4I5QA

Crystal structure and catalytic mechanism for peroplasmic disulfide-bond isomerase dsbc from salmonella enterica serovar typhimurium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein DsbC
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4i5qA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i5qA02
4MPGA 1JFUA 4PQHA 1T3BA 3VURA 3EWLA 2R3XA 3QCPA 2OA7A 2OE1A 3VWWA 1M9AA 2MMOA 3HD5A 4L0UA 4IBPA 3KZQA 4I5QA 5HR3A 3IHQA 5LD0A 5D9XA 4WXTA 2E7PA 4K7OA 3L78A 1XVQA 4POLA 1PN9A 1TK5B 5F06A 4J56E 3QDNA 5B6NA 4XS4A 1V57A 4XCSA 7GSSA 2PU9C 3D5JA 1AUCA 2IFQA 4I6XA 2F8AA 4MF7A 3HY2A 6GSWA 4K1FA 2VCQA 1F2EA 3UEMA 1Z5YE 4ZILA 3ERFA 2O8VB 1HD2A 2VLVA 2ZCTA 2REMA 1PX6A 3BCIA 5F05A 3A2WA 4PX1A 4F03A 3LQ7A 2L5OA 1GUHA 3OR5A 3FYGA 17GSA 2V2GA 3EMPA 2B7JA 1OE8A 4IELA 4KDYA 1UVZA 4YAVA 1HNAA 3DRNA 2L6DA 1SJIA 3S9FA 3IDVA 4MJAA 3P7XA 4TR4A 1O8WA 3ERWA 2H0HA 1GNWA 2CAIA 2IMDA 1WE0A 2WJUA 1K0AA 1ZMAA 1YY7A 2WRTA 3GUSA 3MDKA 5AIXA 4QQ7A 4EVMA 3F3QA 1ZGNA 4QL7A 4GSSA 5KEJA 4G9HA 4X43A 4JR4A 4HZ4A 1BYEA 4IGJA 1HNBA 4ZBAA 3IRAA 4XS4B 3HDCA 2KP2A 2YWNA 2L4QA 2RUEA 4N0ZA 1YEXA 3HYPA 1K3YA 4X1UA 2YWIA 1G7OA 4AJ7A 3ZLPA 1LJRA 3APSA 2IMIA 2C8UA 2QGVA 4TR3A 3ZFLA 3VPQA 5ABRA 3N9JA 4J2FA 2CQ9A 4MDCA 2FY6A 8GSSA 4V2NA 3D4TA 3BBYA 3VWXA 5GSSA 3LXTA 5GZZB 1FVJA 2CVDA 3FRCA 2P5QA 2DMLA 4XS1A 3UIWA 1T8EB 1JLWA 3DVXA 5ECHB 3TKSE 2FWHA 2WCIA 3C71A 2DJKA 1OAZA 1VRSD 5FHIA 1NSWA 2ES7A 4GQCA 1EP8A 2DJ0A 2DLXA 1GSUA 2K6VA 2GT5A 1PKZA 2VD0A 4EE0A 3ZVJD 5DBQA 5AGYA 2LRNA 4BVYA 4WBJA 1XOBA 1FO5A 1XWBA 4GQFA 4F82A 4OFTA 3PR8A 4AJ8A 3C1RA 4DSSA 2F9SA 4IKHA 4WF4A 1VF1A 3GKNA 4POMA 4V2MA 2CV4A 2DIZA 5JWOB 1Z6MA 2I3YA 1T4ZA 3EE2A 1O73A 4HU7A 3VWVA 2IMFA 2O85A 4KSOA 4PUFC 2A4VA 3GYKA 1BG5A 3TOTA 3A2VA 3IA1A 3KMOA 2ZNMA 3KH9A 3ZITA 5CAXA 1ERWA 3QMXA 2IPAA 2QC7A 3W8SA 2MYGA 5CRGA 1GUKA 4K8MA 2VL3A 4POBA 3TJJA 4DEJA 2GLRA 2FWFA 2DJJA 5ECIB 2FCHA 5INYA 2C0EA 3FR9A 5JWRB 4EO3A 3TKSC 1PRXA 1BAYA 1IYHA 3GN3A 4DVCA 1PA3A 4TRXA 1QGVA 2GSQA 2PGTA 1PGTA 1VGLA 2XBIA 2PUKC 4I8BA 2M80A 2R2JA 1X9SB 1YF1A 13GSA 3VI5A 4PXOA 1XZOA 3UJ1A 2YZUA 2PVOC 3KJYA 3HVSA 3Q74A 4K7NA 2E2MA 5ECNB 2A2RA 3FR3A 3GL5A 3GKXA 3D0ZA 3UBKA 3ZRDA 3W8JA 4GRFA 3HVXA 2VO4A 3VK9A 1DBYA 4DSSB 3D22A 1YKAA 2X8GA 5ECMB 5B6MA 2VCZA 2EIQA 3C73A 2KOKA 4F0BA 5D8IA 3IBHA 2CX4A 4RI7A 4XRAA 1Y6EA 1WOUA 1TI1A 3N5OA 3TKSA 3F4RA 2L5LA 3A5WA 3QD9A 5HR2A 4AF2A 5HFKA 2XPEA 1YF0A 3IK9A 4H86A 4XIHA 2BMXA 1Y25A 4V1Ag 4OFMA 5B8AA 4N30A 1SENA 4TN8A 3DD3A 2HE3A 2VLUA 4GSNA 1TKDB 2P5RA 5DDLA 1USBA 2XBQA 4IHUA 5D9WA 4LL4B 2VCWA 2O7KA 2GSTA 4JE1A 2L4CA 4MMMA 2VUPA 1SL2B 3CSHA 2LKUA 1GNEA 1ST9A 3TB2A 4NAXA 3FZ4A 5CRDA 4IJ3A 1A2LA 3TUEA 5ECPB 5ENUA 3H4KA 3GSSA 1KEBA 2GZYA 4N11A 2FA4A 5DJLA 1U3AA 5LCZA 5CP1A 1H75A 3GH9A 3TOUA 4Q5QA 3ZL5A 1AC1A 3EVIA 2LSTA 4YQVA 2HZEB 4E8HA 4BL7A 2LRCA 1GUMA 2DC5A 5IIZA 4JZQA 4MZBA 1X0RA 2H74A 3CMIA 3GKMA 5DALA 2FLSA 3K8NA 3EU4A 4MK3A 3LYPA 4HQSA 12GSA 4KA0A 3D6IA 3A2XA 2LNSA 1VF4A 4EL1A 1KTEA 2LEGA 5DQYA 3KM6A 4CHSA 1O85A 2A2SA 1J0FA 3O3TA 2IN3A 5IO0A 2OBIA 5KN3A 4IW9A 3H8QA 4RQRA 4O32A 5E4WA 2X8HA 1AQVA 3GNJA 1G0TA 3CXGA 1TU7A 3C7MA 1A2MA 5DCHA 1DE2A 1GSFA 3GRXA 4TVEA 3IOSA 2FUG2 2VOCA 4NHWA 3FEUA 3R2QA 1SYXA 1WRYA 1XWCA 3C8EA 1KNGA 3WT1A 4E8EA 4TXOA 1TXXA 1M99A 1V2AA 4K2DA 2F51A 2HLSA 1T4YA 5DCGA 1G6YA 4PURA 4ACSA 1K0CA 3VWUA 4BVXA 5D93A 4BA7A 3F4TA 5HQPA 2LJKA 2AAWA 3RHBA 1XPVA 2K18A 3GTUA 3G7IA 1FG4A 1SK0A 1TRUA 1TW9A 2H30A 2JADA 2YWOA 5DALB 4EKZA 3EMXA 20GSA 2NBSA 3TKPA 3CRUA 4N10A 2PVQA 3HZ4A 1EOGA 2C1YA 1YJ6A 5DAKA 2YJHA 3W6GA 5C00A 3BD2A 3CTGA 2VM2A 3WGEA 2R5GA 2RM5A 3Q19A 3FY7A 2H66A 3GHAA 4WR5A 2PBJA 2H1GA 1B9XC 1XWAA 3GKKA 3QFAC 1XW6A 2V32A 5HFIA 1K3OA 2HXKA 4JU5A 3TCOA 4NV2A 1N2AA 4XHMA 5G5FA 1MDKA 3BCKA 4K0GA 5IMDA 3E9JB 1Q4JA 1QMVA 4O5RA 4CDOA 1I9DA 4TXOB 5CRHA 1KBNA 5HR0A 5ECOB 2G0FA 1JZOA 5ELAA 2K9FA 1U6TA 1G6WA 2C0DA 4KDXA 3G7YA 2C3NA 5EY6A 6GSVA 3L9UA 1SK2A 2GQLA 1X9MB 3GIXA 2YNXA 5G31A 5G1KA 1SD8A 1MEKA 2AV4A 4F2IA 1HNCA 1M0UA 1C72A 2WB9A 2WFCA 4EDYA 2C0GA 2B7KA 4HU9A 5COHA 2WDUA 3TJKA 2IJYA 1YZXA 1DSBA 1MDIA 2C80A 1Z7RA 5DAKB 1E6BA 14GSA 4HJ2A 3LFLA 1GL8A 1GLPA 3GURA 1XBSA 2YN1A 2VL9A 1SL1B 1AXDA 4G19A 5H5SA 3DGQA 2YZHA 2LTKA 3P8WA 3GA4A 1PD21 4IQ1A 1EEJA 5CRWA 2BTOT 3P2AA 3IC4A 3MSZA 2AJQB 2HSYA 2IFQB 2H70A 2JZTA 2OE3A 2OKAA 2K8SA 4HUAA 4WETA 6GSUA 4OMVA 3DMLA 4NV5A 1BX9A 3UAPA 2CZ2A 1AQXA 2XPDA 1U3IA 3MNGA 2CZ3A 4WBRD 1OYJA 1GSEA 1GTUA 3HJMA 4MH3A 1F9MA 4KDUA 3DWVA 1YDKA 5ID2A 3IXRA 5KN2A 3ERGA 4NXIA 4L5OA 4Z7XA 4Q5RA 1U87A 2CA8A 5F8BA 3L9VA 4WF5A 1VF2A 1QXHA 3UL3A 3RBTA 4ZL7A 1THOA 2VCXA 1OC3A 1J08A 2P31A 4GCIA 1XWKA 2FWGA 4KNDA 4HQZA 4TW5A 2WGRA 1OKDA 3LJRA 4OO5A 4ECJA 5J41A 1GTAA 3TJGA 4G2EA 3L9SA 1FB0A 2IIYA 2VCTA 4KAEA 4GLTA 3ZTLA 2E0QA 3GFKA 5GAND 1XCCA 4IS0A 4MP4A 5J9CA 5IOWA 1M2AA 2WULA 3O6TA 3ZVJA 1BQ7A 2EC4A 3IV4A 5KN1A 3TJFA 2LUSA 4OCEA 1WWJA 3G7JA 3D4MA 1Q98A 2QKEA 1TRVA 2PPTA 4RUVA 4EXJA 1AW9A 2H6XA 2LV3A 2FWEA 3GSTA 1AQWA 5FWGA 4IJIA 1M7TA 4F0CA 3EINA 3FHKA 3PH9A 3F4SA 1X5DA 3DYRA 2FHEA 1GLQA 4O7HA 2I81A 2H1AA 1AAZA 1XFLA 1R5PA 3E3EA 1EGOA 4IVFA 2TRXA 2FGXA 1V58A 3HJPA 4MF6A 4WKWA 3KGKA 2YWMA 1ZCPA 3L4NA 1T00A 1FOVA 3ED3A 3WGXA 3UARA 2OADA 2GS3A 2HT9A 1V98A 3CSIA 3APQA 3QAVA 5AISA 3DKSA 3TRPA 4ZB6A 3SBCA 2DJ3A 2C0FA 2OJLA 2GTUA 22GSA 2O87A 3TRQA 1AIUA 2YOIA 1A0RP 3NIVA 2YV9A 4K9ZA 2LS5A 4LLRA 2X64A 2DJ2A 4FO5A 3NOFA 1ERTA 1IYIA 1TK8B 1R5AA 2LJAA 2RUFA 5IMZA 3M0FA 6GSYA 2J23A 2PERA 1SKRB 3M9KA 2L6CA 1XW9A 2KHPA 1O6JA 1OC9A 1ZYQB 4KW6A 5CNWA 1QK8A 3ZYWA 4V1Ap 1B9YC 4BWQA 5B8BA 1TK0B 4AGSA 4JBBA 5ECLB 3LGCA 1GP1A 4MH2A 3IK7A 4O92A 4GTUA 2H75A 2YANA 1OC8A 1ON4A 2H19A 1EV4A 1OE7A 4MZCA 4OFNA 4KX4A 3I43A 3ZMLA 2MMNA 2N5AA 3QOUA 1BJXA 5KN0A 2PMTA 2AB6A 1LBKA 4LMVA 3H93A 3I6AA 1O81A 5G5EA 3NZNA 19GSA 2C4JA 1HYUA 1GULA 3EU3A 1UN2A 3C1SA 5IMFA 2LNTA 4PUAA 1GSYA 1QFNA 5FT3A 1URMA 4OWYA 4RQXA 2L57A 3HCZA 2M72A 3US3A 3EYTA 2HI7A 1TJDA 2MMZA 2KUCA 1EOHA 1TOFA 3WYWA 3TDGA 5IMVA 4BPYA 3E0UA 1OC9B 3APOA 4HEA2 1PMTA 4HDEA 1JZWA 2YV7A 2YPMA 1S3CA 2E2GA 4ZL8A 3L0HA 4ID0A 2NDOA 3ME7A 4TOPA 2BJXA 2EIOA 2LJRA 3RPPA 2OBKA 2KP1A 4GF0A 4ZBBA 3FZ5A 1PSQA 1W4VA 5D96A 3ME8A 5G30A 5IQYA 4F9ZA 2GQMA 1T1VA 2IY2A 2JZRA 3UMAA 1B8XA 3KIJA 4K6XA 5DVBA 3IPZA 3DXBA 3WGDA 2AYTA 5IMAA 2HSHA 2H0GA 3QR6A 6GSTA 4X0XA 5CYYA 2GVPA 2V41A 1TTZA 1Z6NA 3FZAA 4LL1B 2B5EA 4XS6A 2DBCA 5GAPD 3UBLA 2MBTA 2I9HA 3KMNA 4JEDA 4PNFA 1WJKA 3HKRA 3KCMA 1GSSA 2DMMA 2WZ9A 3GMFA 3MWHA 4EF0A 4TR0A 1NHYA 1VF3A 1K0OA 3GX8A 1EZKA 2H8LA 3I9V2 3F3RA 2M46A 2IMEA 5D9VA 1O7UA 2ON7A 3TKQA 2FA8A 2HRNA 3CYNA 4MLYA 4ZXGA 1JLVA 2B5XA 3ZMKA 4KCEA 3QPMA 3FZ9A 4KCAA 1TRWA 4V2LA 6GSSA 2G2QA 3KTLA 2R6KA 16GSA 1SKSB 1XW5A 3TRXA 3KEBA 1BEDA 1J9BA 4OO4A 3JCML 1JHBA 3Q18A 2CVBA 2DIYA 1XOAA 3KTBA 1WP0A 5L71A 5J3RA 2GZZA 4Q5NA 2LRTA 2NVLA 3LG6A 3HZ8A 4YH2A 4HOJA 3KP8A 4L8EA 4ZBDA 4K0NA 2IWTA 3RPNA 1WPIA 2HFDA 2DJ1A 5CO3A 1SJ6A 3FKFA 2GSSA 1A8YA 4RI6A 4IP1A 4IQAA 4AJ6A 2IYJA 2AUVA 4WR4A 4TR1A 3CTFA 2CVKA 4KSMA 5D73A 2F3MA 5EL8A 5A4VA 1RK4A 1PKWA 1R26A 2FD3A 4PNGA 2YJ7A 5G2ZA 3SWLA 3A3TA 3RHCA 4FYUA 1EWXA 3ZREA 3QAGA 3GTUB 4EC0A 1SJZA 1YKCA 1B48A 1Z3EA 3FK8A 4KB3A 3CBUA 5E59A 1GRXA 1Z7PA 4IP6A 4N0VA 3WT2A 1XXUA 1PQNA 1XIYA 1X5EA 3LWAA 3VLNA 5F0GA 1JZRA 3LEFA 1DUGA 1ACVA 5C04A 2Z9SA 5ECSA 4OD7A 1WIKA 5HR1A 4CW9A 4I2TA 4FH8A 2N5FA 3BOAA 3DIEA 2MBSA 2DSAA 3HA9A 4XRDA 3F63A 2JL4A 1YQ1A 5D9TA 3ZZXA 3F8UA 4KGIA 1ZL9A 3U5RE 3GX0A 1F37A 5G1LA 4GXZA 1QQ2A 1CQHA 3QAWA 1SL0B 3VI7A 2R4VA 4Q5FA 1FHEA 4TR1B 3F9UA 2V6KA 5IO2A 3LYKA 5IPGA 4MZWA 1Z9HA 2J9HA 3IAS2 4MJCA 1A23A 5A4UA 5ECRB 1F6MC 3EURA 2VD1A 2H72A 3IR4A 4ECIA 3CSJA 1TRSA 1EEMA 4MPFA 2I4AA 4JR6A 4P3YB 5DQSA 3EC3A 3VFIA 2OACA 3GH6A 1R7HA 4FIWA 2PN8A 2RIIA 4ULXA 1ZZYA 4DSQA 4NWYA 2NTOA 1OKTA 3M3MA 2MZCA 3KXOA 5ELGA 1SK1A 1NM3A 2QSIA 1TDIA 1FW1A 5EVOA 1GWCA 1NW2A 1SU9A 2H73A 1ZOFA 3CRTA 3LORA 1SYRA 3AY8A 4IN0A 1ABAA 1GSQA 4ZB9A 2X8CA 2P0GA 2GZPA 1XVWA 1O8XA 3M8NA 4OCFA 2JSYA 1R4WA 1B4QA 2GDRA 2VL2C 3GV1A 2V6OA 4KE3A 1SD9A 4J57E 4TXVA 2GT6A 2I1UA 5ID2B 4POKA 4FYCA 4ZL9A 2ALBA 5JCUA 4FYBA 3PINA 3DEXA 4HZ2A 3HVVA 3J7Yk 4ISDA 9GSSA 1X9WB 4L0WA 5GSTA 1QUWA 3UOMA 1FVKA 3HJOA 4NMUA 1S3DA 5J4UA 1ILOA 1RW1A 4QL9A 4KH7A 3FW2A 1MD4A 10GSA 2PWJA 3HHVA 1K0NA 1T7PB 2H1DA 1EGRA 5JWQB 4ML6A 2VM1A 1A8LA 4MABA 3IAM2 5IOXA 4KUNA 3KD0A 1ZYEA 4HI7A 2D2ZA 1I5GA 5DJMA 1G7EA 2H1BA 3H79A 5JCWA 1S3AA 4PQ1A 1ERVA 4ML1A 2H6ZA 2H71A 2XHFA 1K0MA 4MJBA 3PGTA 2WS2A 3TKRA 2XC2A 1K0BA 1A24A 1EV9A 4K7IA 1ERUA 2X99A 4ECBA 1W89A 2N5BA 3KP9A 3UVHA 3J7Yb 1TP9A 4XTSA 4EUYA 2VL2A 2L59A 2H01A 2HZEA 2VAFA 5AN1A 2HYXA 3ISOA 2EIRA 3Q6OA 18GSA 4ECCA 2VLTA 3G9BA 4I97A 4PGTA 4TKYA 1M9BA 3UVTA 2VCVA 2CT6A 1FAAA 1PX7A 5CREA 4LMWA 1H4OA 5JCGA 4ILFA 3MAKA 1MD3A 3ZIJA 5H5QA 2YP6A 5IM9A 1CQGA 4D73A 2ON5A 1U88A 3KH7A 1SKWB 2GQKA 2RLIA 4NHZA 2H76A 5J5NA 1V9WA 1UC7A 1K0DA 1LU4A 5ECQB 2TIRA 4HS1A 3IE3A 5A5KA 1FB6A 2AHEA 1EP7A 3LXZA 5IMCA 3TJBA 4MA9A 1GH2A 3LSZA 2OE0A 1ML6A 2CAQA 5LNKe 1PL1A 1WMJA 1F3AA 4ZIJA 1M2BA 6GSXA 2B1KA 4MCUA 1M2DA 2FNOA 2C3QA 1X5CA 4YAPA 1OVNA 1A2JA 2LQQA 2JU5A 2H6YA 3VPTA 3F6DA 4MF5A 5ECKB 2KLXA 4ZB8A 2JACA 4EDZA 2K8VA 2GSRA 4I2UA 5B7CA 1RQMA 1YEPA 4GSTA 3BJ5A 1UA5A 4L5LA 4YQUA 1E2YA 4DSRA 5H5RA 3QFBC 3ZIVA 2MMAA 3RDWA 2NPBA 4GWRA 2RM6A 2B5YA 3H1NA 1HQOA 2F8FA 3I69A 1DE1A 2LQOA 2GGTA 4PQIA 2VIMA 1PL2A 3O76A 3DVWA 1NHOA 2JSZA 4D73B 5J9BA 2C3TA 2B6MA 1GSDA 2IL3A 3TGZA 4BWSA 5A4WA 1A0FA 1K3LA 1MDJA 1B4PA 2JZSA 2ZUPA 4G10A 2CX3A 1GTBA 4NPBA 3WD6A 3FR6A 3D21A 3M9JA 3F0IA 5IPHA 4YQMA 2HNLA 5HFGA 4LA1A 1JZDA 4HJMA 2HZFA 2HRFA 2V1MA 1N8JA 1TU8A 2IMKA 3U6VA 3V1WA 2H0IA 3P90A 3HXSA 3ZFBA 5AIVA 3M1GA 4WEYA 1XWGA 5EPFA 1F3BA 1THXA 4MJEA 1TI3A 2O89A 2TRCP 1V40A 3RAZA 1GTIA 2B1LA 2YCDA 3GL3A 11GSA 5F07A 2B3SA 4JRRA 2R37A 3F6FA 1MTCA
chains in the Genus database with same CATH superfamily
