4I5QA

Crystal structure and catalytic mechanism for peroplasmic disulfide-bond isomerase dsbc from salmonella enterica serovar typhimurium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
AMDPEFMDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbC
publication title Crystal structure of the periplasmic disulfide-bond isomerase DsbC from Salmonella enterica serovar Typhimurium and the mechanistic implications.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Isomerase
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 4i5qA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i5qA02
5AIXA 3RDWA 2E2MA 3L0HA 4D73B 1GSEA 2HLSA 4GCIA 4IVFA 5ECMB 4ZL7A 1ZOFA 4HEA2 1X0RA 2AUVA 1XXUA 1TRVA 1V58A 2CV4A 3DRNA 5DJMA 3VI5A 2O85A 2V2GA 3TJKA 5J5NA 5KN0A 1F37A 2LNTA 3KEBA 3G7IA 3DMLA 4AJ7A 2E0QA 2OADA 4FYUA 4RI6A 4KB3A 1A0RP 2LSTA 2HE3A 4O5RA 3US3A 3IC4A 1ILOA 3U5RE 3CSJA 2OE0A 4MJAA 4EL1A 4TR3A 12GSA 4PUFC 1MDJA 3KM6A 3FZAA 4IQ1A 2IPAA 3GIXA 6GSXA 3GTUA 5F05A 4KAEA 2DLXA 3F4RA 5IMFA 4XIHA 3IAM2 1SYXA 1WMJA 3LXTA 5A5KA 3FR6A 1Z5YE 3J7Yk 4OD7A 5CNWA 4MZBA 2CAIA 4WR5A 2K9FA 4KSOA 3ERFA 3F4SA 2OBIA 5CRDA 2YV9A 3HHVA 2BTOT 1ACVA 4MLYA 4PURA 2JL4A 3TJJA 1JZOA 4F82A 1HD2A 2PGTA 3PGTA 1MTCA 1M2AA 3KTLA 4OFTA 3CSHA 4XRDA 3FW2A 1VF4A 3IBHA 1PL1A 1EV4A 1FVKA 4D73A 2YV7A 2JSYA 1THXA 3VWVA 1CQGA 2MMZA 5EPFA 2LNSA 3GRXA 1EP8A 3PINA 6GSSA 2E2GA 4KDXA 3FRCA 1QMVA 1F2EA 2VO4A 1HNAA 3GHAA 2MMOA 5DJLA 1OC8A 2B1LA 3KTBA 3QCPA 2GTUA 4WETA 2CAQA 2X99A 2DJ1A 3DVWA 3LYPA 1URMA 1QGVA 1A2LA 5GAND 1SL0B 2LV3A 1EGOA 5LCZA 2GSSA 1XWBA 1SENA 4YQMA 3GH9A 1XW6A 2B7KA 4IP1A 3TJFA 3DIEA 3N9JA 1PL2A 1AQXA 4HU9A 5IOWA 3TOUA 3WGXA 1AW9A 1F3AA 1YEPA 1TRWA 4AF2A 1JLVA 1GNWA 2X8GA 5IMDA 1ERWA 1G6WA 1T7PB 4MZCA 2N5AA 5B8BA 3KCMA 5B6NA 4L0UA 3KH7A 1AQVA 3IR4A 3HVVA 3HY2A 3GL5A 3FHKA 3IPZA 1BEDA 3IXRA 1GTIA 4Q5RA 3H1NA 3I9V2 3QAGA 3GKKA 1EZKA 5IPHA 2DMLA 2MBSA 4TXOB 1B48A 3F3RA 1J9BA 2MBTA 2AHEA 2FWHA 1GRXA 1EV9A 2L5LA 2YJ7A 1M9AA 3FEUA 1U3AA 1TRSA 3KJYA 5ECLB 1A2MA 2HXKA 3KZQA 1YY7A 1O6JA 1T4ZA 4IN0A 1WOUA 5C00A 4XRAA 2HT9A 1A0FA 2IYJA 2P0GA 1ZL9A 3QOUA 1E2YA 1OYJA 5ID2B 1NM3A 2R2JA 2BMXA 5EY6A 3ZL5A 3VPQA 4YQVA 4HS1A 2L6DA 1QQ2A 2PERA 4L5LA 1K3OA 1DE1A 2CVKA 1W89A 1DBYA 4HQSA 2K6VA 4K0NA 4RUVA 2L59A 3GX0A 5A4VA 4EF0A 5ECKB 2Z9SA 1FG4A 2HZEB 5A4WA 2YNXA 3M1GA 4I2TA 2FWFA 2H74A 1DE2A 1ERVA 3KP9A 1WRYA 3DXBA 1VF1A 1TRUA 1K0OA 3FZ9A 4ECJA 4TKYA 3TKSE 2AYTA 4X43A 4GQCA 4MMMA 2GQMA 1K3LA 5E59A 5HR3A 3E0UA 3AY8A 3KMNA 3M9KA 1HNCA 1XW5A 2HI7A 3J7Yb 3GNJA 4TXOA 2MZCA 3HD5A 4BVXA 1OC3A 1I5GA 2C0DA 1S3AA 4JZQA 2G0FA 4PUAA 2WCIA 17GSA 4CW9A 3H4KA 3F6FA 4K1FA 1AAZA 1K0NA 4IHUA 1U88A 2YWNA 3UMAA 1A23A 3A2WA 1BAYA 2CX3A 2VM1A 3TRXA 1PA3A 4MJBA 2ON5A 3C73A 5ID2A 4GQFA 3UL3A 2B7JA 2REMA 5J3RA 3FKFA 2GZYA 3HVXA 5JWQB 2FLSA 5D9WA 5D8IA 1GSQA 3F3QA 5JWRB 1B4QA 4N30A 1JFUA 2PVOC 5HR0A 2IWTA 3GKMA 1KTEA 3I43A 3CSIA 4HU7A 3EVIA 6GSWA 3U6VA 4O7HA 3UBKA 3FYGA 4JE1A 4NAXA 4TR4A 1GUKA 3D6IA 3DEXA 3BOAA 4TOPA 1FO5A 2OJLA 2HZEA 3HJMA 1T8EB 3KXOA 4V1Ap 1W4VA 4KX4A 1MEKA 4PGTA 2P31A 5FT3A 3EU4A 3VFIA 3VURA 2IIYA 4FO5A 5DVBA 5ECSA 3V1WA 4TW5A 5LD0A 2C8UA 5HFIA 4GRFA 1WJKA 2HNLA 3F0IA 3TKRA 4J2FA 4Q5NA 4H86A 8GSSA 3D4TA 1WIKA 2MMNA 3HZ4A 2I9HA 3TJGA 2RUFA 1IYHA 4KGIA 2LJKA 2IMFA 2YZHA 2LS5A 2GQLA 1R4WA 4IW9A 1YKAA 1BQ7A 2KOKA 1S3CA 3FZ5A 3HJPA 5ECRB 4ZB6A 3UIWA 3ZZXA 3RPNA 4HUAA 1ZCPA 1FB6A 2MYGA 3ZTLA 3FZ4A 3IDVA 4ZIJA 1Q4JA 4Q5FA 3QR6A 5FWGA 1G7EA 4X1UA 3L9SA 2AAWA 1M0UA 2VD0A 2ZNMA 3M9JA 5ELAA 3O3TA 1PGTA 2IN3A 4MF7A 5J4UA 14GSA 2ZUPA 1YEXA 1B8XA 1AC1A 2NBSA 4WF5A 2GSRA 3IE3A 1Y25A 3LYKA 2VL2C 1V40A 5F06A 4PQ1A 1XPVA 3KP8A 3APSA 1K0CA 1NW2A 2DSAA 2RUEA 5L71A 1E6BA 1PRXA 1G6YA 1NHYA 4BL7A 4P3YB 1Z3EA 4V2NA 2FA4A 2JACA 3BCIA 3EMPA 3P7XA 1ZYEA 5DDLA 2M80A 3BCKA 3KD0A 3A2XA 2C0GA 3PH9A 1OE8A 2LRTA 2RIIA 5ECNB 20GSA 3KH9A 3TDGA 1TW9A 4QL9A 2CVBA 3WGDA 3GV1A 1GTUA 5GAPD 3ERGA 4JEDA 2CT6A 4JRRA 1V98A 1AUCA 3L78A 3K8NA 1XWAA 3A2VA 3BD2A 4EDZA 2GZPA 4ACSA 2TRXA 1X5EA 4O92A 3GFKA 5DQYA 4XTSA 3UOMA 4MK3A 4LMWA 1BJXA 1PSQA 3VWWA 1SK0A 5CREA 4EUYA 5HR1A 3MNGA 6GSTA 2CVDA 1PKZA 2GQKA 4HJMA 5AGYA 2FUG2 2IL3A 4CHSA 2RLIA 2ZCTA 1O8WA 2FCHA 2IJYA 2K8VA 4TVEA 4EKZA 3TB2A 1A24A 2HYXA 1I9DA 3DWVA 2B5XA 5CRGA 5B6MA 2WJUA 2DIYA 2YCDA 3CTGA 1XWKA 1S3DA 3GURA 2G2QA 2VCVA 4MZWA 1ERTA 3HZ8A 1PN9A 1ST9A 1Z6NA 4RQRA 3UVTA 3HA9A 2LJRA 4EVMA 2VOCA 3GX8A 3C1RA 5ECPB 2OBKA 2N5BA 3D0ZA 5GSSA 3IK9A 2E7PA 2LQQA 4GSSA 1GSYA 2H66A 3LG6A 5ECQB 3GL3A 4BWSA 4O32A 4F0CA 2D2ZA 2PVQA 5CRHA 1J0FA 4K7NA 3P2AA 4TR1B 2NTOA 1M9BA 1QFNA 2XBQA 6GSYA 1GNEA 2M46A 4POKA 3IHQA 5EVOA 3EE2A 4OO5A 3O76A 2ON7A 1NHOA 4RQXA 4ECIA 2C0EA 3QD9A 1PX7A 10GSA 2ES7A 3LORA 4GSTA 5CO3A 3L9VA 4KUNA 1TKDB 4HJ2A 5AN1A 4K2DA 2PU9C 1PD21 1PMTA 2V32A 2IMKA 3OR5A 4WR4A 5F8BA 1TOFA 1AXDA 5ECHB 4KCEA 2F3MA 1SL2B 13GSA 3RBTA 2I3YA 4WF4A 2BJXA 2YOIA 5KN2A 19GSA 4E8HA 4F0BA 1M7TA 3RHBA 1MD3A 2GLRA 7GSSA 3JCML 3G9BA 2VM2A 1BG5A 1UA5A 3HCZA 4QL7A 4K7OA 2OKAA 2R37A 4MF6A 1TI1A 3CTFA 4XHMA 3TRQA 1Z9HA 4ZBAA 2YANA 3M8NA 1H4OA 4MJEA 1MDIA 1THOA 5DALB 3KMOA 3Q19A 1ML6A 4IJIA 1JZDA 1OKTA 1SYRA 3IK7A 5IMVA 4V2LA 1Z7RA 1EEJA 1LBKA 3UARA 3M3MA 4TR1A 4J56E 1ZYQB 3VPTA 1OVNA 3HXSA 5KN3A 3Q6OA 4NV5A 4PX1A 2JZRA 2HRNA 2H76A 2VL2A 1JHBA 2LUSA 4LA1A 1EWXA 2H1BA 1XZOA 3ME8A 2A2RA 2VD1A 1GLPA 3VK9A 1QUWA 4IKHA 5CAXA 1C72A 1O81A 1MD4A 2PMTA 1QK8A 2XC2A 2GT6A 1RW1A 3ZRDA 1UN2A 4N0ZA 1VRSD 4BVYA 2H01A 2VCWA 2YN1A 4ID0A 2QSIA 3KGKA 5J9BA 3LXZA 3E9JB 5IOXA 1YQ1A 4HZ4A 3TJBA 4Z7XA 3KIJA 2I81A 4QQ7A 2R4VA 3FK8A 5GSTA 2DIZA 2X8HA 4K8MA 2LQOA 1TI3A 1GULA 1R26A 2FGXA 4ZILA 3I6AA 3F63A 3L9UA 2AJQB 2C1YA 3C71A 5IPGA 3UEMA 1GSSA 1KNGA 4L8EA 2CQ9A 1GSFA 4XS6A 4ILFA 1EOHA 2DBCA 3GSSA 3QAWA 3O6TA 1O85A 4MABA 1GSUA 3W8JA 2QGVA 3L4NA 2R3XA 1XVWA 3EYTA 3FY7A 2C3TA 1T3BA 4J57E 2VLVA 4WEYA 2YJHA 3HJOA 4HI7A 5DALA 2V41A 4HZ2A 3MSZA 5D9VA 4MP4A 2B6MA 5COHA 1GP1A 5H5SA 3DVXA 1R5PA 2L4CA 2VL3A 2J9HA 4Q5QA 1DSBA 2H72A 3TKSC 3ERWA 2H73A 2OA7A 4ZL9A 5ECIB 3W6GA 4JBBA 3SWLA 4V2MA 2JZTA 3ZFBA 3ZFLA 2ALBA 1WP0A 2C0FA 4AJ6A 1K0AA 1SJ6A 2LJAA 3EMXA 5ABRA 2DC5A 1HNBA 1XW9A 4MPGA 4NMUA 2CZ2A 4GLTA 2JZSA 5IMCA 2IY2A 4BPYA 1GWCA 4EC0A 5HQPA 5ENUA 1O8XA 4DSSB 2R5GA 4IP6A 4N10A 3TOTA 2LTKA 5DCHA 1OAZA 2FNOA 4G10A 2TRCP 5A4UA 3G7YA 1XVQA 1YF1A 3ZYWA 1AIUA 3GN3A 1LJRA 4KA0A 5JCGA 4F2IA 1XOBA 1SK2A 1F3BA 2R6KA 2B1KA 2PWJA 4N11A 1IYIA 1RQMA 5JCUA 4I6XA 2HSHA 3C7MA 3D5JA 5H5RA 1FOVA 2HZFA 2KUCA 2CA8A 4L0WA 5JCWA 4YQUA 4TXVA 1PQNA 2VUPA 1ZGNA 3IA1A 3P90A 3Q18A 2O89A 1VF2A 2LEGA 1GUMA 3CRUA 4DSRA 1SJZA 3DYRA 3NOFA 2IMDA 4V1Ag 3EU3A 4JR4A 2WGRA 2JSZA 3HYPA 4KDYA 2NPBA 3GA4A 1GSDA 2X8CA 2KP1A 2H8LA 3HVSA 2HFDA 3ME7A 3TKPA 1FB0A 1K0BA 5GZZB 1AQWA 5KEJA 1SK1A 4K0GA 3UVHA 1EP7A 1GTAA 2H19A 2L6CA 3GUSA 1KBNA 2M72A 5IIZA 3PR8A 1HYUA 3F6DA 2EC4A 3ZVJA 4F9ZA 1GL8A 1V9WA 4DSSA 1ON4A 2A4VA 1K0MA 4YH2A 5DQSA 2J23A 1BYEA 4LMVA 2V6KA 5C04A 2AV4A 4ZL8A 4AJ8A 3LSZA 3Q74A 2VAFA 2KLXA 1X5DA 3ZMKA 3RPPA 2WS2A 1X9MB 1N8JA 1A8LA 2V6OA 3W8SA 4GWRA 1N2AA 1FHEA 3LJRA 1A2JA 1T4YA 5H5QA 5DBQA 3ZIVA 4NPBA 2WULA 2H70A 2DJ0A 4WKWA 4G9HA 1M2BA 3FR9A 3I69A 4POBA 1R7HA 4POLA 2OE3A 1SD9A 2EIOA 1B4PA 2H71A 1U6TA 2AB6A 1YZXA 4PNFA 5J41A 5G1KA 1WE0A 4JR6A 1EOGA 1YKCA 1WPIA 2WFCA 1ZMAA 2DJ3A 1XIYA 1YF0A 2L57A 2VCTA 3ZVJD 3DD3A 1TTZA 2VCQA 1F6MC 2L4QA 3WYWA 1J08A 1EGRA 2B3SA 4FH8A 1V57A 3D4MA 3MWHA 3DKSA 2TIRA 2YPMA 3HKRA 2H1AA 2VCZA 3TUEA 4BWQA 4EDYA 3GYKA 3H79A 2XPDA 5ELGA 2JADA 4ML1A 1VF3A 1KEBA 2FWEA 2IFQB 3IV4A 2H0HA 5IO0A 1JZWA 4ZBDA 1JLWA 1HQOA 2F8AA 4FYCA 1DUGA 5B7CA 3GKNA 3M0FA 4YAVA 3ZIJA 2B5YA 2QC7A 2GDRA 4E8EA 3D22A 3R2QA 2GVPA 3GSTA 4GSNA 3QFAC 2PPTA 4NV2A 2XPEA 3EWLA 4LLRA 3H8QA 1TK5B 2NDOA 4PQHA 3TKSA 5IMZA 3HDCA 4TN8A 4AGSA 1T00A 2B5EA 4OMVA 4MJCA 4L5OA 2C4JA 1USBA 2OACA 5HR2A 2RM5A 4KW6A 3S9FA 3APQA 1ZZYA 2VLTA 1XWCA 1VGLA 1TP9A 4MCUA 5IQYA 1LU4A 5KN1A 4KCAA 2H30A 2H6ZA 4KSMA 3N5OA 2FD3A 4MPFA 4ZBBA 4GXZA 3P8WA 5D93A 2JU5A 1XCCA 4GF0A 2WRTA 2WDUA 1QXHA 3QAVA 1UVZA 5IM9A 5D9TA 5JWOB 1XFLA 3RHCA 3ZITA 2X64A 2GSQA 3LWAA 1K3YA 5AIVA 2C80A 1SU9A 2A2SA 5D9XA 3UAPA 2VL9A 3IRAA 1TK8B 2DJ2A 4KNDA 2F9SA 3EINA 2P5QA 5G30A 1ABAA 2GT5A 2FY6A 3VWXA 3EURA 2IFQA 5D73A 3MAKA 4MF5A 2VCXA 1FVJA 3UBLA 2DMMA 4LL4B 1G0TA 4OFNA 2VLUA 22GSA 5AISA 1Z6MA 2KHPA 4WXTA 1TJDA 3ZLPA 2O7KA 3GMFA 2IMEA 1Q98A 6GSUA 1SKWB 3TRPA 1OC9B 4I2UA 3EC3A 4PQIA 1GTBA 5G1LA 3LEFA 3C1SA 4IGJA 3NIVA 5LNKe 2C3NA 1FAAA 1PKWA 3ZMLA 4G2EA 3BBYA 2IMIA 4IBPA 2LKUA 3GKXA 2GGTA 5FHIA 2QKEA 2P5RA 4YAPA 3FR3A 4G19A 5F0GA 4PNGA 3IOSA 4HDEA 2GS3A 1SJIA 4GTUA 3QDNA 4JU5A 1TK0B 4ECCA 3E3EA 5G5FA 3ZREA 4FYBA 4I5QA 4CDOA 2N5FA 1Z7PA 2H6YA 4EE0A 4ECBA 4IQAA 2L5OA 1XBSA 4F03A 3LFLA 5DAKB 3CXGA 5CP1A 4TRXA 5EL8A 1TXXA 2XBIA 3LGCA 4I8BA 2PBJA 2PUKC 3CBUA 4IS0A 2HRFA 4K7IA 2H1GA 1PX6A 1F9MA 2YWIA 2F51A 1H75A 1SKSB 2YP6A 1FW1A 2CZ3A 6GSVA 4HQZA 3ED3A 1OKDA 1A8YA 4ZB8A 1TDIA 1SKRB 4K6XA 3VWUA 4OWYA 1YDKA 1XWGA 3QMXA 1B9YC 2EIRA 1JZRA 3WD6A 2H6XA 1X9WB 2C3QA 4N0VA 3GH6A 1OC9A 3VI7A 1YJ6A 4MA9A 1B9XC 3CYNA 4BA7A 1G7OA 4POMA 4XCSA 18GSA 2H1DA 1X9SB 2F8FA 2K8SA 2MMAA 3H93A 3SBCA 4ZXGA 3LQ7A 2O87A 5G5EA 2FWGA 1M99A 2DJJA 4DVCA 1UC7A 3UJ1A 2XHFA 1T1VA 3NZNA 4IJ3A 2NVLA 3D21A 3MDKA 4MH3A 3CMIA 4XS4B 3WGEA 2FA8A 3TCOA 5HFKA 4TR0A 2VIMA 1CQHA 2PN8A 1O7UA 5DCGA 1X5CA 3A5WA 5DAKA 3VLNA 2LRNA 2H75A 9GSSA 1MDKA 4DSQA 1TU7A 1OE7A 2YZUA 5B8AA 2LRCA 1V2AA 4WBJA 4KE3A 4EO3A 2FHEA 4I97A 2H0IA 2H0GA 2WB9A 2YWOA 1XOAA 4K9ZA 4NHWA 1U87A 1GUHA 3F8UA 4ULXA 1SD8A 4NXIA 5E4WA 1TU8A 2K18A 2EIQA 1ERUA 1NSWA 1GLQA 3F4TA 3RAZA 4OCFA 2OE1A 1R5AA 4PXOA 5IO2A 3C8EA 4DEJA 5G2ZA 16GSA 3A3TA 5CYYA 5HFGA 4OO4A 4LL1B 11GSA 4KDUA 1SL1B 1BX9A 1WWJA 1EEMA 4EXJA 2GZZA 5F07A 3TKQA 1O73A 2WZ9A 4ISDA 4X0XA 1GH2A 3GTUB 3DGQA 2HSYA 3WT2A 4XS1A 2O8VB 3BJ5A 3IAS2 3APOA 5IMAA 4MH2A 4NWYA 2I4AA 4KH7A 1K0DA 4HOJA 1RK4A 1Y6EA 3ISOA 2DJKA 4XS4A 5D96A 4OFMA 4WBRD 4FIWA 4NHZA 3F9UA 1U3IA 2RM6A 3QFBC 3WT1A 5G31A 4OCEA 4MDCA 4RI7A 5J9CA 2I1UA 3QPMA 3TGZA 5INYA 5CRWA 2V1MA 1M2DA 3G7JA 4IELA 4ZB9A 2CX4A 2KP2A 3CRTA 2GSTA 2YWMA 5ECOB 4ML6A
