2 A;  1NNV A;  2WCI A;  3EC9 A;  1SYX A;  5KOX A;  4YQU A;  2BNG A;  1JN5 B;  1U6T A;  1B2M A;  5AIH A;  4JR4 A;  4GCI A;  1GD4 A;  1M1K 4;  4OO4 A;  5AYR B;  1YJ6 A;  1CQS A;  2DIY A;  3NV0 A;  4O2H A;  2IFQ B;  1PU4 A;  4LL4 B;  1GMR A;  2Y74 A;  3SX1 A;  1M7T A;  5IMF A;  2J9H A;  2OTL 3;  1TU5 A;  2B5Y A;  3GH9 A;  1MNL A;  2HYX A;  2H73 A;  2WJU A;  3H3H A;  2FWG A;  2RFR A;  2R3X A;  1UI8 A;  2FNQ A;  4X43 A;  4YQV A;  4MJC A;  1VQ9 3;  1WIK A;  1EP8 A;  2BIR A;  1S3C A;  4IEL A;  16GS A;  1GY6 A;  5EPF A;  4F82 A;  4GWR A;  3TRP A;  4ULX A;  3DGM A;  3NM2 A;  1K8A 4;  2UX0 A;  3W8S A;  3IA1 A;  1W01 A;  3NXJ A;  3B4O A;  1FGT A;  3HCZ A;  1RW1 A;  1M0U A;  5CF1 A;  2EC4 A;  2ZCT A;  1XOB A;  1JBT A;  2OAD A;  3TKS E;  1RSN A;  2JZS A;  5G5F A;  4G9H A;  2H74 A;  5EVO A;  4I97 A;  4LSO A;  3G71 3;  3M9J A;  2E2V A;  4NAX A;  1GY5 A;  4XTS A;  2R6K A;  5D9X A;  3AGN A;  1SD9 A;  2YFJ B;  1Z1S A;  4OUQ A;  4TN8 A;  3IK9 A;  2INX A;  3FEU A;  4XS4 A;  2CX4 A;  1XVW A;  2R4V A;  1LVN A;  1QJG A;  2B7J A;  3F4R A;  3GX0 A;  4MAB A;  2DBC A;  1JKG B;  4POL A;  2XBI A;  1GLQ A;  2HMM B;  2X8C A;  4V2N A;  2O87 A;  1FYS A;  4BA7 A;  4HM0 B;  2Z6B A;  3HVX A;  3CXC 2;  3F8H A;  2CFK A;  3EN1 B;  1MDI A;  3BOA A;  3L9V A;  4EDZ A;  1JZR A;  2F5M A;  3LG6 A;  3G7J A;  1FUS A;  2PWJ A;  4HI7 A;  4PUF C;  2GS3 A;  3L9S A;  5CF2 A;  3SYU A;  3EVI A;  4MH3 A;  3N9J A;  1I3I A;  3J7Y k;  1OHP A;  1GRX A;  4LLR A;  1IQY A;  4TKY A;  5KP1 A;  4HAA A;  4ZBD A;  6GSP A;  4FMD A;  2H6Y A;  4XCS A;  3L0H A;  5EY6 A;  4EIP A;  3DMC A;  1SKR B;  3HZ4 A;  1M9G A;  4J56 E;  2OBI A;  2VM1 A;  4K9Z A;  1S3D A;  2LST A;  4AJ7 A;  5IMD A;  2R37 A;  3ZML A;  1XBS A;  5DBQ A;  3CCJ 3;  4HDE A;  5DAK A;  1NU3 A;  2GSQ A;  2ZA4 A;  3UL3 A;  3LML A;  4KVH A;  3UBL A;  1Y6E A;  3DGQ A;  1BUQ A;  3T0U A;  3JUQ A;  1A2M A;  2BMQ B;  1XCC A;  3J7Y d;  2C3N A;  4BL3 A;  4IQA A;  2E0Q A;  1YHQ 3;  2YWM A;  4KGI A;  3ZIJ A;  2VUP A;  4LMW A;  4IN0 A;  3CC2 3;  1YI2 3;  4K7O A;  1TW9 A;  5CRG A;  1J2B A;  4RNT A;  4YKG A;  3GWR A;  5JBS A;  2JU5 A;  2ML5 A;  3O3T A;  2C1Y A;  1SK1 A;  4IJI A;  2DJ2 A;  4K8M A;  3KTL A;  3P7X A;  1ZZY A;  1PX7 A;  4WWU C;  3G9B A;  1VF3 A;  3D3L A;  4ZB6 A;  3CSI A;  3WT2 A;  1GYB A;  3TB2 A;  4K0G A;  2D1W A;  1RMS A;  2LQO A;  5G31 A;  2L4Q A;  2GQK A;  5ELJ A;  1G7O A;  3NQY A;  3I69 A;  4ZL7 A;  1ML6 A;  3OX9 A;  3U97 A;  1USB A;  3FY7 A;  4QQ7 A;  3KTB A;  5IEO A;  2H1G A;  1OAZ A;  3PR8 A;  2LQQ A;  2GZZ A;  1W02 A;  2YAN A;  2K18 A;  3KIJ A;  4Q5N A;  3LXU X;  1LOV A;  2KAA A;  3EIN A;  3IHQ A;  3FF0 A;  2H6Z A;  5TGN A;  2DJ3 A;  2YWI A;  5F8B A;  2K6V A;  3B7C A;  1HNB A;  1VZZ A;  2C10 A;  3DVX A;  2GXF A;  5GSP A;  5GSS A;  4O3V A;  1XVQ A;  3CNX A;  4MA9 A;  1KD1 4;  1D6Z A;  5G2Z A;  1UCL A;  1BG5 A;  4N0Z A;  1DE1 A;  4MEI A;  1K3O A;  4X0X A;  4BL7 B;  3TJK A;  5DQS A;  1YDK A;  4I6X A;  1T2I A;  3CC7 3;  2N5B A;  4BU4 A;  2L4C A;  1WOU A;  3O6T A;  2B1X B;  5C00 A;  1W5Z A;  3SBC A;  3GST A;  3HYP A;  2YPM A;  2BO9 B;  3I6A A;  2BMR B;  5CO3 A;  1BAN A;  3G6E 3;  2AUV A;  1IVU A;  3CSH A;  4DSQ A;  1A23 A;  1VQ7 3;  1YF0 A;  5CRE A;  4D73 A;  2C4J A;  5DRE A;  2GEX A;  4TRX A;  2H01 A;  5HR3 A;  1JFU A;  4LMI A;  4ZB9 A;  4O5Q A;  4N6T A;  1JLW A;  4HQS A;  3ER7 A;  1RGH A;  2X4A A;  1RCL A;  1OYJ A;  1F3A A;  1ZX2 A;  3ZLP A;  3GZR A;  1AVK A;  5ID2 B;  1O7W B;  3E3E A;  3IMA B;  1BSB A;  1UGI A;  4JRR A;  3AHW A;  3TKR A;  1PN0 A;  3D5J A;  5ID2 A;  3S67 A;  1IV9 A;  2XGL A;  2VCW A;  4YAP A;  5CXO A;  1U8C B;  1LXE A;  2L59 A;  2E2M A;  3UL6 A;  3EHC A;  2NDO A;  3HKR A;  4N30 A;  7RNT A;  4R9L A;  1W4N A;  2GT5 A;  2HE3 A;  4G0I A;  1GUL A;  3BU4 A;  2IL3 A;  2PBJ A;  4J57 E;  4JRF A;  19GS A;  1FB0 A;  2CX3 A;  3EWL A;  3V1W A;  2HRK A;  2FCH A;  5IMZ A;  1TP9 A;  2MC8 A;  4OCE A;  1B2Z A;  4PGT A;  1CYV A;  1F37 A;  4N10 A;  1YEP A;  3LT9 A;  1O7N B;  1ZMA A;  4KX4 A;  2WGO A;  2WOH A;  3ZG5 A;  2CZ3 A;  1XG8 A;  4KB3 A;  3JUO A;  1BVI A;  2I9H A;  1FB6 A;  4RNY A;  4NWY A;  2C0E A;  