4MPGA 1JFUA 4PQHA 2AAEA 1T3BA 1QVG2 1X1WA 4K5SA 5IEOA 3VURA 3EWLA 1RGFA 2R3XA 3QCPA 1LNIA 2OA7A 2OE1A 3VWWA 1M9AA 2MMOA 3HD5A 4L0UA 4K2XA 4IBPA 3KZQA 1I0XA 3WOEB 4I5QA 5HR3A 3IHQA 5LD0A 5D9XA 4R80A 4WXTA 2E7PA 4K7OA 3L78A 1XVQA 1MGRA 4POLA 1PN9A 1TK5B 5F06A 2XSHB 3SOAA 4J56E 3QDNA 5B6NA 2KF5A 2YX9A 3EQQB 4XS4A 4STDA 5EQLA 1T2IA 1V57A 3A5IA 1VQL3 4XCSA 5KOXA 1B27A 2WO0A 7GSSA 2PU9C 3UJMA 2K3DA 5DREA 3D5JA 1AUCA 3LOYA 2IFQA 3D4AA 4I6XA 2F8AA 4MF7A 1FZUA 3HY2A 6GSWA 4K1FA 5DRVA 4Z2UA 2VCQA 1F2EA 3UEMA 4I4KA 1Z5YE 4ZILA 3ERFA 2KCDA 3M8CA 1UUWB 1HD2A 2O8VB 3G0KA 3RGAA 2VLVA 2ZCTA 2XFSA 2REMA 1B2ZA 1PX6A 1VQK3 3BCIA 5CF2A 1IVXA 5F05A 3A2WA 4PX1A 1BIRA 2MC8A 1MGWA 1N8R4 4F03A 4BTXA 3LQ7A 2L5OA 1GUHA 3OR5A 3FYGA 17GSA 1JRQA 4FMDA 2V2GA 3EMPA 1JB5A 2W56B 2B7JA 3Q2PA 1BU4A 1OE8A 4EIPA 4IELA 4KDYA 1UCKA 1I70A 4HJLB 4MJDA 1TU5A 1UVZA 4YAVA 1HNAA 1Y4KA 3DRNA 1RGGA 3BU4A 3DGLA 2L6DA 1SJIA 3S9FA 2XRXB 1B3SA 2SARA 5JPPA 3IDVA 2ML6A 4MJAA 2HRAA 5I97A 3P7XA 3ROBA 3X3ZA 4TR4A 3F40A 8CHOA 1O8WA 3ERWA 2H0HA 1GNWA 2M7OA 5M18A 2CAIA 2IMDA 3AHWA 1WE0A 2WJUA 3A5EA 1K0AA 4NREA 1IT7A 1ZMAA 1YY7A 2WRTA 1B2MA 3GUSA 3MDKA 5D81A 5AIXA 4QQ7A 3LMLA 4EVMA 1MWTA 3F3QA 1JNQA 1ZGNA 4QL7A 4GSSA 2P05A 2XH9A 1RGLA 5KEJA 2HMKB 4G9HA 1DMMA 3PPUA 4JR4A 4HZ4A 1RN7A 3I553 4X43A 1BYEA 4IGJA 1HNBA 1JB4A 3IJEB 5STDA 1A2KA 2RFRA 4GB5A 5G2GA 1BUQA 1D6UA 2R41A 4ZBAA 3IRAA 4XS4B 3HDCA 2KP2A 3F8XA 2YWNA 2L4QA 2RUEA 4N0ZA 1YEXA 1A2PA 2UGIA 3HYPA 1K3YA 4X1UA 1KSIA 2YWIA 1G7OA 1RRHA 3DMCA 4AJ7A 3LTCA 3LTBA 1LJRA 3ZLPA 3APSA 1JN5B 2IMIA 2C8UA 2QGVA 2HMOB 3S27A 4TR3A 3VPQA 3ZFLA 5ABRA 3N9JA 4J2FA 4HM1B 3B7CA 2CQ9A 1YI23 4MDCA 2FY6A 1FGQA 1OGXA 1E3RA 1JB2A 3URPA 8GSSA 4V2NA 5IENA 3MG2A 3D4TA 3AHSA 3WMDA 1SIHA 3BBYA 4BL2A 3VWXA 2L1SA 5GSSA 4CPKA 3LXTA 1US1A 5GZZB 1FVJA 3I563 1CH0A 1RTUA 2CVDA 3FRCA 1I2FA 3MPHA 5AYRB 2P5QA 3G6E3 4R4KA 2DMLA 4XS1A 3UIWA 1T8EB 1JLWA 4K90B 3DVXA 5ECHB 3TKSE 2FWHA 1ZYPA 2WCIA 1RSNA 3C71A 2DJKA 1OAZA 1VRSD 1VQQA 5FHIA 1NSWA 1M3JA 4XDVA 2ES7A 4GQCA 1EP8A 3K7CA 2DJ0A 3AMOA 2DLXA 1GSUA 2K6VA 1CYUA 2GT5A 4KFDA 1PKZA 2VD0A 4EE0A 3ZVJD 3SEDA 4RNYA 5DBQA 1QALA 5AGYA 4N6UA 2LRNA 1ZGXA 4BVYA 4WBJA 1XOBA 1NB3I 1RKYA 1FO5A 1XWBA 4GQFA 3U97A 4F82A 4OFTA 3PR8A 4AJ8A 1KWIA 2F56A 1BANA 3C1RA 4DSSA 2F9SA 4IKHA 2CKFB 4WF4A 1VF1A 4AKYA 3BNDA 3GKNA 4POMA 1XG8A 4HZ9B 4V2MA 3NBJA 2CV4A 2DIZA 3GWRA 3PXMA 4J5KA 5JWOB 1Z6MA 2I3YA 3HK4A 1BSBA 1T4ZA 3EE2A 1O73A 3MSOA 4HU7A 3VWVA 1WNHA 1OHOA 1W6GA 2IMFA 2O85A 4KSOA 4PUFC 2A4VA 3GYKA 1BG5A 2CWUA 3TOTA 1O7WB 3A2VA 3IA1A 1YJN3 3KMOA 2R0PA 2ZNMA 3KH9A 3ZITA 5CAXA 1ERWA 3R3EA 3QMXA 2IPAA 2QC7A 2HOHA 1E3VA 2GU1A 3W8SA 3DGNA 2MYGA 4TX4A 5CRGA 1GUKA 4K8MA 1IYYA 2VL3A 4POBA 3FLJA 3TJJA 4DEJA 2GLRA 4K5RA 2FWFA 2DJJA 2C4BA 5ECIB 2GSPA 4KVHA 2FCHA 3EB8A 5INYA 3GZBA 2C0EA 3FR9A 5JWRB 4EO3A 3TKSC 1PRXA 1DYUA 1BAYA 4GSPA 1IYHA 3GN3A 1NWWA 4DVCA 3UL6A 1PA3A 4TRXA 1QGVA 2GSQA 2PGTA 1PGTA 2OWPA 1VGLA 2XBIA 3CNXA 2PUKC 2F98A 4I8BA 2M80A 2R2JA 4G0IA 1BRSA 1X9SB 1YF1A 3AMOB 13GSA 3VI5A 2BT3A 4PXOA 1XZOA 3UJ1A 2YZUA 2PVOC 3KJYA 3HVSA 1BNFA 3Q74A 4K7NA 1R4CA 3EN1B 2E2MA 3ZFZA 5ECNB 4Z2RA 2A2RA 4MNNA 3FR3A 3GL5A 1RGCA 3GKXA 4BVYB 3FF2A 3D0ZA 3UBKA 3ZRDA 1TRPA 3W8JA 4GRFA 4WWUC 3LYGA 3HVXA 3HI7A 2VO4A 3VK9A 1DBYA 1Q824 3E99A 4DSSB 1N8QA 3D22A 5JBSA 4EV5A 1YKAA 2X8GA 5ECMB 5B6MA 1RDSA 1HYFA 2VCZA 1VQ63 1GD4A 3MYTA 2EIQA 3C73A 1RGHA 2KOKA 1ZS7A 4F0BA 2P38A 3VSYA 5D8IA 3IBHA 2WGQA 1NU3A 2CX4A 4RI7A 4XRAA 1Y6EA 3RGRA 1N9JA 3FG4A 1WOUA 2RNTA 1TI1A 3N5OA 1IV7A 1T2HA 3TKSA 3F4RA 2CX0A 2L5LA 3A5WA 5AYSC 3QD9A 1FW7A 5HR2A 4AF2A 5HFKA 2XPEA 1YF0A 1IV9A 3IK9A 4H86A 4XIHA 2A2PA 2BMXA 1Y25A 4HM2B 4HVNA 3LW9A 4OFMA 2W6JH 3KZTA 4V1Ag 3CCJ3 5B8AA 4N30A 1SENA 4TN8A 3DD3A 2HE3A 3CD63 3LZAA 2VLUA 4GSNA 2BO9B 1TKDB 2HMNB 4O3VA 3EHCA 1LRAA 2P5RA 3SXXA 1IU7A 1USBA 1UCJA 3HIGA 2XBQA 5DDLA 4IHUA 5D9WA 1W5ZA 4LL4B 2VCWA 2O7KA 1FGMA 2GSTA 5AIHA 4JE1A 3KSPA 2RCDA 2L4CA 4MMMA 1IVVA 2YFLB 2VUPA 1SL2B 3CCM3 2B1XB 3CSHA 2LKUA 1GNEA 5IW9A 1ST9A 1W02A 3TB2A 1OACA 4QWTA 1M1K4 1GOVA 4NAXA 3FZ4A 2FNQA 5CRDA 4IJ3A 1A2LA 1GMPA 5ECPB 5IG5A 3TUEA 4EIQA 3NHXA 5ENUA 1CQSA 3HIIA 3H4KA 3S67A 3GSSA 1KEBA 2GZYA 1K734 1Q7Y4 3PCRA 4WFOA 4N11A 1F8NA 3GRDA 5EVHA 2FA4A 5DJLA 1U3AA 5LCZA 5CP1A 3KFQC 1SQWA 3H51A 3SX1A 1H75A 3GH9A 3JUNA 3TOUA 4Q5QA 1AY7A 2CK3H 1A90A 3ZL5A 4HBRA 1AC1A 3EVIA 3X3XA 1O7HB 1MWRA 2LSTA 4FQUA 4YQVA 1VQP3 2HZEB 1MNLA 1QMAA 4BL7A 4E8HA 2LRCA 2CWVA 1GUMA 2DC5A 5IIZA 1G02A 4JZQA 4MZBA 1X0RA 3NBRA 2H74A 3CMIA 3GKMA 5DALA 1BRNL 1WQLB 2FLSA 3K8NA 3EU4A 4MK3A 3LYPA 4HAAA 4HQSA 12GSA 4KA0A 4HM7B 3D6IA 3A2XA 3N8BA 2LNSA 1YVBI 4XB5A 1VF4A 4EL1A 2O9UX 1FUTA 1KTEA 2LEGA 5DQYA 3KM6A 4FR9A 3K63A 4CHSA 1O85A 1WMOA 2A2SA 1J0FA 3CCL3 3O3TA 1YJ93 2IN3A 4KFFA 5IO0A 5KP3A 3U1WA 2OBIA 5KN3A 4IW9A 3H8QA 4RQRA 4O32A 1BSAA 1GY7A 2OOVC 5E4WA 5IEPA 2X8HA 1AQVA 5AIGA 1N9EA 3GNJA 1G0TA 1G96A 1W2ZA 5BU4A 3CXGA 1TU7A 3B4OA 2W2CA 3C7MA 1A2MA 5DCHA 1DE2A 1GSFA 3GRXA 4TVEA 2GEYA 2FGTA 1X1YA 3IOSA 3LT9A 2FUG2 2VOCA 3G16A 3F14A 4NHWA 3FEUA 3R2QA 1SYXA 1WRYA 1XWCA 3C8EA 1KNGA 3WT1A 3Q90A 1BRGA 3EN8A 2INXA 4E8EA 4TXOA 1TXXA 1M99A 1ROVA 1V2AA 4K2DA 2WGOA 2F51A 2HLSA 4XBTA 1T4YA 1G6YA 5DCGA 1GD3A 4PURA 1M1XB 3A76A 4ACSA 2MF7A 1O7NB 2BMQB 1K0CA 1LNHA 3VWUA 4BVXA 5D93A 2QGUA 4BA7A 3F4TA 5HQPA 2LJKA 2AAWA 3RHBA 1XPVA 2K18A 3GTUA 3MWZA 3G7IA 1FG4A 1SK0A 1TRUA 1TW9A 2H30A 4N6LA 1GYBA 2JADA 2YWOA 5DALB 4EKZA 5BMUA 3EMXA 20GSA 2NBSA 3TKPA 3CC73 3CRUA 4N10A 2PVQA 3NV0A 3HZ4A 2STDA 1EOGA 2C1YA 1YJ6A 1FYSA 2Z7AA 4FMAA 5DAKA 4BU4A 2YJHA 1QAFA 3W6GA 4IT7A 5C00A 4WHAA 2OOVA 3BD2A 3CTGA 1WMNA 4EW5A 1ISKA 5KP1A 2HMJB 2VM2A 3WGEA 4J5GA 2R5GA 2RM5A 3Q19A 3CU3A 1BSCA 3FY7A 2H66A 3GHAA 4WR5A 2PBJA 3DY5A 2H1GA 1B9XC 4BTYA 1XWAA 1NJI4 3GKKA 3QFAC 1XW6A 2V32A 1BUJA 5HFIA 1K3OA 1AVKA 5BIRA 2HXKA 1NNVA 4JU5A 3TCOA 2J8XB 4NV2A 1N2AA 1O7PB 4XHMA 5G5FA 4PTSA 4K1UA 1MDKA 3BCKA 4K0GA 5IMDA 1ZO2A 5CK6A 5HGRA 1LQMB 3E9JB 1Q4JA 1QMVA 1S3RA 4O5RA 4AEQA 4CDOA 1YHQ3 2ML5A 1I9DA 3WA2X 4TXOB 1MWUA 1STDA 3FG3A 5CRHA 1KBNA 5HR0A 5ECOB 2G0FA 4X2HA 1JZOA 2K9FA 5ELAA 2GBXB 1PU4A 1U6TA 1ZX2A 1G6WA 2C0DA 1WTHA 4KDXA 2HSMA 1EQKA 3G7YA 1VQ93 2C3NA 5EY6A 6GSVA 3L9UA 1SK2A 2GQLA 4BVXB 1X9MB 1JJ22 3GIXA 2YNXA 5G31A 5G1KA 1SD8A 1MEKA 2AV4A 4F2IA 1HNCA 1M0UA 1C72A 1C54A 2WB9A 2WFCA 5BRTA 3HOHA 3N9HA 2C0GA 4EDYA 2B7KA 4HU9A 1IQXA 5COHA 2WDUA 3TJKA 3D5GA 3NV0B 4CY8A 2IJYA 1RGEA 1YZXA 4HSCX 4H61A 2FXTA 1DSBA 1MDIA 1I0VA 1W2B2 1Z7RA 2C80A 5DAKB 5AIIA 1BSEA 1E6BA 14GSA 4HJ2A 4L8PA 3LFLA 2Q07A 1GL8A 4J9AA 2V1LA 1GLPA 3GURA 3BNBA 1XBSA 2YN1A 2VL9A 1AR0A 2X49A 1SL1B 1LOWA 1AXDA 4G19A 5H5SA 2CWTA 3F8HA 3DGQA 3PZWA 2YZHA 2LTKA 3ZG5A 2WOHA 3HVNA 1GS3A 3P8WA 3GA4A 4USSA 1PD21 4IQ1A 3VGNA 1W6CA 1VZZA 4JF8A 1EEJA 5CRWA 2BTOT 3P2AA 3IC4A 3K9MC 3MSZA 2AJQB 1BRJA 2HSYA 2IFQB 2H70A 2JZTA 3CC23 1U5OA 1EG9B 3BIRA 2OE3A 5FGOA 2UUGC 2OKAA 2K8SA 4HUAA 4WETA 6GSUA 4JRFA 3DGYA 4OMVA 1Q40A 3DMLA 4NV5A 1BX9A 3UAPA 2OCTA 2CZ2A 1AQXA 2XPDA 1U3IA 1W00A 3MNGA 2CZ3A 4WBRD 1RGAA 2B24B 2BU4A 5BVBA 1OYJA 1GSEA 1GTUA 3HJMA 4N6V0 4MH3A 1F9MA 4KDUA 3DWVA 1YDKA 5ID2A 4HM6B 3IXRA 5KN2A 3ERGA 4NXIA 2I9WA 3LH4A 1BOXA 4L5OA 4Z7XA 4Q5RA 1OF5A 1U87A 2CA8A 5F8BA 3L9VA 1W4NA 2W04A 4WF5A 3BNCA 1VF2A 1QXHA 3UL3A 4HOHA 1YGWA 4L7KA 3RBTA 2KAAA 1DE3A 4ZL7A 1THOA 3KKGA 2VCXA 1OC3A 1J08A 4X4JA 2P31A 4GCIA 1XWKA 2KF3A 1S723 1Q9EA 4YKFA 2FWGA 4KNDA 4HQZA 2C10A 4TW5A 3K0ZA 2WGRA 1OGZA 1OKDA 1BGSA 4XBYA 3FSDA 4PEJA 3LJRA 1DMNA 4OO5A 4H3UA 4ECJA 5J41A 1GTAA 3TJGA 4G2EA 3L9SA 4CJNA 1L5GB 3T8UA 1FB0A 3UNLA 2IIYA 1IQYA 2VCTA 3FCSB 4KAEA 4GLTA 3ZTLA 2E0QA 3GFKA 5GAND 1XCCA 2HRKA 4IS0A 1GOUA 4MP4A 5J9CA 5IOWA 1M2AA 2WULA 3O6TA 3ZVJA 3T8NA 1HZ1A 4EV2A 2XR8B 1BQ7A 2EC4A 4LMIA 2XSOB 3IV4A 1RLSA 2LUSA 5KN1A 3TJFA 4OCEA 1WWJA 3G7JA 3D4MA 3F7SA 4LZIA 1IDPA 1Q98A 2QKEA 1TRVA 1BVIA 2PPTA 4RZMA 4RUVA 1RRLA 2RGQA 4BTWA 1AW9A 2R0CA 4EXJA 2H6XA 2LV3A 5CLKA 1K28A 4G0KA 2FWEA 3ECFA 3GSTA 3V98A 3NM2A 1AQWA 5FWGA 4IJIA 1M7TA 3JUOA 3KIIA 4F0CA 3EINA 3FHKA 3PH9A 3F4SA 4LSOA 1Q40B 4N6NB 1X5DA 3DYRA 2F4YA 2FHEA 2CG0A 1Q42A 1DVDA 2CW9A 5IERA 1GLQA 1PFPA 4O7HA 2XGNA 3CC43 2I81A 2P0XA 1LOYA 2H1AA 1AAZA 1XFLA 1OF5B 1KD14 1R5PA 1BNIA 3JUMA 3E3EA 1EGOA 4IVFA 1ASKA 1BSDA 2TRXA 2FGXA 1V58A 3HJPA 3FH1A 4MF6A 4N6OB 2OQEC 4WKWA 3KGKA 2W03A 1ZCPA 2YWMA 3L4NA 1T00A 1FOVA 3ED3A 1I3FA 1PN0A 3BB9A 3WGXA 3UARA 2OADA 2GS3A 2HT9A 1V98A 3CSIA 1B2XA 1HU9A 3OV4A 1IK3A 3APQA 3QAVA 5AISA 1DVCA 3DKSA 3TRPA 1JBSA 4ZB6A 3BLZA 8RNTA 3SBCA 2DJ3A 1S5AA 2D42A 2C0FA 2OJLA 2GTUA 22GSA 1IQ8A 2O87A 3TRQA 3D9RA 4Z2TA 1AIUA 2YOIA 1A0RP 3NIVA 2YV9A 3RNTA 4K9ZA 2LS5A 3GZXB 4LLRA 2X64A 2DJ2A 4FO5A 5FW5A 4R9KA 3EJVA 3JUQA 2WOFA 4HKVB 3NOFA 1ERTA 1IYIA 5AI1A 1TK8B 1R5AA 2LJAA 2RUFA 5IMZA 3M0FA 6GSYA 2J23A 2PERA 7GSPA 1SKRB 3M9KA 4O5QA 1K9M4 2ZHXB 2L6CA 1XW9A 2KHPA 3H3HA 5JPUA 3PCSA 1O6JA 1OC9A 1ZYQB 4KW6A 5CNWA 1QK8A 3ZYWA 1SARA 4V1Ap 1B9YC 4RNTA 4BWQA 5B8BA 2BMRB 2W9QA 5HOHA 1TK0B 4AGSA 4JBBA 1D6ZA 2XEPA 5ECLB 3LGCA 4OVMA 1M9GA 1N5PA 1GP1A 4DKIA 4MH2A 4HM5B 3IK7A 4O92A 5M1AA 1PY3A 4GTUA 2H75A 1O7MB 2OQEA 1WMPA 1J2BA 3X40A 3X3YA 2YANA 1FGTA 1VQ83 1JKGA 1TIJA 1OC8A 1ON4A 2H19A 3OW22 5CF1A 4K1VA 1EV4A 1OE7A 4MZCA 4OFNA 4KX4A 3I43A 3ZMLA 1RCLA 2MMNA 2N5AA 3QOUA 1BJXA 5KN0A 2PMTA 2AB6A 1LBKA 4LMVA 3H93A 3I6AA 2RSXA 2XGLA 4HM0B 3N54B 4WYKA 1O81A 3NZNA 2GEXA 5G5EA 1AQZA 3DZLA 19GSA 2C4JA 1BRIA 1YVSA 4KT3B 1U8CB 1HYUA 3S5CA 3WR2A 1GULA 4KF9A 3EU3A 1YGEA 1UN2A 3C1SA 5IMFA 4O8SA 2SBLA 2LNTA 4PUAA 1GSYA 1QFNA 5FT3A 2PZVA 5IG4A 1URMA 4OWYA 4RQXA 3LTAA 2YFJB 2L57A 3HCZA 2M72A 3US3A 3EYTA 2QEX3 3OXAA 2HI7A 1RCKA 1TJDA 2LYXA 3GAXA 2MMZA 1LOXA 2KUCA 1EOHA 4BL3A 5IF6A 1TOFA 2D1WA 4A5PA 3WYWA 3TDGA 3Q3FA 5IMVA 2UX0A 4BPYA 3E0UA 5ELJA 1D6YA 4BIRA 1OC9B 5M19A 3APOA 4HEA2 1PMTA 4HDEA 1JZWA 2Z77A 2YV7A 2YPMA 3WOFB 1S3CA 3T0UA 2E2GA 4ZL8A 2DKHA 3L0HA 4MMXB 3WODG 5AEUB 4ID0A 2NDOA 3ME7A 4TOPA 2CHCA 3IMAB 1GSPA 2BJXA 4X2OA 3L0RA 4LGQA 2EIOA 2LJRA 2R0GA 4HM3B 2OBKA 3RPPA 2KP1A 4GF0A 4ZBBA 3FZ5A 1PSQA 1W4VA 1X1XA 4U13A 5D96A 2KRTA 3DUKA 4EC6A 3ME8A 5G30A 5IQYA 4F9ZA 2GQMA 1I2GA 4MMYB 1T1VA 2L4VA 1PFOA 1JKGB 2IY2A 1QVF2 1JBRA 2JZRA 3UMAA 3D5IA 1B8XA 3KIJA 4K6XA 5DVBA 3QK9A 2A4HA 3IPZA 3DXBA 3WGDA 2AYTA 5IMAA 2HSHA 2H0GA 3QR6A 6GSTA 3X41A 4X0XA 5CYYA 2GVPA 2V41A 1TTZA 1BRHA 1Z6NA 3FZAA 1DMQA 4LL1B 2B5EA 4WYKB 4XS6A 3MYDA 7STDA 2DBCA 5GAPD 4KFEA 3CXC2 3UBLA 2MBTA 2I9HA 3AGNA 3KMNA 4JEDA 4R1KA 4PNFA 1WJKA 5AIFA 3HKRA 3KCMA 4N6MA 1GSSA 2DMMA 2RBIA 2WZ9A 3GMFA 5EEOA 5KP4A 1V74A 2XFTA 3MWHA 3G713 1ULIB 1MOLA 4EF0A 1OUNA 4TR0A 4BL7B 2W56A 1NHYA 1VF3A 1A67A 1K0OA 3GX8A 1EZKA 2H8LA 3CCQ3 4MMZB 3I9V2 3F3RA 2M46A 2IMEA 5D9VA 1O7UA 2ON7A 1MWSA 3TKQA 3NM7A 4ORLA 2FA8A 2HRNA 4GHOA 3CYNA 3EC9A 3MHEA 4MLYA 4ZXGA 4NHFA 3QRDA 1JLVA 2B5XA 3ZMKA 3LTDA 4KCEA 3QPMA 3MKIA 3FZ9A 4KCAA 1W6YA 1TRWA 4V2LA 6GSSA 2G2QA 1FGRA 3KTLA 2R6KA 4RNZA 16GSA 1N5HA 2QA2A 1SKSB 3BNEA 4FCMA 1XW5A 1CEWI 3V92A 3TRXA 3KEBA 2Z6BA 3PS8A 1BEDA 1J9BA 4OO4A 3JCML 4HZBB 1JHBA 3Q18A 1UUVB 2GBWB 2CVBA 2DIYA 1XOAA 3GZYB 3KTBA 1WP0A 5L71A 5J3RA 1A2VA 2GZZA 2E2VA 3KE7A 4Q5NA 2LRTA 2NVLA 1TFOA 2QA1A 3LG6A 5TGNA 2CFLA 3LT8A 3SLUA 3HZ8A 5D83A 1BNJA 1UI8A 3KP8A 4HOJA 2O3OA 4L8EA 4YH2A 4ZBDA 4K0NA 1QAKA 4XDWA 2IWTA 1BNSA 3RPNA 3NUVA 1WPIA 4J8TA 1BRKA 2HFDA 1JN5A 3SYUA 2DJ1A 5CO3A 1SJ6A 5GSPA 3SVAA 3FKFA 2GSSA 1A8YA 4RI6A 3DGOA 1TRQA 4IPBA 1TTOA 4IP1A 4IQAA 4AJ6A 2IYJA 1RHLA 2AUVA 4WR4A 4N3VA 4TR1A 3CTFA 2CVKA 4KSMA 5D73A 2F3MA 5IG0A 5EL8A 5A4VA 1OPYA 3OWUA 3DXOA 1RK4A 1R26A 1PKWA 4YKGA 2FD3A 1JV2B 4PNGA 1B2UA 4ZM8A 2YJ7A 5G2ZA 3SWLA 1FA3A 3A3TA 2XF3A 3RHCA 4FYUA 1LQGC 1EWXA 3ZREA 4R9LA 3QAGA 3GTUB 2KXGA 1Z1SA 1EUIC 3IC8A 4EC0A 5KOWA 1AV4A 1SJZA 1YKCA 1B48A 4WP5A 1Z3EA 1GOYA 2JQ5A 3FK8A 3WA3A 2KF4A 4KB3A 3CBUA 5E59A 1GRXA 3CCE3 1Z7PA 4IP6A 4N0VA 3WT2A 3ALAA 3X42A 1XXUA 1PQNA 1XIYA 2P09A 1ULJB 1X5EA 5AEWB 3LWAA 3VLNA 1SIIA 3CCV3 5F0GA 1VQN3 1VQO3 3NXJA 1JZRA 3AGOA 1B20A 2LQVA 3B8LA 3FKAA 4IIAA 3LEFA 3B4PA 1DUGA 1RN4A 1VQM3 2HMLB 1K41A 3EX9A 1ACVA 5C04A 2Z9SA 5ECSA 3FG1A 4OD7A 3D3LA 3CCS3 1WIKA 2ZA4A 5HR1A 4CW9A 4I2TA 4FH8A 2QA43 1B21A 2R4IA 6GSPA 1W7CA 2N5FA 3BOAA 3DIEA 1OH0A 3EE1A 2AADA 2MBSA 3OX9A 2DSAA 3HA9A 3JUPA 3F63A 2JL4A 4XRDA 1YQ1A 5D9TA 3ZZXA 3F8UA 1OCVA 4KGIA 1ZL9A 2PNCA 3U5RE 3GX0A 1UI7A 1F37A 5G1LA 4GXZA 1QQ2A 1CQHA 3QAWA 2CH9A 1SL0B 1Q864 3VI7A 1GMQA 3MG3A 2R4VA 4Q5FA 1FHEA 3O8YA 4TR1B 3F9UA 2V6KA 1EKMA 2A15A 4EYCA 5IO2A 3LYKA 5IPGA 3ZG0A 1BNRA 