chains in the Genus database with same CATH superfamily
3DGNA 5AIXA 3RDWA 2E2MA 3L0HA 2YX9A 4D73B 1GSEA 2HLSA 1B2SA 4GCIA 4IVFA 5ECMB 4ZL7A 3ZG5A 1ZOFA 4HEA2 2OTL3 1X0RA 2AUVA 3N8BA 1XXUA 1TRVA 1V58A 2CV4A 3BNCA 3DRNA 5DJMA 3VI5A 2O85A 1OHOA 2Y73A 5KP3A 2V2GA 2HOHA 3TJKA 1OHPA 5J5NA 1QMAA 3CCQ3 2GSPA 5KN0A 1F37A 2LNTA 1DETA 3KEBA 3G7IA 3DMLA 5AEUB 4G0LA 2E0QA 4AJ7A 3NBRA 1PFPA 1C7HA 4R9KA 2OADA 1BNJA 4FYUA 4RI6A 4KB3A 1A0RP 2LSTA 2HE3A 4O5RA 3US3A 4U13A 3IC4A 1ILOA 3G8ZA 3U5RE 3CSJA 2OE0A 4MJAA 4EL1A 3NV0B 1BNEA 1W6CA 4HBRA 4TR3A 1B2MA 12GSA 3NQZA 4PUFC 1MDJA 3KM6A 4O5QA 4AKYA 3FZAA 4IQ1A 4XBYA 1RGEA 4XDVA 2IPAA 1K28A 2V1LA 1BRNL 3LTBA 3GIXA 6GSXA 1B20A 3GTUA 3BNBA 5F05A 4H61A 4KAEA 2DLXA 3F4RA 5IMFA 1AR0A 3U97A 3WR2A 1Q7HA 1S3RA 3IAM2 4XIHA 4MMXB 1GD4A 5BU4A 3PCRA 4JF8A 2E2VA 1SYXA 1WMJA 3LXTA 1Q7Y4 5CXOA 1S5AA 1TIJA 2B24B 5A5KA 3FR6A 3D3LA 1Z5YE 4IPBA 3J7Yk 4I4KA 3PPUA 4OD7A 1VZZA 5CNWA 4MZBA 2CAIA 4WR5A 1VQL3 3WA2X 1Q40A 2K9FA 4KSOA 3ERFA 3F4SA 2OBIA 1GOYA 2YV9A 5CRDA 3HHVA 2BTOT 1ACVA 4MLYA 4PURA 2JL4A 3TJJA 1JZOA 4F82A 1HD2A 3PCSA 2PGTA 3NHXA 3PGTA 1MTCA 1M2AA 3KTLA 4OFTA 3CSHA 4XRDA 3FW2A 1VF4A 3IBHA 1PL1A 3CC43 1YGWA 4ZM8A 2FGTA 4LEHA 3J7Yd 1FGOA 1EV4A 2YFIB 3EX9A 1YJW3 3GSPA 4CY8A 1FVKA 4R80A 4D73A 2YV7A 1U8CB 2JSYA 3EC9A 1THXA 2W2CA 3FF2A 4J5GA 3VWVA 1CQGA 2MMZA 5EPFA 2LNSA 3GRXA 1EP8A 3PINA 6GSSA 2E2GA 4KDXA 3FRCA 1QMVA 2O3OA 3CCL3 1F2EA 4KT3B 2VO4A 1HNAA 3GZYB 3GHAA 2MMOA 5DJLA 4FMDA 1OC8A 2B1LA 3VF1A 3KTBA 3JUQA 1TFKA 1HYFA 3T8NA 3SX1A 3X41A 4KFFA 3QCPA 2GTUA 2XSHB 4WETA 1FUWA 2CAQA 4OK0A 2X99A 2DJ1A 1IV9A 3DVWA 3LYPA 1URMA 2M7OA 4BIRA 1UDII 4XB5A 3ROBA 3FZWA 3NV0A 1QGVA 2MF7A 1A2LA 5AIGA 1N8QA 5GAND 4N6OB 1SL0B 4AKZA 1RGFA 2LV3A 1EGOA 5LCZA 2GSSA 1XWBA 3NUVA 1NNVA 1SENA 4YQMA 3GH9A 1FUSA 1XW6A 2B7KA 4IP1A 3TJFA 1TU5A 1T5YA 3DIEA 3N9JA 4HZBB 1PL2A 1RNTA 1AQXA 1ULJB 4HU9A 1JBSA 3TOUA 5IOWA 3WGXA 1AW9A 1OF5B 1F3AA 5M1AA 1CQSA 1TRWA 1YEPA 1JLVA 4AF2A 1ZS7A 3S5CA 1RCKA 1VQN3 1GNWA 2X8GA 5IMDA 4HM1B 4K5SA 3S29A 1ERWA 1G6WA 2CG1A 5HGRA 1T7PB 1LQMB 4MZCA 2N5AA 5B8BA 3KCMA 5B6NA 4O3VA 1VQO3 2W9QA 1RGGA 3KH7A 4L0UA 4LGQA 1AQVA 3IR4A 3EJVA 3HVVA 3HY2A 3GL5A 3FHKA 1BRSA 3IPZA 1BEDA 3IXRA 3RGAA 1M1XB 4OVMA 3Q90A 1GTIA 3X42A 4Q5RA 3QRDA 1X1WA 2GBWB 3H1NA 2K0MA 3I9V2 1AQZA 2YFJB 3QAGA 3AMOB 3GKKA 1EZKA 5FW5A 3CXC2 1QALA 5IPHA 3KZTA 4G0IA 3V99A 2DMLA 2MBSA 4TXOB 1B48A 4HM3B 1N9JA 3F3RA 4J9AA 3IHGA 1J9BA 3MHEA 2MBTA 2AHEA 2FWHA 4BVXB 1GRXA 2QEX3 1I70A 2XGLA 1EV9A 2L5LA 1GYBA 1E3VA 3QK9A 4FR9A 1M9AA 1W01A 1U3AA 2YJ7A 3FEUA 5KP4A 1TRSA 3KJYA 5ECLB 1A2MA 3S28A 2HXKA 2BMRB 3KZQA 1YY7A 1O6JA 1T4ZA 4IN0A 1WMNA 1WOUA 5C00A 2UUGC 3N54B 2HT9A 4XRAA 5KOWA 1A0FA 3CME3 4TX4A 4IIAA 2IYJA 2P0GA 3H51A 1ZL9A 1NU3A 1E2YA 3QOUA 1OYJA 2C4BA 2RSXA 2QA2A 5ID2B 3CCU3 2CH9A 3JUMA 2HRKA 1NM3A 2R2JA 2CFLA 5ELJA 1M1K4 2BMXA 3S67A 3V98A 4XBTA 5EY6A 3ZL5A 3VPQA 4YQVA 3MWZA 2JDIH 2P0XA 4HS1A 2L6DA 1QQ2A 3IC8A 1KD14 2PERA 4L5LA 2CIUA 2SARA 1BNFA 3JVCA 1K3OA 1DE1A 1UUGB 2CVKA 1W89A 1CYUA 1DBYA 4HQSA 4GSPA 2K6VA 3NX0A 2W6JH 1OF5A 4K0NA 4RUVA 1RRHA 2L59A 3GX0A 3OW22 1UCJA 5A4VA 4EF0A 3JUPA 4HKVB 5ECKB 2Z9SA 2R0GA 1FG4A 2HZEB 1SPUA 5A4WA 2YNXA 3M1GA 4I2TA 2FWFA 2H74A 1DE2A 1CYVA 1ERVA 1BSEA 1N8R4 3LZAA 1Q864 3G16A 3MG1A 3KP9A 1RGLA 4Z2UA 1WRYA 3DXBA 1B27A 3A5IA 4K1UA 1LOXA 1VF1A 1ZO2A 1TRUA 2HSMA 4N3VA 1YJ93 1K0OA 3FZ9A 4ECJA 4TKYA 3TKSE 2AYTA 4X43A 4GQCA 4MMMA 3A5EA 5BIRA 1RN7A 2GQMA 3PGBA 1K3LA 5E59A 2WGQA 3AMOA 5HR3A 3E0UA 3AY8A 3KMNA 3M9KA 4YKGA 5IG5A 1HNCA 1XW5A 2HI7A 3J7Yb 3GNJA 4TXOA 2MZCA 5BRTA 4EBGA 3HD5A 1B3SA 4BVXA 1OC3A 4N6NB 1I5GA 2C0DA 2GU3A 1UUWB 1L5GB 1S3AA 3FG1A 4JZQA 2G0FA 1T2HA 4PUAA 3NBBA 2WCIA 17GSA 4CW9A 3H4KA 3F6FA 4K1FA 1AAZA 1K0NA 4IHUA 1U88A 2X49A 2YWNA 3UMAA 3BLZA 1A23A 4NREA 2KF5A 4BL3A 3A2WA 3SOAA 1IQXA 1BAYA 1O7WB 2XH9A 3B4OA 2CX3A 2VM1A 3TRXA 1PA3A 2L1SA 4MJBA 3FSDA 2ON5A 3C73A 2IA7A 5ID2A 4MMZB 1S723 4GQFA 3UL3A 2B7JA 2REMA 5J3RA 3FKFA 4MNNA 2GZYA 5D81A 3HVXA 5JWQB 1BRJA 1JBTA 2FLSA 5D9WA 1MOLA 4LMIA 5D8IA 1GSQA 3F3QA 5JWRB 1B4QA 4N30A 4KVHA 5CLKA 1JFUA 1WQLB 2PVOC 1W00A 2IWTA 3GKMA 5HR0A 5STDA 2E2UA 1KTEA 3I43A 3CSIA 1GMQA 2OOVA 3AHSA 4HU7A 3EVIA 6GSWA 3U6VA 4O7HA 2RBIA 1YJN3 3UBKA 3FYGA 4JE1A 4NAXA 4TR4A 1GUKA 3D6IA 2F5WA 4WWUC 3DEXA 3BOAA 4TOPA 1FO5A 2OJLA 2HZEA 3HJMA 1BRKA 1T8EB 3KXOA 4V1Ap 5IENA 1W4VA 1GMRA 4KX4A 1RJOA 3G713 1MEKA 4PGTA 2P31A 5FT3A 3EU4A 3VFIA 1IT7A 3VURA 2IIYA 4FO5A 5DVBA 5ECSA 2R0PA 1VQ63 3V1WA 4TW5A 5LD0A 2RNTA 1US1A 2C8UA 5HFIA 3MSOA 4GRFA 1M3JA 4BL7B 1WJKA 4FQUA 2HNLA 3T8UA 3F0IA 2ZHXB 3TKRA 4J2FA 5A0OB 4Q5NA 4K2XA 1OCVA 1PYLA 4H86A 8GSSA 2K54A 3GRDA 3D4TA 2P05A 1WIKA 1JB5A 2MMNA 3HZ4A 2BHMA 2I9HA 3TJGA 2RUFA 1IYHA 4KGIA 2LJKA 2IMFA 2YZHA 2W56B 2LS5A 3HI7A 2GQLA 1R4WA 1YIJ3 4WP5A 4IW9A 1YKAA 1BQ7A 1A90A 2KOKA 3PXMA 1VQ43 1S3CA 3FZ5A 3HJPA 1W2ZA 3FCSB 5ECRB 5M19A 1IDPA 4ZB6A 3UIWA 3ZZXA 4BTYA 4K1VA 3RPNA 4HUAA 1ZCPA 1ASKA 1FB6A 3PZWA 2MYGA 3ZTLA 2KCDA 2OQEC 3GAXA 3FZ4A 3IDVA 1DVCA 2CFWA 4ZIJA 1TTOA 1Q4JA 4Q5FA 3QR6A 5FWGA 5KOXA 1G7EA 3FG4A 4RBNA 4X1UA 3L9SA 2AAWA 3EQQB 1M0UA 2VD0A 2ZNMA 3M9JA 3O3TA 1PGTA 5ELAA 4O8SA 2IN3A 4MF7A 5J4UA 3X3XA 14GSA 2ZUPA 1YEXA 1B8XA 1AC1A 2NBSA 4WF5A 2GSRA 2QIYA 3IE3A 1Y25A 2LYXA 2BNGA 3LYKA 2VL2C 8CHOA 1IQ8A 1V40A 5F06A 4PQ1A 1X1XA 1XPVA 1NDOB 3KP8A 3APSA 3IPTA 1K0CA 3B4PA 1Q814 1NW2A 8RNTA 2DSAA 2RUEA 5L71A 1E6BA 1PRXA 3CCM3 1D6YA 4FCZA 1G6YA 1YIT3 1N9EA 1NHYA 4BL7A 4P3YB 1X1UA 3RGRA 1Z3EA 4V2NA 2FA4A 1PU4A 2JACA 3BCIA 4K5RA 3EMPA 3UNLA 3P7XA 1O7NB 1ZYEA 2Z77A 5DDLA 2M80A 3BCKA 1BVIA 3KD0A 3A2XA 2C0GA 1A2PA 3CC73 2F56A 3PH9A 1OE8A 1T2IA 2LRTA 1WNHA 2RIIA 5ECNB 20GSA 3CCE3 3TDGA 3KH9A 1TW9A 4HVNA 4QL9A 2CVBA 3SVAA 3WGDA 1GY6A 3GV1A 1GTUA 4N6V0 3V92A 3ERGA 5GAPD 3CCS3 2XFTA 4ICYA 2CT6A 4JEDA 4JRRA 1V98A 3OWYA 1AUCA 2MC8A 3L78A 4EIPA 3K8NA 1GS3A 1W4NA 1XWAA 3CNXA 3A2VA 2SBLA 3BD2A 1YVBI 1RLSA 4EDZA 2GZPA 4ACSA 2TRXA 1X5EA 5AIFA 4O92A 2KRTA 2HMNB 3GFKA 5DQYA 1BRGA 4XTSA 3UOMA 4MK3A 2HRAA 4LMWA 1BJXA 1PSQA 3VWWA 1SK0A 5CREA 1W6YA 2ML5A 1ULIB 4EUYA 1QJGA 1O7GB 3KN4A 3CU3A 5HR1A 1ISKA 3MNGA 6GSTA 1BIRA 3CMA3 6STDA 2CVDA 1PKZA 2CFGA 1V74A 1BUQA 2GQKA 1RGKA 3FGYA 4HJMA 4HM6B 5AGYA 3UJMA 3BNEA 2FUG2 5EQLA 1KWIA 2XGNA 2IL3A 3GZRA 4O5UA 4CHSA 3OV4A 1EKMA 2RLIA 3HZPA 2ZCTA 1O8WA 4MMYB 2FCHA 5JBSA 5IG4A 2IJYA 3ZG0A 1K734 2K8VA 4TVEA 2XR8B 3EPTA 2WGOA 4EKZA 1DMNA 1RGCA 3TB2A 1LQGC 1A24A 2D1WA 2HYXA 1BSDA 4K90B 2P0MA 1I9DA 3DWVA 2B5XA 5CRGA 5B6MA 2RFRA 4HYZA 2WJUA 2DIYA 2YCDA 3CTGA 1XWKA 1S3DA 3GURA 4RNTA 3FH1A 2A15A 2G2QA 2VCVA 4MZWA 1ERTA 5IERA 1BSAA 3DGYA 5D82A 3HZ8A 1PN9A 1ST9A 1ZYPA 5CF2A 1Z6NA 4RQRA 1B21A 4MEIA 3HA9A 3UVTA 2LJRA 1DMMA 3PS8A 4EVMA 3FF0A 3FKAA 1E97A 2VOCA 3GX8A 2ZDJA 3C1RA 5ECPB 1IK3A 1ZX2A 1RSNA 2OBKA 4FMAA 2N5BA 6RNTA 3HVNA 1RGHA 3D0ZA 3DMCA 5GSSA 4X2HA 3IK9A 4A5PA 2E7PA 2LQQA 4GSSA 1GSYA 3LXUX 2H66A 3LG6A 5ECQB 3GL3A 4BWSA 4O32A 4F0CA 3BB9A 2D2ZA 2PVQA 5CRHA 1J0FA 4K7NA 1LNHA 3P2AA 4TR1B 2NTOA 1M9BA 5LC7A 1QFNA 2XBQA 1I2GA 4QWTA 6GSYA 1W7CA 1A67A 1GNEA 2M46A 1NWWA 5M18A 4POKA 3IHQA 3DGLA 2WOHA 4CDLA 5EVOA 1RN4A 1GOUA 3EE2A 2PZVA 2IUKA 1TP6A 2DKIA 4OO5A 3O76A 2ON7A 3EN8A 1NHOA 4RQXA 4ECIA 2C0EA 1IYYA 3QD9A 1TFOA 4BVYB 1PX7A 1LXEA 3UL6A 4HZ9B 10GSA 4N6MA 5LC6A 2ES7A 1O7PB 3LORA 4GSTA 4WHAA 5CO3A 3L9VA 4KUNA 1AVKA 1TKDB 2CKFB 4HJ2A 1I8VA 5AN1A 1OH0A 3AGOA 4K2DA 2PU9C 4XM4A 1PD21 1Q824 1PMTA 2V32A 2IMKA 3OR5A 4WR4A 5F8BA 1TOFA 1IVXA 4FCJA 5ECOB 1ROVA 1AXDA 3UB1A 5ECHB 4CY6A 4KCEA 2F3MA 3GZXB 1MWRA 1O7MB 2STDA 1SL2B 13GSA 3RBTA 2I3YA 2OTJ3 4WF4A 2BJXA 2UGIA 2YOIA 5KN2A 4NHFA 19GSA 3D4AA 4E8HA 1M7TA 3X40A 4F0BA 3H3HA 3RHBA 1MD3A 1SARA 2GLRA 3F40A 3JCML 7GSSA 2BMOB 3G9BA 2VM2A 4N6LA 5IEOA 2CG0A 1BG5A 3LTAA 1EUIC 1UA5A 3HCZA 4QL7A 2OQEA 4K7OA 2OKAA 2R37A 4MF6A 7GSPA 1TI1A 3DZLA 3CTFA 4XHMA 3TRQA 4G0KA 1Z9HA 4ZBAA 2YANA 3M8NA 1H4OA 4MJEA 1MDIA 1JKGB 2CHCA 4HAAA 5EEOA 1THOA 3KMOA 3Q19A 1ML6A 4IJIA 1JZDA 5DALB 1OKTA 1SYRA 3IK7A 5IMVA 4V2LA 1Z7RA 1G96A 1EEJA 1LBKA 3UARA 2W0QA 4R1KA 3M3MA 4TR1A 4J56E 1ZYQB 1C54A 3VPTA 1OVNA 2WO0A 1K41A 3HXSA 1MWTA 5KN3A 3Q6OA 4NV5A 4PX1A 2JZRA 1BGSA 1JRQA 1TRQA 3F7XA 2H76A 2HRNA 2VL2A 1JHBA 2LUSA 1TRPA 4LA1A 1EWXA 2H1BA 1XZOA 3ME8A 2A2RA 2VD1A 1GLPA 3VK9A 1QUWA 1OGXA 3SLUA 4IKHA 5CAXA 3MYTA 1C72A 1O81A 4HM5B 2XEPA 1MD4A 2GXFA 2PMTA 1XG8A 1QK8A 2XC2A 2X4AA 2GT6A 1RW1A 3ZRDA 1UN2A 4N0ZA 1VRSD 4BVYA 2H01A 5AIIA 4PTSA 2VCWA 2ZL8A 2YN1A 4ID0A 2QSIA 3KGKA 1QAKA 4CJNA 4RNYA 5J9BA 3MYDA 3LXZA 3E9JB 1OACA 5IOXA 1YQ1A 4HZ4A 3TJBA 1BNGA 2KXGA 3X3ZA 3KIJA 2I81A 4Z7XA 3B7CA 1I3IA 1PN0A 4QQ7A 2R4VA 2FNQA 4HM8B 3FK8A 5GSTA 2DIZA 5TGNA 2X8HA 4K8MA 3HK4A 2LQOA 1TI3A 1GULA 1R26A 2FGXA 4ZILA 3I6AA 3F63A 3L9UA 2AJQB 2C1YA 3C71A 3ALAA 3F7SA 5IPGA 3UEMA 1GSSA 5BXQA 2I9WA 1VQ93 1KNGA 4L8EA 2CQ9A 1GSFA 4XS6A 4ILFA 1PY3A 3LT9A 1EOHA 2QGUA 4KZ1A 2DBCA 3GSSA 3QAWA 3O6TA 1O85A 1D6ZA 1W6GA 2ZA4A 1GSUA 4MABA 3W8JA 2QGVA 1VQ73 2R3XA 3L4NA 1XVWA 3EYTA 3FY7A 2C3TA 2Z76A 1JN5B 1T3BA 3SOYA 4KF9A 4BL2A 4J57E 2VLVA 4WEYA 2W9PA 4JRFA 3B8LA 4HJLB 2YJHA 3HJOA 4HI7A 1JKGA 5DALA 2V41A 4HZ2A 3MSZA 5D9VA 3KFQC 1RKYA 4BU4A 4MP4A 2B6MA 5KP1A 5COHA 1GP1A 2BMQB 5H5SA 2R0CA 3DVXA 1R5PA 2L4CA 3K63A 4CCVA 3SXXA 3EN1B 3OWUA 3EB8A 2VL3A 2J9HA 7STDA 3NQYA 1DSBA 2H72A 4Q5QA 3TKSC 3DY5A 3ERWA 2H73A 2CX0A 2OA7A 4ZL9A 5ECIB 3W6GA 4JBBA 3SWLA 4V2MA 2P38A 2JZTA 3ZFBA 3ZFLA 4HM4B 2BT3A 4BTWA 2ALBA 1GD3A 1WP0A 2C0FA 1ROAA 4KFEA 1K0AA 4AJ6A 1A2KA 2UZ8A 1SJ6A 2LJAA 3EMXA 5ABRA 2DC5A 1HNBA 1XW9A 1FGQA 3DH2A 4WYKB 4HM7B 7RNTA 4MPGA 4NMUA 2CZ2A 4GLTA 2D42A 2F99A 2JZSA 5IMCA 2IY2A 4BPYA 1GWCA 1MNLA 2GEXA 1HZ1A 2RCDA 4N6TA 4EC0A 2OCTA 2GU1A 3D5IA 5HQPA 1YVSA 5ENUA 1O8XA 4DSSB 1RGAA 2R5GA 4EW5A 4IP6A 3BU4A 4N10A 1O7HB 3TOTA 2LTKA 4R4KA 5DCHA 1OAZA 3BNDA 2FNOA 4G10A 2TRCP 5A4UA 2F5MA 1UI8A 3G7YA 1QVG2 3F8XA 1XVQA 1YF1A 3ZYWA 1FGRA 3NXJA 2RGQA 1AIUA 4Z2RA 3GN3A 1LJRA 4KA0A 5JCGA 4F2IA 3N9HA 1XOBA 1SK2A 4Q53A 5CF1A 1F3BA 2R6KA 2F98A 1NJI4 2B1KA 5AIHA 2PWJA 5IG0A 4N11A 1IYIA 1RQMA 5JCUA 4I6XA 2HSHA 3C7MA 3D5JA 3AHWA 5H5RA 4STDA 1I0VA 2HMJB 3FMWA 1FOVA 2HZFA 2KUCA 1JN5A 4USSA 2CA8A 4L0WA 5JCWA 4YQUA 4TXVA 1PQNA 2VUPA 1ZGNA 1WTHA 3IA1A 3P90A 3Q18A 2O89A 1VF2A 2LEGA 1GUMA 3CRUA 4DSRA 1SJZA 3DYRA 3NOFA 2IMDA 3KKGA 1D6UA 1N5PA 4V1Ag 3EU3A 4JR4A 4BIKA 2WGRA 2JSZA 3EBYA 4WFOA 3HYPA 4KDYA 2CWVA 5I97A 2NPBA 2Q07A 5EVHA 3GA4A 5FGOA 2Z7AA 1BSCA 1GSDA 2X8CA 2KP1A 2H8LA 3URPA 1UUVB 3HVSA 2B1XB 1RCLA 2HFDA 3ME7A 1MWSA 3TKPA 1BOXA 1FB0A 1K0BA 3GZBA 5GZZB 1AQWA 5KEJA 1SK1A 5AEWB 3F9SA 4H3UA 4K0GA 3NM2A 3UVHA 1JB2A 3NM7A 1TUHA 3LTCA 3RDEA 1RRLA 1EP7A 4X4JA 1BNRA 2CWTA 3IMAB 1GTAA 2H19A 3CCR3 4WYKA 2L6CA 3GUSA 3MPHA 2PNCA 1KBNA 2M72A 4O02B 1FW7A 5IIZA 1JV2B 3PR8A 5G2GA 1K8A4 1HYUA 3F6DA 2EC4A 3ZVJA 4F9ZA 1GL8A 1U5OA 3WDGB 1J2BA 1DYUA 1V9WA 4DSSA 2CC3A 3CNMA 1ON4A 2A4VA 1K0MA 4YH2A 5DQSA 4RNZA 2J23A 1EA2A 1BYEA 4LMVA 2V6KA 1B2XA 5C04A 2W56A 3EF8A 2AV4A 1AVLA 4AEQA 1YGEA 4ZL8A 3LYGA 4AJ8A 2OWPA 3G0KA 3ECFA 1BANA 3LSZA 3Q74A 1NB3I 5D83A 2VAFA 2KLXA 3K0ZA 1SQWA 1CH0A 1X5DA 3ZMKA 1LRAA 3RPPA 3F14A 4PEJA 2WS2A 1X9MB 3BIRA 1HU9A 1LOYA 1QAFA 1E3RA 1N8JA 1A8LA 4OUQA 4J5KA 1UGHI 2V6OA 3MKIA 3W8SA 1FA3A 2CX1A 1LVNA 1N2AA 1FHEA 4GWRA 1R4YA 3LJRA 3E99A 3M8CA 1A2JA 3KE7A 1T4YA 5H5QA 1UW1A 5DBQA 1STFI 3ZIVA 1BRIA 4NPBA 2WULA 5IF6A 1IVUA 3KSED 2H70A 2HMOB 2DJ0A 4WKWA 3HOHA 1F8NA 3HIGA 3PYJA 4G9HA 4FMBA 3SEDA 4EV5A 1M2BA 3FR9A 3I69A 5IG3A 4POBA 1R7HA 4YKFA 3LH4A 4HM2B 4POLA 1BSBA 2OE3A 2F86B 1SD9A 2EIOA 1B4PA 2H71A 1U6TA 2AB6A 1YZXA 4PNFA 3ZFZA 5J41A 5G1KA 1YI23 1WE0A 4JR6A 1EOGA 1YKCA 2AADA 5BMUA 1WPIA 2WFCA 1ZMAA 2DJ3A 1XIYA 1W2B2 1VQK3 1YF0A 2OOVC 3CCJ3 1NB5I 3R3EA 1Q42A 2L57A 1I2FA 4IT7A 2VCTA 1IU7A 3ZVJD 1LNIA 3DD3A 1TTZA 2VCQA 1F6MC 2L4QA 3WYWA 2INXA 1PFOA 1J08A 1EGRA 2B3SA 4FH8A 1V57A 3O8YA 1AV4A 5HOHA 3D4MA 2QA43 1FGTA 3MWHA 3DKSA 3Q2PA 2TIRA 2YPMA 3HKRA 4G1MB 4L7KA 2H1AA 2VCZA 3TUEA 2W04A 3CPW2 1YHQ3 4BWQA 4EDYA 3GYKA 5JPUA 3H79A 1Q9EA 2XPDA 3I0YA 5ELGA 4XDWA 2JADA 4HOHA 4ML1A 1RN1A 1RNBA 1VF3A 1I3FA 1GSPA 1LOVA 2P09A 1KEBA 2FWEA 2IFQB 1RMSA 3IV4A 2H0HA 5IO0A 3LMLA 1JZWA 4BTXA 3STDA 4ZBDA 1BUJA 1JLWA 2Y74A 1HQOA 2F8AA 4FYCA 1EQKA 1FOHA 3KCHA 1DUGA 5B7CA 3JUNA 1JJ22 3GKNA 3M0FA 3D9RA 4LZIA 4YAVA 3ZIJA 2B5YA 2QC7A 2GDRA 4E8EA 3D22A 3R2QA 1A2VA 1RDSA 2GVPA 3GSTA 4GSNA 3ER7A 3WHOA 1HKXA 3QFAC 2PPTA 4NV2A 2XPEA 3EWLA 4LLRA 3H8QA 1TK5B 2NDOA 1MGRA 4PQHA 3TKSA 5IMZA 3HDCA 4TN8A 4AGSA 1T00A 4DKIA 2B5EA 4OMVA 3WODG 4MJCA 4L5OA 2C4JA 1USBA 2OACA 5HR2A 2RM5A 4KW6A 3S9FA 3D79A 3DM8A 3OXAA 4EYCA 3APQA 1ZZYA 2VLTA 1XWCA 3NBJA 1VGLA 3UL5A 1TP9A 4MCUA 5IQYA 2R4IA 2L4VA 1LU4A 5KN1A 3FLJA 4EC6A 1B2UA 4KCAA 2H30A 2H6ZA 4KSMA 3N5OA 2F4YA 4HM0B 3OWSA 2FD3A 4MPFA 4GXZA 4ZBBA 1G02A 3P8WA 5D93A 1KQS2 5AYRB 2JU5A 1XCCA 4GF0A 1AY7A 3S27A 2WRTA 3X3YA 1JB4A 2WDUA 3KIIA 1QXHA 3MIXA 1DE3A 3QAVA 3K5TA 1M3IA 3CQFA 3CC23 1JBRA 1UVZA 5IEPA 5IM9A 5D9TA 5JWOB 1VQQA 1BAOA 4L8OA 1XFLA 3RHCA 3ZITA 2X64A 1GY7A 2LQVA 3WMDA 2GSQA 3LWAA 1K3YA 5AIVA 3F8HA 2KF4A 2C80A 1SU9A 3G4S3 2A2SA 5D9XA 3WOEB 3UAPA 2VL9A 3IRAA 1TK8B 2DJ2A 4KNDA 2F9SA 3EINA 2P5QA 5G30A 2GBXB 1ABAA 2GT5A 2CW9A 2FY6A 2W03A 3VWXA 3MG2A 3EURA 2IFQA 2CWUA 1JNQA 5DRVA 5D73A 3MAKA 1BU4A 3D5GA 2VCXA 4MF5A 1FVJA 3UBLA 4X2OA 2DMMA 2QA1A 4LL4B 1G0TA 4OFNA 2XF3A 2VLUA 3LT8A 2IMJA 22GSA 5AISA 1Z6MA 2KHPA 4WXTA 1TJDA 3ZLPA 2O7KA 3GMFA 2IMEA 1W02A 1Q98A 3LTDA 6GSUA 2AAEA 4CPKA 1SKWB 3TRPA 1OC9B 4I2UA 1WMOA 5ELUA 2CFDA 1IV7A 3SYUA 1VQ83 3EC3A 4O2HA 4PQIA 1GTBA 5G1LA 3LEFA 3C1SA 4IGJA 1FUTA 3NIVA 5LNKe 2C3NA 2DKHA 1FAAA 1PKWA 3ZMLA 4G2EA 5AYSC 3BBYA 2IMIA 4IBPA 1FZUA 3I563 5AI1A 2LKUA 2K3DA 3GKXA 1GY5A 2GGTA 1BRHA 2QKEA 5FHIA 2P5RA 4YAPA 3FR3A 4G19A 5F0GA 4PNGA 1STDA 3OX9A 3IOSA 4HDEA 2GS3A 4LSOA 1SJIA 4GTUA 1B2ZA 3QDNA 5DREA 4JU5A 1TK0B 1Y4KA 4ECCA 5JPPA 3E3EA 5G5FA 3ZREA 3KSPA 4FYBA 4I5QA 4CDOA 2N5FA 3I553 1Z7PA 2R41A 2H6YA 3Q1CA 4EE0A 4ECBA 3HIIA 1RHLA 4IQAA 1SIHA 2L5OA 1XBSA 4F03A 1OHSA 3LFLA 5CP1A 3CXGA 3DGMA 5DAKB 4TRXA 5EL8A 1TXXA 3CPOA 2XBIA 3LGCA 4I8BA 3CCV3 2PBJA 4ORLA 2PUKC 2CK3H 3CBUA 4IS0A 2HRFA 4K7IA 2H1GA 1M9GA 1F9MA 1PX6A 2YWIA 2F51A 1SJWA 1R4CA 1ZYNA 1VQ53 1H75A 1SKSB 2YP6A 1FW1A 2CZ3A 6GSVA 4EV2A 2CFKA 1QVF2 3ED3A 4HQZA 2BIRA 2HMMB 1OKDA 1A8YA 1OGZA 3EHCA 1IVWA 4ZB8A 1TDIA 1SKRB 4K6XA 1KSIA 3VWUA 4OWYA 1VQP3 1LOWA 4LYLB 1YDKA 1SIIA 2WOFA 1XWGA 1UCLA 3QMXA 1RTUA 2KF3A 1UCIA 1B9YC 2EIRA 1JZRA 3WD6A 2H6XA 1X9WB 2C3QA 4N0VA 3GH6A 2XFSA 1N5HA 2O9UX 3IJEB 1OC9A 3VI7A 3U1WA 1YJ6A 4MA9A 1B9XC 3MG3A 4XBXA 3CYNA 4BA7A 2FXTA 1G7OA 4POMA 4XCSA 18GSA 2H1DA 3WOFB 1X9SB 2F8FA 2K8SA 2MMAA 3H93A 3SBCA 2XRXB 4ZXGA 3K9MC 2O87A 3LQ7A 2ML6A 5G5EA 4Z2TA 2FWGA 1M99A 2DJJA 4DVCA 2JQ5A 1GOVA 1UC7A 3UJ1A 2XHFA 1T1VA 1GMPA 3NZNA 4IJ3A 2NVLA 5CK6A 3D21A 3MDKA 4MH3A 3CMIA 1BNIA 1UGIA 1IQYA 4XS4B 2A2PA 3WGEA 4GL6A 2FA8A 1KC84 3TCOA 2YFLB 5HFKA 6GSPA 4TR0A 2VIMA 1CQHA 2PN8A 1O7UA 2GEYA 3EBTA 1Z1SA 4RZMA 1NO3A 2A4HA 2Z6BA 5DCGA 5IW9A 1X5CA 3A5WA 5DAKA 4FMCA 3VLNA 2LRNA 2H75A 9GSSA 1MDKA 1IT8A 1K9M4 4DSQA 1OUNA 2BU4A 1OE7A 1TU7A 2YZUA 5B8AA 2LRCA 1V2AA 4WBJA 4KE3A 2C10A 4EO3A 1DMQA 3VGNA 2FHEA 3WA3A 4I97A 3T0UA 2H0IA 2H0GA 4K61A 1MGWA 2WB9A 2YWOA 1XOAA 4K9ZA 4NHWA 1U87A 1GUHA 1MWUA 3RNTA 4FCMA 3F8UA 4ULXA 1SD8A 3LW9A 3G6E3 4NXIA 4GB5A 3LOYA 5E4WA 1UCKA 2IUJA 1TU8A 2K18A 2EIQA 1DVDA 1UI7A 2UX0A 3VSYA 1ERUA 3FG3A 3K7CA 1NSWA 4EXRA 1FGMA 2E2TA 4L8PA 1GLQA 3F4TA 3RAZA 1CEWI 4OCFA 2OE1A 1R5AA 4PXOA 4R9LA 4KFDA 5IO2A 1YNVX 3C8EA 5BVBA 4DEJA 5G2ZA 16GSA 1W5ZA 3A3TA 5CYYA 5HFGA 2KAAA 1X1YA 3GWRA 3L0RA 4OO4A 3DUKA 9RNTA 4LL1B 11GSA 4N6UA 4KDUA 2HMKB 2HMLB 2XSOB 1VQM3 1SL1B 2KF6A 1BX9A 1WWJA 1EEMA 3CD63 4MJDA 4EXJA 2GZZA 5F07A 3TKQA 1O73A 3DXOA 2WZ9A 4ISDA 4X0XA 1GH2A 3GTUB 3DGQA 4HSCX 2HSYA 1IVVA 3WT2A 3JUOA 4XS1A 5GSPA 2O8VB 3BJ5A 3IAS2 3APOA 5IMAA 4MH2A 4NWYA 2I4AA 4KH7A 1K0DA 4HOJA 4J8TA 2BO9B 1RK4A 2C11A 1Y6EA 3ISOA 2DJKA 4XS4A 4GHOA 5D96A 4OFMA 4WBRD 3A76A 4FIWA 1I2EA 4NHZA 1Q40B 3F9UA 1BNSA 2J8XB 1U3IA 2RM6A 1WMPA 3HX8A 3QFBC 3AGNA 5G31A 3WT1A 4OCEA 4MDCA 4RI7A 4EIQA 5J9CA 1OPYA 1M904 2I1UA 3QPMA 3TGZA 5INYA 5CRWA 1I0XA 3DGOA 2V1MA 1M2DA 3G7JA 3EE1A 4IELA 4ZB9A 2CX4A 2KP2A 3CRTA 2GSTA 1EG9B 2YWMA 1FYSA 3Q3FA 1ZGXA 5RNTA 4ML6A
chains in the Genus database with same CATH topology