2ZNM A;  3EUR A;  3ZFB A;  1WMN A;  1TRQ A;  4X2O A;  4XRA A;  3BJ5 A;  4MZB A;  2BHM A;  5COH A;  4KW6 A;  3ERF A;  4JU5 A;  2HZF A;  5IG0 A;  1GOY A;  3NBR A;  1Y25 A;  1HNA A;  4AF2 A;  2GDR A;  4WXT A;  3GV1 A;  1GMP A;  5IEN A;  2P5R A;  1JLV A;  2YNX A;  3F6D A;  2L5L A;  2Z76 A;  3RPP A;  3HIG A;  5B8B A;  1THX A;  2X99 A;  2V32 A;  4DSR A;  4Z2U A;  1BSC A;  1RGC A;  1T3B A;  1DMN A;  2DLX A;  3GSS A;  1I2F A;  4KFE A;  4OD7 A;  1TK5 B;  2WDU A;  2DC5 A;  2L1S A;  2BU4 A;  2LQV A;  1A67 A;  4N11 A;  1JRQ A;  2I4A A;  3TDG A;  1IYY A;  3S9F A;  4IQ1 A;  5EVH A;  3GUR A;  3HJP A;  2D42 A;  1JBS A;  1TKD B;  3GN3 A;  1X1U A;  4HJ2 A;  2Q07 A;  2A2R A;  2SBL A;  3EU4 A;  4HZ2 A;  5JWR B;  4GL6 A;  2H71 A;  2HZE A;  2F4Y A;  2OQE A;  5DJL A;  3RAZ A;  5FWG A;  5B7C A;  1SL0 B;  1NB3 I;  2CA8 A;  1DVC A;  14GS A;  1K3Y A;  2MMN A;  4FQU A;  4F03 A;  1UVZ A;  1LRA A;  1YNV X;  4N6M A;  2KXG A;  2PU9 C;  5A5K A;  2HFD A;  4ECB A;  2XGN A;  4CPK A;  3CCQ 3;  3CCE 3;  1IVW A;  4HBR A;  5DVB A;  1RGK A;  2LKU A;  3ISO A;  1VRS D;  4V2L A;  4JBB A;  1ZL9 A;  1XWK A;  1A24 A;  1SL1 B;  1MGW A;  1OGZ A;  1YIJ 3;  3G7I A;  3A5W A;  3E9J B;  4NHF A;  4KUN A;  4OO5 A;  1N5P A;  4ISD A;  1QK8 A;  1Q9E A;  4WP5 A;  4F0C A;  1T8E B;  2E7P A;  2H1B A;  2ZUP A;  3VPT A;  2OOV C;  1T00 A;  3X3Y A;  3LOR A;  2CG0 A;  2O85 A;  1ERT A;  3UVT A;  1TUH A;  1A2V A;  1X1Y A;  1UDI I;  3N9H A;  4MJB A;  3VLN A;  2R0C A;  2E2G A;  3IPZ A;  3KH9 A;  1B4P A;  4ILF A;  5H5Q A;  4IBP A;  1HD2 A;  4IT7 A;  2HNL A;  4LL1 B;  1SL2 B;  3N5O A;  3AHS A;  1TI3 A;  1B20 A;  4G0K A;  12GS A;  2JAD A;  5HR0 A;  1ZYE A;  4CW9 A;  3MSZ A;  4HJM A;  1G96 A;  3HA9 A;  4EBG A;  4H3U A;  3OXA A;  2A4V A;  3G16 A;  2DJJ A;  4ICY A;  1MWS A;  1M2B A;  1GTA A;  1FOH A;  5FT3 A;  3C7M A;  5BRT A;  3G0K A;  2GSS A;  2WUL A;  2W9Q A;  2K54 A;  1B9Y C;  2YWN A;  3JUP A;  3OR5 A;  1RGF A;  1EOH A;  2K0M A;  2NTO A;  3VPQ A;  1RKY A;  1MEK A;  4KF9 A;  1N8J A;  3VWX A;  1GL8 A;  1LBK A;  1Q7Y 4;  1E6B A;  2LUS A;  4QL7 A;  1S5A A;  1GWC A;  2YN1 A;  2QGU A;  4K61 A;  4WHA A;  2GSP A;  1MDK A;  1UCJ A;  3LTD A;  1GS3 A;  2AAW A;  5D9W A;  2GTU A;  4CY6 A;  3F63 A;  5J5N A;  2PER A;  3MYD A;  4N6L A;  3A5I A;  3TGZ A;  1GUH A;  2F98 A;  1OKT A;  1BU4 A;  4TX4 A;  1G6W A;  2XBQ A;  5HQP A;  5BU4 A;  1H75 A;  1M2D A;  4O5R A;  3GTU B;  1LNH A;  1EOG A;  2FGT A;  1E3V A;  4KDU A;  1SJI A;  1RDS A;  1MWU A;  5AYS C;  4FR9 A;  3P8W A;  2VCZ A;  2YFI B;  3GZX B;  3CME 3;  3DGO A;  4IKH A;  3F14 A;  3KGK A;  3GZB A;  4IP6 A;  2X49 A;  4RQR A;  3PYJ A;  5G30 A;  1GMQ A;  2HMN B;  3F7S A;  3RNT A;  2IMD A;  1YZX A;  4MMY B;  5ECI B;  1QAK A;  2Y73 A;  3EQQ B;  1BJX A;  2W56 B;  1NDO B;  5HR2 A;  1OF5 B;  1IV7 A;  4BL2 A;  1I9D A;  2C80 A;  4LMV A;  2N5A A;  4OK0 A;  1KSI A;  3Q1C A;  2H0I A;  1K9M 4;  1JZW A;  3HK4 A;  1OHO A;  4K1F A;  1Z6M A;  3PGT A;  2H75 A;  3L4N A;  4H61 A;  1W89 A;  1N5H A;  4AKZ A;  2YFL B;  3LTA A;  3M9K A;  1URM A;  1XWG A;  2GQM A;  5ECO B;  3ZRE A;  2YZU A;  3IJE B;  3WGD A;  3FKA A;  3SVA A;  1Z7P A;  3O8Y A;  3KE7 A;  2V6O A;  4GQF A;  4Q5F A;  4YAV A;  1RGA A;  3EB8 A;  5DJM A;  5JCU A;  1BIR A;  3ALA A;  4EL1 A;  5GZZ B;  3MPH A;  2AAE A;  4L5O A;  3ZFZ A;  3CCM 3;  2DJK A;  3BNB A;  3MNG A;  3FG4 A;  4GLT A;  1E2Y A;  1RN1 A;  3M1G A;  3X41 A;  4NRE A;  2KHP A;  4R4K A;  4D73 B;  4LEH A;  2VOC A;  1TIJ A;  1RCK A;  2XFT A;  5CNW A;  3ME8 A;  3NQZ A;  1FW7 A;  1NHY A;  1ABA A;  1TRV A;  4O32 A;  1UUG B;  2JDI H;  3KCM A;  4V1A g;  4XM4 A;  2W6J H;  2LYX A;  1AW9 A;  5D83 A;  1JZO A;  4PXO A;  3LYG A;  3HOH A;  3FZW A;  3SLU A;  3FHK A;  3EX9 A;  1G0T A;  1GD3 A;  2P0G A;  4V1A p;  1TK0 B;  2IY2 A;  1X1X A;  4N6O B;  3ZL5 A;  1PL2 A;  1TRU A;  1M2A A;  4XBX A;  1WQL B;  3BBY A;  1ERW A;  4HUA A;  3UOM A;  4POB A;  1K0C A;  1Y4K A;  3TRX A;  4WF4 A;  3EBY A;  3T8N A;  4IS0 A;  4WYK B;  1AQW A;  5H5R A;  3H4K A;  1EGR A;  3D4A A;  3QAW A;  1OGX A;  5KN0 A;  5IPG A;  3LT8 A;  3LEF A;  4BWQ A;  5AIF A;  3MDK A;  4IVF A;  2BMO B;  1BNG