4MZWA 1Z9HA 2J9HA 3IAS2 2KF6A 1ROAA 4CCVA 4MJCA 3NBBA 3G8ZA 1A23A 5A4UA 5LC7A 5ECRB 6RNTA 5RNTA 1F6MC 3CQFA 3EURA 2VD1A 2H72A 4EBGA 3IR4A 4O2HA 1JBTA 4ECIA 3CSJA 1TRSA 4BIKA 3HX8A 1EEMA 4MPFA 2BHMA 4XBXA 2I4AA 4JR6A 2E2UA 4P3YB 1W01A 5DQSA 3EC3A 3VFIA 2OACA 4FMBA 3GH6A 1R7HA 4FIWA 2PN8A 3MG1A 2RIIA 3FMWA 1TFKA 1ZZYA 4ULXA 4EXRA 1YIT3 1OHPA 4DSQA 4NWYA 2NTOA 1OKTA 3M3MA 3MIXA 2MZCA 3KXOA 5ELGA 1I3IA 1SK1A 3PGBA 1STFI 3FGYA 5ELUA 1NM3A 2QSIA 1TDIA 2CFWA 2W0QA 2ZDJA 1O7GB 1FW1A 5EVOA 1GWCA 9RNTA 1NW2A 3OWSA 1RMSA 1BNEA 1SU9A 2H73A 1R4YA 1ZOFA 3CRTA 1UUGB 3NQZA 3LORA 1SYRA 3J7Yd 3AY8A 4IN0A 4FCZA 1ABAA 4O5UA 1GSQA 4ZB9A 5IG3A 2X8CA 4GL6A 1BAOA 2GZPA 2P0GA 2ZL8A 2CC3A 1XVWA 1O8XA 3KCHA 3M8NA 1RN1A 4OCFA 2JSYA 1R4WA 4HM8B 3KSED 1B4QA 2GDRA 2VL2C 1SPUA 1C7HA 3GV1A 2V6OA 4K61A 3STDA 6STDA 4KE3A 1SD9A 4J57E 1T5YA 1UW1A 4TXVA 3FZWA 2GT6A 2I1UA 4G1MB 5ID2B 3EBYA 4POKA 4FYCA 4ZL9A 2ALBA 1YNVX 5JCUA 4AKZA 4FYBA 3JVCA 3CME3 3PINA 3DEXA 4HZ2A 2CFDA 2QIYA 3HVVA 5LC6A 3J7Yk 3CPW2 4ISDA 2CFGA 9GSSA 1UCIA 1X9WB 1IVUA 4L0WA 5GSTA 1QUWA 1Q7HA 2DKIA 1FVKA 3UOMA 4Q53A 3HJOA 4NMUA 1S3DA 5J4UA 1ILOA 1RW1A 2K0MA 4QL9A 4KH7A 3FW2A 1MD4A 10GSA 2PWJA 3HHVA 1K0NA 1T7PB 2H1DA 1EGRA 5JWQB 1RNBA 4ML6A 1I8VA 2VM1A 1A8LA 5BXQA 2P0MA 4MABA 3IAM2 4OUQA 5IOXA 4KUNA 4RBNA 1QJGA 4L8OA 1ZYEA 3KD0A 4HI7A 2D2ZA 1I5GA 5DJMA 1BNGA 1G7EA 2H1BA 3S29A 3H79A 5JCWA 1S3AA 2GU3A 1FGOA 2IUJA 1IT8A 1ERVA 4PQ1A 4ML1A 2H6ZA 1PYLA 2H71A 3GZRA 2XHFA 1K0MA 4MJBA 2GXFA 3PGTA 2WS2A 3TKRA 3FF0A 3KN4A 1KQS2 2XC2A 1K0BA 1A24A 1EV9A 4K7IA 3DH2A 1ERUA 2X99A 3VF1A 3NX0A 4XM4A 4CY6A 3DGMA 5CXOA 1W89A 2N5BA 4ECBA 1YIJ3 5D82A 1RNTA 1ZYNA 3KP9A 1UDII 3UVHA 3J7Yb 1TP9A 3IPTA 4XTSA 4EUYA 2VL2A 2L59A 2H01A 2HZEA 2VAFA 1K8A4 5AN1A 2HYXA 3UB1A 3ISOA 2EIRA 1RJOA 3Q6OA 18GSA 4ECCA 2VLTA 3G9BA 4I97A 4PGTA 7RNTA 1HKXA 4G0LA 3SOYA 1M9BA 4TKYA 1E97A 3UVTA 2VCVA 2CT6A 1FAAA 1PX7A 1LXEA 5CREA 4LMWA 1H4OA 5JCGA 4LEHA 4ILFA 3MAKA 1MD3A 3ZIJA 4N6TA 5H5QA 3G4S3 2YP6A 5IM9A 2BMOB 3CMA3 1LVNA 3OWYA 1CQGA 4CDLA 4LYLB 4D73A 5A0OB 2ON5A 1U88A 3S28A 3KH7A 1SKWB 4OK0A 2F5WA 2Y74A 2GQKA 2RLIA 4O02B 4NHZA 1FUWA 1NDOB 2H76A 5J5NA 1I2EA 1V9WA 1FOHA 1UC7A 1K0DA 1LU4A 5ECQB 2TIRA 4HS1A 3NQYA 3IE3A 5A5KA 1FB6A 2AHEA 1EP7A 1GY5A 3LXZA 5IMCA 3TJBA 4MA9A 1GH2A 3LSZA 2OE0A 1ML6A 1IVWA 1UCLA 1GMRA 2CAQA 5LNKe 2E2TA 3PYJA 2F99A 1PL1A 1Q814 1WMJA 1F3AA 4ZIJA 1M2BA 1TUHA 6GSXA 2B1KA 4MCUA 1M2DA 1KC84 2IMJA 2YFIB 2FNOA 2F86B 2C3QA 2IA7A 1X5CA 3F9SA 4YAPA 2UZ8A 1OVNA 1A2JA 1EA2A 2LQQA 2JU5A 1DETA 2IUKA 1UGHI 4HM4B 2H6YA 1SJWA 3VPTA 3F6DA 4MF5A 5ECKB 3D79A 2KLXA 4ZB8A 2JACA 4EDZA 2K8VA 2GSRA 4I2UA 5B7CA 1UGIA 1VQ43 1RQMA 1YEPA 4GSTA 3GSPA 3BJ5A 2K54A 1UA5A 2CIUA 4L5LA 4YQUA 1E2YA 3CCU3 4DSRA 5H5RA 3QFBC 3K5TA 3ZIVA 2MMAA 4ICYA 3RDWA 2NPBA 1B2SA 4GWRA 2RM6A 2B5YA 3CCR3 3H1NA 3IHGA 1HQOA 2F8FA 2Y73A 3I69A 1DE1A 2LQOA 1NO3A 3HZPA 3CNMA 2F5MA 1AVLA 2GGTA 4PQIA 2VIMA 4HYZA 1PL2A 2JDIH 3O76A 3WDGB 3I0YA 3DVWA 1NHOA 2JSZA 2CX1A 2X4AA 4D73B 2C11A 5J9BA 2C3TA 2B6MA 1RGKA 1GSDA 1M3IA 2IL3A 3V99A 3TGZA 2HMMB 4BWSA 5A4WA 1A0FA 1K3LA 3ER7A 2W9PA 2CG1A 1MDJA 1B4PA 2OTL3 2JZSA 2ZUPA 4G10A 2CX3A 1GTBA 4NPBA 3WD6A 3FR6A 2BNGA 1M904 3D21A 3M9JA 3F0IA 5IPHA 2CFKA 3EF8A 4YQMA 2OTJ3 2HNLA 4KZ1A 4FMCA 3EPTA 4LA1A 5HFGA 1JZDA 4HJMA 2HZFA 1VQ53 1LOVA 2HRFA 3CPOA 2V1MA 1YJW3 1N8JA 1VQ73 1TU8A 2IMKA 3Q1CA 3U6VA 3DM8A 2H0IA 3P90A 3HXSA 3V1WA 3ZFBA 5AIVA 3M1GA 4WEYA 1XWGA 5EPFA 1NB5I 1X1UA 1F3BA 1THXA 1FUSA 1GY6A 3UL5A 3EBTA 4MJEA 1TI3A 2O89A 2TRCP 1V40A 4FCJA 3RAZA 1GTIA 2BIRA 3WHOA 1CYVA 3F7XA 2B1LA 4MEIA 2YCDA 3GL3A 11GSA 5F07A 1OHSA 1TP6A 3RDEA 2B3SA 4JRRA 2R37A 3F6FA 2Z76A 1MTCA 3LXUX
chains in the Genus database with same CATH topology
4MPGA 1JFUA 4PQHA 1T3BA 4K5SA 3VURA 3EWLA 2R3XA 3QCPA 2OA7A 2OE1A 3VWWA 1M9AA 2MMOA 3HD5A 4L0UA 4K2XA 4IBPA 3KZQA 4I5QA 5HR3A 3IHQA 5LD0A 5D9XA 4WXTA 2E7PA 4K7OA 3L78A 1XVQA 4POLA 1PN9A 1TK5B 5F06A 4J56E 3QDNA 5B6NA 4XS4A 1V57A 3A5IA 4XCSA 5KOXA 7GSSA 2PU9C 3D5JA 1AUCA 2IFQA 4I6XA 2F8AA 4MF7A 3HY2A 6GSWA 4K1FA 4Z2UA 2VCQA 1F2EA 3UEMA 1Z5YE 4ZILA 3ERFA 2O8VB 1HD2A 2VLVA 2ZCTA 2REMA 1PX6A 3BCIA 5F05A 3A2WA 4PX1A 4F03A 3LQ7A 2L5OA 1GUHA 3OR5A 3FYGA 17GSA 2V2GA 3EMPA 2B7JA 1OE8A 4EIPA 4IELA 4KDYA 1UVZA 4YAVA 1HNAA 3DRNA 2L6DA 1SJIA 3S9FA 3IDVA 4MJAA 2HRAA 3P7XA 4TR4A 1O8WA 3ERWA 2H0HA 1GNWA 2CAIA 2IMDA 1WE0A 2WJUA 1K0AA 1ZMAA 1YY7A 2WRTA 3GUSA 3MDKA 5AIXA 4QQ7A 4EVMA 3F3QA 1ZGNA 4QL7A 4GSSA 5KEJA 4G9HA 3PPUA 4JR4A 4X43A 4HZ4A 1BYEA 4IGJA 1HNBA 4ZBAA 3IRAA 4XS4B 3HDCA 2KP2A 2YWNA 2L4QA 2RUEA 4N0ZA 1YEXA 3HYPA 1K3YA 4X1UA 2YWIA 1G7OA 4AJ7A 3ZLPA 1LJRA 3APSA 2IMIA 2C8UA 2QGVA 4TR3A 3ZFLA 3VPQA 5ABRA 3N9JA 4J2FA 2CQ9A 4MDCA 2FY6A 8GSSA 4V2NA 3D4TA 3BBYA 3VWXA 5GSSA 3LXTA 5GZZB 1FVJA 2CVDA 3FRCA 2P5QA 2DMLA 4XS1A 3UIWA 1T8EB 1JLWA 3DVXA 5ECHB 3TKSE 2FWHA 1ZYPA 2WCIA 3C71A 2DJKA 1OAZA 1VRSD 5FHIA 1NSWA 2ES7A 4GQCA 1EP8A 2DJ0A 2DLXA 1GSUA 2K6VA 2GT5A 1PKZA 2VD0A 4EE0A 3ZVJD 5DBQA 5AGYA 2LRNA 4BVYA 4WBJA 1XOBA 1FO5A 1XWBA 4GQFA 4F82A 4OFTA 3PR8A 4AJ8A 3C1RA 4DSSA 2F9SA 4IKHA 4WF4A 1VF1A 3GKNA 4POMA 4V2MA 2CV4A 2DIZA 5JWOB 1Z6MA 2I3YA 1T4ZA 3EE2A 1O73A 4HU7A 3VWVA 2IMFA 2O85A 4KSOA 4PUFC 2A4VA 3GYKA 1BG5A 3TOTA 3A2VA 3IA1A 3KMOA 2R0PA 2ZNMA 3KH9A 3ZITA 5CAXA 1ERWA 3R3EA 3QMXA 2IPAA 2QC7A 3W8SA 2MYGA 5CRGA 1GUKA 4K8MA 2VL3A 4POBA 3TJJA 4DEJA 2GLRA 4K5RA 2FWFA 2DJJA 5ECIB 2FCHA 5INYA 2C0EA 3FR9A 5JWRB 4EO3A 3TKSC 1PRXA 1BAYA 1IYHA 3GN3A 4DVCA 1PA3A 4TRXA 1QGVA 2GSQA 2PGTA 1PGTA 1VGLA 2XBIA 2PUKC 4I8BA 2M80A 2R2JA 4G0IA 1X9SB 1YF1A 13GSA 3VI5A 4PXOA 1XZOA 3UJ1A 2YZUA 2PVOC 3KJYA 3HVSA 3Q74A 4K7NA 2E2MA 5ECNB 4Z2RA 2A2RA 4MNNA 3FR3A 3GL5A 3GKXA 4BVYB 3D0ZA 3UBKA 3ZRDA 3W8JA 4GRFA 3HVXA 2VO4A 3VK9A 1DBYA 4DSSB 3D22A 1YKAA 2X8GA 5ECMB 5B6MA 2VCZA 2EIQA 3C73A 2KOKA 4F0BA 5D8IA 3IBHA 2CX4A 4RI7A 4XRAA 1Y6EA 1WOUA 1TI1A 3N5OA 3TKSA 3F4RA 2L5LA 3A5WA 3QD9A 5HR2A 4AF2A 5HFKA 2XPEA 1YF0A 3IK9A 4H86A 4XIHA 2A2PA 2BMXA 1Y25A 3LW9A 4OFMA 4V1Ag 5B8AA 4N30A 1SENA 4TN8A 3DD3A 2HE3A 2VLUA 4GSNA 1TKDB 2P5RA 5DDLA 1USBA 2XBQA 4IHUA 5D9WA 4LL4B 2VCWA 2O7KA 2GSTA 4JE1A 2L4CA 4MMMA 2VUPA 1SL2B 3CSHA 2LKUA 1GNEA 1ST9A 3TB2A 4NAXA 3FZ4A 5CRDA 4IJ3A 1A2LA 3TUEA 5ECPB 4EIQA 5ENUA 3H4KA 3GSSA 1KEBA 2GZYA 4N11A 2FA4A 5DJLA 1U3AA 5LCZA 5CP1A 1H75A 3GH9A 3TOUA 4Q5QA 3ZL5A 1AC1A 3EVIA 4FQUA 2LSTA 4YQVA 2HZEB 4E8HA 4BL7A 2LRCA 1GUMA 2DC5A 5IIZA 4JZQA 4MZBA 1X0RA 2H74A 3CMIA 3GKMA 5DALA 2FLSA 3K8NA 3EU4A 4MK3A 3LYPA 4HQSA 12GSA 4KA0A 3D6IA 3A2XA 2LNSA 1VF4A 4EL1A 1KTEA 2LEGA 5DQYA 3KM6A 4CHSA 1O85A 2A2SA 1J0FA 3O3TA 2IN3A 5IO0A 2OBIA 5KN3A 4IW9A 3H8QA 4RQRA 4O32A 5E4WA 2X8HA 1AQVA 3GNJA 1G0TA 3CXGA 1TU7A 3C7MA 1A2MA 5DCHA 1DE2A 1GSFA 3GRXA 4TVEA 3IOSA 2FUG2 2VOCA 4NHWA 3FEUA 3R2QA 1SYXA 1WRYA 1XWCA 3C8EA 1KNGA 3WT1A 4E8EA 4TXOA 1TXXA 1M99A 1V2AA 4K2DA 2F51A 2HLSA 1T4YA 5DCGA 1G6YA 4PURA 4ACSA 1K0CA 3VWUA 4BVXA 5D93A 4BA7A 3F4TA 5HQPA 2LJKA 2AAWA 3RHBA 1XPVA 2K18A 3GTUA 3G7IA 1FG4A 1SK0A 1TRUA 1TW9A 2H30A 2JADA 2YWOA 5DALB 4EKZA 5BMUA 3EMXA 20GSA 2NBSA 3TKPA 3CRUA 4N10A 2PVQA 3HZ4A 1EOGA 2C1YA 1YJ6A 5DAKA 2YJHA 3W6GA 5C00A 3BD2A 3CTGA 2VM2A 3WGEA 2R5GA 2RM5A 3Q19A 3FY7A 2H66A 3GHAA 4WR5A 2PBJA 2H1GA 1B9XC 1XWAA 3GKKA 3QFAC 1XW6A 2V32A 5HFIA 1K3OA 2HXKA 4JU5A 3TCOA 4NV2A 1N2AA 4XHMA 5G5FA 4PTSA 1MDKA 3BCKA 4K0GA 5IMDA 3E9JB 1Q4JA 1QMVA 4O5RA 4CDOA 1I9DA 4TXOB 5CRHA 1KBNA 5HR0A 5ECOB 2G0FA 1JZOA 2K9FA 5ELAA 1U6TA 1G6WA 2C0DA 4KDXA 2HSMA 3G7YA 2C3NA 5EY6A 6GSVA 3L9UA 1SK2A 2GQLA 4BVXB 1X9MB 3GIXA 2YNXA 5G31A 5G1KA 1SD8A 1MEKA 2AV4A 4F2IA 1HNCA 1M0UA 1C72A 2WB9A 2WFCA 5BRTA 4EDYA 2C0GA 2B7KA 4HU9A 5COHA 2WDUA 3TJKA 4CY8A 2IJYA 1YZXA 1DSBA 1MDIA 2C80A 1Z7RA 5DAKB 1E6BA 14GSA 4HJ2A 3LFLA 1GL8A 1GLPA 3GURA 1XBSA 2YN1A 2VL9A 2X49A 1SL1B 1AXDA 4G19A 5H5SA 3DGQA 2YZHA 2LTKA 3P8WA 3GA4A 4USSA 1PD21 4IQ1A 1EEJA 5CRWA 2BTOT 3P2AA 3IC4A 3MSZA 2AJQB 2HSYA 2IFQB 2H70A 2JZTA 2OE3A 2OKAA 2K8SA 4HUAA 4WETA 6GSUA 4OMVA 3DMLA 4NV5A 1BX9A 3UAPA 2CZ2A 1AQXA 2XPDA 1U3IA 3MNGA 2CZ3A 4WBRD 1OYJA 1GSEA 1GTUA 3HJMA 4MH3A 1F9MA 4KDUA 3DWVA 1YDKA 5ID2A 3IXRA 5KN2A 3ERGA 4NXIA 4L5OA 4Z7XA 4Q5RA 1U87A 2CA8A 5F8BA 3L9VA 4WF5A 1VF2A 1QXHA 3UL3A 3RBTA 4ZL7A 1THOA 2VCXA 1OC3A 1J08A 4X4JA 2P31A 4GCIA 1XWKA 4YKFA 2FWGA 4KNDA 4HQZA 4TW5A 2WGRA 1OKDA 3LJRA 4OO5A 4ECJA 5J41A 1GTAA 3TJGA 4G2EA 3L9SA 1FB0A 2IIYA 2VCTA 4KAEA 4GLTA 3ZTLA 2E0QA 3GFKA 5GAND 1XCCA 2HRKA 4IS0A 4MP4A 5J9CA 5IOWA 1M2AA 2WULA 3O6TA 3ZVJA 1BQ7A 2EC4A 3IV4A 5KN1A 3TJFA 2LUSA 4OCEA 1WWJA 3G7JA 3D4MA 1Q98A 2QKEA 1TRVA 2PPTA 4RUVA 4EXJA 1AW9A 2R0CA 2H6XA 2LV3A 4G0KA 2FWEA 3GSTA 1AQWA 5FWGA 4IJIA 1M7TA 4F0CA 3EINA 3FHKA 3PH9A 3F4SA 1X5DA 3DYRA 2FHEA 1GLQA 4O7HA 2I81A 2H1AA 1AAZA 1XFLA 1R5PA 3E3EA 1EGOA 4IVFA 2TRXA 2FGXA 1V58A 3HJPA 4MF6A 4WKWA 3KGKA 2YWMA 1ZCPA 3L4NA 1T00A 1FOVA 3ED3A 1PN0A 3WGXA 3UARA 2OADA 2GS3A 2HT9A 1V98A 3CSIA 3APQA 3QAVA 5AISA 3DKSA 3TRPA 4ZB6A 3SBCA 2DJ3A 2C0FA 2OJLA 2GTUA 22GSA 2O87A 3TRQA 4Z2TA 1AIUA 2YOIA 1A0RP 3NIVA 2YV9A 4K9ZA 2LS5A 4LLRA 2X64A 2DJ2A 4FO5A 3NOFA 1ERTA 1IYIA 1TK8B 1R5AA 2LJAA 2RUFA 5IMZA 3M0FA 6GSYA 2J23A 2PERA 1SKRB 3M9KA 4O5QA 2L6CA 1XW9A 2KHPA 1O6JA 1OC9A 1ZYQB 4KW6A 5CNWA 1QK8A 3ZYWA 4V1Ap 1B9YC 4BWQA 5B8BA 1TK0B 4AGSA 4JBBA 5ECLB 3LGCA 1GP1A 4MH2A 3IK7A 4O92A 4GTUA 2H75A 2YANA 1OC8A 1ON4A 2H19A 1EV4A 1OE7A 4MZCA 4OFNA 4KX4A 3I43A 3ZMLA 2MMNA 2N5AA 3QOUA 1BJXA 5KN0A 2PMTA 2AB6A 1LBKA 4LMVA 3H93A 3I6AA 1O81A 5G5EA 3NZNA 19GSA 2C4JA 1HYUA 1GULA 4KF9A 3EU3A 1UN2A 3C1SA 5IMFA 2LNTA 4PUAA 1GSYA 1QFNA 5FT3A 1URMA 4OWYA 4RQXA 2L57A 3HCZA 2M72A 3US3A 3EYTA 2HI7A 1TJDA 2MMZA 2KUCA 1EOHA 1TOFA 4A5PA 3WYWA 3TDGA 5IMVA 4BPYA 3E0UA 1OC9B 3APOA 4HEA2 1PMTA 4HDEA 1JZWA 2YV7A 2YPMA 1S3CA 2E2GA 4ZL8A 2DKHA 3L0HA 4ID0A 2NDOA 3ME7A 4TOPA 2BJXA 2EIOA 2LJRA 2R0GA 3RPPA 2OBKA 2KP1A 4GF0A 4ZBBA 3FZ5A 1PSQA 1W4VA 5D96A 3ME8A 5G30A 5IQYA 4F9ZA 2GQMA 1T1VA 2IY2A 2JZRA 3UMAA 1B8XA 3KIJA 4K6XA 5DVBA 2A4HA 3IPZA 3DXBA 3WGDA 2AYTA 5IMAA 2HSHA 2H0GA 3QR6A 6GSTA 4X0XA 5CYYA 2GVPA 2V41A 1TTZA 1Z6NA 3FZAA 4LL1B 2B5EA 4XS6A 3MYDA 2DBCA 5GAPD 3UBLA 2MBTA 2I9HA 3KMNA 4JEDA 4PNFA 1WJKA 3HKRA 3KCMA 1GSSA 2DMMA 2WZ9A 3GMFA 3MWHA 4EF0A 4TR0A 4BL7B 1NHYA 1VF3A 1K0OA 3GX8A 1EZKA 2H8LA 3I9V2 3F3RA 2M46A 2IMEA 5D9VA 1O7UA 2ON7A 3TKQA 2FA8A 2HRNA 3CYNA 4MLYA 4ZXGA 1JLVA 2B5XA 3ZMKA 4KCEA 3QPMA 3FZ9A 4KCAA 1TRWA 4V2LA 6GSSA 2G2QA 3KTLA 2R6KA 16GSA 2QA2A 1SKSB 1XW5A 3TRXA 3KEBA 1BEDA 1J9BA 4OO4A 3JCML 1JHBA 3Q18A 2CVBA 2DIYA 1XOAA 3KTBA 1WP0A 5L71A 5J3RA 2GZZA 4Q5NA 2LRTA 2NVLA 2QA1A 3LG6A 3HZ8A 4YH2A 4HOJA 3KP8A 4L8EA 4ZBDA 4K0NA 2IWTA 3RPNA 1WPIA 2HFDA 2DJ1A 5CO3A 1SJ6A 3FKFA 2GSSA 1A8YA 4RI6A 4IP1A 4IQAA 4AJ6A 2IYJA 2AUVA 4WR4A 4TR1A 3CTFA 2CVKA 4KSMA 5D73A 2F3MA 5EL8A 5A4VA 1RK4A 1PKWA 1R26A 4YKGA 2FD3A 4PNGA 2YJ7A 5G2ZA 3SWLA 3A3TA 3RHCA 4FYUA 1EWXA 3ZREA 3QAGA 3GTUB 3IC8A 4EC0A 5KOWA 1SJZA 1YKCA 1B48A 1Z3EA 3FK8A 4KB3A 3CBUA 5E59A 1GRXA 1Z7PA 4IP6A 4N0VA 3WT2A 1XXUA 1PQNA 1XIYA 1X5EA 3LWAA 3VLNA 5F0GA 1JZRA 3LEFA 1DUGA 1ACVA 5C04A 2Z9SA 5ECSA 4OD7A 1WIKA 5HR1A 4CW9A 4I2TA 4FH8A 2N5FA 3BOAA 3DIEA 2MBSA 2DSAA 3HA9A 4XRDA 3F63A 2JL4A 1YQ1A 5D9TA 3ZZXA 3F8UA 4KGIA 1ZL9A 3U5RE 3GX0A 1F37A 5G1LA 4GXZA 