5AIXA 3RDWA 2E2MA 3L0HA 4D73B 1GSEA 2HLSA 4GCIA 4IVFA 5ECMB 4ZL7A 1ZOFA 4HEA2 1X0RA 2AUVA 1XXUA 1TRVA 1V58A 2CV4A 3DRNA 5DJMA 3VI5A 2O85A 2V2GA 3TJKA 5J5NA 5KN0A 1F37A 2LNTA 3KEBA 3G7IA 3DMLA 4G0LA 2E0QA 4AJ7A 2OADA 4FYUA 4RI6A 4KB3A 1A0RP 2LSTA 2HE3A 4O5RA 3US3A 3IC4A 1ILOA 3U5RE 3CSJA 2OE0A 4MJAA 4EL1A 4TR3A 12GSA 4PUFC 1MDJA 3KM6A 4O5QA 3FZAA 4IQ1A 2IPAA 3GIXA 6GSXA 3GTUA 5F05A 4KAEA 2DLXA 3F4RA 5IMFA 4XIHA 3IAM2 1SYXA 1WMJA 3LXTA 5A5KA 3FR6A 1Z5YE 3J7Yk 3PPUA 4OD7A 5CNWA 4MZBA 2CAIA 4WR5A 2K9FA 4KSOA 3ERFA 3F4SA 2OBIA 5CRDA 2YV9A 3HHVA 2BTOT 1ACVA 4MLYA 4PURA 2JL4A 3TJJA 1JZOA 4F82A 1HD2A 2PGTA 3PGTA 1MTCA 1M2AA 3KTLA 4OFTA 3CSHA 4XRDA 3FW2A 1VF4A 3IBHA 1PL1A 1EV4A 4CY8A 1FVKA 4D73A 2YV7A 2JSYA 1THXA 3VWVA 1CQGA 2MMZA 5EPFA 2LNSA 3GRXA 1EP8A 3PINA 6GSSA 2E2GA 4KDXA 3FRCA 1QMVA 1F2EA 2VO4A 1HNAA 3GHAA 2MMOA 5DJLA 1OC8A 2B1LA 3KTBA 3QCPA 2GTUA 4WETA 2CAQA 2X99A 2DJ1A 3DVWA 3LYPA 1URMA 1QGVA 1A2LA 5GAND 1SL0B 2LV3A 1EGOA 5LCZA 2GSSA 1XWBA 1SENA 4YQMA 3GH9A 1XW6A 2B7KA 4IP1A 3TJFA 3DIEA 3N9JA 1PL2A 1AQXA 4HU9A 5IOWA 3TOUA 3WGXA 1AW9A 1F3AA 1YEPA 1TRWA 4AF2A 1JLVA 1GNWA 2X8GA 5IMDA 4K5SA 1ERWA 1G6WA 1T7PB 4MZCA 2N5AA 5B8BA 3KCMA 5B6NA 4L0UA 3KH7A 1AQVA 3IR4A 3HVVA 3HY2A 3GL5A 3FHKA 3IPZA 1BEDA 3IXRA 1GTIA 4Q5RA 3H1NA 3I9V2 3QAGA 3GKKA 1EZKA 5IPHA 4G0IA 2DMLA 2MBSA 4TXOB 1B48A 3F3RA 3IHGA 1J9BA 2MBTA 2AHEA 2FWHA 4BVXB 1GRXA 1EV9A 2L5LA 2YJ7A 1M9AA 3FEUA 1U3AA 1TRSA 3KJYA 5ECLB 1A2MA 2HXKA 3KZQA 1YY7A 1O6JA 1T4ZA 4IN0A 1WOUA 5C00A 4XRAA 2HT9A 5KOWA 1A0FA 2IYJA 2P0GA 1ZL9A 3QOUA 1E2YA 1OYJA 2QA2A 5ID2B 2HRKA 1NM3A 2R2JA 2BMXA 5EY6A 3ZL5A 3VPQA 4YQVA 4HS1A 2L6DA 1QQ2A 3IC8A 2PERA 4L5LA 1K3OA 1DE1A 2CVKA 1W89A 1DBYA 4HQSA 2K6VA 4K0NA 4RUVA 2L59A 3GX0A 5A4VA 4EF0A 5ECKB 2Z9SA 2R0GA 1FG4A 2HZEB 5A4WA 2YNXA 3M1GA 4I2TA 2FWFA 2H74A 1DE2A 1ERVA 3KP9A 4Z2UA 1WRYA 3DXBA 3A5IA 1VF1A 1TRUA 2HSMA 1K0OA 3FZ9A 4ECJA 4TKYA 3TKSE 2AYTA 4X43A 4GQCA 4MMMA 2GQMA 1K3LA 5E59A 5HR3A 3E0UA 3AY8A 3KMNA 3M9KA 4YKGA 1HNCA 1XW5A 2HI7A 3J7Yb 3GNJA 4TXOA 2MZCA 5BRTA 3HD5A 4BVXA 1OC3A 1I5GA 2C0DA 1S3AA 4JZQA 2G0FA 4PUAA 2WCIA 17GSA 4CW9A 3H4KA 3F6FA 4K1FA 1AAZA 1K0NA 4IHUA 1U88A 2X49A 2YWNA 3UMAA 1A23A 3A2WA 1BAYA 2CX3A 2VM1A 3TRXA 1PA3A 4MJBA 2ON5A 3C73A 5ID2A 4GQFA 3UL3A 2B7JA 2REMA 5J3RA 3FKFA 4MNNA 2GZYA 3HVXA 5JWQB 2FLSA 5D9WA 5D8IA 1GSQA 3F3QA 5JWRB 1B4QA 4N30A 1JFUA 2PVOC 5HR0A 2IWTA 3GKMA 1KTEA 3I43A 3CSIA 4HU7A 3EVIA 6GSWA 3U6VA 4O7HA 3UBKA 3FYGA 4JE1A 4NAXA 4TR4A 1GUKA 3D6IA 3DEXA 3BOAA 4TOPA 1FO5A 2OJLA 2HZEA 3HJMA 1T8EB 3KXOA 4V1Ap 1W4VA 4KX4A 1MEKA 4PGTA 2P31A 5FT3A 3EU4A 3VFIA 3VURA 2IIYA 4FO5A 5DVBA 5ECSA 2R0PA 3V1WA 4TW5A 5LD0A 2C8UA 5HFIA 4GRFA 4BL7B 1WJKA 4FQUA 2HNLA 3F0IA 3TKRA 4J2FA 4Q5NA 4K2XA 4H86A 8GSSA 3D4TA 1WIKA 2MMNA 3HZ4A 2I9HA 3TJGA 2RUFA 1IYHA 4KGIA 2LJKA 2IMFA 2YZHA 2LS5A 2GQLA 1R4WA 4IW9A 1YKAA 1BQ7A 2KOKA 1S3CA 3FZ5A 3HJPA 5ECRB 4ZB6A 3UIWA 3ZZXA 3RPNA 4HUAA 1ZCPA 1FB6A 2MYGA 3ZTLA 3FZ4A 3IDVA 4ZIJA 1Q4JA 4Q5FA 3QR6A 5FWGA 5KOXA 1G7EA 4X1UA 3L9SA 2AAWA 1M0UA 2VD0A 2ZNMA 3M9JA 3O3TA 5ELAA 1PGTA 2IN3A 4MF7A 5J4UA 14GSA 2ZUPA 1YEXA 1B8XA 1AC1A 2NBSA 4WF5A 2GSRA 3IE3A 1Y25A 3LYKA 2VL2C 1V40A 5F06A 4PQ1A 1XPVA 3KP8A 3APSA 1K0CA 1NW2A 2DSAA 2RUEA 5L71A 1E6BA 1PRXA 1G6YA 1NHYA 4BL7A 4P3YB 1Z3EA 4V2NA 2FA4A 2JACA 3BCIA 4K5RA 3EMPA 3P7XA 1ZYEA 5DDLA 2M80A 3BCKA 3KD0A 3A2XA 2C0GA 3PH9A 1OE8A 2LRTA 2RIIA 5ECNB 20GSA 3KH9A 3TDGA 1TW9A 4QL9A 2CVBA 3WGDA 3GV1A 1GTUA 5GAPD 3ERGA 4ICYA 4JEDA 2CT6A 4JRRA 1V98A 1AUCA 3L78A 4EIPA 3K8NA 1XWAA 3A2VA 3BD2A 4EDZA 2GZPA 4ACSA 2TRXA 1X5EA 4O92A 3GFKA 5DQYA 4XTSA 3UOMA 4MK3A 2HRAA 4LMWA 1BJXA 1PSQA 3VWWA 1SK0A 5CREA 4EUYA 5HR1A 3MNGA 6GSTA 2CVDA 1PKZA 2GQKA 4HJMA 5AGYA 2FUG2 2IL3A 4CHSA 4O5UA 2RLIA 2ZCTA 1O8WA 2FCHA 2IJYA 2K8VA 4TVEA 3EPTA 4EKZA 3TB2A 1A24A 2HYXA 1I9DA 3DWVA 2B5XA 5CRGA 5B6MA 2WJUA 2DIYA 2YCDA 3CTGA 1XWKA 1S3DA 3GURA 2G2QA 2VCVA 4MZWA 1ERTA 3HZ8A 1PN9A 1ST9A 1ZYPA 1Z6NA 4RQRA 3UVTA 3HA9A 2LJRA 4EVMA 2VOCA 3GX8A 3C1RA 5ECPB 2OBKA 2N5BA 3D0ZA 5GSSA 3IK9A 4A5PA 2E7PA 2LQQA 4GSSA 1GSYA 2H66A 3LG6A 5ECQB 3GL3A 4BWSA 4O32A 4F0CA 2D2ZA 2PVQA 5CRHA 1J0FA 4K7NA 3P2AA 4TR1B 2NTOA 1M9BA 1QFNA 2XBQA 6GSYA 1GNEA 2M46A 4POKA 3IHQA 5EVOA 3EE2A 2DKIA 4OO5A 3O76A 2ON7A 1NHOA 4RQXA 4ECIA 2C0EA 3QD9A 4BVYB 1PX7A 10GSA 2ES7A 3LORA 4GSTA 5CO3A 3L9VA 4KUNA 1TKDB 4HJ2A 5AN1A 4K2DA 2PU9C 1PD21 1PMTA 2V32A 2IMKA 3OR5A 4WR4A 5F8BA 1TOFA 1AXDA 5ECHB 4CY6A 4KCEA 2F3MA 1SL2B 13GSA 3RBTA 2I3YA 4WF4A 2BJXA 2YOIA 5KN2A 19GSA 4E8HA 4F0BA 1M7TA 3RHBA 1MD3A 2GLRA 7GSSA 3JCML 3G9BA 2VM2A 1BG5A 1UA5A 3HCZA 4QL7A 4K7OA 2OKAA 2R37A 4MF6A 1TI1A 3CTFA 4XHMA 3TRQA 4G0KA 1Z9HA 4ZBAA 2YANA 3M8NA 1H4OA 4MJEA 1MDIA 1THOA 3KMOA 5DALB 3Q19A 1ML6A 4IJIA 1JZDA 1OKTA 1SYRA 3IK7A 5IMVA 4V2LA 1Z7RA 1EEJA 1LBKA 3UARA 3M3MA 4TR1A 4J56E 1ZYQB 3VPTA 1OVNA 3HXSA 5KN3A 3Q6OA 4NV5A 4PX1A 2JZRA 2HRNA 2H76A 2VL2A 1JHBA 2LUSA 4LA1A 1EWXA 2H1BA 1XZOA 3ME8A 2A2RA 2VD1A 1GLPA 3VK9A 1QUWA 4IKHA 5CAXA 1C72A 1O81A 1MD4A 2PMTA 1QK8A 2XC2A 2X4AA 2GT6A 1RW1A 3ZRDA 1UN2A 4N0ZA 1VRSD 4BVYA 2H01A 4PTSA 2VCWA 2YN1A 4ID0A 2QSIA 3KGKA 5J9BA 3MYDA 3LXZA 3E9JB 5IOXA 1YQ1A 4HZ4A 3TJBA 4Z7XA 3KIJA 2I81A 4QQ7A 1PN0A 2R4VA 3FK8A 5GSTA 2DIZA 2X8HA 4K8MA 2LQOA 1TI3A 1GULA 1R26A 2FGXA 4ZILA 3I6AA 3F63A 3L9UA 2AJQB 2C1YA 3C71A 5IPGA 3UEMA 1GSSA 1KNGA 4L8EA 2CQ9A 1GSFA 4XS6A 4ILFA 1EOHA 2DBCA 3GSSA 3QAWA 3O6TA 1O85A 4MABA 1GSUA 3W8JA 2QGVA 3L4NA 2R3XA 1XVWA 3EYTA 3FY7A 2C3TA 1T3BA 4KF9A 4J57E 2VLVA 4WEYA 2YJHA 3HJOA 4HI7A 5DALA 2V41A 4HZ2A 3MSZA 5D9VA 4MP4A 2B6MA 5COHA 1GP1A 5H5SA 2R0CA 3DVXA 1R5PA 2L4CA 2VL3A 2J9HA 4Q5QA 1DSBA 2H72A 3TKSC 3ERWA 2H73A 2OA7A 4ZL9A 5ECIB 3W6GA 4JBBA 3SWLA 4V2MA 2JZTA 3ZFBA 3ZFLA 2ALBA 1WP0A 2C0FA 4AJ6A 1K0AA 2UZ8A 1SJ6A 2LJAA 3EMXA 5ABRA 2DC5A 1HNBA 1XW9A 4MPGA 4NMUA 2CZ2A 4GLTA 2JZSA 5IMCA 2IY2A 4BPYA 1GWCA 4EC0A 5HQPA 5ENUA 1O8XA 4DSSB 2R5GA 4IP6A 4N10A 3TOTA 2LTKA 5DCHA 1OAZA 2FNOA 4G10A 2TRCP 5A4UA 3G7YA 1XVQA 1YF1A 3ZYWA 1AIUA 4Z2RA 3GN3A 1LJRA 4KA0A 5JCGA 4F2IA 1XOBA 1SK2A 1F3BA 2R6KA 2B1KA 2PWJA 4N11A 1IYIA 1RQMA 5JCUA 4I6XA 2HSHA 3C7MA 3D5JA 5H5RA 3FMWA 1FOVA 2HZFA 2KUCA 4USSA 2CA8A 4L0WA 5JCWA 4YQUA 4TXVA 1PQNA 2VUPA 1ZGNA 3IA1A 3P90A 3Q18A 2O89A 1VF2A 2LEGA 1GUMA 3CRUA 4DSRA 1SJZA 3DYRA 3NOFA 2IMDA 4V1Ag 3EU3A 4JR4A 2WGRA 2JSZA 3HYPA 4KDYA 2NPBA 3GA4A 1GSDA 2X8CA 2KP1A 2H8LA 3HVSA 2HFDA 3ME7A 3TKPA 1FB0A 1K0BA 5GZZB 1AQWA 5KEJA 1SK1A 4K0GA 3UVHA 4X4JA 1EP7A 1GTAA 2H19A 2L6CA 3GUSA 1KBNA 2M72A 5IIZA 3PR8A 1HYUA 3F6DA 2EC4A 3ZVJA 4F9ZA 1GL8A 1V9WA 4DSSA 1ON4A 2A4VA 1K0MA 4YH2A 5DQSA 2J23A 1BYEA 4LMVA 2V6KA 5C04A 2AV4A 4ZL8A 4AJ8A 3LSZA 3Q74A 2VAFA 2KLXA 1X5DA 3ZMKA 3RPPA 2WS2A 1X9MB 1N8JA 1A8LA 2V6OA 3W8SA 4GWRA 1N2AA 1FHEA 3LJRA 1A2JA 1T4YA 5H5QA 5DBQA 3ZIVA 4NPBA 2WULA 2H70A 2DJ0A 4WKWA 4G9HA 1M2BA 3FR9A 3I69A 4POBA 1R7HA 4YKFA 4POLA 2OE3A 1SD9A 2EIOA 1B4PA 2H71A 1U6TA 2AB6A 1YZXA 4PNFA 5J41A 5G1KA 1WE0A 4JR6A 1EOGA 1YKCA 5BMUA 1WPIA 2WFCA 1ZMAA 2DJ3A 1XIYA 1YF0A 3R3EA 2L57A 2VCTA 3ZVJD 3DD3A 1TTZA 2VCQA 1F6MC 2L4QA 3WYWA 1J08A 1EGRA 2B3SA 4FH8A 1V57A 3D4MA 3MWHA 3DKSA 2TIRA 2YPMA 3HKRA 2H1AA 2VCZA 3TUEA 4BWQA 4EDYA 3GYKA 3H79A 2XPDA 5ELGA 2JADA 4ML1A 1VF3A 1KEBA 2FWEA 2IFQB 3IV4A 2H0HA 5IO0A 1JZWA 4ZBDA 1JLWA 1HQOA 2F8AA 4FYCA 1FOHA 1DUGA 5B7CA 3GKNA 3M0FA 4YAVA 3ZIJA 2B5YA 2QC7A 2GDRA 4E8EA 3D22A 3R2QA 2GVPA 3GSTA 4GSNA 3QFAC 2PPTA 4NV2A 2XPEA 3EWLA 4LLRA 3H8QA 1TK5B 2NDOA 4PQHA 3TKSA 5IMZA 3HDCA 4TN8A 4AGSA 1T00A 2B5EA 4OMVA 4MJCA 4L5OA 2C4JA 1USBA 2OACA 5HR2A 2RM5A 4KW6A 3S9FA 3APQA 1ZZYA 2VLTA 1XWCA 1VGLA 1TP9A 4MCUA 5IQYA 1LU4A 5KN1A 4KCAA 2H30A 2H6ZA 4KSMA 3N5OA 2FD3A 4MPFA 4ZBBA 4GXZA 3P8WA 5D93A 2JU5A 1XCCA 4GF0A 2WRTA 2WDUA 1QXHA 3MIXA 3QAVA 1UVZA 5IM9A 5D9TA 5JWOB 1XFLA 3RHCA 3ZITA 2X64A 2GSQA 3LWAA 1K3YA 5AIVA 2C80A 1SU9A 2A2SA 5D9XA 3UAPA 2VL9A 3IRAA 1TK8B 2DJ2A 4KNDA 2F9SA 3EINA 2P5QA 5G30A 1ABAA 2GT5A 2FY6A 3VWXA 3EURA 2IFQA 5D73A 3MAKA 4MF5A 2VCXA 1FVJA 3UBLA 2DMMA 2QA1A 4LL4B 1G0TA 4OFNA 2VLUA 22GSA 5AISA 1Z6MA 2KHPA 4WXTA 1TJDA 3ZLPA 2O7KA 3GMFA 2IMEA 1Q98A 6GSUA 1SKWB 3TRPA 1OC9B 4I2UA 3EC3A 4PQIA 1GTBA 5G1LA 3LEFA 3C1SA 4IGJA 3NIVA 5LNKe 2C3NA 2DKHA 1FAAA 1PKWA 3ZMLA 4G2EA 3BBYA 2IMIA 4IBPA 2LKUA 3GKXA 2GGTA 5FHIA 2QKEA 2P5RA 4YAPA 3FR3A 4G19A 5F0GA 4PNGA 3IOSA 4HDEA 2GS3A 1SJIA 4GTUA 3QDNA 4JU5A 1TK0B 4ECCA 3E3EA 5G5FA 3ZREA 4FYBA 4I5QA 4CDOA 2N5FA 1Z7PA 2H6YA 4EE0A 4ECBA 4IQAA 2L5OA 1XBSA 4F03A 3LFLA 5CP1A 3CXGA 5DAKB 4TRXA 5EL8A 1TXXA 2XBIA 3LGCA 4I8BA 2PBJA 2PUKC 3CBUA 4IS0A 2HRFA 4K7IA 2H1GA 1PX6A 1F9MA 2YWIA 2F51A 1ZYNA 1H75A 1SKSB 2YP6A 1FW1A 2CZ3A 6GSVA 4HQZA 3ED3A 1OKDA 1A8YA 4ZB8A 1TDIA 1SKRB 4K6XA 3VWUA 4OWYA 1YDKA 1XWGA 3QMXA 1B9YC 2EIRA 1JZRA 3WD6A 2H6XA 1X9WB 2C3QA 4N0VA 3GH6A 1OC9A 3VI7A 1YJ6A 4MA9A 1B9XC 3CYNA 4BA7A 1G7OA 4POMA 4XCSA 18GSA 2H1DA 1X9SB 2F8FA 2K8SA 2MMAA 3H93A 