A;  3W8J A;  1EA2 A;  3K8N A;  1FGM A;  2YV7 A;  2M7O A;  4L0W A;  2DKH A;  5IG3 A;  5GST A;  3PPU A;  2PNC A;  2QSI A;  2GBX B;  3GRD A;  2VL3 A;  4Q53 A;  5D73 A;  2R0G A;  2LJK A;  4EDY A;  2H6X A;  2KF5 A;  2CV4 A;  5LCZ A;  3D22 A;  1WWJ A;  4HM3 B;  4K1U A;  1GSD A;  3ZYW A;  3RDW A;  3WA2 X;  3QR6 A;  3MKI A;  4OFN A;  2OWP A;  3WYW A;  2KRT A;  4ZIL A;  4OVM A;  1F2E A;  2I3Y A;  4F9Z A;  1GSU A;  5HFG A;  4EC6 A;  1LOW A;  5CP1 A;  1WTH A;  1T2H A;  3NBJ A;  1DE3 A;  2VM2 A;  4R1K A;  3ME7 A;  4MMM A;  4FMB A;  3EE2 A;  2XPE A;  3DGL A;  3IC8 A;  1UCK A;  6GSU A;  3US3 A;  1O7P B;  1IYH A;  4I2U A;  4HZB B;  1YQ1 A;  4FCM A;  3QD9 A;  4Z2R A;  2CQ9 A;  1VQ5 3;  2F5W A;  4FYU A;  3DEX A;  3MWZ A;  2YOI A;  3GAX A;  1X5C A;  2DML A;  2AJQ B;  1M3I A;  4PEJ A;  4RQX A;  3UMA A;  1BAY A;  1JKG A;  3X40 A;  2NVL A;  2OKA A;  1VQO 3;  1K0M A;  5IMV A;  1BRH A;  3HZ8 A;  2YZH A;  3N8B A;  2K8V A;  4HM8 B;  1SQW A;  1QGV A;  3DVW A;  2X64 A;  2QKE A;  2O3O A;  1A0F A;  1FZU A;  5LC7 A;  3BLZ A;  1I8V A;  1GP1 A;  3UNL A;  3TJJ A;  3CTG A;  5GAN D;  3SXX A;  2RUF A;  1TU8 A;  3APQ A;  4J5G A;  3SOA A;  1F3B A;  3LW9 A;  2V6K A;  5CYY A;  2CHC A;  3OW2 2;  4XHM A;  1AV4 A;  4FIW A;  2OE0 A;  3HZP A;  1SKS B;  1CQG A;  2FXT A;  1YIT 3;  3FR6 A;  2VL2 C;  3U5R E;  2LS5 A;  3QRD A;  1GLP A;  1TTO A;  1G6Y A;  1ZYP A;  4YH2 A;  9RNT A;  3EBT A;  1IT8 A;  5G2G A;  2PPT A;  11GS A;  2P31 A;  2STD A;  4TOP A;  1KTE A;  3HXS A;  4NHW A;  5M18 A;  2B3S A;  2PZV A;  3GKK A;  4KE3 A;  1SJZ A;  2JAC A;  1DE2 A;  2IUK A;  3NUV A;  5AEU B;  2VCV A;  5DAL B;  1DET A;  1RQM A;  4MJE A;  1JZD A;  2L5O A;  3WHO A;  1Q40 B;  6GSY A;  3TUE A;  2MMZ A;  1QAL A;  2HRA A;  3E0U A;  4MLY A;  2F99 A;  8RNT A;  5F05 A;  2V1L A;  3GZY B;  1X0R A;  3WD6 A;  3LGC A;  3QOU A;  2B24 B;  1RTU A;  3QFB C;  1EG9 B;  1VGL A;  4HM6 B;  4ZL9 A;  2YP6 A;  5CRD A;  3IE3 A;  5AIS A;  4U13 A;  2DMM A;  5EQL A;  1W00 A;  3GKN A;  3ZRD A;  1M9B A;  1PD2 1;  2GEY A;  3KKG A;  4FCJ A;  2CT6 A;  3BD2 A;  1AXD A;  1K0D A;  4HJL B;  1TU7 A;  2CAI A;  3AY8 A;  4ZB8 A;  2YJ7 A;  5IER A;  1DVD A;  1BNI A;  2L4V A;  3PXM A;  2KF3 A;  1EP7 A;  1TRP A;  2UGI A;  4ID0 A;  3HI7 A;  5JCW A;  1SEN A;  3BCI A;  1GTB A;  3UBK A;  5CLK A;  3STD A;  2TRX A;  5EL8 A;  1FO5 A;  1R4W A;  1EGO A;  5J9B A;  2RCD A;  2V2G A;  1R4Y A;  1M90 4;  1C7H A;  5KN2 A;  1TJD A;  1I2G A;  4X1U A;  2XH9 A;  5M1A A;  3LTC A;  5AII A;  2GST A;  3SWL A;  5H5S A;  4Q5Q A;  4OFM A;  5HFI A;  2VD1 A;  3CRU A;  4QL9 A;  1FVJ A;  1BRG A;  1YEX A;  4J8T A;  1HYU A;  2A4H A;  4FH8 A;  4FYB A;  3F7X A;  2L6D A;  4JZQ A;  4GSN A;  4TR4 A;  3P90 A;  1T4Z A;  1YJ9 3;  2CG1 A;  1V57 A;  1Q86 4;  1YKC A;  3DM8 A;  3GX8 A;  1O6J A;  1A2K A;  3D0Z A;  3TRQ A;  4IJ3 A;  4ZBA A;  1K0A A;  3VGN A;  2G0F A;  4FMA A;  3DUK A;  4J9A A;  4MDC A;  5M19 A;  3W6G A;  5IF6 A;  1IK3 A;  4KDY A;  1A0R P;  1U88 A;  1B27 A;  3N54 B;  4EV2 A;  1DBY A;  2P0M A;  1ST9 A;  3V92 A;  1GSS A;  2OE3 A;  2FWF A;  2REM A;  3EPT A;  5A4W A;  1V58 A;  3H79 A;  4MCU A;  3X3X A;  3CBU A;  1N9J A;  4HVN A;  2QGV A;  3QPM A;  1GNE A;  4ZBB A;  1V74 A;  2GSR A;  2IYJ A;  1IU7 A;  3FR9 A;  1TXX A;  5AEW B;  3MG3 A;  1K0O A;  5BVB A;  5IM9 A;  2KCD A;  1ERV A;  2C8U A;  1TDI A;  3KXO A;  3PIN A;  3CCL 3;  4PUA A;  5DCH A;  1VF4 A;  1JNQ A;  1IVV A;  3AGO A;  3JCM L;  2W0Q A;  4K90 B;  2F8A A;  3HHV A;  5BMU A;  3CYN A;  1TRW A;  5D81 A;  3I55 3;  4DVC A;  5BIR A;  3G4S 3;  2QIY A;  1STD A;  2X8H A;  1O85 A;  1YGE A;  2X8G A;  5ECM B;  5G1L A;  1Q82 4;  4FMC A;  4E8E A;  2Z7A A;  2I1U A;  5HOH A;  3KH7 A;  3FMW A;  4KH7 A;  4PUR A;  3MG1 A;  3QK9 A;  4GQC A;  2B5X A;  4TR0 A;  2LJA A;  1Z3E A;  3IHG A;  1M1X B;  1OC9 A;  2L57 A;  5ECS A;  3M0F A;  1JB4 A;  2HLS A;  3IBH A;  4NMU A;  1RRH A;  1BX9 A;  4ECI A;  2AAD A;  1AQZ A;  1J0F A;  4OWY A;  4BTX A;  2IMJ A;  1ERU A;  1OC3 A;  5JPU A;  3F9S A;  1BRK A;  3IAM 2;  3FH1 A;  2CIU A;  3BNC A;  3DKS A;  2W04 A;  2WZ9 A;  4X4J A;  1OCV A;  2B6M A;  4BVY A;  2IJY A;  1ZO2 A;  3NV0 B;  2IFQ A;  1UI7 A;  2R5G A;  3L9U A;  3D21 A;  3R2Q A;  3KSP A;  3ZG0 A;  3FF2 A;  1EWX A;  4EF0 A;  3KP9 A;  3ED3 A;  4HM2 B;  4O7H A;  4MH2 A;  4MJD A;  3PS8 A;  1KEB A;  1XW9 A;  4K7N A;  1GSQ A;  1W4V A;  1NJI 4;  2DIZ A;  3ZIT A;  4O92 A;  1QMV A;  4CDO A;  2H0G A;  1RJO A;  2F51 A;  1N8Q A;  4AKY A;  4WF5 A;  1EEM A;  2Z9S A;  3VWW A;  3ZIV A;  5D96 A;  2RUE A;  5KN1 A;  1O7G B;  1TRS A;  1B4Q A;  4OMV A;  4ECJ A;  3VI5 A;  1GY7 A;  4RUV A;  2K8S A;  4O5U A;  4L0U A;  3UJM A;  5DAL A;  1B2X A;  2CFD A;  1VQ4 3;  1S3R A;  1X5D A;  2PVQ A;  3F4S A;  2WOF A;  4HKV B;  1VQK 3;  4G19 A;  3GH6 A;  1PQN A;  1FAA A;  2TRC P;  5L71 A;  1AAZ A;  1N2A A;  2KOK A;  1T1V A;  1ASK A;  5J4U A;  1PX6 A;  5ELU A;  2OA7 A;  2MZC A;  4RNZ A;  2PUK C;  3DD3 A;  4EW5 A;  3HX8 A;  1CEW I;  2OCT A;  3FYG A;  3RDE A;  3NOF A;  5ECH B;  1WJK A;  1XWB A;  4TXO B;  3HY2 A;  2ZHX B;  1T4Y A;  3KP8 A;  4K5S A;  2O9U X;  1QAF A;  6GST A;  2P0X A;  2YWO A;  2E2U A;  3MYT A;  3Q90 A;  1K0B A;  3LWA A;  2B7K A;  1B8X A;  3BNE A;  5JWQ B;  1VQ8 3;  2B1K A;  4I8B A;  2M80 A;  1CYU A;  3LXT A;  2IMK A;  1S3A A;  4PQ1 A;  6GSW A;  5KOW A;  4MPG A;  1R5A A;  3X42 A;  2XFS A;  4KSO A;  3F40 A;  2R0P A;  1W2Z A;  4K5R A;  2QA4 3;  3Q2P A;  1XXU A;  2DSA A;  4HEA 2;  5DDL A;  1IYI A;  4AJ8 A;  3GMF A;  2A2P A;  1YJN 3;  22GS A;  1R7H A;  3F4T A;  4PX1 A;  5IOX A;  2CAQ A;  5D82 A;  2HML B;  3MIX A;  3JVC A;  5IG5 A;  1VQM 3;  1XZO A;  3KD0 A;  2ZL8 A;  13GS A;  3K7C A;  5JCG A;  1ON4 A;  2JQ5 A;  1Q81 4;  2A2S A;  5ECP B;  3TKQ A;  2EIO A;  3ERG A;  3H1N A;  1U5O A;  2UUG C;  3IR4 A;  1I70 A;  1NO3 A;  3CPO A;  2L6C A;  3CMI A;  3Q6O A;  5F07 A;  5E4W A;  7GSS A;  2VCQ A;  1PSQ A;  3GA4 A;  5HGR A;  3GKM A;  4XB5 A;  4HZ9 B;  4K0N A;  1B9X C;  2FNO A;  2OE1 A;  1HU9 A;  1ZCP A;  1YY7 A;  1D6U A;  1TK8 B;  2HMK B;  4GHO A;  1NSW A;  5LC6 A;  1LJR A;  4CCV A;  2C0D A;  4EC0 A;  4XS1 A;  5AIX A;  1XWA A;  3HDC A;  2VLT A;  5ABR A;  5KEJ A;  1QQ2 A;  3NZN A;  3EF8 A;  6GSX A;  1Z9H A;  2NBS A;  2D2Z A;  4J5K A;  2IUJ A;  1W6C A;  1WMP A;  4KAE A;  5CAX A;  4O02 B;  3ERW A;  4N6N B;  3TJG A;  3EJV A;  1BSA A;  5G1K A;  1UCI A;  1A8Y A;  3E99 A;  2I9W A;  5I97 A;  3LYP A;  2A15 A;  1GTU A;  2JSY A;  2BJX A;  3FGY A;  3EMP A;  3C8E A;  1IT7 A;  3WDG B;  1AR0 A;  4ML6 A;  1X9S B;  1QVG 2;  1X9M B;  3WR2 A;  3IAS 2;  4H86 A;  4MNN A;  1IVX A;  3UL5 A;  1RHL A;  2M46 A;  1ULI B;  4AEQ A;  2J23 A;  3PGB A;  4KCE A;  4WBR D;  1IQX A;  1A2L A;  1BUJ A;  2OBK A;  1BYE A;  2H8L A;  3ROB A;  1A90 A;  3FZ5 A;  3MAK A;  1G02 A;  3I0Y A;  2DJ0 A;  3FZ9 A;  1K0N A;  3QAV A;  3L0R A;  1RN4 A;  1AIU A;  2XHF A;  4LYL B;  5IMC A;  1F9M A;  2CH9 A;  2M72 A;  1PMT A;  5B6M A;  5JPP A;  4BL7 A;  3F8U A;  4N0V A;  1NWW A;  3NX0 A;  2FD3 A;  3NBB A;  1FOV A;  2R4I A;  2FLS A;  5GAP D;  3IXR A;  4K2D A;  3PZW A;  2VO4 A;  2KLX A;  3Q74 A;  2WO0 A;  1QFN A;  4MJA A;  4GTU A;  3S28 A;  4JR6 A;  2C11 A;  1HZ1 A;  2CFL A;  3DXO A;  4CY8 A;  3FR3 A;  3TOU A;  1PL1 A;  3CSJ A;  3FZ4 A;  4PNF A;  1ROA A;  2P05 A;  3KM6 A;  2EIQ A;  2FWE A;  1B21 A;  4X2H A;  5IO0 A;  3EE1 A;  3HII A;  4HM5 B;  1VQP 3;  1XW6 A;  2K9F A;  1QXH A;  3GTU A;  5G5E A;  1R4C A;  5FW5 A;  3CC4 3;  3UEM A;  1XIY A;  1Q98 A;  4ZL8 A;  1YVS A;  1K41 A;  1FUT A;  3PCR A;  3DY5 A;  1O8W A;  4HU9 A;  1W7C A;  2E2T A;  4NV5 A;  1I0X A;  3KFQ C;  4HZ4 A;  3S29 A;  4EKZ A;  3BND A;  4PTS A;  5AIG A;  2CX0 A;  2HSY A;  1MDJ A;  8CHO A;  1Q7H A;  1I0V A;  1RRL A;  3WMD A;  2ZDJ A;  2XSH B;  5DCG A;  1W6G A;  2WRT A;  4MPF A;  2RBI A;  5IPH A;  1NB5 I;  2F3M A;  3C71 A;  3F3R A;  1A8L A;  1Z7R A;  3GL3 A;  4EXR A;  2P09 A;  4EXJ A;  1LOY A;  3PCS A;  5AGY A;  1ILO A;  1V2A A;  4L7K A;  5LNK e;  2F8F A;  2IMI A;  3K5T A;  4TXV A;  4IPB A;  4DEJ A;  1EZK A;  3H93 A;  4DSS B;  3QCP A;  4DKI A;  2HRF A;  3KN4 A;  4XRD A;  1ZS7 A;  3RHC A;  2B5E A;  3LSZ A;  3A5E A;  4XS4 B;  1YJW 3;  2HSM A;  2LRC A;  1ZGN A;  3CXG A;  2CX1 A;  1Q4J A;  2MBS A;  2ON5 A;  1VF1 A;  4XIH A;  3R3E A;  10GS A;  1TOF A;  2GQL A;  5A4V A;  