1QQ2A 1CQHA 3QAWA 1SL0B 3VI7A 2R4VA 4Q5FA 1FHEA 4TR1B 3F9UA 2V6KA 5IO2A 3LYKA 5IPGA 4MZWA 1Z9HA 2J9HA 3IAS2 4MJCA 1A23A 5A4UA 5ECRB 1F6MC 3EURA 2VD1A 2H72A 3IR4A 4ECIA 3CSJA 1TRSA 1EEMA 4MPFA 2I4AA 4JR6A 4P3YB 5DQSA 3EC3A 3VFIA 2OACA 3GH6A 1R7HA 4FIWA 2PN8A 2RIIA 3FMWA 4ULXA 1ZZYA 4DSQA 4NWYA 2NTOA 1OKTA 3M3MA 3MIXA 2MZCA 3KXOA 5ELGA 1SK1A 1NM3A 2QSIA 1TDIA 1FW1A 5EVOA 1GWCA 1NW2A 1SU9A 2H73A 1ZOFA 3CRTA 3LORA 1SYRA 3AY8A 4IN0A 1ABAA 4O5UA 1GSQA 4ZB9A 2X8CA 2P0GA 2GZPA 1XVWA 1O8XA 3M8NA 4OCFA 2JSYA 1R4WA 1B4QA 2GDRA 2VL2C 3GV1A 2V6OA 4KE3A 1SD9A 4J57E 4TXVA 2GT6A 2I1UA 5ID2B 4POKA 4FYCA 4ZL9A 2ALBA 5JCUA 4FYBA 3PINA 3DEXA 4HZ2A 3HVVA 3J7Yk 4ISDA 9GSSA 1X9WB 4L0WA 5GSTA 1QUWA 2DKIA 1FVKA 3UOMA 3HJOA 4NMUA 1S3DA 5J4UA 1ILOA 1RW1A 4QL9A 4KH7A 3FW2A 1MD4A 10GSA 2PWJA 3HHVA 1K0NA 1T7PB 2H1DA 1EGRA 5JWQB 4ML6A 2VM1A 1A8LA 4MABA 3IAM2 5IOXA 4KUNA 3KD0A 1ZYEA 4HI7A 2D2ZA 1I5GA 5DJMA 1G7EA 2H1BA 3H79A 5JCWA 1S3AA 4PQ1A 1ERVA 4ML1A 2H6ZA 2H71A 2XHFA 1K0MA 4MJBA 3PGTA 2WS2A 3TKRA 2XC2A 1K0BA 1A24A 1EV9A 4K7IA 1ERUA 2X99A 4ECBA 4CY6A 1W89A 2N5BA 1ZYNA 3KP9A 3UVHA 3J7Yb 1TP9A 4XTSA 4EUYA 2VL2A 2L59A 2H01A 2HZEA 2VAFA 5AN1A 2HYXA 3ISOA 2EIRA 3Q6OA 18GSA 4ECCA 2VLTA 3G9BA 4I97A 4PGTA 4G0LA 4TKYA 1M9BA 3UVTA 2VCVA 2CT6A 1FAAA 1PX7A 5CREA 4LMWA 1H4OA 5JCGA 4ILFA 3MAKA 1MD3A 3ZIJA 5H5QA 2YP6A 5IM9A 1CQGA 4D73A 2ON5A 1U88A 3KH7A 1SKWB 2GQKA 2RLIA 4NHZA 2H76A 5J5NA 1V9WA 1FOHA 1UC7A 1K0DA 1LU4A 5ECQB 2TIRA 4HS1A 3IE3A 5A5KA 1FB6A 2AHEA 1EP7A 3LXZA 5IMCA 3TJBA 4MA9A 1GH2A 3LSZA 2OE0A 1ML6A 2CAQA 5LNKe 1PL1A 1WMJA 1F3AA 4ZIJA 1M2BA 6GSXA 2B1KA 4MCUA 1M2DA 2FNOA 2C3QA 1X5CA 4YAPA 2UZ8A 1OVNA 1A2JA 2LQQA 2JU5A 2H6YA 3VPTA 3F6DA 4MF5A 5ECKB 2KLXA 4ZB8A 2JACA 4EDZA 2K8VA 2GSRA 4I2UA 5B7CA 1RQMA 1YEPA 4GSTA 3BJ5A 1UA5A 4L5LA 4YQUA 1E2YA 4DSRA 5H5RA 3QFBC 3ZIVA 2MMAA 4ICYA 3RDWA 2NPBA 4GWRA 2RM6A 2B5YA 3H1NA 3IHGA 1HQOA 2F8FA 3I69A 1DE1A 2LQOA 2GGTA 4PQIA 2VIMA 1PL2A 3O76A 3DVWA 1NHOA 2JSZA 4D73B 2X4AA 5J9BA 2C3TA 2B6MA 1GSDA 2IL3A 3TGZA 4BWSA 5A4WA 1A0FA 1K3LA 1MDJA 1B4PA 2JZSA 2ZUPA 4G10A 2CX3A 1GTBA 4NPBA 3WD6A 3FR6A 3D21A 3M9JA 3F0IA 5IPHA 4YQMA 2HNLA 3EPTA 5HFGA 4LA1A 1JZDA 4HJMA 2HZFA 2HRFA 2V1MA 1N8JA 1TU8A 2IMKA 3U6VA 3V1WA 2H0IA 3P90A 3HXSA 3ZFBA 5AIVA 3M1GA 4WEYA 1XWGA 5EPFA 1F3BA 1THXA 4MJEA 1TI3A 2O89A 2TRCP 1V40A 3RAZA 1GTIA 2B1LA 2YCDA 3GL3A 11GSA 5F07A 2B3SA 4JRRA 2R37A 3F6FA 1MTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPG A;  1JFU A;  4PQH A;  1T3B A;  3VUR A;  3EWL A;  2R3X A;  3QCP A;  2OA7 A;  2OE1 A;  3VWW A;  1M9A A;  2MMO A;  3HD5 A;  4L0U A;  4IBP A;  3KZQ A;  4I5Q A;  5HR3 A;  3IHQ A;  5LD0 A;  5D9X A;  4WXT A;  2E7P A;  4K7O A;  3L78 A;  1XVQ A;  4POL A;  1PN9 A;  1TK5 B;  5F06 A;  4J56 E;  3QDN A;  5B6N A;  4XS4 A;  1V57 A;  4XCS A;  7GSS A;  2PU9 C;  3D5J A;  1AUC A;  2IFQ A;  4I6X A;  2F8A A;  4MF7 A;  3HY2 A;  6GSW A;  4K1F A;  2VCQ A;  1F2E A;  3UEM A;  1Z5Y E;  4ZIL A;  3ERF A;  2O8V B;  1HD2 A;  2VLV A;  2ZCT A;  2REM A;  1PX6 A;  3BCI A;  5F05 A;  3A2W A;  4PX1 A;  4F03 A;  3LQ7 A;  2L5O A;  1GUH A;  3OR5 A;  3FYG A;  17GS A;  2V2G A;  3EMP A;  2B7J A;  1OE8 A;  4IEL A;  4KDY A;  1UVZ A;  4YAV A;  1HNA A;  3DRN A;  2L6D A;  1SJI A;  3S9F A;  3IDV A;  4MJA A;  3P7X A;  4TR4 A;  1O8W A;  3ERW A;  2H0H A;  1GNW A;  2CAI A;  2IMD A;  1WE0 A;  2WJU A;  1K0A A;  1ZMA A;  1YY7 A;  2WRT A;  3GUS A;  3MDK A;  5AIX A;  4QQ7 A;  4EVM A;  3F3Q A;  1ZGN A;  4QL7 A;  4GSS A;  5KEJ A;  4G9H A;  4X43 A;  4JR4 A;  4HZ4 A;  1BYE A;  4IGJ A;  1HNB A;  4ZBA A;  3IRA A;  4XS4 B;  3HDC A;  2KP2 A;  2YWN A;  2L4Q A;  2RUE A;  4N0Z A;  1YEX A;  3HYP A;  1K3Y A;  4X1U A;  2YWI A;  1G7O A;  4AJ7 A;  3ZLP A;  1LJR A;  3APS A;  2IMI A;  2C8U A;  2QGV A;  4TR3 A;  3ZFL A;  3VPQ A;  5ABR A;  3N9J A;  4J2F A;  2CQ9 A;  4MDC A;  2FY6 A;  8GSS A;  4V2N A;  3D4T A;  3BBY A;  3VWX A;  5GSS A;  3LXT A;  5GZZ B;  1FVJ A;  2CVD A;  3FRC A;  2P5Q A;  2DML A;  4XS1 A;  3UIW A;  1T8E B;  1JLW A;  3DVX A;  5ECH B;  3TKS E;  2FWH A;  2WCI A;  3C71 A;  2DJK A;  1OAZ A;  1VRS D;  5FHI A;  1NSW A;  2ES7 A;  4GQC A;  1EP8 A;  2DJ0 A;  2DLX A;  1GSU A;  2K6V A;  2GT5 A;  1PKZ A;  2VD0 A;  4EE0 A;  3ZVJ D;  5DBQ A;  5AGY A;  2LRN A;  4BVY A;  4WBJ A;  1XOB A;  1FO5 A;  1XWB A;  4GQF A;  4F82 A;  4OFT A;  3PR8 A;  4AJ8 A;  3C1R A;  4DSS A;  2F9S A;  4IKH A;  4WF4 A;  1VF1 A;  3GKN A;  4POM A;  4V2M A;  2CV4 A;  2DIZ A;  5JWO B;  1Z6M A;  2I3Y A;  1T4Z A;  3EE2 A;  1O73 A;  4HU7 A;  3VWV A;  2IMF A;  2O85 A;  4KSO A;  4PUF C;  2A4V A;  3GYK A;  1BG5 A;  3TOT A;  3A2V A;  3IA1 A;  3KMO A;  2ZNM A;  3KH9 A;  3ZIT A;  5CAX A;  1ERW A;  3QMX A;  2IPA A;  2QC7 A;  3W8S A;  2MYG A;  5CRG A;  1GUK A;  4K8M A;  2VL3 A;  4POB A;  3TJJ A;  4DEJ A;  2GLR A;  2FWF A;  2DJJ A;  5ECI B;  2FCH A;  5INY A;  2C0E A;  3FR9 A;  5JWR B;  4EO3 A;  3TKS C;  1PRX A;  1BAY A;  1IYH A;  3GN3 A;  4DVC A;  1PA3 A;  4TRX A;  1QGV A;  2GSQ A;  2PGT A;  1PGT A;  1VGL A;  2XBI A;  2PUK C;  4I8B A;  2M80 A;  2R2J A;  1X9S B;  1YF1 A;  13GS A;  3VI5 A;  4PXO A;  1XZO A;  3UJ1 A;  2YZU A;  2PVO C;  3KJY A;  3HVS A;  3Q74 A;  4K7N A;  2E2M A;  5ECN B;  2A2R A;  3FR3 A;  3GL5 A;  3GKX A;  3D0Z A;  3UBK A;  3ZRD A;  3W8J A;  4GRF A;  3HVX A;  2VO4 A;  3VK9 A;  1DBY A;  4DSS B;  3D22 A;  1YKA A;  2X8G A;  5ECM B;  5B6M A;  2VCZ A;  2EIQ A;  3C73 A;  2KOK A;  4F0B A;  5D8I A;  3IBH A;  2CX4 A;  4RI7 A;  4XRA A;  1Y6E A;  1WOU A;  1TI1 A;  3N5O A;  3TKS A;  3F4R A;  2L5L A;  3A5W A;  3QD9 A;  5HR2 A;  4AF2 A;  5HFK A;  2XPE A;  1YF0 A;  3IK9 A;  4H86 A;  4XIH A;  2BMX A;  1Y25 A;  4V1A g;  4OFM A;  5B8A A;  4N30 A;  1SEN A;  4TN8 A;  3DD3 A;  2HE3 A;  2VLU A;  4GSN A;  1TKD B;  2P5R A;  5DDL A;  1USB A;  2XBQ A;  4IHU A;  5D9W A;  4LL4 B;  2VCW A;  2O7K A;  2GST A;  4JE1 A;  2L4C A;  4MMM A;  2VUP A;  1SL2 B;  3CSH A;  2LKU A;  1GNE A;  1ST9 A;  3TB2 A;  4NAX A;  3FZ4 A;  5CRD A;  4IJ3 A;  1A2L A;  3TUE A;  5ECP B;  5ENU A;  3H4K A;  3GSS A;  1KEB A;  2GZY A;  4N11 A;  2FA4 A;  5DJL A;  1U3A A;  5LCZ A;  5CP1 A;  1H75 A;  3GH9 A;  3TOU A;  4Q5Q A;  3ZL5 A;  1AC1 A;  3EVI A;  2LST A;  4YQV A;  2HZE B;  4E8H A;  4BL7 A;  2LRC A;  1GUM A;  2DC5 A;  5IIZ A;  4JZQ A;  4MZB A;  1X0R A;  2H74 A;  3CMI A;  3GKM A;  5DAL A;  2FLS A;  3K8N A;  3EU4 A;  4MK3 A;  3LYP A;  4HQS A;  12GS A;  4KA0 A;  3D6I A;  3A2X A;  2LNS A;  1VF4 A;  4EL1 A;  1KTE A;  2LEG A;  5DQY A;  3KM6 A;  4CHS A;  1O85 A;  2A2S A;  1J0F A;  3O3T A;  2IN3 A;  5IO0 A;  2OBI A;  5KN3 A;  4IW9 A;  3H8Q A;  4RQR A;  4O32 A;  5E4W A;  2X8H A;  1AQV A;  3GNJ A;  1G0T A;  3CXG A;  1TU7 A;  3C7M A;  1A2M A;  5DCH A;  1DE2 A;  1GSF A;  3GRX A;  4TVE A;  3IOS A;  2FUG 2;  2VOC A;  4NHW A;  3FEU A;  3R2Q A;  1SYX A;  1WRY A;  1XWC A;  3C8E A;  1KNG A;  3WT1 A;  4E8E A;  4TXO A;  1TXX A;  1M99 A;  1V2A A;  4K2D A;  2F51 A;  2HLS A;  1T4Y A;  5DCG A;  1G6Y A;  4PUR A;  4ACS A;  1K0C A;  3VWU A;  4BVX A;  5D93 A;  4BA7 A;  3F4T A;  5HQP A;  2LJK A;  2AAW A;  3RHB A;  1XPV A;  2K18 A;  3GTU A;  3G7I A;  1FG4 A;  1SK0 A;  1TRU A;  1TW9 A;  2H30 A;  2JAD A;  2YWO A;  5DAL B;  4EKZ A;  3EMX A;  20GS A;  2NBS A;  3TKP A;  3CRU A;  4N10 A;  2PVQ A;  3HZ4 A;  1EOG A;  2C1Y A;  1YJ6 A;  5DAK A;  2YJH A;  3W6G A;  5C00 A;  3BD2 A;  3CTG A;  2VM2 A;  3WGE A;  2R5G A;  2RM5 A;  3Q19 A;  3FY7 A;  2H66 A;  3GHA A;  4WR5 A;  2PBJ A;  2H1G A;  1B9X C;  1XWA A;  3GKK A;  3QFA C;  1XW6 A;  2V32 A;  5HFI A;  1K3O A;  2HXK A;  4JU5 A;  3TCO A;  4NV2 A;  1N2A A;  4XHM A;  5G5F A;  1MDK A;  3BCK A;  4K0G A;  5IMD A;  3E9J B;  1Q4J A;  1QMV A;  4O5R A;  4CDO A;  1I9D A;  4TXO B;  5CRH A;  1KBN A;  5HR0 A;  5ECO B;  2G0F A;  1JZO A;  5ELA A;  2K9F A;  1U6T A;  1G6W A;  2C0D A;  4KDX A;  3G7Y A;  2C3N A;  5EY6 A;  6GSV A;  3L9U A;  1SK2 A;  2GQL A;  1X9M B;  3GIX A;  2YNX A;  5G31 A;  5G1K A;  1SD8 A;  1MEK A;  2AV4 A;  4F2I A;  1HNC A;  1M0U A;  1C72 A;  2WB9 A;  2WFC A;  4EDY A;  2C0G A;  2B7K A;  4HU9 A;  5COH A;  2WDU A;  3TJK A;  2IJY A;  1YZX A;  1DSB A;  1MDI A;  2C80 A;  1Z7R A;  5DAK B;  1E6B A;  14GS A;  4HJ2 A;  3LFL A;  1GL8 A;  1GLP A;  3GUR A;  1XBS A;  2YN1 A;  2VL9 A;  1SL1 B;  1AXD A;  4G19 A;  5H5S A;  3DGQ A;  2YZH A;  2LTK A;  3P8W A;  3GA4 A;  1PD2 1;  4IQ1 A;  1EEJ A;  5CRW A;  2BTO T;  3P2A A;  3IC4 A;  3MSZ A;  2AJQ B;  2HSY A;  2IFQ B;  2H70 A;  2JZT A;  2OE3 A;  2OKA A;  2K8S A;  4HUA A;  4WET A;  6GSU A;  4OMV A;  3DML A;  4NV5 A;  1BX9 A;  3UAP A;  2CZ2 A;  1AQX A;  2XPD A;  1U3I A;  3MNG A;  2CZ3 A;  4WBR D;  1OYJ A;  1GSE A;  1GTU A;  3HJM A;  4MH3 A;  1F9M A;  4KDU A;  3DWV A;  1YDK A;  5ID2 A;  3IXR A;  5KN2 A;  3ERG A;  4NXI A;  4L5O A;  4Z7X A;  4Q5R A;  1U87 A;  2CA8 A;  5F8B A;  3L9V A;  4WF5 A;  1VF2 A;  1QXH A;  3UL3 A;  3RBT A;  4ZL7 A;  1THO A;  2VCX A;  1OC3 A;  1J08 A;  2P31 A;  4GCI A;  1XWK A;  2FWG A;  4KND A;  4HQZ A;  4TW5 A;  2WGR A;  1OKD A;  3LJR A;  4OO5 A;  4ECJ A;  5J41 A;  1GTA A;  3TJG A;  4G2E A;  3L9S A;  1FB0 A;  2IIY A;  2VCT A;  4KAE A;  4GLT A;  3ZTL A;  2E0Q A;  3GFK A;  5GAN D;  1XCC A;  4IS0 A;  4MP4 A;  5J9C A;  5IOW A;  1M2A A;  2WUL A;  3O6T A;  3ZVJ A;  1BQ7 A;  2EC4 A;  3IV4 A;  5KN1 A;  3TJF A;  2LUS A;  4OCE A;  1WWJ A;  3G7J A;  3D4M A;  1Q98 A;  2QKE A;  1TRV A;  2PPT A;  4RUV A;  4EXJ A;  1AW9 A;  2H6X A;  2LV3 A;  2FWE A;  3GST A;  1AQW A;  5FWG A;  4IJI A;  1M7T A;  4F0C A;  3EIN A;  3FHK A;  3PH9 A;  3F4S A;  1X5D A;  3DYR A;  2FHE A;  1GLQ A;  4O7H A;  2I81 A;  2H1A A;  1AAZ A;  1XFL A;  1R5P A;  3E3E A;  1EGO A;  4IVF A;  2TRX A;  2FGX A;  1V58 A;  3HJP A;  4MF6 A;  4WKW A;  3KGK A;  2YWM A;  1ZCP A;  3L4N A;  1T00 A;  1FOV A;  3ED3 A;  3WGX A;  3UAR A;  2OAD A;  2GS3 A;  2HT9 A;  1V98 A;  3CSI A;  3APQ A;  3QAV A;  5AIS A;  3DKS A;  3TRP A;  4ZB6 A;  3SBC A;  2DJ3 A;  2C0F A;  2OJL A;  2GTU A;  22GS A;  2O87 A;  3TRQ A;  1AIU A;  2YOI A;  1A0R P;  3NIV A;  2YV9 A;  4K9Z A;  2LS5 A;  4LLR A;  2X64 A;  2DJ2 A;  4FO5 A;  3NOF A;  1ERT A;  1IYI A;  1TK8 B;  1R5A A;  2LJA A;  2RUF A;  5IMZ A;  3M0F A;  6GSY A;  2J23 A;  2PER A;  1SKR B;  3M9K A;  2L6C A;  1XW9 A;  2KHP A;  1O6J A;  1OC9 A;  1ZYQ B;  4KW6 A;  5CNW A;  1QK8 A;  3ZYW A;  4V1A p;  1B9Y C;  4BWQ A;  5B8B A;  1TK0 B;  4AGS A;  4JBB A;  5ECL B;  3LGC A;  1GP1 A;  4MH2 A;  3IK7 A;  4O92 A;  4GTU A;  2H75 A;  2YAN A;  1OC8 A;  1ON4 A;  2H19 A;  1EV4 A;  1OE7 A;  4MZC A;  4OFN A;  4KX4 A;  3I43 A;  3ZML A;  2MMN A;  2N5A A;  3QOU A;  1BJX A;  5KN0 A;  2PMT A;  2AB6 A;  1LBK A;  4LMV A;  3H93 A;  3I6A A;  1O81 A;  5G5E A;  3NZN A;  19GS A;  2C4J A;  1HYU A;  1GUL A;  3EU3 A;  1UN2 A;  3C1S A;  5IMF A;  2LNT A;  4PUA A;  1GSY A;  1QFN A;  5FT3 A;  1URM A;  4OWY A;  4RQX A;  2L57 A;  3HCZ A;  2M72 A;  3US3 A;  3EYT A;  2HI7 A;  1TJD A;  2MMZ A;  2KUC A;  1EOH A;  1TOF A;  3WYW A;  3TDG A;  5IMV A;  4BPY A;  3E0U A;  1OC9 B;  3APO A;  4HEA 2;  1PMT A;  4HDE A;  1JZW A;  2YV7 A;  2YPM A;  1S3C A;  2E2G A;  4ZL8 A;  3L0H A;  4ID0 A;  2NDO A;  3ME7 A;  4TOP A;  2BJX A;  2EIO A;  2LJR A;  3RPP A;  2OBK A;  