3SBCA 4ZXGA 3LQ7A 2O87A 5G5EA 4Z2TA 2FWGA 1M99A 2DJJA 4DVCA 1UC7A 3UJ1A 2XHFA 1T1VA 3NZNA 4IJ3A 2NVLA 3D21A 3MDKA 4MH3A 3CMIA 4XS4B 2A2PA 3WGEA 2FA8A 3TCOA 5HFKA 4TR0A 2VIMA 1CQHA 2PN8A 1O7UA 2A4HA 5DCGA 1X5CA 3A5WA 5DAKA 3VLNA 2LRNA 2H75A 9GSSA 1MDKA 4DSQA 1TU7A 1OE7A 2YZUA 5B8AA 2LRCA 1V2AA 4WBJA 4KE3A 4EO3A 2FHEA 4I97A 2H0IA 2H0GA 2WB9A 2YWOA 1XOAA 4K9ZA 4NHWA 1U87A 1GUHA 3F8UA 4ULXA 1SD8A 3LW9A 4NXIA 5E4WA 1TU8A 2K18A 2EIQA 1ERUA 1NSWA 1GLQA 3F4TA 3RAZA 4OCFA 2OE1A 1R5AA 4PXOA 5IO2A 3C8EA 4DEJA 5G2ZA 16GSA 3A3TA 5CYYA 5HFGA 4OO4A 4LL1B 11GSA 4KDUA 1SL1B 1BX9A 1WWJA 1EEMA 4EXJA 2GZZA 5F07A 3TKQA 1O73A 2WZ9A 4ISDA 4X0XA 1GH2A 3GTUB 3DGQA 2HSYA 3WT2A 4XS1A 2O8VB 3BJ5A 3IAS2 3APOA 5IMAA 4MH2A 4NWYA 2I4AA 4KH7A 1K0DA 4HOJA 1RK4A 1Y6EA 3ISOA 2DJKA 4XS4A 5D96A 4OFMA 4WBRD 4FIWA 4NHZA 3F9UA 1U3IA 2RM6A 3QFBC 3WT1A 5G31A 4OCEA 4MDCA 4RI7A 4EIQA 5J9CA 2I1UA 3QPMA 3TGZA 5INYA 5CRWA 2V1MA 1M2DA 3G7JA 4IELA 4ZB9A 2CX4A 2KP2A 3CRTA 2GSTA 2YWMA 5ECOB 4ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIX A;  3RDW A;  2E2M A;  3L0H A;  4D73 B;  1GSE A;  2HLS A;  4GCI A;  4IVF A;  5ECM B;  4ZL7 A;  1ZOF A;  4HEA 2;  1X0R A;  2AUV A;  1XXU A;  1TRV A;  1V58 A;  2CV4 A;  3DRN A;  5DJM A;  3VI5 A;  2O85 A;  2V2G A;  3TJK A;  5J5N A;  5KN0 A;  1F37 A;  2LNT A;  3KEB A;  3G7I A;  3DML A;  4AJ7 A;  2E0Q A;  2OAD A;  4FYU A;  4RI6 A;  4KB3 A;  1A0R P;  2LST A;  2HE3 A;  4O5R A;  3US3 A;  3IC4 A;  1ILO A;  3U5R E;  3CSJ A;  2OE0 A;  4MJA A;  4EL1 A;  4TR3 A;  12GS A;  4PUF C;  1MDJ A;  3KM6 A;  3FZA A;  4IQ1 A;  2IPA A;  3GIX A;  6GSX A;  3GTU A;  5F05 A;  4KAE A;  2DLX A;  3F4R A;  5IMF A;  4XIH A;  3IAM 2;  1SYX A;  1WMJ A;  3LXT A;  5A5K A;  3FR6 A;  1Z5Y E;  3J7Y k;  4OD7 A;  5CNW A;  4MZB A;  2CAI A;  4WR5 A;  2K9F A;  4KSO A;  3ERF A;  3F4S A;  2OBI A;  5CRD A;  2YV9 A;  3HHV A;  2BTO T;  1ACV A;  4MLY A;  4PUR A;  2JL4 A;  3TJJ A;  1JZO A;  4F82 A;  1HD2 A;  2PGT A;  3PGT A;  1MTC A;  1M2A A;  3KTL A;  4OFT A;  3CSH A;  4XRD A;  3FW2 A;  1VF4 A;  3IBH A;  1PL1 A;  1EV4 A;  1FVK A;  4D73 A;  2YV7 A;  2JSY A;  1THX A;  3VWV A;  1CQG A;  2MMZ A;  5EPF A;  2LNS A;  3GRX A;  1EP8 A;  3PIN A;  6GSS A;  2E2G A;  4KDX A;  3FRC A;  1QMV A;  1F2E A;  2VO4 A;  1HNA A;  3GHA A;  2MMO A;  5DJL A;  1OC8 A;  2B1L A;  3KTB A;  3QCP A;  2GTU A;  4WET A;  2CAQ A;  2X99 A;  2DJ1 A;  3DVW A;  3LYP A;  1URM A;  1QGV A;  1A2L A;  5GAN D;  1SL0 B;  2LV3 A;  1EGO A;  5LCZ A;  2GSS A;  1XWB A;  1SEN A;  4YQM A;  3GH9 A;  1XW6 A;  2B7K A;  4IP1 A;  3TJF A;  3DIE A;  3N9J A;  1PL2 A;  1AQX A;  4HU9 A;  5IOW A;  3TOU A;  3WGX A;  1AW9 A;  1F3A A;  1YEP A;  1TRW A;  4AF2 A;  1JLV A;  1GNW A;  2X8G A;  5IMD A;  1ERW A;  1G6W A;  1T7P B;  4MZC A;  2N5A A;  5B8B A;  3KCM A;  5B6N A;  4L0U A;  3KH7 A;  1AQV A;  3IR4 A;  3HVV A;  3HY2 A;  3GL5 A;  3FHK A;  3IPZ A;  1BED A;  3IXR A;  1GTI A;  4Q5R A;  3H1N A;  3I9V 2;  3QAG A;  3GKK A;  1EZK A;  5IPH A;  2DML A;  2MBS A;  4TXO B;  1B48 A;  3F3R A;  1J9B A;  2MBT A;  2AHE A;  2FWH A;  1GRX A;  1EV9 A;  2L5L A;  2YJ7 A;  1M9A A;  3FEU A;  1U3A A;  1TRS A;  3KJY A;  5ECL B;  1A2M A;  2HXK A;  3KZQ A;  1YY7 A;  1O6J A;  1T4Z A;  4IN0 A;  1WOU A;  5C00 A;  4XRA A;  2HT9 A;  1A0F A;  2IYJ A;  2P0G A;  1ZL9 A;  3QOU A;  1E2Y A;  1OYJ A;  5ID2 B;  1NM3 A;  2R2J A;  2BMX A;  5EY6 A;  3ZL5 A;  3VPQ A;  4YQV A;  4HS1 A;  2L6D A;  1QQ2 A;  2PER A;  4L5L A;  1K3O A;  1DE1 A;  2CVK A;  1W89 A;  1DBY A;  4HQS A;  2K6V A;  4K0N A;  4RUV A;  2L59 A;  3GX0 A;  5A4V A;  4EF0 A;  5ECK B;  2Z9S A;  1FG4 A;  2HZE B;  5A4W A;  2YNX A;  3M1G A;  4I2T A;  2FWF A;  2H74 A;  1DE2 A;  1ERV A;  3KP9 A;  1WRY A;  3DXB A;  1VF1 A;  1TRU A;  1K0O A;  3FZ9 A;  4ECJ A;  4TKY A;  3TKS E;  2AYT A;  4X43 A;  4GQC A;  4MMM A;  2GQM A;  1K3L A;  5E59 A;  5HR3 A;  3E0U A;  3AY8 A;  3KMN A;  3M9K A;  1HNC A;  1XW5 A;  2HI7 A;  3J7Y b;  3GNJ A;  4TXO A;  2MZC A;  3HD5 A;  4BVX A;  1OC3 A;  1I5G A;  2C0D A;  1S3A A;  4JZQ A;  2G0F A;  4PUA A;  2WCI A;  17GS A;  4CW9 A;  3H4K A;  3F6F A;  4K1F A;  1AAZ A;  1K0N A;  4IHU A;  1U88 A;  2YWN A;  3UMA A;  1A23 A;  3A2W A;  1BAY A;  2CX3 A;  2VM1 A;  3TRX A;  1PA3 A;  4MJB A;  2ON5 A;  3C73 A;  5ID2 A;  4GQF A;  3UL3 A;  2B7J A;  2REM A;  5J3R A;  3FKF A;  2GZY A;  3HVX A;  5JWQ B;  2FLS A;  5D9W A;  5D8I A;  1GSQ A;  3F3Q A;  5JWR B;  1B4Q A;  4N30 A;  1JFU A;  2PVO C;  5HR0 A;  2IWT A;  3GKM A;  1KTE A;  3I43 A;  3CSI A;  4HU7 A;  3EVI A;  6GSW A;  3U6V A;  4O7H A;  3UBK A;  3FYG A;  4JE1 A;  4NAX A;  4TR4 A;  1GUK A;  3D6I A;  3DEX A;  3BOA A;  4TOP A;  1FO5 A;  2OJL A;  2HZE A;  3HJM A;  1T8E B;  3KXO A;  4V1A p;  1W4V A;  4KX4 A;  1MEK A;  4PGT A;  2P31 A;  5FT3 A;  3EU4 A;  3VFI A;  3VUR A;  2IIY A;  4FO5 A;  5DVB A;  5ECS A;  3V1W A;  4TW5 A;  5LD0 A;  2C8U A;  5HFI A;  4GRF A;  1WJK A;  2HNL A;  3F0I A;  3TKR A;  4J2F A;  4Q5N A;  4H86 A;  8GSS A;  3D4T A;  1WIK A;  2MMN A;  3HZ4 A;  2I9H A;  3TJG A;  2RUF A;  1IYH A;  4KGI A;  2LJK A;  2IMF A;  2YZH A;  2LS5 A;  2GQL A;  1R4W A;  4IW9 A;  1YKA A;  1BQ7 A;  2KOK A;  1S3C A;  3FZ5 A;  3HJP A;  5ECR B;  4ZB6 A;  3UIW A;  3ZZX A;  3RPN A;  4HUA A;  1ZCP A;  1FB6 A;  2MYG A;  3ZTL A;  3FZ4 A;  3IDV A;  4ZIJ A;  1Q4J A;  4Q5F A;  3QR6 A;  5FWG A;  1G7E A;  4X1U A;  3L9S A;  2AAW A;  1M0U A;  2VD0 A;  2ZNM A;  3M9J A;  5ELA A;  3O3T A;  1PGT A;  2IN3 A;  4MF7 A;  5J4U A;  14GS A;  2ZUP A;  1YEX A;  1B8X A;  1AC1 A;  2NBS A;  4WF5 A;  2GSR A;  3IE3 A;  1Y25 A;  3LYK A;  2VL2 C;  1V40 A;  5F06 A;  4PQ1 A;  1XPV A;  3KP8 A;  3APS A;  1K0C A;  1NW2 A;  2DSA A;  2RUE A;  5L71 A;  1E6B A;  1PRX A;  1G6Y A;  1NHY A;  4BL7 A;  4P3Y B;  1Z3E A;  4V2N A;  2FA4 A;  2JAC A;  3BCI A;  3EMP A;  3P7X A;  1ZYE A;  5DDL A;  2M80 A;  3BCK A;  3KD0 A;  3A2X A;  2C0G A;  3PH9 A;  1OE8 A;  2LRT A;  2RII A;  5ECN B;  20GS A;  3KH9 A;  3TDG A;  1TW9 A;  4QL9 A;  2CVB A;  3WGD A;  3GV1 A;  1GTU A;  5GAP D;  3ERG A;  4JED A;  2CT6 A;  4JRR A;  1V98 A;  1AUC A;  3L78 A;  3K8N A;  1XWA A;  3A2V A;  3BD2 A;  4EDZ A;  2GZP A;  4ACS A;  2TRX A;  1X5E A;  4O92 A;  3GFK A;  5DQY A;  4XTS A;  3UOM A;  4MK3 A;  4LMW A;  1BJX A;  1PSQ A;  3VWW A;  1SK0 A;  5CRE A;  4EUY A;  5HR1 A;  3MNG A;  6GST A;  2CVD A;  1PKZ A;  2GQK A;  4HJM A;  5AGY A;  2FUG 2;  2IL3 A;  4CHS A;  2RLI A;  2ZCT A;  1O8W A;  2FCH A;  2IJY A;  2K8V A;  4TVE A;  4EKZ A;  3TB2 A;  1A24 A;  2HYX A;  1I9D A;  3DWV A;  2B5X A;  5CRG A;  5B6M A;  2WJU A;  2DIY A;  2YCD A;  3CTG A;  1XWK A;  1S3D A;  3GUR A;  2G2Q A;  2VCV A;  4MZW A;  1ERT A;  3HZ8 A;  1PN9 A;  1ST9 A;  1Z6N A;  4RQR A;  3UVT A;  3HA9 A;  2LJR A;  4EVM A;  2VOC A;  3GX8 A;  3C1R A;  5ECP B;  2OBK A;  2N5B A;  3D0Z A;  5GSS A;  3IK9 A;  2E7P A;  2LQQ A;  4GSS A;  1GSY A;  2H66 A;  3LG6 A;  5ECQ B;  3GL3 A;  4BWS A;  4O32 A;  4F0C A;  2D2Z A;  2PVQ A;  5CRH A;  1J0F A;  4K7N A;  3P2A A;  4TR1 B;  2NTO A;  1M9B A;  1QFN A;  2XBQ A;  6GSY A;  1GNE A;  2M46 A;  4POK A;  3IHQ A;  5EVO A;  3EE2 A;  4OO5 A;  3O76 A;  2ON7 A;  1NHO A;  4RQX A;  4ECI A;  2C0E A;  3QD9 A;  1PX7 A;  10GS A;  2ES7 A;  3LOR A;  4GST A;  5CO3 A;  3L9V A;  4KUN A;  1TKD B;  4HJ2 A;  5AN1 A;  4K2D A;  2PU9 C;  1PD2 1;  1PMT A;  2V32 A;  2IMK A;  3OR5 A;  4WR4 A;  5F8B A;  1TOF A;  1AXD A;  5ECH B;  4KCE A;  2F3M A;  1SL2 B;  13GS A;  3RBT A;  2I3Y A;  4WF4 A;  2BJX A;  2YOI A;  5KN2 A;  19GS A;  4E8H A;  4F0B A;  1M7T A;  3RHB A;  1MD3 A;  2GLR A;  7GSS A;  3JCM L;  3G9B A;  2VM2 A;  1BG5 A;  1UA5 A;  3HCZ A;  4QL7 A;  4K7O A;  2OKA A;  2R37 A;  4MF6 A;  1TI1 A;  3CTF A;  4XHM A;  3TRQ A;  1Z9H A;  4ZBA A;  2YAN A;  3M8N A;  1H4O A;  4MJE A;  1MDI A;  1THO A;  5DAL B;  3KMO A;  3Q19 A;  1ML6 A;  4IJI A;  1JZD A;  1OKT A;  1SYR A;  3IK7 A;  5IMV A;  4V2L A;  1Z7R A;  1EEJ A;  1LBK A;  3UAR A;  3M3M A;  4TR1 A;  4J56 E;  1ZYQ B;  3VPT A;  1OVN A;  3HXS A;  5KN3 A;  3Q6O A;  4NV5 A;  4PX1 A;  2JZR A;  2HRN A;  2H76 A;  2VL2 A;  1JHB A;  2LUS A;  4LA1 A;  1EWX A;  2H1B A;  1XZO A;  3ME8 A;  2A2R A;  2VD1 A;  1GLP A;  3VK9 A;  1QUW A;  4IKH A;  5CAX A;  1C72 A;  1O81 A;  1MD4 A;  2PMT A;  1QK8 A;  2XC2 A;  2GT6 A;  1RW1 A;  3ZRD A;  1UN2 A;  4N0Z A;  1VRS D;  4BVY A;  2H01 A;  2VCW A;  2YN1 A;  4ID0 A;  2QSI A;  3KGK A;  5J9B A;  3LXZ A;  3E9J B;  5IOX A;  1YQ1 A;  4HZ4 A;  3TJB A;  4Z7X A;  3KIJ A;  2I81 A;  4QQ7 A;  2R4V A;  3FK8 A;  5GST A;  2DIZ A;  2X8H A;  4K8M A;  2LQO A;  1TI3 A;  1GUL A;  1R26 A;  2FGX A;  4ZIL A;  3I6A A;  3F63 A;  3L9U A;  2AJQ B;  2C1Y A;  3C71 A;  5IPG A;  3UEM A;  1GSS A;  1KNG A;  4L8E A;  2CQ9 A;  1GSF A;  4XS6 A;  4ILF A;  1EOH A;  2DBC A;  3GSS A;  3QAW A;  3O6T A;  1O85 A;  4MAB A;  1GSU A;  3W8J A;  2QGV