4HM4 B;  3SOY A;  3IV4 A;  4IIA A;  4A5P A;  4L8E A;  3FK8 A;  5D93 A;  1A2P A;  2PMT A;  1GUK A;  4MMX B;  2VAF A;  4PQH A;  3FCS B;  3LQ7 A;  2O89 A;  1AY7 A;  4WET A;  2NPB A;  1O7M B;  17GS A;  1PA3 A;  4XDW A;  4ECC A;  4KZ1 A;  5ELA A;  3B4P A;  1SIH A;  3FW2 A;  3BCK A;  3FSD A;  3K63 A;  3IDV A;  3HVN A;  2FWH A;  3ZZX A;  1BRN L;  3HVS A;  3ECF A;  4I2T A;  2C3T A;  1AQV A;  3A2V A;  1QVF 2;  3U6V A;  2UZ8 A;  1CH0 A;  2IN3 A;  1YGW A;  3MG2 A;  1W6Y A;  3WOD G;  1Z5Y E;  2CKF B;  4MF7 A;  3TOT A;  3OWS A;  2F86 B;  4G0L A;  3D4M A;  4BVX A;  4MZC A;  2OOV A;  3HJO A;  1OE8 A;  4GSS A;  4CJN A;  2RLI A;  8GSS A;  2RGQ A;  1BED A;  4POK A;  1C72 A;  3VWV A;  2BT3 A;  1F8N A;  1QUW A;  1ZYQ B;  3JUM A;  2V41 A;  1ISK A;  2GZY A;  2RM5 A;  1VF2 A;  3HD5 A;  3NIV A;  5F06 A;  1T7P B;  3TKP A;  2V1M A;  1N8R 4;  2ES7 A;  3S27 A;  3Q18 A;  5RNT A;  4MK3 A;  1X1W A;  5E59 A;  3VK9 A;  1OH0 A;  2OQE C;  2KP1 A;  1PKW A;  3CCV 3;  1WRY A;  2WB9 A;  1JB2 A;  4NV2 A;  1PN9 A;  2RSX A;  5IMA A;  4YKF A;  1SU9 A;  1LNI A;  3WOE B;  3V99 A;  3EMX A;  3F8X A;  1K3L A;  1STF I;  1BGS A;  3DRN A;  1S72 3;  4RZM A;  4L5L A;  1O8X A;  5HR1 A;  2HXK A;  3UIW A;  1WNH A;  4KA0 A;  1O7U A;  3GNJ A;  1GTI A;  4WKW A;  1PGT A;  3LTB A;  1FG4 A;  1SAR A;  3CU3 A;  1OHS A;  3I56 3;  1EQK A;  4L8P A;  2XSO B;  3D4T A;  2WGR A;  2F9S A;  1BNF A;  3F0I A;  2FY6 A;  3F6F A;  3B8L A;  2AHE A;  4ML1 A;  2YX9 A;  3GFK A;  1B3S A;  4WEY A;  1OKD A;  1OAC A;  5EEO A;  1ULJ B;  3CD6 3;  2PGT A;  4E8H A;  3SED A;  4G10 A;  5JWO B;  1DMQ A;  2VCX A;  1KNG A;  2LEG A;  4HOJ A;  2H19 A;  1PYL A;  1ZYN A;  1Q42 A;  1NHO A;  2HMO B;  3OV4 A;  2XPD A;  4AGS A; 
#chains in the Genus database with same CATH homology
 2WFC A;  4Q5R A;  4GRF A;  4GXZ A;  2YV9 A;  1A2J A;  1UN2 A;  2BTO T;  1YF1 A;  4IP1 A;  1X5E A;  9GSS A;  3GRX A;  3VI7 A;  2VL9 A;  1KBN A;  2R2J A;  2AB6 A;  3IC4 A;  1XFL A;  2FHE A;  4J2F A;  4Z7X A;  5D9V A;  2IIY A;  1EEJ A;  1UA5 A;  1XWC A;  4PQI A;  3D6I A;  5LD0 A;  4HS1 A;  2BMX A;  3DYR A;  3UAP A;  1AQX A;  1GSY A;  3FZA A;  3I43 A;  3CTF A;  1THO A;  2OAC A;  3EC3 A;  3TJF A;  2O8V B;  1OVN A;  3DML A;  5D8I A;  1LU4 A;  1GNW A;  2H76 A;  3UAR A;  2LJR A;  1TI1 A;  3TKS C;  3QDN A;  1XOA A;  2H72 A;  4WBJ A;  4LA1 A;  5ENU A;  2C3Q A;  1SJ6 A;  4USS A;  4EE0 A;  3ZVJ A;  1WPI A;  4F2I A;  1I5G A;  1G7E A;  4ACS A;  4XS6 A;  1OC8 A;  2AV4 A;  3QAG A;  5J9C A;  2FGX A;  3DIE A;  4OCF A;  5ECL B;  4K2X A;  1WP0 A;  2HZE B;  2LTK A;  4NHZ A;  4WR4 A;  3VWU A;  4RI6 A;  3DWV A;  2H70 A;  3HVV A;  2FA8 A;  2QA1 A;  1FW1 A;  4ZIJ A;  1R5P A;  4POM A;  20GS A;  3F9U A;  4I5Q A;  1GSF A;  1Z6N A;  4G2E A;  3CRT A;  1EV4 A;  3GYK A;  4Z2T A;  2KUC A;  4HQZ A;  2GLR A;  3KEB A;  3IK7 A;  3QMX A;  1HNC A;  1U3A A;  1XW5 A;  1NW2 A;  1J08 A;  3A3T A;  4WR5 A;  2HSH A;  1MD4 A;  5CRH A;  2MMA A;  2B1L A;  2P5Q A;  2VIM A;  1SKW B;  1GUM A;  2LV3 A;  5A4U A;  3KZQ A;  2CVK A;  3WGX A;  4MF6 A;  1YKA A;  4JE1 A;  4DSS A;  4GF0 A;  6GSV A;  2VLV A;  1MD3 A;  4EVM A;  3KMN A;  1FHE A;  4YQM A;  1O81 A;  1O73 A;  2H66 A;  3H8Q A;  2GVP A;  4RI7 A;  5D9T A;  2MBT A;  1BQ7 A;  2HT9 A;  4P3Y B;  2IPA A;  1WE0 A;  4MZW A;  3IRA A;  3MWH A;  4IW9 A;  1M99 A;  2I81 A;  1FVK A;  3KMO A;  2CVD A;  4EO3 A;  5ELG A;  4F0B A;  2GZP A;  3IOS A;  1X9W B;  4K7I A;  4NPB A;  4K6X A;  3TKS A;  4NXI A;  3RHB A;  3WT1 A;  1OE7 A;  3LYK A;  2WS2 A;  3APO A;  4TR1 A;  2C0F A;  1GH2 A;  2CZ2 A;  1H4O A;  3HJM A;  2EIR A;  2H30 A;  1ZOF A;  4FYC A;  3VFI A;  5ECN B;  3GUS A;  3M3M A;  2JL4 A;  1JHB A;  2DKI A;  1PRX A;  2KP2 A;  4IHU A;  1UC7 A;  3Q19 A;  2N5F A;  5INY A;  3P2A A;  4ZXG A;  3TJB A;  4BVX B;  4KCA A;  4TVE A;  3A2X A;  3QFA C;  5ECK B;  1RK4 A;  4MF5 A;  3APS A;  2IMF A;  5C04 A;  3LFL A;  3TCO A;  3I9V 2;  1SK2 A;  4CHS A;  4JED A;  5ECQ B;  1R26 A;  2CVB A;  1TTZ A;  4IGJ A;  3F3Q A;  4BPY A;  2GGT A;  6GSS A;  3VUR A;  1B48 A;  5J41 A;  2HI7 A;  2PVO C;  1XPV A;  2H1D A;  2VD0 A;  2H0H A;  4OFT A;  1J9B A;  2RII A;  2ON7 A;  2TIR