2KP1 A;  4GF0 A;  4ZBB A;  3FZ5 A;  1PSQ A;  1W4V A;  5D96 A;  3ME8 A;  5G30 A;  5IQY A;  4F9Z A;  2GQM A;  1T1V A;  2IY2 A;  2JZR A;  3UMA A;  1B8X A;  3KIJ A;  4K6X A;  5DVB A;  3IPZ A;  3DXB A;  3WGD A;  2AYT A;  5IMA A;  2HSH A;  2H0G A;  3QR6 A;  6GST A;  4X0X A;  5CYY A;  2GVP A;  2V41 A;  1TTZ A;  1Z6N A;  3FZA A;  4LL1 B;  2B5E A;  4XS6 A;  2DBC A;  5GAP D;  3UBL A;  2MBT A;  2I9H A;  3KMN A;  4JED A;  4PNF A;  1WJK A;  3HKR A;  3KCM A;  1GSS A;  2DMM A;  2WZ9 A;  3GMF A;  3MWH A;  4EF0 A;  4TR0 A;  1NHY A;  1VF3 A;  1K0O A;  3GX8 A;  1EZK A;  2H8L A;  3I9V 2;  3F3R A;  2M46 A;  2IME A;  5D9V A;  1O7U A;  2ON7 A;  3TKQ A;  2FA8 A;  2HRN A;  3CYN A;  4MLY A;  4ZXG A;  1JLV A;  2B5X A;  3ZMK A;  4KCE A;  3QPM A;  3FZ9 A;  4KCA A;  1TRW A;  4V2L A;  6GSS A;  2G2Q A;  3KTL A;  2R6K A;  16GS A;  1SKS B;  1XW5 A;  3TRX A;  3KEB A;  1BED A;  1J9B A;  4OO4 A;  3JCM L;  1JHB A;  3Q18 A;  2CVB A;  2DIY A;  1XOA A;  3KTB A;  1WP0 A;  5L71 A;  5J3R A;  2GZZ A;  4Q5N A;  2LRT A;  2NVL A;  3LG6 A;  3HZ8 A;  4YH2 A;  4HOJ A;  3KP8 A;  4L8E A;  4ZBD A;  4K0N A;  2IWT A;  3RPN A;  1WPI A;  2HFD A;  2DJ1 A;  5CO3 A;  1SJ6 A;  3FKF A;  2GSS A;  1A8Y A;  4RI6 A;  4IP1 A;  4IQA A;  4AJ6 A;  2IYJ A;  2AUV A;  4WR4 A;  4TR1 A;  3CTF A;  2CVK A;  4KSM A;  5D73 A;  2F3M A;  5EL8 A;  5A4V A;  1RK4 A;  1PKW A;  1R26 A;  2FD3 A;  4PNG A;  2YJ7 A;  5G2Z A;  3SWL A;  3A3T A;  3RHC A;  4FYU A;  1EWX A;  3ZRE A;  3QAG A;  3GTU B;  4EC0 A;  1SJZ A;  1YKC A;  1B48 A;  1Z3E A;  3FK8 A;  4KB3 A;  3CBU A;  5E59 A;  1GRX A;  1Z7P A;  4IP6 A;  4N0V A;  3WT2 A;  1XXU A;  1PQN A;  1XIY A;  1X5E A;  3LWA A;  3VLN A;  5F0G A;  1JZR A;  3LEF A;  1DUG A;  1ACV A;  5C04 A;  2Z9S A;  5ECS A;  4OD7 A;  1WIK A;  5HR1 A;  4CW9 A;  4I2T A;  4FH8 A;  2N5F A;  3BOA A;  3DIE A;  2MBS A;  2DSA A;  3HA9 A;  4XRD A;  3F63 A;  2JL4 A;  1YQ1 A;  5D9T A;  3ZZX A;  3F8U A;  4KGI A;  1ZL9 A;  3U5R E;  3GX0 A;  1F37 A;  5G1L A;  4GXZ A;  1QQ2 A;  1CQH A;  3QAW A;  1SL0 B;  3VI7 A;  2R4V A;  4Q5F A;  1FHE A;  4TR1 B;  3F9U A;  2V6K A;  5IO2 A;  3LYK A;  5IPG A;  4MZW A;  1Z9H A;  2J9H A;  3IAS 2;  4MJC A;  1A23 A;  5A4U A;  5ECR B;  1F6M C;  3EUR A;  2VD1 A;  2H72 A;  3IR4 A;  4ECI A;  3CSJ A;  1TRS A;  1EEM A;  4MPF A;  2I4A A;  4JR6 A;  4P3Y B;  5DQS A;  3EC3 A;  3VFI A;  2OAC A;  3GH6 A;  1R7H A;  4FIW A;  2PN8 A;  2RII A;  4ULX A;  1ZZY A;  4DSQ A;  4NWY A;  2NTO A;  1OKT A;  3M3M A;  2MZC A;  3KXO A;  5ELG A;  1SK1 A;  1NM3 A;  2QSI A;  1TDI A;  1FW1 A;  5EVO A;  1GWC A;  1NW2 A;  1SU9 A;  2H73 A;  1ZOF A;  3CRT A;  3LOR A;  1SYR A;  3AY8 A;  4IN0 A;  1ABA A;  1GSQ A;  4ZB9 A;  2X8C A;  2P0G A;  2GZP A;  1XVW A;  1O8X A;  3M8N A;  4OCF A;  2JSY A;  1R4W A;  1B4Q A;  2GDR A;  2VL2 C;  3GV1 A;  2V6O A;  4KE3 A;  1SD9 A;  4J57 E;  4TXV A;  2GT6 A;  2I1U A;  5ID2 B;  4POK A;  4FYC A;  4ZL9 A;  2ALB A;  5JCU A;  4FYB A;  3PIN A;  3DEX A;  4HZ2 A;  3HVV A;  3J7Y k;  4ISD A;  9GSS A;  1X9W B;  4L0W A;  5GST A;  1QUW A;  3UOM A;  1FVK A;  3HJO A;  4NMU A;  1S3D A;  5J4U A;  1ILO A;  1RW1 A;  4QL9 A;  4KH7 A;  3FW2 A;  1MD4 A;  10GS A;  2PWJ A;  3HHV A;  1K0N A;  1T7P B;  2H1D A;  1EGR A;  5JWQ B;  4ML6 A;  2VM1 A;  1A8L A;  4MAB A;  3IAM 2;  5IOX A;  4KUN A;  3KD0 A;  1ZYE A;  4HI7 A;  2D2Z A;  1I5G A;  5DJM A;  1G7E A;  2H1B A;  3H79 A;  5JCW A;  1S3A A;  4PQ1 A;  1ERV A;  4ML1 A;  2H6Z A;  2H71 A;  2XHF A;  1K0M A;  4MJB A;  3PGT A;  2WS2 A;  3TKR A;  2XC2 A;  1K0B A;  1A24 A;  1EV9 A;  4K7I A;  1ERU A;  2X99 A;  4ECB A;  1W89 A;  2N5B A;  3KP9 A;  3UVH A;  3J7Y b;  1TP9 A;  4XTS A;  4EUY A;  2VL2 A;  2L59 A;  2H01 A;  2HZE A;  2VAF A;  5AN1 A;  2HYX A;  3ISO A;  2EIR A;  3Q6O A;  18GS A;  4ECC A;  2VLT A;  3G9B A;  4I97 A;  4PGT A;  4TKY A;  1M9B A;  3UVT A;  2VCV A;  2CT6 A;  1FAA A;  1PX7 A;  5CRE A;  4LMW A;  1H4O A;  5JCG A;  4ILF A;  3MAK A;  1MD3 A;  3ZIJ A;  5H5Q A;  2YP6 A;  5IM9 A;  1CQG A;  4D73 A;  2ON5 A;  1U88 A;  3KH7 A;  1SKW B;  2GQK A;  2RLI A;  4NHZ A;  2H76 A;  5J5N A;  1V9W A;  1UC7 A;  1K0D A;  1LU4 A;  5ECQ B;  2TIR A;  4HS1 A;  3IE3 A;  5A5K A;  1FB6 A;  2AHE A;  1EP7 A;  3LXZ A;  5IMC A;  3TJB A;  4MA9 A;  1GH2 A;  3LSZ A;  2OE0 A;  1ML6 A;  2CAQ A;  5LNK e;  1PL1 A;  1WMJ A;  1F3A A;  4ZIJ A;  1M2B A;  6GSX A;  2B1K A;  4MCU A;  1M2D A;  2FNO A;  2C3Q A;  1X5C A;  4YAP A;  1OVN A;  1A2J A;  2LQQ A;  2JU5 A;  2H6Y A;  3VPT A;  3F6D A;  4MF5 A;  5ECK B;  2KLX A;  4ZB8 A;  2JAC A;  4EDZ A;  2K8V A;  2GSR A;  4I2U A;  5B7C A;  1RQM A;  1YEP A;  4GST A;  3BJ5 A;  1UA5 A;  4L5L A;  4YQU A;  1E2Y A;  4DSR A;  5H5R A;  3QFB C;  3ZIV A;  2MMA A;  3RDW A;  2NPB A;  4GWR A;  2RM6 A;  2B5Y A;  3H1N A;  1HQO A;  2F8F A;  3I69 A;  1DE1 A;  2LQO A;  2GGT A;  4PQI A;  2VIM A;  1PL2 A;  3O76 A;  3DVW A;  1NHO A;  2JSZ A;  4D73 B;  5J9B A;  2C3T A;  2B6M A;  1GSD A;  2IL3 A;  3TGZ A;  4BWS A;  5A4W A;  1A0F A;  1K3L A;  1MDJ A;  1B4P A;  2JZS A;  2ZUP A;  4G10 A;  2CX3 A;  1GTB A;  4NPB A;  3WD6 A;  3FR6 A;  3D21 A;  3M9J A;  3F0I A;  5IPH A;  4YQM A;  2HNL A;  5HFG A;  4LA1 A;  1JZD A;  4HJM A;  2HZF A;  2HRF A;  2V1M A;  1N8J A;  1TU8 A;  2IMK A;  3U6V A;  3V1W A;  2H0I A;  3P90 A;  3HXS A;  3ZFB A;  5AIV A;  3M1G A;  4WEY A;  1XWG A;  5EPF A;  1F3B A;  1THX A;  4MJE A;  1TI3 A;  2O89 A;  2TRC P;  1V40 A;  3RAZ A;  1GTI A;  2B1L A;  2YCD A;  3GL3 A;  11GS A;  5F07 A;  2B3S A;  4JRR A;  2R37 A;  3F6F A;  1MTC A; 
#chains in the Genus database with same CATH topology
 4MPG A;  1JFU A;  4PQH A;  2AAE A;  1T3B A;  1QVG 2;  1X1W A;  4K5S A;  5IEO A;  3VUR A;  3EWL A;  1RGF A;  2R3X A;  3QCP A;  1LNI A;  2OA7 A;  2OE1 A;  3VWW A;  1M9A A;  2MMO A;  3HD5 A;  4L0U A;  4K2X A;  4IBP A;  3KZQ A;  1I0X A;  3WOE B;  4I5Q A;  5HR3 A;  3IHQ A;  5LD0 A;  5D9X A;  4R80 A;  4WXT A;  2E7P A;  4K7O A;  3L78 A;  1XVQ A;  1MGR A;  4POL A;  1PN9 A;  1TK5 B;  5F06 A;  2XSH B;  3SOA A;  4J56 E;  3QDN A;  5B6N A;  2KF5 A;  2YX9 A;  3EQQ B;  4XS4 A;  4STD A;  5EQL A;  1T2I A;  1V57 A;  3A5I A;  1VQL 3;  4XCS A;  5KOX A;  1B27 A;  2WO0 A;  7GSS A;  2PU9 C;  3UJM A;  2K3D A;  5DRE A;  3D5J A;  1AUC A;  3LOY A;  2IFQ A;  3D4A A;  4I6X A;  2F8A A;  4MF7 A;  1FZU A;  3HY2 A;  6GSW A;  4K1F A;  5DRV A;  4Z2U A;  2VCQ A;  1F2E A;  3UEM A;  4I4K A;  1Z5Y E;  4ZIL A;  3ERF A;  2KCD A;  3M8C A;  1UUW B;  1HD2 A;  2O8V B;  3G0K A;  3RGA A;  2VLV A;  2ZCT A;  2XFS A;  2REM A;  1B2Z A;  1PX6 A;  1VQK 3;  3BCI A;  5CF2 A;  1IVX A;  5F05 A;  3A2W A;  4PX1 A;  1BIR A;  2MC8 A;  1MGW A;  1N8R 4;  4F03 A;  4BTX A;  3LQ7 A;  2L5O A;  1GUH A;  3OR5 A;  3FYG A;  17GS A;  1JRQ A;  4FMD A;  2V2G A;  3EMP A;  1JB5 A;  2W56 B;  2B7J A;  3Q2P A;  1BU4 A;  1OE8 A;  4EIP A;  4IEL A;  4KDY A;  1UCK A;  1I70 A;  4HJL B;  4MJD A;  1TU5 A;  1UVZ A;  4YAV A;  1HNA A;  1Y4K A;  3DRN A;  1RGG A;  3BU4 A;  3DGL A;  2L6D A;  1SJI A;  3S9F A;  2XRX B;  1B3S A;  2SAR A;  5JPP A;  3IDV A;  2ML6 A;  4MJA A;  2HRA A;  5I97 A;  3P7X A;  3ROB A;  3X3Z A;  4TR4 A;  3F40 A;  8CHO A;  1O8W A;  3ERW A;  2H0H A;  1GNW A;  2M7O A;  5M18 A;  2CAI A;  2IMD A;  3AHW A;  1WE0 A;  2WJU A;  3A5E A;  1K0A A;  4NRE A;  1IT7 A;  1ZMA A;  1YY7 A;  2WRT A;  1B2M A;  3GUS A;  3MDK A;  5D81 A;  5AIX A;  4QQ7 A;  3LML A;  4EVM A;  1MWT A;  3F3Q A;  1JNQ A;  1ZGN A;  4QL7 A;  4GSS A;  2P05 A;  2XH9 A;  1RGL A;  5KEJ A;  2HMK B;  4G9H A;  1DMM A;  3PPU A;  4JR4 A;  4HZ4 A;  1RN7 A;  3I55 3;  4X43 A;  1BYE A;  4IGJ A;  1HNB A;  1JB4 A;  3IJE B;  5STD A;  1A2K A;  2RFR A;  4GB5 A;  5G2G A;  1BUQ A;  1D6U A;  2R41 A;  4ZBA A;  3IRA A;  4XS4 B;  3HDC A;  2KP2 A;  3F8X A;  2YWN A;  2L4Q A;  2RUE A;  4N0Z A;  1YEX A;  1A2P A;  2UGI A;  3HYP A;  1K3Y A;  4X1U A;  1KSI A;  2YWI A;  1G7O A;  1RRH A;  3DMC A;  4AJ7 A;  3LTC A;  3LTB A;  1LJR A;  3ZLP A;  3APS A;  1JN5 B;  2IMI A;  2C8U A;  2QGV A;  2HMO B;  3S27 A;  4TR3 A;  3VPQ A;  3ZFL A;  5ABR A;  3N9J A;  4J2F A;  4HM1 B;  3B7C A;  2CQ9 A;  1YI2 3;  4MDC A;  2FY6 A;  1FGQ A;  1OGX A;  1E3R A;  1JB2 A;  3URP A;  8GSS A;  4V2N A;  5IEN A;  3MG2 A;  3D4T A;  3AHS A;  3WMD A;  1SIH A;  3BBY A;  4BL2 A;  3VWX A;  2L1S A;  5GSS A;  4CPK A;  3LXT A;  1US1 A;  5GZZ B;  1FVJ A;  3I56 3;  1CH0 A;  1RTU A;  2CVD A;  3FRC A;  1I2F A;  3MPH A;  5AYR B;  2P5Q A;  3G6E 3;  4R4K A;  2DML A;  4XS1 A;  3UIW A;  1T8E B;  1JLW A;  4K90 B;  3DVX A;  5ECH B;  3TKS E;  2FWH A;  1ZYP A;  2WCI A;  1RSN A;  3C71 A;  2DJK A;  1OAZ A;  1VRS D;  1VQQ A;  5FHI A;  1NSW A;  1M3J A;  4XDV A;  2ES7 A;  4GQC A;  1EP8 A;  3K7C A;  2DJ0 A;  3AMO A;  2DLX A;  1GSU A;  2K6V A;  1CYU A;  2GT5 A;  4KFD A;  1PKZ A;  2VD0 A;  4EE0 A;  3ZVJ D;  3SED A;  4RNY A;  5DBQ A;  1QAL A;  5AGY A;  4N6U A;  2LRN A;  1ZGX A;  4BVY A;  4WBJ A;  1XOB A;  1NB3 I;  1RKY A;  1FO5 A;  1XWB A;  4GQF A;  3U97 A;  4F82 A;  4OFT A;  3PR8 A;  4AJ8 A;  1KWI A;  2F56 A;  1BAN A;  3C1R A;  4DSS A;  2F9S A;  4IKH A;  2CKF B;  4WF4 A;  1VF1 A;  4AKY A;  3BND A;  3GKN A;  4POM A;  1XG8 A;  4HZ9 B;  4V2M A;  3NBJ A;  2CV4 A;  2DIZ A;  3GWR A;  3PXM A;  4J5K A;  5JWO B;  1Z6M A;  2I3Y A;  3HK4 A;  1BSB A;  1T4Z A;  3EE2 A;  1O73 A;  3MSO A;  4HU7 A;  3VWV A;  1WNH A;  1OHO A;  1W6G A;  2IMF A;  2O85 A;  4KSO A;  4PUF C;  2A4V A;  3GYK A;  1BG5 A;  2CWU A;  3TOT A;  1O7W B;  3A2V A;  3IA1 A;  1YJN 3;  3KMO A;  2R0P A;  2ZNM A;  3KH9 A;  3ZIT A;  5CAX A;  1ERW A;  3R3E A;  3QMX A;  2IPA A;  2QC7 A;  2HOH A;  1E3V A;  2GU1 A;  3W8S A;  3DGN A;  2MYG A;  4TX4 A;  5CRG A;  1GUK A;  4K8M A;  1IYY A;  2VL3 A;  4POB A;  3FLJ A;  3TJJ A;  4DEJ A;  2GLR A;  4K5R A;  2FWF A;  2DJJ A;  2C4B A;  5ECI B;  2GSP A;  4KVH A;  2FCH A;  3EB8 A;  5INY A;  3GZB A;  2C0E A;  3FR9 A;  5JWR B;  4EO3 A;  3TKS C;  1PRX A;  1DYU A;  1BAY A;  4GSP A;  1IYH A;  3GN3 A;  1NWW A;  4DVC A;  3UL6 A;  1PA3 A;  4TRX A;  1QGV A;  2GSQ A;  2PGT A;  1PGT A;  2OWP A;  1VGL A;  2XBI A;  3CNX A;  2PUK C;  2F98 A;  4I8B A;  2M80 A;  2R2J A;  4G0I A;  1BRS A;  1X9S B;  1YF1 A;  3AMO B;  13GS A;  3VI5 A;  2BT3 A;  4PXO A;  1XZO A;  3UJ1 A;  2YZU A;  2PVO C;  3KJY A;  3HVS A;  1BNF A;  3Q74 A;  4K7N A;  1R4C A;  3EN1 B;  2E2M A;  3ZFZ A;  5ECN B;  4Z2R A;  2A2R A;  4MNN A;  3FR3 A;  3GL5 A;  1RGC A;  3GKX A;  4BVY B;  3FF2 A;  3D0Z A;  3UBK A;  3ZRD A;  1TRP A;  3W8J A;  4GRF A;  4WWU C;  3LYG A;  3HVX A;  3HI7 A;  2VO4 A;  3VK9 A;  1DBY A;  1Q82 4;  3E99 A;  4DSS B;  1N8Q A;  3D22 A;  5JBS A;  4EV5 A;  1YKA A;  2X8G A;  5ECM B;  5B6M A;  1RDS A;  1HYF A;  2VCZ A;  1VQ6 3;  1GD4 A;  3MYT A;  2EIQ A;  3C73 A;  1RGH A;  2KOK A;  1ZS7 A;  4F0B A;  2P38 A;  3VSY A;  5D8I A;  3IBH A;  2WGQ A;  1NU3 A;  2CX4 A;  4RI7 A;  4XRA A;  1Y6E A;  3RGR A;  1N9J A;  3FG4 A;  1WOU A;  2RNT A;  1TI1 A;  3N5O A;  1IV7 A;  1T2H A;  3TKS A;  3F4R A;  2CX0 A;  2L5L A;  3A5W A;  5AYS C;  3QD9 A;  1FW7 A;  5HR2 A;  4AF2 A;  5HFK A;  2XPE A;  1YF0 A;  1IV9 A;  3IK9 A;  4H86 A;  4XIH A;  2A2P A;  2BMX A;  1Y25 A;  4HM2 B;  4HVN A;  3LW9 A;  4OFM A;  2W6J H;  3KZT A;  4V1A g;  3CCJ 3;  5B8A A;  4N30 A;  1SEN A;  