A;  3L4N A;  2R3X A;  1XVW A;  3EYT A;  3FY7 A;  2C3T A;  1T3B A;  4J57 E;  2VLV A;  4WEY A;  2YJH A;  3HJO A;  4HI7 A;  5DAL A;  2V41 A;  4HZ2 A;  3MSZ A;  5D9V A;  4MP4 A;  2B6M A;  5COH A;  1GP1 A;  5H5S A;  3DVX A;  1R5P A;  2L4C A;  2VL3 A;  2J9H A;  4Q5Q A;  1DSB A;  2H72 A;  3TKS C;  3ERW A;  2H73 A;  2OA7 A;  4ZL9 A;  5ECI B;  3W6G A;  4JBB A;  3SWL A;  4V2M A;  2JZT A;  3ZFB A;  3ZFL A;  2ALB A;  1WP0 A;  2C0F A;  4AJ6 A;  1K0A A;  1SJ6 A;  2LJA A;  3EMX A;  5ABR A;  2DC5 A;  1HNB A;  1XW9 A;  4MPG A;  4NMU A;  2CZ2 A;  4GLT A;  2JZS A;  5IMC A;  2IY2 A;  4BPY A;  1GWC A;  4EC0 A;  5HQP A;  5ENU A;  1O8X A;  4DSS B;  2R5G A;  4IP6 A;  4N10 A;  3TOT A;  2LTK A;  5DCH A;  1OAZ A;  2FNO A;  4G10 A;  2TRC P;  5A4U A;  3G7Y A;  1XVQ A;  1YF1 A;  3ZYW A;  1AIU A;  3GN3 A;  1LJR A;  4KA0 A;  5JCG A;  4F2I A;  1XOB A;  1SK2 A;  1F3B A;  2R6K A;  2B1K A;  2PWJ A;  4N11 A;  1IYI A;  1RQM A;  5JCU A;  4I6X A;  2HSH A;  3C7M A;  3D5J A;  5H5R A;  1FOV A;  2HZF A;  2KUC A;  2CA8 A;  4L0W A;  5JCW A;  4YQU A;  4TXV A;  1PQN A;  2VUP A;  1ZGN A;  3IA1 A;  3P90 A;  3Q18 A;  2O89 A;  1VF2 A;  2LEG A;  1GUM A;  3CRU A;  4DSR A;  1SJZ A;  3DYR A;  3NOF A;  2IMD A;  4V1A g;  3EU3 A;  4JR4 A;  2WGR A;  2JSZ A;  3HYP A;  4KDY A;  2NPB A;  3GA4 A;  1GSD A;  2X8C A;  2KP1 A;  2H8L A;  3HVS A;  2HFD A;  3ME7 A;  3TKP A;  1FB0 A;  1K0B A;  5GZZ B;  1AQW A;  5KEJ A;  1SK1 A;  4K0G A;  3UVH A;  1EP7 A;  1GTA A;  2H19 A;  2L6C A;  3GUS A;  1KBN A;  2M72 A;  5IIZ A;  3PR8 A;  1HYU A;  3F6D A;  2EC4 A;  3ZVJ A;  4F9Z A;  1GL8 A;  1V9W A;  4DSS A;  1ON4 A;  2A4V A;  1K0M A;  4YH2 A;  5DQS A;  2J23 A;  1BYE A;  4LMV A;  2V6K A;  5C04 A;  2AV4 A;  4ZL8 A;  4AJ8 A;  3LSZ A;  3Q74 A;  2VAF A;  2KLX A;  1X5D A;  3ZMK A;  3RPP A;  2WS2 A;  1X9M B;  1N8J A;  1A8L A;  2V6O A;  3W8S A;  4GWR A;  1N2A A;  1FHE A;  3LJR A;  1A2J A;  1T4Y A;  5H5Q A;  5DBQ A;  3ZIV A;  4NPB A;  2WUL A;  2H70 A;  2DJ0 A;  4WKW A;  4G9H A;  1M2B A;  3FR9 A;  3I69 A;  4POB A;  1R7H A;  4POL A;  2OE3 A;  1SD9 A;  2EIO A;  1B4P A;  2H71 A;  1U6T A;  2AB6 A;  1YZX A;  4PNF A;  5J41 A;  5G1K A;  1WE0 A;  4JR6 A;  1EOG A;  1YKC A;  1WPI A;  2WFC A;  1ZMA A;  2DJ3 A;  1XIY A;  1YF0 A;  2L57 A;  2VCT A;  3ZVJ D;  3DD3 A;  1TTZ A;  2VCQ A;  1F6M C;  2L4Q A;  3WYW A;  1J08 A;  1EGR A;  2B3S A;  4FH8 A;  1V57 A;  3D4M A;  3MWH A;  3DKS A;  2TIR A;  2YPM A;  3HKR A;  2H1A A;  2VCZ A;  3TUE A;  4BWQ A;  4EDY A;  3GYK A;  3H79 A;  2XPD A;  5ELG A;  2JAD A;  4ML1 A;  1VF3 A;  1KEB A;  2FWE A;  2IFQ B;  3IV4 A;  2H0H A;  5IO0 A;  1JZW A;  4ZBD A;  1JLW A;  1HQO A;  2F8A A;  4FYC A;  1DUG A;  5B7C A;  3GKN A;  3M0F A;  4YAV A;  3ZIJ A;  2B5Y A;  2QC7 A;  2GDR A;  4E8E A;  3D22 A;  3R2Q A;  2GVP A;  3GST A;  4GSN A;  3QFA C;  2PPT A;  4NV2 A;  2XPE A;  3EWL A;  4LLR A;  3H8Q A;  1TK5 B;  2NDO A;  4PQH A;  3TKS A;  5IMZ A;  3HDC A;  4TN8 A;  4AGS A;  1T00 A;  2B5E A;  4OMV A;  4MJC A;  4L5O A;  2C4J A;  1USB A;  2OAC A;  5HR2 A;  2RM5 A;  4KW6 A;  3S9F A;  3APQ A;  1ZZY A;  2VLT A;  1XWC A;  1VGL A;  1TP9 A;  4MCU A;  5IQY A;  1LU4 A;  5KN1 A;  4KCA A;  2H30 A;  2H6Z A;  4KSM A;  3N5O A;  2FD3 A;  4MPF A;  4ZBB A;  4GXZ A;  3P8W A;  5D93 A;  2JU5 A;  1XCC A;  4GF0 A;  2WRT A;  2WDU A;  1QXH A;  3QAV A;  1UVZ A;  5IM9 A;  5D9T A;  5JWO B;  1XFL A;  3RHC A;  3ZIT A;  2X64 A;  2GSQ A;  3LWA A;  1K3Y A;  5AIV A;  2C80 A;  1SU9 A;  2A2S A;  5D9X A;  3UAP A;  2VL9 A;  3IRA A;  1TK8 B;  2DJ2 A;  4KND A;  2F9S A;  3EIN A;  2P5Q A;  5G30 A;  1ABA A;  2GT5 A;  2FY6 A;  3VWX A;  3EUR A;  2IFQ A;  5D73 A;  3MAK A;  4MF5 A;  2VCX A;  1FVJ A;  3UBL A;  2DMM A;  4LL4 B;  1G0T A;  4OFN A;  2VLU A;  22GS A;  5AIS A;  1Z6M A;  2KHP A;  4WXT A;  1TJD A;  3ZLP A;  2O7K A;  3GMF A;  2IME A;  1Q98 A;  6GSU A;  1SKW B;  3TRP A;  1OC9 B;  4I2U A;  3EC3 A;  4PQI A;  1GTB A;  5G1L A;  3LEF A;  3C1S A;  4IGJ A;  3NIV A;  5LNK e;  2C3N A;  1FAA A;  1PKW A;  3ZML A;  4G2E A;  3BBY A;  2IMI A;  4IBP A;  2LKU A;  3GKX A;  2GGT A;  5FHI A;  2QKE A;  2P5R A;  4YAP A;  3FR3 A;  4G19 A;  5F0G A;  4PNG A;  3IOS A;  4HDE A;  2GS3 A;  1SJI A;  4GTU A;  3QDN A;  4JU5 A;  1TK0 B;  4ECC A;  3E3E A;  5G5F A;  3ZRE A;  4FYB A;  4I5Q A;  4CDO A;  2N5F A;  1Z7P A;  2H6Y A;  4EE0 A;  4ECB A;  4IQA A;  2L5O A;  1XBS A;  4F03 A;  3LFL A;  5DAK B;  3CXG A;  5CP1 A;  4TRX A;  5EL8 A;  1TXX A;  2XBI A;  3LGC A;  4I8B A;  2PBJ A;  2PUK C;  3CBU A;  4IS0 A;  2HRF A;  4K7I A;  2H1G A;  1PX6 A;  1F9M A;  2YWI A;  2F51 A;  1H75 A;  1SKS B;  2YP6 A;  1FW1 A;  2CZ3 A;  6GSV A;  4HQZ A;  3ED3 A;  1OKD A;  1A8Y A;  4ZB8 A;  1TDI A;  1SKR B;  4K6X A;  3VWU A;  4OWY A;  1YDK A;  1XWG A;  3QMX A;  1B9Y C;  2EIR A;  1JZR A;  3WD6 A;  2H6X A;  1X9W B;  2C3Q A;  4N0V A;  3GH6 A;  1OC9 A;  3VI7 A;  1YJ6 A;  4MA9 A;  1B9X C;  3CYN A;  4BA7 A;  1G7O A;  4POM A;  4XCS A;  18GS A;  2H1D A;  1X9S B;  2F8F A;  2K8S A;  2MMA A;  3H93 A;  3SBC A;  4ZXG A;  3LQ7 A;  2O87 A;  5G5E A;  2FWG A;  1M99 A;  2DJJ A;  4DVC A;  1UC7 A;  3UJ1 A;  2XHF A;  1T1V A;  3NZN A;  4IJ3 A;  2NVL A;  3D21 A;  3MDK A;  4MH3 A;  3CMI A;  4XS4 B;  3WGE A;  2FA8 A;  3TCO A;  5HFK A;  4TR0 A;  2VIM A;  1CQH A;  2PN8 A;  1O7U A;  5DCG A;  1X5C A;  3A5W A;  5DAK A;  3VLN A;  2LRN A;  2H75 A;  9GSS A;  1MDK A;  4DSQ A;  1TU7 A;  1OE7 A;  2YZU A;  5B8A A;  2LRC A;  1V2A A;  4WBJ A;  4KE3 A;  4EO3 A;  2FHE A;  4I97 A;  2H0I A;  2H0G A;  2WB9 A;  2YWO A;  1XOA A;  4K9Z A;  4NHW A;  1U87 A;  1GUH A;  3F8U A;  4ULX A;  1SD8 A;  4NXI A;  5E4W A;  1TU8 A;  2K18 A;  2EIQ A;  1ERU A;  1NSW A;  1GLQ A;  3F4T A;  3RAZ A;  4OCF A;  2OE1 A;  1R5A A;  4PXO A;  5IO2 A;  3C8E A;  4DEJ A;  5G2Z A;  16GS A;  3A3T A;  5CYY A;  5HFG A;  4OO4 A;  4LL1 B;  11GS A;  4KDU A;  1SL1 B;  1BX9 A;  1WWJ A;  1EEM A;  4EXJ A;  2GZZ A;  5F07 A;  3TKQ A;  1O73 A;  2WZ9 A;  4ISD A;  4X0X A;  1GH2 A;  3GTU B;  3DGQ A;  2HSY A;  3WT2 A;  4XS1 A;  2O8V B;  3BJ5 A;  3IAS 2;  3APO A;  5IMA A;  4MH2 A;  4NWY A;  2I4A A;  4KH7 A;  1K0D A;  4HOJ A;  1RK4 A;  1Y6E A;  3ISO A;  2DJK A;  4XS4 A;  5D96 A;  4OFM A;  4WBR D;  4FIW A;  4NHZ A;  3F9U A;  1U3I A;  2RM6 A;  3QFB C;  3WT1 A;  5G31 A;  4OCE A;  4MDC A;  4RI7 A;  5J9C A;  2I1U A;  3QPM A;  3TGZ A;  5INY A;  5CRW A;  2V1M A;  1M2D A;  3G7J A;  4IEL A;  4ZB9 A;  2CX4 A;  2KP2 A;  3CRT A;  2GST A;  2YWM A;  5ECO B;  4ML6 A; 
#chains in the Genus database with same CATH topology
 3DGN A;  5AIX A;  3RDW A;  2E2M A;  3L0H A;  2YX9 A;  4D73 B;  1GSE A;  2HLS A;  1B2S A;  4GCI A;  4IVF A;  5ECM B;  4ZL7 A;  3ZG5 A;  1ZOF A;  4HEA 2;  2OTL 3;  1X0R A;  2AUV A;  3N8B A;  1XXU A;  1TRV A;  1V58 A;  2CV4 A;  3BNC A;  3DRN A;  5DJM A;  3VI5 A;  2O85 A;  1OHO A;  2Y73 A;  5KP3 A;  2V2G A;  2HOH A;  3TJK A;  1OHP A;  5J5N A;  1QMA A;  3CCQ 3;  2GSP A;  5KN0 A;  1F37 A;  2LNT A;  1DET A;  3KEB A;  3G7I A;  3DML A;  5AEU B;  4G0L A;  2E0Q A;  4AJ7 A;  3NBR A;  1PFP A;  1C7H A;  4R9K A;  2OAD A;  1BNJ A;  4FYU A;  4RI6 A;  4KB3 A;  1A0R P;  2LST A;  2HE3 A;  4O5R A;  3US3 A;  4U13 A;  3IC4 A;  1ILO A;  3G8Z A;  3U5R E;  3CSJ A;  2OE0 A;  4MJA A;  4EL1 A;  3NV0 B;  1BNE A;  1W6C A;  4HBR A;  4TR3 A;  1B2M A;  12GS A;  3NQZ A;  4PUF C;  1MDJ A;  3KM6 A;  4O5Q A;  4AKY A;  3FZA A;  4IQ1 A;  4XBY A;  1RGE A;  4XDV A;  2IPA A;  1K28 A;  2V1L A;  1BRN L;  3LTB A;  3GIX A;  6GSX A;  1B20 A;  3GTU A;  3BNB A;  5F05 A;  4H61 A;  4KAE A;  2DLX A;  3F4R A;  5IMF A;  1AR0 A;  3U97 A;  3WR2 A;  1Q7H A;  1S3R A;  3IAM 2;  4XIH A;  4MMX B;  1GD4 A;  5BU4 A;  3PCR A;  4JF8 A;  2E2V A;  1SYX A;  1WMJ A;  3LXT A;  1Q7Y 4;  5CXO A;  1S5A A;  1TIJ A;  2B24 B;  5A5K A;  3FR6 A;  3D3L A;  1Z5Y E;  4IPB A;  3J7Y k;  4I4K A;  3PPU A;  4OD7 A;  1VZZ A;  5CNW A;  4MZB A;  2CAI A;  4WR5 A;  1VQL 3;  3WA2 X;  1Q40 A;  2K9F A;  4KSO A;  3ERF A;  3F4S A;  2OBI A;  1GOY A;  2YV9 A;  5CRD A;  3HHV A;  2BTO T;  1ACV A;  4MLY A;  4PUR A;  2JL4 A;  3TJJ A;  1JZO A;  4F82 A;  1HD2 A;  3PCS A;  2PGT A;  3NHX A;  3PGT A;  1MTC A;  1M2A A;  3KTL A;  4OFT A;  3CSH A;  4XRD A;  3FW2 A;  1VF4 A;  3IBH A;  1PL1 A;  3CC4 3;  1YGW A;  4ZM8 A;  2FGT A;  4LEH A;  3J7Y d;  1FGO A;  1EV4 A;  2YFI B;  3EX9 A;  1YJW 3;  3GSP A;  4CY8 A;  1FVK A;  4R80 A;  4D73 A;  2YV7 A;  1U8C B;  2JSY A;  3EC9 A;  1THX A;  2W2C A;  3FF2 A;  4J5G A;  3VWV A;  1CQG A;  2MMZ A;  5EPF A;  2LNS A;  3GRX A;  1EP8 A;  3PIN A;  6GSS A;  2E2G A;  4KDX A;  3FRC A;  1QMV A;  2O3O A;  3CCL 3;  1F2E A;  4KT3 B;  2VO4 A;  1HNA A;  3GZY B;  3GHA A;  2MMO A;  5DJL A;  4FMD A;  1OC8 A;  2B1L A;  3VF1 A;  3KTB A;  3JUQ A;  1TFK A;  1HYF A;  3T8N A;  3SX1 A;  3X41 A;  4KFF A;  3QCP A;  2GTU A;  2XSH B;  4WET A;  1FUW A;  