A;  2FUG 2;  3C1S A;  1GSE A;  4TXO A;  2LNS A;  5J3R A;  1DSB A;  4KDX A;  3FKF A;  1CQH A;  1V40 A;  1AUC A;  3LJR A;  3ZVJ D;  2VCT A;  2G2Q A;  4TR3 A;  1SD8 A;  5B6N A;  3GL5 A;  5DQY A;  2OJL A;  5B8A A;  3LXZ A;  3ZFL A;  3GHA A;  3PH9 A;  2JSZ A;  1NM3 A;  5IIZ A;  1U3I A;  3L78 A;  3J7Y b;  1MTC A;  2ALB A;  3C73 A;  5CRW A;  1V98 A;  4MP4 A;  4BWS A;  3A2W A;  1F6M C;  4KND A;  3GKX A;  4TR1 B;  3WGE A;  2VL2 A;  5IO2 A;  4KSM A;  2AYT A;  5IOW A;  4PNG A;  1SK0 A;  3RPN A;  2DJ1 A;  1ACV A;  2LNT A;  3GIX A;  5F0G A;  4BVY B;  2IWT A;  5ECR B;  1PKZ A;  4FO5 A;  4EUY A;  5DAK B;  1HQO A;  3O76 A;  4GST A;  2JZR A;  3ZTL A;  2VLU A;  3EU3 A;  2MMO A;  3KJY A;  2YCD A;  2HRN A;  2JZT A;  3UVH A;  2XC2 A;  2LRN A;  5AIV A;  1WMJ A;  1V9W A;  1SYR A;  4EIQ A;  1EV9 A;  2RM6 A;  5AN1 A;  4V2M A;  4TW5 A;  2LRT A;  3FRC A;  3G7Y A;  18GS A;  4AJ6 A;  3ZMK A;  2YJH A;  2QC7 A;  2C0G A;  2GT6 A;  2O7K A;  4HU7 A;  2PN8 A;  5FHI A;  2FA4 A;  1M9A A;  5IQY A;  3C1R A;  2IME A;  3EYT A;  2H1A A;  1AC1 A;  1U87 A;  3DXB A;  5KN3 A;  3RBT A;  2MYG A;  3UJ1 A;  3M8N A;  1DUG A;  1OC9 B;  5HFK A;  2QA2 A;  2WCI A;  1SYX A;  5KOX A;  4YQU A;  1U6T A;  4JR4 A;  4GCI A;  4OO4 A;  1YJ6 A;  2DIY A;  2IFQ B;  4LL4 B;  1M7T A;  5IMF A;  2J9H A;  2B5Y A;  3GH9 A;  2HYX A;  2H73 A;  2WJU A;  2FWG A;  2R3X A;  4X43 A;  4YQV A;  4MJC A;  1WIK A;  1EP8 A;  1S3C A;  4IEL A;  16GS A;  5EPF A;  4F82 A;  4GWR A;  3TRP A;  4ULX A;  3W8S A;  3IA1 A;  3HCZ A;  1RW1 A;  1M0U A;  2EC4 A;  2ZCT A;  1XOB A;  2OAD A;  3TKS E;  2JZS A;  5G5F A;  4G9H A;  2H74 A;  5EVO A;  4I97 A;  4NAX A;  3M9J A;  4XTS A;  2R6K A;  5D9X A;  1SD9 A;  4TN8 A;  3IK9 A;  3FEU A;  4XS4 A;  2CX4 A;  1XVW A;  2R4V A;  3F4R A;  2B7J A;  3GX0 A;  4MAB A;  2DBC A;  4POL A;  2XBI A;  1GLQ A;  2X8C A;  4V2N A;  2O87 A;  4BA7 A;  3HVX A;  1MDI A;  3BOA A;  3L9V A;  4EDZ A;  1JZR A;  3LG6 A;  3G7J A;  2PWJ A;  4HI7 A;  4PUF C;  2GS3 A;  3L9S A;  3EVI A;  4MH3 A;  3N9J A;  3J7Y k;  1GRX A;  4LLR A;  4TKY A;  4ZBD A;  2H6Y A;  4XCS A;  3L0H A;  5EY6 A;  4EIP A;  1SKR B;  3HZ4 A;  4J56 E;  2OBI A;  2VM1 A;  4K9Z A;  1S3D A;  2LST A;  4AJ7 A;  5IMD A;  2R37 A;  3ZML A;  1XBS A;  5DBQ A;  4HDE A;  5DAK A;  2GSQ A;  3UL3 A;  3UBL A;  1Y6E A;  3DGQ A;  1A2M A;  2C3N A;  1XCC A;  4IQA A;  2E0Q A;  2YWM A;  4KGI A;  3ZIJ A;  2VUP A;  4LMW A;  4IN0 A;  4K7O A;  1TW9 A;  5CRG A;  4YKG A;  2JU5 A;  3O3T A;  2C1Y A;  1SK1 A;  4IJI A;  2DJ2 A;  4K8M A;  3KTL A;  3P7X A;  1ZZY A;  1PX7 A;  3G9B A;  1VF3 A;  4ZB6 A;  3CSI A;  3WT2 A;  3TB2 A;  4K0G A;  5G31 A;  2LQO A;  2L4Q A;  2GQK A;  1G7O A;  3I69 A;  4ZL7 A;  1ML6 A;  1USB A;  3FY7 A;  4QQ7 A;  3KTB A;  2H1G A;  1OAZ A;  3PR8 A;  2LQQ A;  2GZZ A;  2YAN A;  2K18 A;  3KIJ A;  4Q5N A;  3EIN A;  3IHQ A;  2H6Z A;  2DJ3 A;  2YWI A;  5F8B A;  2K6V A;  1HNB A;  3DVX A;  5GSS A;  1XVQ A;  4MA9 A;  5G2Z A;  1BG5 A;  4N0Z A;  1DE1 A;  1K3O A;  4X0X A;  4BL7 B;  3TJK A;  5DQS A;  1YDK A;  4I6X A;  2N5B A;  2L4C A;  1WOU A;  3O6T A;  5C00 A;  3SBC A;  3GST A;  3HYP A;  2YPM A;  3I6A A;  5CO3 A;  2AUV A;  3CSH A;  4DSQ A;  1A23 A;  1YF0 A;  5CRE A;  4D73 A;  2C4J A;  4TRX A;  2H01 A;  5HR3 A;  1JFU A;  4ZB9 A;  4O5Q A;  1JLW A;  4HQS A;  2X4A A;  1OYJ A;  1F3A A;  3ZLP A;  5ID2 B;  3E3E A;  4JRR A;  3TKR A;  1PN0 A;  3D5J A;  5ID2 A;  2VCW A;  4YAP A;  2L59 A;  2E2M A;  2NDO A;  3HKR A;  4N30 A;  2GT5 A;  2HE3 A;  4G0I A;  1GUL A;  2IL3 A;  2PBJ A;  4J57 E;  19GS A;  1FB0 A;  2CX3 A;  3EWL A;  3V1W A;  2HRK A;  2FCH A;  5IMZ A;  1TP9 A;  4OCE A;  4PGT A;  1F37 A;  4N10 A;  1YEP A;  1ZMA A;  4KX4 A;  2CZ3 A;  4KB3 A;  2I9H A;  1FB6 A;  4NWY A;  2C0E A;  2ZNM A;  3EUR A;  3ZFB A;  4XRA A;  5COH A;  3BJ5 A;  4MZB A;  4KW6 A;  3ERF A;  4JU5 A;  2HZF A;  1Y25 A;  1HNA A;  4AF2 A;  2GDR A;  4WXT A;  3GV1 A;  2P5R A;  1JLV A;  2YNX A;  3F6D A;  2L5L A;  3RPP A;  5B8B A;  1THX A;  2X99 A;  2V32 A;  4DSR A;  4Z2U A;  1T3B A;  2DLX A;  3GSS A;  1TK5 B;  4OD7 A;  2WDU A;  2DC5 A;  4N11 A;  2I4A A;  3TDG A;  3S9F A;  4IQ1 A;  3GUR A;  3HJP A;  1TKD B;  3GN3 A;  4HJ2 A;  2A2R A;  3EU4 A;  4HZ2 A;  5JWR B;  2H71 A;  2HZE A;  5DJL A;  3RAZ A;  5FWG A;  5B7C A;  1SL0 B;  2CA8 A;  14GS A;  1K3Y A;  2MMN A;  4FQU A;  4F03 A;  1UVZ A;  2PU9 C;  5A5K A;  2HFD A;  4ECB A;  5DVB A;  2LKU A;  3ISO A;  1VRS D;  4V2L A;  4JBB A;  1ZL9 A;  1XWK A;  1A24 A;  1SL1 B;  3G7I A;  3A5W A;  3E9J B;  4KUN A;  4OO5 A;  4ISD A;  1QK8 A;  4F0C A;  1T8E B;  2E7P A;  2H1B A;  2ZUP A;  3VPT A;  1T00 A;  3LOR A;  2O85 A;  1ERT A;  3UVT A;  4MJB A;  3VLN A;  2R0C A;  2E2G A;  3IPZ A;  3KH9 A;  1B4P A;  4ILF A;  5H5Q A;  4IBP A;  1HD2 A;  2HNL A;  4LL1 B;  1SL2 B;  3N5O A;  1TI3 A;  4G0K A;  12GS A;  2JAD A;  5HR0 A;  1ZYE A;  4CW9 A;  3MSZ A;  4HJM A;  3HA9 A;  2A4V A;  2DJJ A;  4ICY A;  1M2B A;  1GTA A;  1FOH A;  5FT3 A;  3C7M A;  5BRT A;  2GSS A;  2WUL A;  1B9Y C;  2YWN A;  3OR5 A;  1EOH A;  2NTO A;  3VPQ A;  1MEK A;  4KF9 A;  1N8J A;  3VWX A;  1GL8 A;  1LBK A;  1E6B A;  2LUS A;  4QL7 A;  1GWC A;  2YN1 A;  1MDK A;  2AAW A;  5D9W A;  2GTU A;  4CY6 A;  3F63 A;  5J5N A;  2PER A;  3MYD A;  3A5I A;  3TGZ A;  1GUH A;  1OKT A;  1G6W A;  2XBQ A;  5HQP A;  1H75 A;  1M2D A;  4O5R A;  3GTU B;  1EOG A;  4KDU A;  1SJI A;  3P8W A;  2VCZ A;  4IKH A;  3KGK A;  4IP6 A;  2X49 A;  4RQR A;  5G30 A;  2IMD A;  1YZX A;  5ECI B;  1BJX A;  5HR2 A;  1I9D A;  2C80 A;  4LMV A;  2N5A A;  2H0I A;  1JZW A;  4K1F A;  1Z6M A;  3PGT A;  2H75 A;  3L4N A;  1W89 A;  3M9K A;  1URM A;  1XWG A;  2GQM A;  5ECO B;  3ZRE A;  2YZU A;  3WGD A;  1Z7P A;  2V6O A;  4Q5F A;  4GQF A;  4YAV A;  5DJM A;  5JCU A;  4EL1 A;  5GZZ B;  4L5O A;  2DJK A;  3MNG A;  4GLT A;  1E2Y A;  3M1G A;  2KHP A;  4D73 B;  2VOC A;  5CNW A;  3ME8 A;  1NHY A;  1ABA A;  1TRV A;  4O32 A;  3KCM A;  4V1A g;  1AW9 A;  1JZO A;  4PXO A;  3FHK A;  1G0T A;  2P0G A;  4V1A p;  1TK0 B;  2IY2 A;  3ZL5 A;  1PL2 A;  1TRU A;  1M2A A;  4HUA A;  3BBY A;  1ERW A;  3UOM A;  4POB A;  1K0C A;  3TRX A;  4WF4 A;  4IS0 A;  1AQW A;  5H5R A;  3H4K A;  1EGR A;  3QAW A;  5KN0 A;  5IPG A;  3LEF A;  4BWQ A;  3MDK A;  4IVF A;  3W8J A;  3K8N A;  2YV7 A;  4L0W A;  2DKH A;  5GST A;  3PPU A;  2QSI A;  2VL3 A;  5D73 A;  2R0G A;  2LJK A;  4EDY A;  2H6X A;  2CV4 A;  5LCZ A;  3D22 A;  1WWJ A;  1GSD A;  3ZYW A;  3RDW A;  3QR6 A;  4OFN A;  3WYW A;  4ZIL A;  1F2E A;  2I3Y A;  4F9Z A;  1GSU A;  5HFG A;  5CP1 A;  2VM2 A;  3ME7 A;  4MMM A;  3EE2 A;  2XPE A;  3IC8 A;  6GSU A;  3US3 A;  1IYH A;  4I2U A;  3QD9 A;  1YQ1 A;  4Z2R A;  2CQ9 A;  4FYU A;  3DEX A;  2YOI A;  1X5C A;  2DML A;  2AJQ B;  4RQX A;  3UMA A;  1BAY A;  2NVL A;  2OKA A;  5IMV A;  1K0M A;  3HZ8 A;  2YZH A;  2K8V A;  1QGV A;  3DVW A;  2X64 A;  2QKE A;  1A0F A;  1GP1 A;  3TJJ A;  3CTG A;  5GAN D;  2RUF A;  1TU8 A;  3APQ A;  1F3B A;  3LW9 A;  2V6K A;  5CYY A;  4XHM A;  4FIW A;  2OE0 A;  1SKS B;  1CQG A;  3FR6 A;  2VL2 C;  3U5R E;  2LS5 A;  1GLP A;  1G6Y A;  1ZYP A;  4YH2 A;  2PPT A;  11GS A;  2P31 A;  4TOP A;  1KTE A;  3HXS A;  4NHW A;  2B3S A;  3GKK A;  4KE3 A;  1SJZ A;  2JAC A;  1DE2 A;  2VCV A;  5DAL B;  1RQM A;  4MJE A;  1JZD A;  2L5O A;  6GSY A;  3TUE A;  2MMZ A;  2HRA A;  3E0U A;  4MLY A;  5F05 A;  1X0R A;  3WD6 A;  3LGC A;  3QOU A;  3QFB C;  1VGL A;  4ZL9 A;  2YP6 A;  5CRD A;  3IE3 A;  5AIS A;  3ZRD A;  2DMM A;  3GKN A;  1M9B A;  1PD2 1;  3BD2 A;  2CT6 A;  1AXD A;  1K0D A;  1TU7 A;  2CAI A;  3AY8 A;  4ZB8 A;  2YJ7 A;  1EP7 A;  4ID0 A;  5JCW A;  1SEN A;  3BCI A;  1GTB A;  3UBK A;  2TRX A;  5EL8 A;  1FO5 A;  1R4W A;  1EGO A;  5J9B A;  2V2G A;  5KN2 A;  1TJD A;  4X1U A;  2GST A;  3SWL A;  5H5S A;  4Q5Q A;  4OFM A;  5HFI A;  2VD1 A;  3CRU A;  4QL9 A;  1FVJ A;  1YEX A;  4JZQ A;  1HYU A;  4TR4 A;  2A4H A;  4FH8 A;  4FYB A;  2L6D A;  4GSN A;  3P90 A;  1T4Z A;  1V57 A;  1YKC A;  3GX8 A;  1O6J A;  3D0Z A;  3TRQ A;  4IJ3 A;  4ZBA A;  1K0A A;  2G0F A;  4MDC A;  3W6G A;  4KDY A;  1A0R P;  1U88 A;  1DBY A;  1ST9 A;  1GSS A;  2OE3 A;  2FWF A;  2REM A;  3EPT A;  5A4W A;  1V58 A;  3H79 A;  4MCU A;  3CBU A;  2QGV A;  3QPM A;  1GNE A;  4ZBB A;  2GSR A;  2IYJ A;  3FR9 A;  1TXX A;  1K0O A;  5IM9 A;  1ERV A;  2C8U A;  1TDI A;  3KXO A;  3PIN A;  