4TN8 A;  3DD3 A;  2HE3 A;  3CD6 3;  3LZA A;  2VLU A;  4GSN A;  2BO9 B;  1TKD B;  2HMN B;  4O3V A;  3EHC A;  1LRA A;  2P5R A;  3SXX A;  1IU7 A;  1USB A;  1UCJ A;  3HIG A;  2XBQ A;  5DDL A;  4IHU A;  5D9W A;  1W5Z A;  4LL4 B;  2VCW A;  2O7K A;  1FGM A;  2GST A;  5AIH A;  4JE1 A;  3KSP A;  2RCD A;  2L4C A;  4MMM A;  1IVV A;  2YFL B;  2VUP A;  1SL2 B;  3CCM 3;  2B1X B;  3CSH A;  2LKU A;  1GNE A;  5IW9 A;  1ST9 A;  1W02 A;  3TB2 A;  1OAC A;  4QWT A;  1M1K 4;  1GOV A;  4NAX A;  3FZ4 A;  2FNQ A;  5CRD A;  4IJ3 A;  1A2L A;  1GMP A;  5ECP B;  5IG5 A;  3TUE A;  4EIQ A;  3NHX A;  5ENU A;  1CQS A;  3HII A;  3H4K A;  3S67 A;  3GSS A;  1KEB A;  2GZY A;  1K73 4;  1Q7Y 4;  3PCR A;  4WFO A;  4N11 A;  1F8N A;  3GRD A;  5EVH A;  2FA4 A;  5DJL A;  1U3A A;  5LCZ A;  5CP1 A;  3KFQ C;  1SQW A;  3H51 A;  3SX1 A;  1H75 A;  3GH9 A;  3JUN A;  3TOU A;  4Q5Q A;  1AY7 A;  2CK3 H;  1A90 A;  3ZL5 A;  4HBR A;  1AC1 A;  3EVI A;  3X3X A;  1O7H B;  1MWR A;  2LST A;  4FQU A;  4YQV A;  1VQP 3;  2HZE B;  1MNL A;  1QMA A;  4BL7 A;  4E8H A;  2LRC A;  2CWV A;  1GUM A;  2DC5 A;  5IIZ A;  1G02 A;  4JZQ A;  4MZB A;  1X0R A;  3NBR A;  2H74 A;  3CMI A;  3GKM A;  5DAL A;  1BRN L;  1WQL B;  2FLS A;  3K8N A;  3EU4 A;  4MK3 A;  3LYP A;  4HAA A;  4HQS A;  12GS A;  4KA0 A;  4HM7 B;  3D6I A;  3A2X A;  3N8B A;  2LNS A;  1YVB I;  4XB5 A;  1VF4 A;  4EL1 A;  2O9U X;  1FUT A;  1KTE A;  2LEG A;  5DQY A;  3KM6 A;  4FR9 A;  3K63 A;  4CHS A;  1O85 A;  1WMO A;  2A2S A;  1J0F A;  3CCL 3;  3O3T A;  1YJ9 3;  2IN3 A;  4KFF A;  5IO0 A;  5KP3 A;  3U1W A;  2OBI A;  5KN3 A;  4IW9 A;  3H8Q A;  4RQR A;  4O32 A;  1BSA A;  1GY7 A;  2OOV C;  5E4W A;  5IEP A;  2X8H A;  1AQV A;  5AIG A;  1N9E A;  3GNJ A;  1G0T A;  1G96 A;  1W2Z A;  5BU4 A;  3CXG A;  1TU7 A;  3B4O A;  2W2C A;  3C7M A;  1A2M A;  5DCH A;  1DE2 A;  1GSF A;  3GRX A;  4TVE A;  2GEY A;  2FGT A;  1X1Y A;  3IOS A;  3LT9 A;  2FUG 2;  2VOC A;  3G16 A;  3F14 A;  4NHW A;  3FEU A;  3R2Q A;  1SYX A;  1WRY A;  1XWC A;  3C8E A;  1KNG A;  3WT1 A;  3Q90 A;  1BRG A;  3EN8 A;  2INX A;  4E8E A;  4TXO A;  1TXX A;  1M99 A;  1ROV A;  1V2A A;  4K2D A;  2WGO A;  2F51 A;  2HLS A;  4XBT A;  1T4Y A;  1G6Y A;  5DCG A;  1GD3 A;  4PUR A;  1M1X B;  3A76 A;  4ACS A;  2MF7 A;  1O7N B;  2BMQ B;  1K0C A;  1LNH A;  3VWU A;  4BVX A;  5D93 A;  2QGU A;  4BA7 A;  3F4T A;  5HQP A;  2LJK A;  2AAW A;  3RHB A;  1XPV A;  2K18 A;  3GTU A;  3MWZ A;  3G7I A;  1FG4 A;  1SK0 A;  1TRU A;  1TW9 A;  2H30 A;  4N6L A;  1GYB A;  2JAD A;  2YWO A;  5DAL B;  4EKZ A;  5BMU A;  3EMX A;  20GS A;  2NBS A;  3TKP A;  3CC7 3;  3CRU A;  4N10 A;  2PVQ A;  3NV0 A;  3HZ4 A;  2STD A;  1EOG A;  2C1Y A;  1YJ6 A;  1FYS A;  2Z7A A;  4FMA A;  5DAK A;  4BU4 A;  2YJH A;  1QAF A;  3W6G A;  4IT7 A;  5C00 A;  4WHA A;  2OOV A;  3BD2 A;  3CTG A;  1WMN A;  4EW5 A;  1ISK A;  5KP1 A;  2HMJ B;  2VM2 A;  3WGE A;  4J5G A;  2R5G A;  2RM5 A;  3Q19 A;  3CU3 A;  1BSC A;  3FY7 A;  2H66 A;  3GHA A;  4WR5 A;  2PBJ A;  3DY5 A;  2H1G A;  1B9X C;  4BTY A;  1XWA A;  1NJI 4;  3GKK A;  3QFA C;  1XW6 A;  2V32 A;  1BUJ A;  5HFI A;  1K3O A;  1AVK A;  5BIR A;  2HXK A;  1NNV A;  4JU5 A;  3TCO A;  2J8X B;  4NV2 A;  1N2A A;  1O7P B;  4XHM A;  5G5F A;  4PTS A;  4K1U A;  1MDK A;  3BCK A;  4K0G A;  5IMD A;  1ZO2 A;  5CK6 A;  5HGR A;  1LQM B;  3E9J B;  1Q4J A;  1QMV A;  1S3R A;  4O5R A;  4AEQ A;  4CDO A;  1YHQ 3;  2ML5 A;  1I9D A;  3WA2 X;  4TXO B;  1MWU A;  1STD A;  3FG3 A;  5CRH A;  1KBN A;  5HR0 A;  5ECO B;  2G0F A;  4X2H A;  1JZO A;  2K9F A;  5ELA A;  2GBX B;  1PU4 A;  1U6T A;  1ZX2 A;  1G6W A;  2C0D A;  1WTH A;  4KDX A;  2HSM A;  1EQK A;  3G7Y A;  1VQ9 3;  2C3N A;  5EY6 A;  6GSV A;  3L9U A;  1SK2 A;  2GQL A;  4BVX B;  1X9M B;  1JJ2 2;  3GIX A;  2YNX A;  5G31 A;  5G1K A;  1SD8 A;  1MEK A;  2AV4 A;  4F2I A;  1HNC A;  1M0U A;  1C72 A;  1C54 A;  2WB9 A;  2WFC A;  5BRT A;  3HOH A;  3N9H A;  2C0G A;  4EDY A;  2B7K A;  4HU9 A;  1IQX A;  5COH A;  2WDU A;  3TJK A;  3D5G A;  3NV0 B;  4CY8 A;  2IJY A;  1RGE A;  1YZX A;  4HSC X;  4H61 A;  2FXT A;  1DSB A;  1MDI A;  1I0V A;  1W2B 2;  1Z7R A;  2C80 A;  5DAK B;  5AII A;  1BSE A;  1E6B A;  14GS A;  4HJ2 A;  4L8P A;  3LFL A;  2Q07 A;  1GL8 A;  4J9A A;  2V1L A;  1GLP A;  3GUR A;  3BNB A;  1XBS A;  2YN1 A;  2VL9 A;  1AR0 A;  2X49 A;  1SL1 B;  1LOW A;  1AXD A;  4G19 A;  5H5S A;  2CWT A;  3F8H A;  3DGQ A;  3PZW A;  2YZH A;  2LTK A;  3ZG5 A;  2WOH A;  3HVN A;  1GS3 A;  3P8W A;  3GA4 A;  4USS A;  1PD2 1;  4IQ1 A;  3VGN A;  1W6C A;  1VZZ A;  4JF8 A;  1EEJ A;  5CRW A;  2BTO T;  3P2A A;  3IC4 A;  3K9M C;  3MSZ A;  2AJQ B;  1BRJ A;  2HSY A;  2IFQ B;  2H70 A;  2JZT A;  3CC2 3;  1U5O A;  1EG9 B;  3BIR A;  2OE3 A;  5FGO A;  2UUG C;  2OKA A;  2K8S A;  4HUA A;  4WET A;  6GSU A;  4JRF A;  3DGY A;  4OMV A;  1Q40 A;  3DML A;  4NV5 A;  1BX9 A;  3UAP A;  2OCT A;  2CZ2 A;  1AQX A;  2XPD A;  1U3I A;  1W00 A;  3MNG A;  2CZ3 A;  4WBR D;  1RGA A;  2B24 B;  2BU4 A;  5BVB A;  1OYJ A;  1GSE A;  1GTU A;  3HJM A;  4N6V 0;  4MH3 A;  1F9M A;  4KDU A;  3DWV A;  1YDK A;  5ID2 A;  4HM6 B;  3IXR A;  5KN2 A;  3ERG A;  4NXI A;  2I9W A;  3LH4 A;  1BOX A;  4L5O A;  4Z7X A;  4Q5R A;  1OF5 A;  1U87 A;  2CA8 A;  5F8B A;  3L9V A;  1W4N A;  2W04 A;  4WF5 A;  3BNC A;  1VF2 A;  1QXH A;  3UL3 A;  4HOH A;  1YGW A;  4L7K A;  3RBT A;  2KAA A;  1DE3 A;  4ZL7 A;  1THO A;  3KKG A;  2VCX A;  1OC3 A;  1J08 A;  4X4J A;  2P31 A;  4GCI A;  1XWK A;  2KF3 A;  1S72 3;  1Q9E A;  4YKF A;  2FWG A;  4KND A;  4HQZ A;  2C10 A;  4TW5 A;  3K0Z A;  2WGR A;  1OGZ A;  1OKD A;  1BGS A;  4XBY A;  3FSD A;  4PEJ A;  3LJR A;  1DMN A;  4OO5 A;  4H3U A;  4ECJ A;  5J41 A;  1GTA A;  3TJG A;  4G2E A;  3L9S A;  4CJN A;  1L5G B;  3T8U A;  1FB0 A;  3UNL A;  2IIY A;  1IQY A;  2VCT A;  3FCS B;  4KAE A;  4GLT A;  3ZTL A;  2E0Q A;  3GFK A;  5GAN D;  1XCC A;  2HRK A;  4IS0 A;  1GOU A;  4MP4 A;  5J9C A;  5IOW A;  1M2A A;  2WUL A;  3O6T A;  3ZVJ A;  3T8N A;  1HZ1 A;  4EV2 A;  2XR8 B;  1BQ7 A;  2EC4 A;  4LMI A;  2XSO B;  3IV4 A;  1RLS A;  2LUS A;  5KN1 A;  3TJF A;  4OCE A;  1WWJ A;  3G7J A;  3D4M A;  3F7S A;  4LZI A;  1IDP A;  1Q98 A;  2QKE A;  1TRV A;  1BVI A;  2PPT A;  4RZM A;  4RUV A;  1RRL A;  2RGQ A;  4BTW A;  1AW9 A;  2R0C A;  4EXJ A;  2H6X A;  2LV3 A;  5CLK A;  1K28 A;  4G0K A;  2FWE A;  3ECF A;  3GST A;  3V98 A;  3NM2 A;  1AQW A;  5FWG A;  4IJI A;  1M7T A;  3JUO A;  3KII A;  4F0C A;  3EIN A;  3FHK A;  3PH9 A;  3F4S A;  4LSO A;  1Q40 B;  4N6N B;  1X5D A;  3DYR A;  2F4Y A;  2FHE A;  2CG0 A;  1Q42 A;  1DVD A;  2CW9 A;  5IER A;  1GLQ A;  1PFP A;  4O7H A;  2XGN A;  3CC4 3;  2I81 A;  2P0X A;  1LOY A;  2H1A A;  1AAZ A;  1XFL A;  1OF5 B;  1KD1 4;  1R5P A;  1BNI A;  3JUM A;  3E3E A;  1EGO A;  4IVF A;  1ASK A;  1BSD A;  2TRX A;  2FGX A;  1V58 A;  3HJP A;  3FH1 A;  4MF6 A;  4N6O B;  2OQE C;  4WKW A;  3KGK A;  2W03 A;  1ZCP A;  2YWM A;  3L4N A;  1T00 A;  1FOV A;  3ED3 A;  1I3F A;  1PN0 A;  3BB9 A;  3WGX A;  3UAR A;  2OAD A;  2GS3 A;  2HT9 A;  1V98 A;  3CSI A;  1B2X A;  1HU9 A;  3OV4 A;  1IK3 A;  3APQ A;  3QAV A;  5AIS A;  1DVC A;  3DKS A;  3TRP A;  1JBS A;  4ZB6 A;  3BLZ A;  8RNT A;  3SBC A;  2DJ3 A;  1S5A A;  2D42 A;  2C0F A;  2OJL A;  2GTU A;  22GS A;  1IQ8 A;  2O87 A;  3TRQ A;  3D9R A;  4Z2T A;  1AIU A;  2YOI A;  1A0R P;  3NIV A;  2YV9 A;  3RNT A;  4K9Z A;  2LS5 A;  3GZX B;  4LLR A;  2X64 A;  2DJ2 A;  4FO5 A;  5FW5 A;  4R9K A;  3EJV A;  3JUQ A;  2WOF A;  4HKV B;  3NOF A;  1ERT A;  1IYI A;  5AI1 A;  1TK8 B;  1R5A A;  2LJA A;  2RUF A;  5IMZ A;  3M0F A;  6GSY A;  2J23 A;  2PER A;  7GSP A;  1SKR B;  3M9K A;  4O5Q A;  1K9M 4;  2ZHX B;  2L6C A;  1XW9 A;  2KHP A;  3H3H A;  5JPU A;  3PCS A;  1O6J A;  1OC9 A;  1ZYQ B;  4KW6 A;  5CNW A;  1QK8 A;  3ZYW A;  1SAR A;  4V1A p;  1B9Y C;  4RNT A;  4BWQ A;  5B8B A;  2BMR B;  2W9Q A;  5HOH A;  1TK0 B;  4AGS A;  4JBB A;  1D6Z A;  2XEP A;  5ECL B;  3LGC A;  4OVM A;  1M9G A;  1N5P A;  1GP1 A;  4DKI A;  4MH2 A;  4HM5 B;  3IK7 A;  4O92 A;  5M1A A;  1PY3 A;  4GTU A;  2H75 A;  1O7M B;  2OQE A;  1WMP A;  1J2B A;  3X40 A;  3X3Y A;  2YAN A;  1FGT A;  1VQ8 3;  1JKG A;  1TIJ A;  1OC8 A;  1ON4 A;  2H19 A;  3OW2 2;  5CF1 A;  4K1V A;  1EV4 A;  1OE7 A;  4MZC A;  4OFN A;  4KX4 A;  3I43 A;  3ZML A;  1RCL A;  2MMN A;  2N5A A;  3QOU A;  1BJX A;  5KN0 A;  2PMT A;  2AB6 A;  1LBK A;  4LMV A;  3H93 A;  3I6A A;  2RSX A;  2XGL A;  4HM0 B;  3N54 B;  4WYK A;  1O81 A;  3NZN A;  2GEX A;  5G5E A;  1AQZ A;  3DZL A;  19GS A;  2C4J A;  1BRI A;  1YVS A;  4KT3 B;  1U8C B;  1HYU A;  3S5C A;  3WR2 A;  1GUL A;  4KF9 A;  3EU3 A;  1YGE A;  1UN2 A;  3C1S A;  5IMF A;  4O8S A;  2SBL A;  2LNT A;  4PUA A;  1GSY A;  1QFN A;  5FT3 A;  2PZV A;  5IG4 A;  1URM A;  4OWY A;  4RQX A;  3LTA A;  2YFJ B;  2L57 A;  3HCZ A;  2M72 A;  3US3 A;  3EYT A;  2QEX 3;  3OXA A;  2HI7 A;  1RCK A;  1TJD A;  2LYX A;  3GAX A;  2MMZ A;  1LOX A;  2KUC A;  1EOH A;  4BL3 A;  5IF6 A;  1TOF A;  2D1W A;  4A5P A;  3WYW A;  3TDG A;  3Q3F A;  5IMV A;  2UX0 A;  4BPY A;  3E0U A;  5ELJ A;  1D6Y A;  4BIR A;  1OC9 B;  5M19 A;  3APO A;  4HEA 2;  1PMT A;  4HDE A;  1JZW A;  2Z77 A;  2YV7 A;  2YPM A;  3WOF B;  1S3C A;  3T0U A;  2E2G A;  4ZL8 A;  2DKH A;  3L0H A;  4MMX B;  3WOD G;  5AEU B;  4ID0 A;  2NDO A;  3ME7 A;  4TOP A;  2CHC A;  3IMA B;  1GSP A;  2BJX A;  4X2O A;  3L0R A;  4LGQ A;  2EIO A;  2LJR A;  2R0G A;  4HM3 B;  2OBK A;  3RPP A;  2KP1 A;  4GF0 A;  4ZBB A;  3FZ5 A;  1PSQ A;  1W4V A;  1X1X A;  4U13 A;  5D96 A;  2KRT A;  3DUK A;  4EC6 A;  3ME8 A;  5G30 A;  5IQY A;  4F9Z A;  2GQM A;  1I2G A;  4MMY B;  1T1V A;  2L4V A;  1PFO A;  1JKG B;  2IY2 A;  1QVF 2;  1JBR A;  2JZR A;  3UMA A;  3D5I A;  1B8X A;  3KIJ A;  4K6X A;  5DVB A;  3QK9 A;  2A4H A;  3IPZ A;  3DXB A;  3WGD A;  2AYT A;  5IMA A;  2HSH A;  2H0G A;  3QR6 A;  6GST A;  3X41 A;  4X0X A;  5CYY A;  2GVP A;  2V41 A;  1TTZ A;  1BRH A;  1Z6N A;  3FZA A;  1DMQ A;  4LL1 B;  2B5E A;  4WYK B;  4XS6 A;  3MYD A;  7STD A;  2DBC A;  5GAP D;  4KFE A;  3CXC 2;  3UBL A;  2MBT A;  2I9H A;  3AGN A;  3KMN A;  4JED A;  4R1K A;  4PNF A;  1WJK A;  5AIF A;  3HKR A;  3KCM A;  4N6M A;  1GSS A;  2DMM A;  2RBI A;  2WZ9 A;  3GMF A;  5EEO A;  5KP4 A;  1V74 A;  2XFT A;  3MWH A;  3G71 3;  1ULI B;  1MOL A;  4EF0 A;  1OUN A;  4TR0 A;  4BL7 B;  2W56 A;  1NHY A;  1VF3 A;  1A67 A;  1K0O A;  3GX8 A;  1EZK A;  2H8L A;  3CCQ 3;  4MMZ B;  3I9V 2;  3F3R A;  2M46 A;  2IME A;  5D9V A;  1O7U A;  2ON7 A;  1MWS A;  3TKQ A;  3NM7 A;  4ORL A;  2FA8 A;  2HRN A;  4GHO A;  3CYN A;  3EC9 A;  3MHE A;  4MLY A;  4ZXG A;  4NHF A;  3QRD A;  1JLV A;  2B5X A;  3ZMK A;  3LTD A;  4KCE A;  3QPM A;  3MKI A;  3FZ9 A;  4KCA A;  1W6Y A;  1TRW A;  4V2L A;  6GSS A;  2G2Q A;  1FGR A;  3KTL A;  2R6K A;  4RNZ A;  16GS A;  1N5H A;  2QA2 A;  1SKS B;  3BNE A;  4FCM A;  1XW5 A;  1CEW I;  3V92 A;  3TRX A;  3KEB A;  2Z6B A;  3PS8 A;  1BED A;  1J9B A;  4OO4 A;  3JCM L;  4HZB B;  1JHB A;  3Q18 A;  1UUV B;  2GBW B;  2CVB A;  2DIY A;  1XOA A;  3GZY B;  3KTB A;  1WP0 A;  5L71 A;  5J3R A;  1A2V A;  2GZZ A;  2E2V A;  3KE7 A;  4Q5N A;  2LRT A;  2NVL A;  1TFO A;  2QA1 A;  3LG6 A;  5TGN A;  2CFL A;  3LT8 A;  3SLU A;  3HZ8 A;  5D83 A;  1BNJ A;  1UI8 A;  3KP8 A;  4HOJ A;  2O3O A;  4L8E A;  4YH2 A;  4ZBD A;  4K0N A;  1QAK A;  4XDW A;  2IWT A;  1BNS A;  3RPN A;  3NUV A;  1WPI A;  4J8T A;  1BRK A;  2HFD A;  1JN5 A;  3SYU A;  2DJ1 A;  5CO3 A;  1SJ6 A;  5GSP A;  3SVA A;  3FKF A;  2GSS A;  1A8Y A;  4RI6 A;  3DGO A;  1TRQ A;  4IPB A;  1TTO A;  4IP1 A;  4IQA A;  4AJ6 A;  2IYJ A;  1RHL A;  2AUV A;  4WR4 A;  4N3V A;  4TR1 A;  3CTF A;  2CVK A;  4KSM A;  5D73 A;  2F3M A;  5IG0 A;  5EL8 A;  5A4V A;  1OPY A;  3OWU A;  3DXO A;  1RK4 A;  1R26 A;  1PKW A;  4YKG A;  2FD3 A;  1JV2 B;  4PNG A;  1B2U A;  4ZM8 A;  2YJ7 A;  5G2Z A;  3SWL A;  1FA3 A;  3A3T A;  2XF3 A;  3RHC A;  4FYU A;  1LQG C;  1EWX A;  3ZRE A;  4R9L A;  3QAG A;  3GTU B;  2KXG A;  1Z1S A;  1EUI C;  3IC8 A;  4EC0 A;  5KOW A;  1AV4 A;  1SJZ A;  1YKC A;  1B48 A;  4WP5 A;  1Z3E A;  1GOY A;  2JQ5 A;  3FK8 A;  3WA3 A;  2KF4 A;  4KB3 A;  3CBU A;  5E59 A;  1GRX A;  3CCE 3;  1Z7P A;  4IP6 A;  4N0V A;  3WT2 A;  3ALA A;  3X42 A;  1XXU A;  1PQN A;  1XIY A;  2P09 A;  1ULJ B;  1X5E A;  5AEW B;  3LWA A;  3VLN A;  1SII A;  3CCV 3;  5F0G A;  1VQN 3;  1VQO 3;  3NXJ A;  1JZR A;  3AGO A;  1B20 A;  2LQV A;  3B8L A;  3FKA A;  4IIA A;  3LEF A;  3B4P A;  1DUG A;  1RN4 A;  1VQM 3;  2HML B;  1K41 A;  3EX9 A;  1ACV A;  5C04 A;  2Z9S A;  5ECS A;  3FG1 A;  4OD7 A;  3D3L A;  3CCS 3;  1WIK A;  2ZA4 A;  5HR1 A;  4CW9 A;  4I2T A;  4FH8 A;  2QA4 3;  1B21 A;  2R4I A;  6GSP A;  1W7C A;  2N5F A;  3BOA A;  3DIE A;  1OH0 A;  3EE1 A;  2AAD A;  2MBS A;  3OX9 A;  2DSA A;  3HA9 A;  3JUP A;  3F63 A;  2JL4 A;  4XRD A;  1YQ1 A;  5D9T A;  3ZZX A;  3F8U A;  1OCV A;  4KGI A;  1ZL9 A;  2PNC A;  3U5R E;  3GX0 A;  1UI7 A;  1F37 A;  5G1L A;  4GXZ A;  1QQ2 A;  1CQH A;  3QAW A;  2CH9 A;  1SL0 B;  1Q86 4;  3VI7 A;  1GMQ A;  3MG3 A;  2R4V A;  4Q5F A;  1FHE A;  3O8Y A;  4TR1 B;  3F9U A;  2V6K A;  1EKM A;  2A15 A;  4EYC A;  5IO2 A;  3LYK A;  5IPG A;  3ZG0 A;  1BNR A;  4MZW A;  1Z9H A;  2J9H A;  3IAS 2;  2KF6 A;  1ROA A;  4CCV A;  4MJC A;  3NBB A;  3G8Z A;  1A23 A;  5A4U A;  5LC7 A;  5ECR B;  6RNT A;  5RNT A;  1F6M C;  3CQF A;  3EUR A;  2VD1 A;  2H72 A;  4EBG A;  3IR4 A;  4O2H A;  1JBT A;  4ECI A;  3CSJ A;  1TRS A;  4BIK A;  3HX8 A;  1EEM A;  4MPF A;  2BHM A;  4XBX A;  2I4A A;  4JR6 A;  2E2U A;  4P3Y B;  1W01 A;  5DQS A;  3EC3 A;  3VFI A;  2OAC A;  4FMB A;  3GH6 A;  1R7H A;  4FIW A;  2PN8 A;  3MG1 A;  2RII A;  3FMW A;  1TFK A;  1ZZY A;  4ULX A;  4EXR A;  1YIT 3;  1OHP A;  4DSQ A;  4NWY A;  2NTO A;  1OKT A;  3M3M A;  3MIX A;  2MZC A;  3KXO A;  5ELG A;  1I3I A;  1SK1 A;  3PGB A;  1STF I;  3FGY A;  5ELU A;  1NM3 A;  2QSI A;  1TDI A;  2CFW A;  2W0Q A;  2ZDJ A;  1O7G B;  1FW1 A;  5EVO A;  1GWC A;  9RNT A;  1NW2 A;  3OWS A;  1RMS A;  1BNE A;  1SU9 A;  2H73 A;  1R4Y A;  1ZOF A;  3CRT A;  1UUG B;  3NQZ A;  3LOR A;  1SYR A;  3J7Y d;  3AY8 A;  4IN0 A;  4FCZ A;  1ABA A;  4O5U A;  1GSQ A;  4ZB9 A;  5IG3 A;  2X8C A;  4GL6 A;  1BAO A;  2GZP A;  2P0G A;  2ZL8 A;  2CC3 A;  1XVW A;  1O8X A;  3KCH A;  3M8N A;  1RN1 A;  4OCF A;  2JSY A;  1R4W A;  4HM8 B;  3KSE D;  1B4Q A;  2GDR A;  2VL2 C;  1SPU A;  1C7H A;  3GV1 A;  2V6O A;  4K61 A;  3STD A;  6STD A;  4KE3 A;  1SD9 A;  4J57 E;  1T5Y A;  1UW1 A;  4TXV A;  3FZW A;  2GT6 A;  2I1U A;  4G1M B;  5ID2 B;  3EBY A;  4POK A;  4FYC A;  4ZL9 A;  2ALB A;  1YNV X;  5JCU A;  4AKZ A;  4FYB A;  3JVC A;  3CME 3;  3PIN A;  3DEX A;  4HZ2 A;  2CFD A;  2QIY A;  3HVV A;  5LC6 A;  3J7Y k;  3CPW 2;  4ISD A;  2CFG A;  9GSS A;  1UCI A;  1X9W B;  1IVU A;  4L0W A;  5GST A;  1QUW A;  1Q7H A;  2DKI A;  1FVK A;  3UOM A;  4Q53 A;  3HJO A;  4NMU A;  1S3D A;  5J4U A;  1ILO A;  1RW1 A;  2K0M A;  4QL9 A;  4KH7 A;  3FW2 A;  1MD4 A;  10GS A;  2PWJ A;  3HHV A;  1K0N A;  1T7P B;  2H1D A;  1EGR A;  5JWQ B;  1RNB A;  4ML6 A;  1I8V A;  2VM1 A;  1A8L A;  5BXQ A;  2P0M A;  4MAB A;  3IAM 2;  4OUQ A;  5IOX A;  4KUN A;  4RBN A;  1QJG A;  4L8O A;  1ZYE A;  3KD0 A;  4HI7 A;  2D2Z A;  1I5G A;  5DJM A;  1BNG A;  1G7E A;  2H1B A;  3S29 A;  3H79 A;  5JCW A;  1S3A A;  2GU3 A;  1FGO A;  2IUJ A;  1IT8 A;  1ERV A;  4PQ1 A;  4ML1 A;  2H6Z A;  1PYL A;  2H71 A;  3GZR A;  2XHF A;  1K0M A;  4MJB A;  2GXF A;  3PGT A;  2WS2 A;  3TKR A;  3FF0 A;  3KN4 A;  1KQS 2;  2XC2 A;  1K0B A;  1A24 A;  1EV9 A;  4K7I A;  3DH2 A;  1ERU A;  2X99 A;  3VF1 A;  3NX0 A;  4XM4 A;  4CY6 A;  3DGM A;  5CXO A;  1W89 A;  2N5B A;  4ECB A;  1YIJ 3;  5D82 A;  1RNT A;  1ZYN A;  3KP9 A;  1UDI I;  3UVH A;  3J7Y b;  1TP9 A;  3IPT A;  4XTS A;  4EUY A;  2VL2 A;  2L59 A;  2H01 A;  2HZE A;  2VAF A;  1K8A 4;  5AN1 A;  2HYX A;  3UB1 A;  3ISO A;  2EIR A;  1RJO A;  3Q6O A;  18GS A;  4ECC A;  2VLT A;  3G9B A;  4I97 A;  4PGT A;  7RNT A;  1HKX A;  4G0L A;  3SOY A;  1M9B A;  4TKY A;  1E97 A;  3UVT A;  2VCV A;  2CT6 A;  1FAA A;  1PX7 A;  1LXE A;  5CRE A;  4LMW A;  1H4O A;  5JCG A;  4LEH A;  4ILF A;  3MAK A;  1MD3 A;  3ZIJ A;  4N6T A;  5H5Q A;  3G4S 3;  2YP6 A;  5IM9 A;  2BMO B;  3CMA 3;  1LVN A;  3OWY A;  1CQG A;  4CDL A;  4LYL B;  4D73 A;  5A0O B;  2ON5 A;  1U88 A;  3S28 A;  3KH7 A;  1SKW B;  4OK0 A;  2F5W A;  2Y74 A;  2GQK A;  2RLI A;  4O02 B;  4NHZ A;  1FUW A;  1NDO B;  2H76 A;  5J5N A;  1I2E A;  1V9W A;  1FOH A;  1UC7 A;  1K0D A;  1LU4 A;  5ECQ B;  2TIR A;  4HS1 A;  3NQY A;  3IE3 A;  5A5K A;  1FB6 A;  2AHE A;  1EP7 A;  1GY5 A;  3LXZ A;  5IMC A;  3TJB A;  4MA9 A;  1GH2 A;  3LSZ A;  2OE0 A;  1ML6 A;  1IVW A;  1UCL A;  1GMR A;  2CAQ A;  5LNK e;  2E2T A;  3PYJ A;  2F99 A;  1PL1 A;  1Q81 4;  1WMJ A;  1F3A A;  4ZIJ A;  1M2B A;  1TUH A;  6GSX A;  2B1K A;  4MCU A;  1M2D A;  1KC8 4;  2IMJ A;  2YFI B;  2FNO A;  2F86 B;  2C3Q A;  2IA7 A;  1X5C A;  3F9S A;  4YAP A;  2UZ8 A;  1OVN A;  1A2J A;  1EA2 A;  2LQQ A;  2JU5 A;  1DET A;  2IUK A;  1UGH I;  4HM4 B;  2H6Y A;  1SJW A;  3VPT A;  3F6D A;  4MF5 A;  5ECK B;  3D79 A;  2KLX A;  4ZB8 A;  2JAC A;  4EDZ A;  2K8V A;  2GSR A;  4I2U A;  5B7C A;  1UGI A;  1VQ4 3;  1RQM A;  1YEP A;  4GST A;  3GSP A;  3BJ5 A;  2K54 A;  1UA5 A;  2CIU A;  4L5L A;  4YQU A;  1E2Y A;  3CCU 3;  4DSR A;  5H5R A;  3QFB C;  3K5T A;  3ZIV A;  2MMA A;  4ICY A;  3RDW A;  2NPB A;  1B2S A;  4GWR A;  2RM6 A;  2B5Y A;  3CCR 3;  3H1N A;  3IHG A;  1HQO A;  2F8F A;  2Y73 A;  3I69 A;  1DE1 A;  2LQO A;  1NO3 A;  3HZP A;  3CNM A;  2F5M A;  1AVL A;  2GGT A;  4PQI A;  2VIM A;  4HYZ A;  1PL2 A;  2JDI H;  3O76 A;  3WDG B;  3I0Y A;  3DVW A;  1NHO A;  2JSZ A;  2CX1 A;  2X4A A;  4D73 B;  2C11 A;  5J9B A;  2C3T A;  2B6M A;  1RGK A;  1GSD A;  1M3I A;  2IL3 A;  3V99 A;  3TGZ A;  2HMM B;  4BWS A;  5A4W A;  1A0F A;  1K3L A;  3ER7 A;  2W9P A;  2CG1 A;  1MDJ A;  1B4P A;  2OTL 3;  2JZS A;  2ZUP A;  4G10 A;  2CX3 A;  1GTB A;  4NPB A;  3WD6 A;  3FR6 A;  2BNG A;  1M90 4;  3D21 A;  3M9J A;  3F0I A;  5IPH A;  2CFK A;  3EF8 A;  4YQM A;  2OTJ 3;  2HNL A;  4KZ1 A;  4FMC A;  3EPT A;  4LA1 A;  5HFG A;  1JZD A;  4HJM A;  2HZF A;  1VQ5 3;  1LOV A;  2HRF A;  3CPO A;  2V1M A;  1YJW 3;  1N8J A;  1VQ7 3;  1TU8 A;  2IMK A;  3Q1C A;  3U6V A;  3DM8 A;  2H0I A;  3P90 A;  3HXS A;  3V1W A;  3ZFB A;  5AIV A;  3M1G A;  4WEY A;  1XWG A;  5EPF A;  1NB5 I;  1X1U A;  1F3B A;  1THX A;  1FUS A;  1GY6 A;  3UL5 A;  3EBT A;  4MJE A;  1TI3 A;  2O89 A;  2TRC P;  1V40 A;  4FCJ A;  3RAZ A;  1GTI A;  2BIR A;  3WHO A;  1CYV A;  3F7X A;  2B1L A;  4MEI A;  2YCD A;  3GL3 A;  11GS A;  5F07 A;  1OHS A;  1TP6 A;  3RDE A;  2B3S A;  4JRR A;  2R37 A;  3F6F A;  2Z76 A;  1MTC A;  3LXU X; 
#chains in the Genus database with same CATH homology
 4MPG A;  1JFU A;  4PQH A;  1T3B A;  4K5S A;  3VUR A;  3EWL A;  2R3X A;  3QCP A;  2OA7 A;  2OE1 A;  3VWW A;  1M9A A;  2MMO A;  3HD5 A;  4L0U A;  4K2X A;  4IBP A;  3KZQ A;  4I5Q A;  5HR3 A;  3IHQ A;  5LD0 A;  5D9X A;  4WXT A;  2E7P A;  4K7O A;  3L78 A;  1XVQ A;  4POL A;  1PN9 A;  1TK5 B;  5F06 A;  4J56 E;  3QDN A;  5B6N A;  4XS4 A;  1V57 A;  3A5I A;  4XCS A;  5KOX A;  7GSS A;  2PU9 C;  3D5J A;  1AUC A;  2IFQ A;  4I6X A;  2F8A A;  4MF7 A;  3HY2 A;  6GSW A;  4K1F A;  4Z2U A;  2VCQ A;  1F2E A;  3UEM A;  1Z5Y E;  4ZIL A;  3ERF A;  2O8V B;  1HD2 A;  2VLV A;  2ZCT A;  2REM A;  1PX6 A;  3BCI A;  5F05 A;  3A2W A;  4PX1 A;  4F03 A;  3LQ7 A;  2L5O A;  1GUH A;  3OR5 A;  3FYG A;  17GS A;  2V2G A;  3EMP A;  2B7J A;  1OE8 A;  4EIP A;  4IEL A;  4KDY A;  1UVZ A;  4YAV A;  1HNA A;  3DRN A;  2L6D A;  1SJI A;  3S9F A;  3IDV A;  4MJA A;  2HRA A;  3P7X A;  4TR4 A;  1O8W A;  3ERW A;  2H0H A;  1GNW A;  2CAI A;  2IMD A;  1WE0 A;  2WJU A;  1K0A A;  1ZMA A;  1YY7 A;  2WRT A;  3GUS A;  3MDK A;  5AIX A;  4QQ7 A;  4EVM A;  3F3Q A;  1ZGN A;  4QL7 A;  4GSS A;  5KEJ A;  4G9H A;  3PPU A;  4JR4 A;  4X43 A;  4HZ4 A;  1BYE A;  4IGJ A;  1HNB A;  4ZBA A;  3IRA A;  4XS4 B;  3HDC A;  2KP2 A;  2YWN A;  2L4Q A;  2RUE A;  4N0Z A;  1YEX A;  3HYP A;  1K3Y A;  4X1U A;  2YWI A;  1G7O A;  4AJ7 A;  3ZLP A;  1LJR A;  3APS A;  2IMI A;  2C8U A;  2QGV A;  4TR3 A;  3ZFL A;  3VPQ A;  5ABR A;  3N9J A;  4J2F A;  2CQ9 A;  4MDC A;  2FY6 A;  8GSS A;  4V2N A;  3D4T A;  3BBY A;  3VWX A;  5GSS A;  3LXT A;  5GZZ B;  1FVJ A;  2CVD A;  3FRC A;  2P5Q A;  2DML A;  4XS1 A;  3UIW A;  1T8E B;  1JLW A;  3DVX A;  5ECH B;  3TKS E;  2FWH A;  1ZYP A;  2WCI A;  3C71 A;  2DJK A;  1OAZ A;  1VRS D;  5FHI A;  1NSW A;  2ES7 A;  4GQC A;  1EP8 A;  2DJ0 A;  2DLX A;  1GSU A;  2K6V A;  2GT5 A;  1PKZ A;  2VD0 A;  4EE0 A;  3ZVJ D;  5DBQ A;  5AGY A;  2LRN A;  4BVY A;  4WBJ A;  1XOB A;  1FO5 A;  1XWB A;  4GQF A;  4F82 A;  4OFT A;  3PR8 A;  4AJ8 A;  3C1R A;  4DSS A;  2F9S A;  4IKH A;  4WF4 A;  1VF1 A;  3GKN A;  4POM A;  4V2M A;  2CV4 A;  2DIZ A;  5JWO B;  1Z6M A;  2I3Y A;  1T4Z A;  3EE2 A;  1O73 A;  4HU7 A;  3VWV A;  2IMF A;  2O85 A;  4KSO A;  4PUF C;  2A4V A;  3GYK A;  1BG5 A;  3TOT A;  3A2V A;  3IA1 A;  3KMO A;  2R0P A;  2ZNM A;  3KH9 A;  3ZIT A;  5CAX A;  1ERW A;  3R3E A;  3QMX A;  2IPA A;  2QC7 A;  3W8S A;  2MYG A;  5CRG A;  1GUK A;  4K8M A;  2VL3 A;  4POB A;  3TJJ A;  4DEJ A;  2GLR A;  4K5R A;  2FWF A;  2DJJ A;  5ECI B;  2FCH A;  5INY A;  2C0E A;  3FR9 A;  5JWR B;  4EO3 A;  3TKS C;  1PRX A;  1BAY A;  1IYH A;  3GN3 A;  4DVC A;  1PA3 A;  4TRX A;  1QGV A;  2GSQ A;  2PGT A;  1PGT A;  1VGL A;  2XBI A;  2PUK C;  4I8B A;  2M80 A;  2R2J A;  4G0I A;  1X9S B;  1YF1 A;  13GS A;  3VI5 A;  4PXO A;  1XZO A;  3UJ1 A;  2YZU A;  2PVO C;  3KJY A;  3HVS A;  3Q74 A;  4K7N A;  2E2M A;  5ECN B;  4Z2R A;  2A2R A;  4MNN A;  3FR3 A;  3GL5 A;  3GKX A;  4BVY B;  3D0Z A;  3UBK A;  3ZRD A;  3W8J A;  4GRF A;  3HVX A;  2VO4 A;  3VK9 A;  1DBY A;  4DSS B;  3D22 A;  1YKA A;  2X8G A;  5ECM B;  5B6M A;  2VCZ A;  2EIQ A;  3C73 A;  2KOK A;  4F0B A;  5D8I A;  3IBH A;  2CX4 A;  4RI7 A;  4XRA A;  1Y6E A;  1WOU A;  1TI1 A;  3N5O A;  3TKS A;  3F4R A;  2L5L A;  3A5W A;  3QD9 A;  5HR2 A;  4AF2 A;  5HFK A;  2XPE A;  1YF0 A;  3IK9 A;  4H86 A;  4XIH A;  2A2P A;  2BMX A;  1Y25 A;  3LW9 A;  4OFM A;  4V1A g;  5B8A A;  4N30 A;  1SEN A;  4TN8 A;  3DD3 A;  2HE3 A;  2VLU A;  4GSN A;  1TKD B;  2P5R A;  5DDL A;  1USB A;  2XBQ A;  4IHU A;  5D9W A;  4LL4 B;  2VCW A;  2O7K A;  2GST A;  4JE1 A;  2L4C A;  4MMM A;  2VUP A;  1SL2 B;  3CSH A;  2LKU A;  1GNE A;  1ST9 A;  3TB2 A;  4NAX A;  3FZ4 