4PUA A;  5DCH A;  1VF4 A;  3JCM L;  3HHV A;  2F8A A;  5BMU A;  3CYN A;  1TRW A;  4DVC A;  2X8H A;  1O85 A;  2X8G A;  5ECM B;  5G1L A;  4E8E A;  2I1U A;  3KH7 A;  3FMW A;  4KH7 A;  4PUR A;  4GQC A;  2B5X A;  4TR0 A;  2LJA A;  1Z3E A;  3IHG A;  1OC9 A;  2L57 A;  5ECS A;  3M0F A;  2HLS A;  3IBH A;  4NMU A;  1BX9 A;  4ECI A;  1J0F A;  4OWY A;  1ERU A;  1OC3 A;  3IAM 2;  3DKS A;  2WZ9 A;  4X4J A;  2B6M A;  4BVY A;  2IJY A;  2IFQ A;  2R5G A;  3L9U A;  3D21 A;  3R2Q A;  1EWX A;  4EF0 A;  3KP9 A;  3ED3 A;  4O7H A;  4MH2 A;  1KEB A;  1XW9 A;  4K7N A;  1GSQ A;  1W4V A;  2DIZ A;  3ZIT A;  4O92 A;  1QMV A;  4CDO A;  2H0G A;  2F51 A;  4WF5 A;  1EEM A;  2Z9S A;  3VWW A;  3ZIV A;  5D96 A;  2RUE A;  5KN1 A;  1TRS A;  1B4Q A;  4OMV A;  4ECJ A;  3VI5 A;  4RUV A;  2K8S A;  4O5U A;  4L0U A;  5DAL A;  1X5D A;  2PVQ A;  3F4S A;  4G19 A;  3GH6 A;  1PQN A;  1FAA A;  2TRC P;  5L71 A;  1AAZ A;  1N2A A;  2KOK A;  1T1V A;  5J4U A;  1PX6 A;  2OA7 A;  2MZC A;  2PUK C;  3DD3 A;  3FYG A;  3NOF A;  5ECH B;  1WJK A;  1XWB A;  4TXO B;  3HY2 A;  1T4Y A;  4K5S A;  3KP8 A;  6GST A;  2YWO A;  1K0B A;  3LWA A;  2B7K A;  1B8X A;  5JWQ B;  2B1K A;  4I8B A;  2M80 A;  3LXT A;  2IMK A;  1S3A A;  4PQ1 A;  6GSW A;  5KOW A;  4MPG A;  1R5A A;  4KSO A;  2R0P A;  4K5R A;  1XXU A;  2DSA A;  4HEA 2;  5DDL A;  1IYI A;  4AJ8 A;  3GMF A;  2A2P A;  22GS A;  1R7H A;  3F4T A;  4PX1 A;  5IOX A;  2CAQ A;  3MIX A;  1XZO A;  3KD0 A;  13GS A;  5JCG A;  1ON4 A;  2A2S A;  5ECP B;  3TKQ A;  2EIO A;  3ERG A;  3H1N A;  3IR4 A;  2L6C A;  3CMI A;  3Q6O A;  5F07 A;  5E4W A;  7GSS A;  2VCQ A;  1PSQ A;  3GA4 A;  3GKM A;  4K0N A;  1B9X C;  2FNO A;  2OE1 A;  1ZCP A;  1YY7 A;  1TK8 B;  1NSW A;  1LJR A;  2C0D A;  4EC0 A;  4XS1 A;  5AIX A;  1XWA A;  3HDC A;  2VLT A;  5ABR A;  5KEJ A;  1QQ2 A;  3NZN A;  6GSX A;  1Z9H A;  2NBS A;  2D2Z A;  4KAE A;  5CAX A;  3TJG A;  3ERW A;  5G1K A;  1A8Y A;  3LYP A;  1GTU A;  2JSY A;  2BJX A;  3EMP A;  3C8E A;  4ML6 A;  1X9S B;  1X9M B;  3IAS 2;  4H86 A;  4MNN A;  2M46 A;  2J23 A;  4KCE A;  4WBR D;  1A2L A;  2OBK A;  1BYE A;  2H8L A;  3FZ5 A;  3MAK A;  2DJ0 A;  3FZ9 A;  1K0N A;  3QAV A;  1AIU A;  2XHF A;  5IMC A;  1F9M A;  2M72 A;  1PMT A;  5B6M A;  4BL7 A;  3F8U A;  4N0V A;  2FD3 A;  1FOV A;  2FLS A;  5GAP D;  3IXR A;  4K2D A;  2VO4 A;  2KLX A;  3Q74 A;  1QFN A;  4MJA A;  4GTU A;  4JR6 A;  4CY8 A;  3FR3 A;  3TOU A;  1PL1 A;  3CSJ A;  3FZ4 A;  4PNF A;  3KM6 A;  2EIQ A;  2FWE A;  5IO0 A;  1XW6 A;  2K9F A;  1QXH A;  3GTU A;  5G5E A;  3UEM A;  1XIY A;  1Q98 A;  4ZL8 A;  1O8W A;  4HU9 A;  4NV5 A;  4HZ4 A;  4EKZ A;  4PTS A;  2HSY A;  1MDJ A;  5DCG A;  2WRT A;  4MPF A;  5IPH A;  2F3M A;  3C71 A;  3F3R A;  1A8L A;  1Z7R A;  3GL3 A;  4EXJ A;  5AGY A;  1ILO A;  1V2A A;  5LNK e;  4TXV A;  2F8F A;  2IMI A;  4DEJ A;  1EZK A;  3H93 A;  4DSS B;  3QCP A;  2HRF A;  4XRD A;  3RHC A;  2B5E A;  3LSZ A;  4XS4 B;  2HSM A;  2LRC A;  1ZGN A;  3CXG A;  1Q4J A;  2MBS A;  4XIH A;  2ON5 A;  1VF1 A;  3R3E A;  10GS A;  1TOF A;  2GQL A;  5A4V A;  3IV4 A;  4A5P A;  4L8E A;  3FK8 A;  5D93 A;  2PMT A;  1GUK A;  2VAF A;  4PQH A;  3LQ7 A;  2O89 A;  4WET A;  2NPB A;  17GS A;  1PA3 A;  4ECC A;  5ELA A;  3FW2 A;  3BCK A;  3IDV A;  2FWH A;  3ZZX A;  3HVS A;  4I2T A;  2C3T A;  1AQV A;  3A2V A;  3U6V A;  2UZ8 A;  2IN3 A;  1Z5Y E;  4MF7 A;  3TOT A;  4G0L A;  4BVX A;  3D4M A;  4MZC A;  3HJO A;  1OE8 A;  4GSS A;  2RLI A;  8GSS A;  1BED A;  4POK A;  1C72 A;  3VWV A;  1QUW A;  1ZYQ B;  2V41 A;  2GZY A;  2RM5 A;  1VF2 A;  3HD5 A;  3NIV A;  5F06 A;  1T7P B;  3TKP A;  2V1M A;  2ES7 A;  3Q18 A;  4MK3 A;  5E59 A;  3VK9 A;  2KP1 A;  1PKW A;  1WRY A;  2WB9 A;  4NV2 A;  1PN9 A;  5IMA A;  4YKF A;  1SU9 A;  3EMX A;  1K3L A;  3DRN A;  4L5L A;  1O8X A;  5HR1 A;  2HXK A;  3UIW A;  4KA0 A;  1O7U A;  3GNJ A;  1GTI A;  4WKW A;  1PGT A;  1FG4 A;  3D4T A;  2WGR A;  2F9S A;  3F0I A;  2FY6 A;  3F6F A;  2AHE A;  4ML1 A;  3GFK A;  4WEY A;  1OKD A;  2PGT A;  4E8H A;  4G10 A;  5JWO B;  2VCX A;  1KNG A;  2LEG A;  4HOJ A;  2H19 A;  1ZYN A;  1NHO A;  2XPD A;  4AGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...