A;  5CRD A;  4IJ3 A;  1A2L A;  3TUE A;  5ECP B;  4EIQ A;  5ENU A;  3H4K A;  3GSS A;  1KEB A;  2GZY A;  4N11 A;  2FA4 A;  5DJL A;  1U3A A;  5LCZ A;  5CP1 A;  1H75 A;  3GH9 A;  3TOU A;  4Q5Q A;  3ZL5 A;  1AC1 A;  3EVI A;  4FQU A;  2LST A;  4YQV A;  2HZE B;  4E8H A;  4BL7 A;  2LRC A;  1GUM A;  2DC5 A;  5IIZ A;  4JZQ A;  4MZB A;  1X0R A;  2H74 A;  3CMI A;  3GKM A;  5DAL A;  2FLS A;  3K8N A;  3EU4 A;  4MK3 A;  3LYP A;  4HQS A;  12GS A;  4KA0 A;  3D6I A;  3A2X A;  2LNS A;  1VF4 A;  4EL1 A;  1KTE A;  2LEG A;  5DQY A;  3KM6 A;  4CHS A;  1O85 A;  2A2S A;  1J0F A;  3O3T A;  2IN3 A;  5IO0 A;  2OBI A;  5KN3 A;  4IW9 A;  3H8Q A;  4RQR A;  4O32 A;  5E4W A;  2X8H A;  1AQV A;  3GNJ A;  1G0T A;  3CXG A;  1TU7 A;  3C7M A;  1A2M A;  5DCH A;  1DE2 A;  1GSF A;  3GRX A;  4TVE A;  3IOS A;  2FUG 2;  2VOC A;  4NHW A;  3FEU A;  3R2Q A;  1SYX A;  1WRY A;  1XWC A;  3C8E A;  1KNG A;  3WT1 A;  4E8E A;  4TXO A;  1TXX A;  1M99 A;  1V2A A;  4K2D A;  2F51 A;  2HLS A;  1T4Y A;  5DCG A;  1G6Y A;  4PUR A;  4ACS A;  1K0C A;  3VWU A;  4BVX A;  5D93 A;  4BA7 A;  3F4T A;  5HQP A;  2LJK A;  2AAW A;  3RHB A;  1XPV A;  2K18 A;  3GTU A;  3G7I A;  1FG4 A;  1SK0 A;  1TRU A;  1TW9 A;  2H30 A;  2JAD A;  2YWO A;  5DAL B;  4EKZ A;  5BMU A;  3EMX A;  20GS A;  2NBS A;  3TKP A;  3CRU A;  4N10 A;  2PVQ A;  3HZ4 A;  1EOG A;  2C1Y A;  1YJ6 A;  5DAK A;  2YJH A;  3W6G A;  5C00 A;  3BD2 A;  3CTG A;  2VM2 A;  3WGE A;  2R5G A;  2RM5 A;  3Q19 A;  3FY7 A;  2H66 A;  3GHA A;  4WR5 A;  2PBJ A;  2H1G A;  1B9X C;  1XWA A;  3GKK A;  3QFA C;  1XW6 A;  2V32 A;  5HFI A;  1K3O A;  2HXK A;  4JU5 A;  3TCO A;  4NV2 A;  1N2A A;  4XHM A;  5G5F A;  4PTS A;  1MDK A;  3BCK A;  4K0G A;  5IMD A;  3E9J B;  1Q4J A;  1QMV A;  4O5R A;  4CDO A;  1I9D A;  4TXO B;  5CRH A;  1KBN A;  5HR0 A;  5ECO B;  2G0F A;  1JZO A;  2K9F A;  5ELA A;  1U6T A;  1G6W A;  2C0D A;  4KDX A;  2HSM A;  3G7Y A;  2C3N A;  5EY6 A;  6GSV A;  3L9U A;  1SK2 A;  2GQL A;  4BVX B;  1X9M B;  3GIX A;  2YNX A;  5G31 A;  5G1K A;  1SD8 A;  1MEK A;  2AV4 A;  4F2I A;  1HNC A;  1M0U A;  1C72 A;  2WB9 A;  2WFC A;  5BRT A;  4EDY A;  2C0G A;  2B7K A;  4HU9 A;  5COH A;  2WDU A;  3TJK A;  4CY8 A;  2IJY A;  1YZX A;  1DSB A;  1MDI A;  2C80 A;  1Z7R A;  5DAK B;  1E6B A;  14GS A;  4HJ2 A;  3LFL A;  1GL8 A;  1GLP A;  3GUR A;  1XBS A;  2YN1 A;  2VL9 A;  2X49 A;  1SL1 B;  1AXD A;  4G19 A;  5H5S A;  3DGQ A;  2YZH A;  2LTK A;  3P8W A;  3GA4 A;  4USS A;  1PD2 1;  4IQ1 A;  1EEJ A;  5CRW A;  2BTO T;  3P2A A;  3IC4 A;  3MSZ A;  2AJQ B;  2HSY A;  2IFQ B;  2H70 A;  2JZT A;  2OE3 A;  2OKA A;  2K8S A;  4HUA A;  4WET A;  6GSU A;  4OMV A;  3DML A;  4NV5 A;  1BX9 A;  3UAP A;  2CZ2 A;  1AQX A;  2XPD A;  1U3I A;  3MNG A;  2CZ3 A;  4WBR D;  1OYJ A;  1GSE A;  1GTU A;  3HJM A;  4MH3 A;  1F9M A;  4KDU A;  3DWV A;  1YDK A;  5ID2 A;  3IXR A;  5KN2 A;  3ERG A;  4NXI A;  4L5O A;  4Z7X A;  4Q5R A;  1U87 A;  2CA8 A;  5F8B A;  3L9V A;  4WF5 A;  1VF2 A;  1QXH A;  3UL3 A;  3RBT A;  4ZL7 A;  1THO A;  2VCX A;  1OC3 A;  1J08 A;  4X4J A;  2P31 A;  4GCI A;  1XWK A;  4YKF A;  2FWG A;  4KND A;  4HQZ A;  4TW5 A;  2WGR A;  1OKD A;  3LJR A;  4OO5 A;  4ECJ A;  5J41 A;  1GTA A;  3TJG A;  4G2E A;  3L9S A;  1FB0 A;  2IIY A;  2VCT A;  4KAE A;  4GLT A;  3ZTL A;  2E0Q A;  3GFK A;  5GAN D;  1XCC A;  2HRK A;  4IS0 A;  4MP4 A;  5J9C A;  5IOW A;  1M2A A;  2WUL A;  3O6T A;  3ZVJ A;  1BQ7 A;  2EC4 A;  3IV4 A;  5KN1 A;  3TJF A;  2LUS A;  4OCE A;  1WWJ A;  3G7J A;  3D4M A;  1Q98 A;  2QKE A;  1TRV A;  2PPT A;  4RUV A;  4EXJ A;  1AW9 A;  2R0C A;  2H6X A;  2LV3 A;  4G0K A;  2FWE A;  3GST A;  1AQW A;  5FWG A;  4IJI A;  1M7T A;  4F0C A;  3EIN A;  3FHK A;  3PH9 A;  3F4S A;  1X5D A;  3DYR A;  2FHE A;  1GLQ A;  4O7H A;  2I81 A;  2H1A A;  1AAZ A;  1XFL A;  1R5P A;  3E3E A;  1EGO A;  4IVF A;  2TRX A;  2FGX A;  1V58 A;  3HJP A;  4MF6 A;  4WKW A;  3KGK A;  2YWM A;  1ZCP A;  3L4N A;  1T00 A;  1FOV A;  3ED3 A;  1PN0 A;  3WGX A;  3UAR A;  2OAD A;  2GS3 A;  2HT9 A;  1V98 A;  3CSI A;  3APQ A;  3QAV A;  5AIS A;  3DKS A;  3TRP A;  4ZB6 A;  3SBC A;  2DJ3 A;  2C0F A;  2OJL A;  2GTU A;  22GS A;  2O87 A;  3TRQ A;  4Z2T A;  1AIU A;  2YOI A;  1A0R P;  3NIV A;  2YV9 A;  4K9Z A;  2LS5 A;  4LLR A;  2X64 A;  2DJ2 A;  4FO5 A;  3NOF A;  1ERT A;  1IYI A;  1TK8 B;  1R5A A;  2LJA A;  2RUF A;  5IMZ A;  3M0F A;  6GSY A;  2J23 A;  2PER A;  1SKR B;  3M9K A;  4O5Q A;  2L6C A;  1XW9 A;  2KHP A;  1O6J A;  1OC9 A;  1ZYQ B;  4KW6 A;  5CNW A;  1QK8 A;  3ZYW A;  4V1A p;  1B9Y C;  4BWQ A;  5B8B A;  1TK0 B;  4AGS A;  4JBB A;  5ECL B;  3LGC A;  1GP1 A;  4MH2 A;  3IK7 A;  4O92 A;  4GTU A;  2H75 A;  2YAN A;  1OC8 A;  1ON4 A;  2H19 A;  1EV4 A;  1OE7 A;  4MZC A;  4OFN A;  4KX4 A;  3I43 A;  3ZML A;  2MMN A;  2N5A A;  3QOU A;  1BJX A;  5KN0 A;  2PMT A;  2AB6 A;  1LBK A;  4LMV A;  3H93 A;  3I6A A;  1O81 A;  5G5E A;  3NZN A;  19GS A;  2C4J A;  1HYU A;  1GUL A;  4KF9 A;  3EU3 A;  1UN2 A;  3C1S A;  5IMF A;  2LNT A;  4PUA A;  1GSY A;  1QFN A;  5FT3 A;  1URM A;  4OWY A;  4RQX A;  2L57 A;  3HCZ A;  2M72 A;  3US3 A;  3EYT A;  2HI7 A;  1TJD A;  2MMZ A;  2KUC A;  1EOH A;  1TOF A;  4A5P A;  3WYW A;  3TDG A;  5IMV A;  4BPY A;  3E0U A;  1OC9 B;  3APO A;  4HEA 2;  1PMT A;  4HDE A;  1JZW A;  2YV7 A;  2YPM A;  1S3C A;  2E2G A;  4ZL8 A;  2DKH A;  3L0H A;  4ID0 A;  2NDO A;  3ME7 A;  4TOP A;  2BJX A;  2EIO A;  2LJR A;  2R0G A;  3RPP A;  2OBK A;  2KP1 A;  4GF0 A;  4ZBB A;  3FZ5 A;  1PSQ A;  1W4V A;  5D96 A;  3ME8 A;  5G30 A;  5IQY A;  4F9Z A;  2GQM A;  1T1V A;  2IY2 A;  2JZR A;  3UMA A;  1B8X A;  3KIJ A;  4K6X A;  5DVB A;  2A4H A;  3IPZ A;  3DXB A;  3WGD A;  2AYT A;  5IMA A;  2HSH A;  2H0G A;  3QR6 A;  6GST A;  4X0X A;  5CYY A;  2GVP A;  2V41 A;  1TTZ A;  1Z6N A;  3FZA A;  4LL1 B;  2B5E A;  4XS6 A;  3MYD A;  2DBC A;  5GAP D;  3UBL A;  2MBT A;  2I9H A;  3KMN A;  4JED A;  4PNF A;  1WJK A;  3HKR A;  3KCM A;  1GSS A;  2DMM A;  2WZ9 A;  3GMF A;  3MWH A;  4EF0 A;  4TR0 A;  4BL7 B;  1NHY A;  1VF3 A;  1K0O A;  3GX8 A;  1EZK A;  2H8L A;  3I9V 2;  3F3R A;  2M46 A;  2IME A;  5D9V A;  1O7U A;  2ON7 A;  3TKQ A;  2FA8 A;  2HRN A;  3CYN A;  4MLY A;  4ZXG A;  1JLV A;  2B5X A;  3ZMK A;  4KCE A;  3QPM A;  3FZ9 A;  4KCA A;  1TRW A;  4V2L A;  6GSS A;  2G2Q A;  3KTL A;  2R6K A;  16GS A;  2QA2 A;  1SKS B;  1XW5 A;  3TRX A;  3KEB A;  1BED A;  1J9B A;  4OO4 A;  3JCM L;  1JHB A;  3Q18 A;  2CVB A;  2DIY A;  1XOA A;  3KTB A;  1WP0 A;  5L71 A;  5J3R A;  2GZZ A;  4Q5N A;  2LRT A;  2NVL A;  2QA1 A;  3LG6 A;  3HZ8 A;  4YH2 A;  4HOJ A;  3KP8 A;  4L8E A;  4ZBD A;  4K0N A;  2IWT A;  3RPN A;  1WPI A;  2HFD A;  2DJ1 A;  5CO3 A;  1SJ6 A;  3FKF A;  2GSS A;  1A8Y A;  4RI6 A;  4IP1 A;  4IQA A;  4AJ6 A;  2IYJ A;  2AUV A;  4WR4 A;  4TR1 A;  3CTF A;  2CVK A;  4KSM A;  5D73 A;  2F3M A;  5EL8 A;  5A4V A;  1RK4 A;  1PKW A;  1R26 A;  4YKG A;  2FD3 A;  4PNG A;  2YJ7 A;  5G2Z A;  3SWL A;  3A3T A;  3RHC A;  4FYU A;  1EWX A;  3ZRE A;  3QAG A;  3GTU B;  3IC8 A;  4EC0 A;  5KOW A;  1SJZ A;  1YKC A;  1B48 A;  1Z3E A;  3FK8 A;  4KB3 A;  3CBU A;  5E59 A;  1GRX A;  1Z7P A;  4IP6 A;  4N0V A;  3WT2 A;  1XXU A;  1PQN A;  1XIY A;  1X5E A;  3LWA A;  3VLN A;  5F0G A;  1JZR A;  3LEF A;  1DUG A;  1ACV A;  5C04 A;  2Z9S A;  5ECS A;  4OD7 A;  1WIK A;  5HR1 A;  4CW9 A;  4I2T A;  4FH8 A;  2N5F A;  3BOA A;  3DIE A;  2MBS A;  2DSA A;  3HA9 A;  4XRD A;  3F63 A;  2JL4 A;  1YQ1 A;  5D9T A;  3ZZX A;  3F8U A;  4KGI A;  1ZL9 A;  3U5R E;  3GX0 A;  1F37 A;  5G1L A;  4GXZ A;  1QQ2 A;  1CQH A;  3QAW A;  1SL0 B;  3VI7 A;  2R4V A;  4Q5F A;  1FHE A;  4TR1 B;  3F9U A;  2V6K A;  5IO2 A;  3LYK A;  5IPG A;  4MZW A;  1Z9H A;  2J9H A;  3IAS 2;  4MJC A;  1A23 A;  5A4U A;  5ECR B;  1F6M C;  3EUR A;  2VD1 A;  2H72 A;  3IR4 A;  4ECI A;  3CSJ A;  1TRS A;  1EEM A;  4MPF A;  2I4A A;  4JR6 A;  4P3Y B;  5DQS A;  3EC3 A;  3VFI A;  2OAC A;  3GH6 A;  1R7H A;  4FIW A;  2PN8 A;  2RII A;  3FMW A;  4ULX A;  1ZZY A;  4DSQ A;  4NWY A;  2NTO A;  1OKT A;  3M3M A;  3MIX A;  2MZC A;  3KXO A;  5ELG A;  1SK1 A;  1NM3 A;  2QSI A;  1TDI A;  1FW1 A;  5EVO A;  1GWC A;  1NW2 A;  1SU9 A;  2H73 A;  1ZOF A;  3CRT A;  3LOR A;  1SYR A;  3AY8 A;  4IN0 A;  1ABA A;  4O5U A;  1GSQ A;  4ZB9 A;  2X8C A;  2P0G A;  2GZP A;  1XVW A;  1O8X A;  3M8N A;  4OCF A;  2JSY A;  1R4W A;  1B4Q A;  2GDR A;  2VL2 C;  3GV1 A;  2V6O A;  4KE3 A;  1SD9 A;  4J57 E;  4TXV A;  2GT6 A;  2I1U A;  5ID2 B;  4POK A;  4FYC A;  4ZL9 A;  2ALB A;  5JCU A;  4FYB A;  3PIN A;  3DEX A;  4HZ2 A;  3HVV A;  3J7Y k;  4ISD A;  9GSS A;  1X9W B;  4L0W A;  5GST A;  1QUW A;  2DKI A;  1FVK A;  3UOM A;  3HJO A;  4NMU A;  1S3D A;  5J4U A;  1ILO A;  1RW1 A;  4QL9 A;  4KH7 A;  3FW2 A;  1MD4 A;  10GS A;  2PWJ A;  3HHV A;  1K0N A;  1T7P B;  2H1D A;  1EGR A;  5JWQ B;  4ML6 A;  2VM1 A;  1A8L A;  4MAB A;  3IAM 2;  5IOX A;  4KUN A;  3KD0 A;  1ZYE A;  4HI7 A;  2D2Z A;  1I5G A;  5DJM A;  1G7E A;  2H1B A;  3H79 A;  5JCW A;  1S3A A;  4PQ1 A;  1ERV A;  4ML1 A;  2H6Z A;  2H71 A;  2XHF A;  1K0M A;  4MJB A;  3PGT A;  2WS2 A;  3TKR A;  2XC2 A;  1K0B A;  1A24 A;  1EV9 A;  4K7I A;  1ERU A;  2X99 A;  4ECB A;  4CY6 A;  1W89 A;  2N5B A;  1ZYN A;  3KP9 A;  3UVH A;  3J7Y b;  1TP9 A;  4XTS A;  4EUY A;  2VL2 A;  2L59 A;  2H01 A;  2HZE A;  2VAF A;  5AN1 A;  2HYX A;  3ISO A;  2EIR A;  3Q6O A;  18GS A;  4ECC A;  2VLT A;  3G9B A;  4I97 A;  4PGT A;  4G0L A;  4TKY A;  1M9B A;  3UVT A;  2VCV A;  2CT6 A;  1FAA A;  1PX7 A;  5CRE A;  4LMW A;  1H4O A;  5JCG A;  4ILF A;  3MAK A;  1MD3 A;  3ZIJ A;  5H5Q A;  2YP6 A;  5IM9 A;  1CQG A;  4D73 A;  2ON5 A;  1U88 A;  3KH7 A;  1SKW B;  2GQK A;  2RLI A;  4NHZ A;  2H76 A;  5J5N A;  1V9W A;  1FOH A;  1UC7 A;  1K0D A;  1LU4 A;  5ECQ B;  2TIR A;  4HS1 A;  3IE3 A;  5A5K A;  1FB6 A;  2AHE A;  1EP7 A;  3LXZ A;  5IMC A;  3TJB A;  4MA9 A;  1GH2 A;  3LSZ A;  2OE0 A;  1ML6 A;  2CAQ A;  5LNK e;  1PL1 A;  1WMJ A;  1F3A A;  4ZIJ A;  1M2B A;  6GSX A;  2B1K A;  4MCU A;  1M2D A;  2FNO A;  2C3Q A;  1X5C A;  4YAP A;  2UZ8 A;  1OVN A;  1A2J A;  2LQQ A;  2JU5 A;  2H6Y A;  3VPT A;  3F6D A;  4MF5 A;  5ECK B;  2KLX A;  4ZB8 A;  2JAC A;  4EDZ A;  2K8V A;  2GSR A;  4I2U A;  5B7C A;  1RQM A;  1YEP A;  4GST A;  3BJ5 A;  1UA5 A;  4L5L A;  4YQU A;  1E2Y A;  4DSR A;  5H5R A;  3QFB C;  3ZIV A;  2MMA A;  4ICY A;  3RDW A;  2NPB A;  4GWR A;  2RM6 A;  2B5Y A;  3H1N A;  3IHG A;  1HQO A;  2F8F A;  3I69 A;  1DE1 A;  2LQO A;  2GGT A;  4PQI A;  2VIM A;  1PL2 A;  3O76 A;  3DVW A;  1NHO A;  2JSZ A;  4D73 B;  2X4A A;  5J9B A;  2C3T A;  2B6M A;  1GSD A;  2IL3 A;  3TGZ A;  4BWS A;  5A4W A;  1A0F A;  1K3L A;  1MDJ A;  1B4P A;  2JZS A;  2ZUP A;  4G10 A;  2CX3 A;  1GTB A;  4NPB A;  3WD6 A;  3FR6 A;  3D21 A;  3M9J A;  3F0I A;  5IPH A;  4YQM A;  2HNL A;  3EPT A;  5HFG A;  4LA1 A;  1JZD A;  4HJM A;  2HZF A;  2HRF A;  2V1M A;  1N8J A;  1TU8 A;  2IMK A;  3U6V A;  3V1W A;  2H0I A;  3P90 A;  3HXS A;  3ZFB A;  5AIV A;  3M1G A;  4WEY A;  1XWG A;  5EPF A;  1F3B A;  1THX A;  4MJE A;  1TI3 A;  2O89 A;  2TRC P;  1V40 A;  3RAZ A;  1GTI A;  2B1L A;  2YCD A;  3GL3 A;  11GS A;  5F07 A;  2B3S A;  4JRR A;  2R37 A;  3F6F A;  1MTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...