2CAQ A;  4OK0 A;  2X99 A;  2DJ1 A;  1IV9 A;  3DVW A;  3LYP A;  1URM A;  2M7O A;  4BIR A;  1UDI I;  4XB5 A;  3ROB A;  3FZW A;  3NV0 A;  1QGV A;  2MF7 A;  1A2L A;  5AIG A;  1N8Q A;  5GAN D;  4N6O B;  1SL0 B;  4AKZ A;  1RGF A;  2LV3 A;  1EGO A;  5LCZ A;  2GSS A;  1XWB A;  3NUV A;  1NNV A;  1SEN A;  4YQM A;  3GH9 A;  1FUS A;  1XW6 A;  2B7K A;  4IP1 A;  3TJF A;  1TU5 A;  1T5Y A;  3DIE A;  3N9J A;  4HZB B;  1PL2 A;  1RNT A;  1AQX A;  1ULJ B;  4HU9 A;  1JBS A;  3TOU A;  5IOW A;  3WGX A;  1AW9 A;  1OF5 B;  1F3A A;  5M1A A;  1CQS A;  1TRW A;  1YEP A;  1JLV A;  4AF2 A;  1ZS7 A;  3S5C A;  1RCK A;  1VQN 3;  1GNW A;  2X8G A;  5IMD A;  4HM1 B;  4K5S A;  3S29 A;  1ERW A;  1G6W A;  2CG1 A;  5HGR A;  1T7P B;  1LQM B;  4MZC A;  2N5A A;  5B8B A;  3KCM A;  5B6N A;  4O3V A;  1VQO 3;  2W9Q A;  1RGG A;  3KH7 A;  4L0U A;  4LGQ A;  1AQV A;  3IR4 A;  3EJV A;  3HVV A;  3HY2 A;  3GL5 A;  3FHK A;  1BRS A;  3IPZ A;  1BED A;  3IXR A;  3RGA A;  1M1X B;  4OVM A;  3Q90 A;  1GTI A;  3X42 A;  4Q5R A;  3QRD A;  1X1W A;  2GBW B;  3H1N A;  2K0M A;  3I9V 2;  1AQZ A;  2YFJ B;  3QAG A;  3AMO B;  3GKK A;  1EZK A;  5FW5 A;  3CXC 2;  1QAL A;  5IPH A;  3KZT A;  4G0I A;  3V99 A;  2DML A;  2MBS A;  4TXO B;  1B48 A;  4HM3 B;  1N9J A;  3F3R A;  4J9A A;  3IHG A;  1J9B A;  3MHE A;  2MBT A;  2AHE A;  2FWH A;  4BVX B;  1GRX A;  2QEX 3;  1I70 A;  2XGL A;  1EV9 A;  2L5L A;  1GYB A;  1E3V A;  3QK9 A;  4FR9 A;  1M9A A;  1W01 A;  1U3A A;  2YJ7 A;  3FEU A;  5KP4 A;  1TRS A;  3KJY A;  5ECL B;  1A2M A;  3S28 A;  2HXK A;  2BMR B;  3KZQ A;  1YY7 A;  1O6J A;  1T4Z A;  4IN0 A;  1WMN A;  1WOU A;  5C00 A;  2UUG C;  3N54 B;  2HT9 A;  4XRA A;  5KOW A;  1A0F A;  3CME 3;  4TX4 A;  4IIA A;  2IYJ A;  2P0G A;  3H51 A;  1ZL9 A;  1NU3 A;  1E2Y A;  3QOU A;  1OYJ A;  2C4B A;  2RSX A;  2QA2 A;  5ID2 B;  3CCU 3;  2CH9 A;  3JUM A;  2HRK A;  1NM3 A;  2R2J A;  2CFL A;  5ELJ A;  1M1K 4;  2BMX A;  3S67 A;  3V98 A;  4XBT A;  5EY6 A;  3ZL5 A;  3VPQ A;  4YQV A;  3MWZ A;  2JDI H;  2P0X A;  4HS1 A;  2L6D A;  1QQ2 A;  3IC8 A;  1KD1 4;  2PER A;  4L5L A;  2CIU A;  2SAR A;  1BNF A;  3JVC A;  1K3O A;  1DE1 A;  1UUG B;  2CVK A;  1W89 A;  1CYU A;  1DBY A;  4HQS A;  4GSP A;  2K6V A;  3NX0 A;  2W6J H;  1OF5 A;  4K0N A;  4RUV A;  1RRH A;  2L59 A;  3GX0 A;  3OW2 2;  1UCJ A;  5A4V A;  4EF0 A;  3JUP A;  4HKV B;  5ECK B;  2Z9S A;  2R0G A;  1FG4 A;  2HZE B;  1SPU A;  5A4W A;  2YNX A;  3M1G A;  4I2T A;  2FWF A;  2H74 A;  1DE2 A;  1CYV A;  1ERV A;  1BSE A;  1N8R 4;  3LZA A;  1Q86 4;  3G16 A;  3MG1 A;  3KP9 A;  1RGL A;  4Z2U A;  1WRY A;  3DXB A;  1B27 A;  3A5I A;  4K1U A;  1LOX A;  1VF1 A;  1ZO2 A;  1TRU A;  2HSM A;  4N3V A;  1YJ9 3;  1K0O A;  3FZ9 A;  4ECJ A;  4TKY A;  3TKS E;  2AYT A;  4X43 A;  4GQC A;  4MMM A;  3A5E A;  5BIR A;  1RN7 A;  2GQM A;  3PGB A;  1K3L A;  5E59 A;  2WGQ A;  3AMO A;  5HR3 A;  3E0U A;  3AY8 A;  3KMN A;  3M9K A;  4YKG A;  5IG5 A;  1HNC A;  1XW5 A;  2HI7 A;  3J7Y b;  3GNJ A;  4TXO A;  2MZC A;  5BRT A;  4EBG A;  3HD5 A;  1B3S A;  4BVX A;  1OC3 A;  4N6N B;  1I5G A;  2C0D A;  2GU3 A;  1UUW B;  1L5G B;  1S3A A;  3FG1 A;  4JZQ A;  2G0F A;  1T2H A;  4PUA A;  3NBB A;  2WCI A;  17GS A;  4CW9 A;  3H4K A;  3F6F A;  4K1F A;  1AAZ A;  1K0N A;  4IHU A;  1U88 A;  2X49 A;  2YWN A;  3UMA A;  3BLZ A;  1A23 A;  4NRE A;  2KF5 A;  4BL3 A;  3A2W A;  3SOA A;  1IQX A;  1BAY A;  1O7W B;  2XH9 A;  3B4O A;  2CX3 A;  2VM1 A;  3TRX A;  1PA3 A;  2L1S A;  4MJB A;  3FSD A;  2ON5 A;  3C73 A;  2IA7 A;  5ID2 A;  4MMZ B;  1S72 3;  4GQF A;  3UL3 A;  2B7J A;  2REM A;  5J3R A;  3FKF A;  4MNN A;  2GZY A;  5D81 A;  3HVX A;  5JWQ B;  1BRJ A;  1JBT A;  2FLS A;  5D9W A;  1MOL A;  4LMI A;  5D8I A;  1GSQ A;  3F3Q A;  5JWR B;  1B4Q A;  4N30 A;  4KVH A;  5CLK A;  1JFU A;  1WQL B;  2PVO C;  1W00 A;  2IWT A;  3GKM A;  5HR0 A;  5STD A;  2E2U A;  1KTE A;  3I43 A;  3CSI A;  1GMQ A;  2OOV A;  3AHS A;  4HU7 A;  3EVI A;  6GSW A;  3U6V A;  4O7H A;  2RBI A;  1YJN 3;  3UBK A;  3FYG A;  4JE1 A;  4NAX A;  4TR4 A;  1GUK A;  3D6I A;  2F5W A;  4WWU C;  3DEX A;  3BOA A;  4TOP A;  1FO5 A;  2OJL A;  2HZE A;  3HJM A;  1BRK A;  1T8E B;  3KXO A;  4V1A p;  5IEN A;  1W4V A;  1GMR A;  4KX4 A;  1RJO A;  3G71 3;  1MEK A;  4PGT A;  2P31 A;  5FT3 A;  3EU4 A;  3VFI A;  1IT7 A;  3VUR A;  2IIY A;  4FO5 A;  5DVB A;  5ECS A;  2R0P A;  1VQ6 3;  3V1W A;  4TW5 A;  5LD0 A;  2RNT A;  1US1 A;  2C8U A;  5HFI A;  3MSO A;  4GRF A;  1M3J A;  4BL7 B;  1WJK A;  4FQU A;  2HNL A;  3T8U A;  3F0I A;  2ZHX B;  3TKR A;  4J2F A;  5A0O B;  4Q5N A;  4K2X A;  1OCV A;  1PYL A;  4H86 A;  8GSS A;  2K54 A;  3GRD A;  3D4T A;  2P05 A;  1WIK A;  1JB5 A;  2MMN A;  3HZ4 A;  2BHM A;  2I9H A;  3TJG A;  2RUF A;  1IYH A;  4KGI A;  2LJK A;  2IMF A;  2YZH A;  2W56 B;  2LS5 A;  3HI7 A;  2GQL A;  1R4W A;  1YIJ 3;  4WP5 A;  4IW9 A;  1YKA A;  1BQ7 A;  1A90 A;  2KOK A;  3PXM A;  1VQ4 3;  1S3C A;  3FZ5 A;  3HJP A;  1W2Z A;  3FCS B;  5ECR B;  5M19 A;  1IDP A;  4ZB6 A;  3UIW A;  3ZZX A;  4BTY A;  4K1V A;  3RPN A;  4HUA A;  1ZCP A;  1ASK A;  1FB6 A;  3PZW A;  2MYG A;  3ZTL A;  2KCD A;  2OQE C;  3GAX A;  3FZ4 A;  3IDV A;  1DVC A;  2CFW A;  4ZIJ A;  1TTO A;  1Q4J A;  4Q5F A;  3QR6 A;  5FWG A;  5KOX A;  1G7E A;  3FG4 A;  4RBN A;  4X1U A;  3L9S A;  2AAW A;  3EQQ B;  1M0U A;  2VD0 A;  2ZNM A;  3M9J A;  3O3T A;  1PGT A;  5ELA A;  4O8S A;  2IN3 A;  4MF7 A;  5J4U A;  3X3X A;  14GS A;  2ZUP A;  1YEX A;  1B8X A;  1AC1 A;  2NBS A;  4WF5 A;  2GSR A;  2QIY A;  3IE3 A;  1Y25 A;  2LYX A;  2BNG A;  3LYK A;  2VL2 C;  8CHO A;  1IQ8 A;  1V40 A;  5F06 A;  4PQ1 A;  1X1X A;  1XPV A;  1NDO B;  3KP8 A;  3APS A;  3IPT A;  1K0C A;  3B4P A;  1Q81 4;  1NW2 A;  8RNT A;  2DSA A;  2RUE A;  5L71 A;  1E6B A;  1PRX A;  3CCM 3;  1D6Y A;  4FCZ A;  1G6Y A;  1YIT 3;  1N9E A;  1NHY A;  4BL7 A;  4P3Y B;  1X1U A;  3RGR A;  1Z3E A;  4V2N A;  2FA4 A;  1PU4 A;  2JAC A;  3BCI A;  4K5R A;  3EMP A;  3UNL A;  3P7X A;  1O7N B;  1ZYE A;  2Z77 A;  5DDL A;  2M80 A;  3BCK A;  1BVI A;  3KD0 A;  3A2X A;  2C0G A;  1A2P A;  3CC7 3;  2F56 A;  3PH9 A;  1OE8 A;  1T2I A;  2LRT A;  1WNH A;  2RII A;  5ECN B;  20GS A;  3CCE 3;  3TDG A;  3KH9 A;  1TW9 A;  4HVN A;  4QL9 A;  2CVB A;  3SVA A;  3WGD A;  1GY6 A;  3GV1 A;  1GTU A;  4N6V 0;  3V92 A;  3ERG A;  5GAP D;  3CCS 3;  2XFT A;  4ICY A;  2CT6 A;  4JED A;  4JRR A;  1V98 A;  3OWY A;  1AUC A;  2MC8 A;  3L78 A;  4EIP A;  3K8N A;  1GS3 A;  1W4N A;  1XWA A;  3CNX A;  3A2V A;  2SBL A;  3BD2 A;  1YVB I;  1RLS A;  4EDZ A;  2GZP A;  4ACS A;  2TRX A;  1X5E A;  5AIF A;  4O92 A;  2KRT A;  2HMN B;  3GFK A;  5DQY A;  1BRG A;  4XTS A;  3UOM A;  4MK3 A;  2HRA A;  4LMW A;  1BJX A;  1PSQ A;  3VWW A;  1SK0 A;  5CRE A;  1W6Y A;  2ML5 A;  1ULI B;  4EUY A;  1QJG A;  1O7G B;  3KN4 A;  3CU3 A;  5HR1 A;  1ISK A;  3MNG A;  6GST A;  1BIR A;  3CMA 3;  6STD A;  2CVD A;  1PKZ A;  2CFG A;  1V74 A;  1BUQ A;  2GQK A;  1RGK A;  3FGY A;  4HJM A;  4HM6 B;  5AGY A;  3UJM A;  3BNE A;  2FUG 2;  5EQL A;  1KWI A;  2XGN A;  2IL3 A;  3GZR A;  4O5U A;  4CHS A;  3OV4 A;  1EKM A;  2RLI A;  3HZP A;  2ZCT A;  1O8W A;  4MMY B;  2FCH A;  5JBS A;  5IG4 A;  2IJY A;  3ZG0 A;  1K73 4;  2K8V A;  4TVE A;  2XR8 B;  3EPT A;  2WGO A;  4EKZ A;  1DMN A;  1RGC A;  3TB2 A;  1LQG C;  1A24 A;  2D1W A;  2HYX A;  1BSD A;  4K90 B;  2P0M A;  1I9D A;  3DWV A;  2B5X A;  5CRG A;  5B6M A;  2RFR A;  4HYZ A;  2WJU A;  2DIY A;  2YCD A;  3CTG A;  1XWK A;  1S3D A;  3GUR A;  4RNT A;  3FH1 A;  2A15 A;  2G2Q A;  2VCV A;  4MZW A;  1ERT A;  5IER A;  1BSA A;  3DGY A;  5D82 A;  3HZ8 A;  1PN9 A;  1ST9 A;  1ZYP A;  5CF2 A;  1Z6N A;  4RQR A;  1B21 A;  4MEI A;  3HA9 A;  3UVT A;  2LJR A;  1DMM A;  3PS8 A;  4EVM A;  3FF0 A;  3FKA A;  1E97 A;  2VOC A;  3GX8 A;  2ZDJ A;  3C1R A;  5ECP B;  1IK3 A;  1ZX2 A;  1RSN A;  2OBK A;  4FMA A;  2N5B A;  6RNT A;  3HVN A;  1RGH A;  3D0Z A;  3DMC A;  5GSS A;  4X2H A;  3IK9 A;  4A5P A;  2E7P A;  2LQQ A;  4GSS A;  1GSY A;  3LXU X;  2H66 A;  3LG6 A;  5ECQ B;  3GL3 A;  4BWS A;  4O32 A;  4F0C A;  3BB9 A;  2D2Z A;  2PVQ A;  5CRH A;  1J0F A;  4K7N A;  1LNH A;  3P2A A;  4TR1 B;  2NTO A;  1M9B A;  5LC7 A;  1QFN A;  2XBQ A;  1I2G A;  4QWT A;  6GSY A;  1W7C A;  1A67 A;  1GNE A;  2M46 A;  1NWW A;  5M18 A;  4POK A;  3IHQ A;  3DGL A;  2WOH A;  4CDL A;  5EVO A;  1RN4 A;  1GOU A;  3EE2 A;  2PZV A;  2IUK A;  1TP6 A;  2DKI A;  4OO5 A;  3O76 A;  2ON7 A;  3EN8 A;  1NHO A;  4RQX A;  4ECI A;  2C0E A;  1IYY A;  3QD9 A;  1TFO A;  4BVY B;  1PX7 A;  1LXE A;  3UL6 A;  4HZ9 B;  10GS A;  4N6M A;  5LC6 A;  2ES7 A;  1O7P B;  3LOR A;  4GST A;  4WHA A;  5CO3 A;  3L9V A;  4KUN A;  1AVK A;  1TKD B;  2CKF B;  4HJ2 A;  1I8V A;  5AN1 A;  1OH0 A;  3AGO A;  4K2D A;  2PU9 C;  4XM4 A;  1PD2 1;  1Q82 4;  1PMT A;  2V32 A;  2IMK A;  3OR5 A;  4WR4 A;  5F8B A;  1TOF A;  1IVX A;  4FCJ A;  5ECO B;  1ROV A;  1AXD A;  3UB1 A;  5ECH B;  4CY6 A;  4KCE A;  2F3M A;  3GZX B;  1MWR A;  1O7M B;  2STD A;  1SL2 B;  13GS A;  3RBT A;  2I3Y A;  2OTJ 3;  4WF4 A;  2BJX A;  2UGI A;  2YOI A;  5KN2 A;  4NHF A;  19GS A;  3D4A A;  4E8H A;  1M7T A;  3X40 A;  4F0B A;  3H3H A;  3RHB A;  1MD3 A;  1SAR A;  2GLR A;  3F40 A;  3JCM L;  7GSS A;  2BMO B;  3G9B A;  2VM2 A;  4N6L A;  5IEO A;  2CG0 A;  1BG5 A;  3LTA A;  1EUI C;  1UA5 A;  3HCZ A;  4QL7 A;  2OQE A;  4K7O A;  2OKA A;  2R37 A;  4MF6 A;  7GSP A;  1TI1 A;  3DZL A;  3CTF A;  4XHM A;  3TRQ A;  4G0K A;  1Z9H A;  4ZBA A;  2YAN A;  3M8N A;  1H4O A;  4MJE A;  1MDI A;  1JKG B;  2CHC A;  4HAA A;  5EEO A;  1THO A;  3KMO A;  3Q19 A;  1ML6 A;  4IJI A;  1JZD A;  5DAL B;  1OKT A;  1SYR A;  3IK7 A;  5IMV A;  4V2L A;  1Z7R A;  1G96 A;  1EEJ A;  1LBK A;  3UAR A;  2W0Q A;  4R1K A;  3M3M A;  4TR1 A;  4J56 E;  1ZYQ B;  1C54 A;  3VPT A;  1OVN A;  2WO0 A;  1K41 A;  3HXS A;  1MWT A;  5KN3 A;  3Q6O A;  4NV5 A;  4PX1 A;  2JZR A;  1BGS A;  1JRQ A;  1TRQ A;  3F7X A;  2H76 A;  2HRN A;  2VL2 A;  1JHB A;  2LUS A;  1TRP A;  4LA1 A;  1EWX A;  2H1B A;  1XZO A;  3ME8 A;  2A2R A;  2VD1 A;  1GLP A;  3VK9 A;  1QUW A;  1OGX A;  3SLU A;  4IKH A;  5CAX A;  3MYT A;  1C72 A;  1O81 A;  4HM5 B;  2XEP A;  1MD4 A;  2GXF A;  2PMT A;  1XG8 A;  1QK8 A;  2XC2 A;  2X4A A;  2GT6 A;  1RW1 A;  3ZRD A;  1UN2 A;  4N0Z A;  1VRS D;  4BVY A;  2H01 A;  5AII A;  4PTS A;  2VCW A;  2ZL8 A;  2YN1 A;  4ID0 A;  2QSI A;  3KGK A;  1QAK A;  4CJN A;  4RNY A;  5J9B A;  3MYD A;  3LXZ A;  3E9J B;  1OAC A;  5IOX A;  1YQ1 A;  4HZ4 A;  3TJB A;  1BNG A;  2KXG A;  3X3Z A;  3KIJ A;  2I81 A;  4Z7X A;  3B7C A;  1I3I A;  1PN0 A;  4QQ7 A;  2R4V A;  2FNQ A;  4HM8 B;  3FK8 A;  5GST A;  2DIZ A;  5TGN A;  2X8H A;  4K8M A;  3HK4 A;  2LQO A;  1TI3 A;  1GUL A;  1R26 A;  2FGX A;  4ZIL A;  3I6A A;  3F63 A;  3L9U A;  2AJQ B;  2C1Y A;  3C71 A;  3ALA A;  3F7S A;  5IPG A;  3UEM A;  1GSS A;  5BXQ A;  2I9W A;  1VQ9 3;  1KNG A;  4L8E A;  2CQ9 A;  1GSF A;  4XS6 A;  4ILF A;  1PY3 A;  3LT9 A;  1EOH A;  2QGU A;  4KZ1 A;  2DBC A;  3GSS A;  3QAW A;  3O6T A;  1O85 A;  1D6Z A;  1W6G A;  2ZA4 A;  1GSU A;  4MAB A;  3W8J A;  2QGV A;  1VQ7 3;  2R3X A;  3L4N A;  1XVW A;  3EYT A;  3FY7 A;  2C3T A;  2Z76 A;  1JN5 B;  1T3B A;  3SOY A;  4KF9 A;  4BL2 A;  4J57 E;  2VLV A;  4WEY A;  2W9P A;  4JRF A;  3B8L A;  4HJL B;  2YJH A;  3HJO A;  4HI7 A;  1JKG A;  5DAL A;  2V41 A;  4HZ2 A;  3MSZ A;  5D9V A;  3KFQ C;  1RKY A;  4BU4 A;  4MP4 A;  2B6M A;  5KP1 A;  5COH A;  1GP1 A;  2BMQ B;  5H5S A;  2R0C A;  3DVX A;  1R5P A;  2L4C A;  3K63 A;  4CCV A;  3SXX A;  3EN1 B;  3OWU A;  3EB8 A;  2VL3 A;  2J9H A;  7STD A;  3NQY A;  1DSB A;  2H72 A;  4Q5Q A;  3TKS C;  3DY5 A;  3ERW A;  2H73 A;  2CX0 A;  2OA7 A;  4ZL9 A;  5ECI B;  3W6G A;  4JBB A;  3SWL A;  4V2M A;  2P38 A;  2JZT A;  3ZFB A;  3ZFL A;  4HM4 B;  2BT3 A;  4BTW A;  2ALB A;  1GD3 A;  1WP0 A;  2C0F A;  1ROA A;  4KFE A;  1K0A A;  4AJ6 A;  1A2K A;  2UZ8 A;  1SJ6 A;  2LJA A;  3EMX A;  5ABR A;  2DC5 A;  1HNB A;  1XW9 A;  1FGQ A;  3DH2 A;  4WYK B;  4HM7 B;  7RNT A;  4MPG A;  4NMU A;  2CZ2 A;  4GLT A;  2D42 A;  2F99 A;  2JZS A;  5IMC A;  2IY2 A;  4BPY A;  1GWC A;  1MNL A;  2GEX A;  1HZ1 A;  2RCD A;  4N6T A;  4EC0 A;  2OCT A;  2GU1 A;  3D5I A;  5HQP A;  1YVS A;  5ENU A;  1O8X A;  4DSS B;  1RGA A;  2R5G A;  4EW5 A;  4IP6 A;  3BU4 A;  4N10 A;  1O7H B;  3TOT A;  2LTK A;  4R4K A;  5DCH A;  1OAZ A;  3BND A;  2FNO A;  4G10 A;  2TRC P;  5A4U A;  2F5M A;  1UI8 A;  3G7Y A;  1QVG 2;  3F8X A;  1XVQ A;  1YF1 A;  3ZYW A;  1FGR A;  3NXJ A;  2RGQ A;  1AIU A;  4Z2R A;  3GN3 A;  1LJR A;  4KA0 A;  5JCG A;  4F2I A;  3N9H A;  1XOB A;  1SK2 A;  4Q53 A;  5CF1 A;  1F3B A;  2R6K A;  2F98 A;  1NJI 4;  2B1K A;  5AIH A;  2PWJ A;  5IG0 A;  4N11 A;  1IYI A;  1RQM A;  5JCU A;  4I6X A;  2HSH A;  3C7M A;  3D5J A;  3AHW A;  5H5R A;  4STD A;  1I0V A;  2HMJ B;  3FMW A;  1FOV A;  2HZF A;  2KUC A;  1JN5 A;  4USS A;  2CA8 A;  4L0W A;  5JCW A;  4YQU A;  4TXV A;  1PQN A;  2VUP A;  1ZGN A;  1WTH A;  3IA1 A;  3P90 A;  3Q18 A;  2O89 A;  1VF2 A;  2LEG A;  1GUM A;  3CRU A;  4DSR A;  1SJZ A;  3DYR A;  3NOF A;  2IMD A;  3KKG A;  1D6U A;  1N5P A;  4V1A g;  3EU3 A;  4JR4 A;  4BIK A;  2WGR A;  2JSZ A;  3EBY A;  4WFO A;  3HYP A;  4KDY A;  2CWV A;  5I97 A;  2NPB A;  2Q07 A;  5EVH A;  3GA4 A;  5FGO A;  2Z7A A;  1BSC A;  1GSD A;  2X8C A;  2KP1 A;  2H8L A;  3URP A;  1UUV B;  3HVS A;  2B1X B;  1RCL A;  2HFD A;  3ME7 A;  1MWS A;  3TKP A;  1BOX A;  1FB0 A;  1K0B A;  3GZB A;  5GZZ B;  1AQW A;  5KEJ A;  1SK1 A;  5AEW B;  3F9S A;  4H3U A;  4K0G A;  3NM2 A;  3UVH A;  1JB2 A;  3NM7 A;  1TUH A;  3LTC A;  3RDE A;  1RRL A;  1EP7 A;  4X4J A;  1BNR A;  2CWT A;  3IMA B;  1GTA A;  2H19 A;  3CCR 3;  4WYK A;  2L6C A;  3GUS A;  3MPH A;  2PNC A;  1KBN A;  2M72 A;  4O02 B;  1FW7 A;  5IIZ A;  1JV2 B;  3PR8 A;  5G2G A;  1K8A 4;  1HYU A;  3F6D A;  2EC4 A;  3ZVJ A;  4F9Z A;  1GL8 A;  1U5O A;  3WDG B;  1J2B A;  1DYU A;  1V9W A;  4DSS A;  2CC3 A;  3CNM A;  1ON4 A;  2A4V A;  1K0M A;  4YH2 A;  5DQS A;  4RNZ A;  2J23 A;  1EA2 A;  1BYE A;  4LMV A;  2V6K A;  1B2X A;  5C04 A;  2W56 A;  3EF8 A;  2AV4 A;  1AVL A;  4AEQ A;  1YGE A;  4ZL8 A;  3LYG A;  4AJ8 A;  2OWP A;  3G0K A;  3ECF A;  1BAN A;  3LSZ A;  3Q74 A;  1NB3 I;  5D83 A;  2VAF A;  2KLX A;  3K0Z A;  1SQW A;  1CH0 A;  1X5D A;  3ZMK A;  1LRA A;  3RPP A;  3F14 A;  4PEJ A;  2WS2 A;  1X9M B;  3BIR A;  1HU9 A;  1LOY A;  1QAF A;  1E3R A;  1N8J A;  1A8L A;  4OUQ A;  4J5K A;  1UGH I;  2V6O A;  3MKI A;  3W8S A;  1FA3 A;  2CX1 A;  1LVN A;  1N2A A;  1FHE A;  4GWR A;  1R4Y A;  3LJR A;  3E99 A;  3M8C A;  1A2J A;  3KE7 A;  1T4Y A;  5H5Q A;  1UW1 A;  5DBQ A;  1STF I;  3ZIV A;  1BRI A;  4NPB A;  2WUL A;  5IF6 A;  1IVU A;  3KSE D;  2H70 A;  2HMO B;  2DJ0 A;  4WKW A;  3HOH A;  1F8N A;  3HIG A;  3PYJ A;  4G9H A;  4FMB A;  3SED A;  4EV5 A;  1M2B A;  3FR9 A;  3I69 A;  5IG3 A;  4POB A;  1R7H A;  4YKF A;  3LH4 A;  4HM2 B;  4POL A;  1BSB A;  2OE3 A;  2F86 B;  1SD9 A;  2EIO A;  1B4P A;  2H71 A;  1U6T A;  2AB6 A;  1YZX A;  4PNF A;  3ZFZ A;  5J41 A;  5G1K A;  1YI2 3;  1WE0 A;  4JR6 A;  1EOG A;  1YKC A;  2AAD A;  5BMU A;  1WPI A;  2WFC A;  1ZMA A;  2DJ3 A;  1XIY A;  1W2B 2;  1VQK 3;  1YF0 A;  2OOV C;  3CCJ 3;  1NB5 I;  3R3E A;  1Q42 A;  2L57 A;  1I2F A;  4IT7 A;  2VCT A;  1IU7 A;  3ZVJ D;  1LNI A;  3DD3 A;  1TTZ A;  2VCQ A;  1F6M C;  2L4Q A;  3WYW A;  2INX A;  1PFO A;  1J08 A;  1EGR A;  2B3S A;  4FH8 A;  1V57 A;  3O8Y A;  1AV4 A;  5HOH A;  3D4M A;  2QA4 3;  1FGT A;  3MWH A;  3DKS A;  3Q2P A;  2TIR A;  2YPM A;  3HKR A;  4G1M B;  4L7K A;  2H1A A;  2VCZ A;  3TUE A;  2W04 A;  3CPW 2;  1YHQ 3;  4BWQ A;  4EDY A;  3GYK A;  5JPU A;  3H79 A;  1Q9E A;  2XPD A;  3I0Y A;  5ELG A;  4XDW A;  2JAD A;  4HOH A;  4ML1 A;  1RN1 A;  1RNB A;  1VF3 A;  1I3F A;  1GSP A;  1LOV A;  2P09 A;  1KEB A;  2FWE A;  2IFQ B;  1RMS A;  3IV4 A;  2H0H A;  5IO0 A;  3LML A;  1JZW A;  4BTX A;  3STD A;  4ZBD A;  1BUJ A;  1JLW A;  2Y74 A;  1HQO A;  2F8A A;  4FYC A;  1EQK A;  1FOH A;  3KCH A;  1DUG A;  5B7C A;  3JUN A;  1JJ2 2;  3GKN A;  3M0F A;  3D9R A;  4LZI A;  4YAV A;  3ZIJ A;  2B5Y A;  2QC7 A;  2GDR A;  4E8E A;  3D22 A;  3R2Q A;  1A2V A;  1RDS A;  2GVP A;  3GST A;  4GSN A;  3ER7 A;  3WHO A;  1HKX A;  3QFA C;  2PPT A;  4NV2 A;  2XPE A;  3EWL A;  4LLR A;  3H8Q A;  1TK5 B;  2NDO A;  1MGR A;  4PQH A;  3TKS A;  5IMZ A;  3HDC A;  4TN8 A;  4AGS A;  1T00 A;  4DKI A;  2B5E A;  4OMV A;  3WOD G;  4MJC A;  4L5O A;  2C4J A;  1USB A;  2OAC A;  5HR2 A;  2RM5 A;  4KW6 A;  3S9F A;  3D79 A;  3DM8 A;  3OXA A;  4EYC A;  3APQ A;  1ZZY A;  2VLT A;  1XWC A;  3NBJ A;  1VGL A;  3UL5 A;  1TP9 A;  4MCU A;  5IQY A;  2R4I A;  2L4V A;  1LU4 A;  5KN1 A;  3FLJ A;  4EC6 A;  1B2U A;  4KCA A;  2H30 A;  2H6Z A;  4KSM A;  3N5O A;  2F4Y A;  4HM0 B;  3OWS A;  2FD3 A;  4MPF A;  4GXZ A;  4ZBB A;  1G02 A;  3P8W A;  5D93 A;  1KQS 2;  5AYR B;  2JU5 A;  1XCC A;  4GF0 A;  1AY7 A;  3S27 A;  2WRT A;  3X3Y A;  1JB4 A;  2WDU A;  3KII A;  1QXH A;  3MIX A;  1DE3 A;  3QAV A;  3K5T A;  1M3I A;  3CQF A;  3CC2 3;  1JBR A;  1UVZ A;  5IEP A;  5IM9 A;  5D9T A;  5JWO B;  1VQQ A;  1BAO A;  4L8O A;  1XFL A;  3RHC A;  3ZIT A;  2X64 A;  1GY7 A;  2LQV A;  3WMD A;  2GSQ A;  3LWA A;  1K3Y A;  5AIV A;  3F8H A;  2KF4 A;  2C80 A;  1SU9 A;  3G4S 3;  2A2S A;  5D9X A;  3WOE B;  3UAP A;  2VL9 A;  3IRA A;  1TK8 B;  2DJ2 A;  4KND A;  2F9S A;  3EIN A;  2P5Q A;  5G30 A;  2GBX B;  1ABA A;  2GT5 A;  2CW9 A;  2FY6 A;  2W03 A;  3VWX A;  3MG2 A;  3EUR A;  2IFQ A;  2CWU A;  1JNQ A;  5DRV A;  5D73 A;  3MAK A;  1BU4 A;  3D5G A;  2VCX A;  4MF5 A;  1FVJ A;  3UBL A;  4X2O A;  2DMM A;  2QA1 A;  4LL4 B;  1G0T A;  4OFN A;  2XF3 A;  2VLU A;  3LT8 A;  2IMJ A;  22GS A;  5AIS A;  1Z6M A;  2KHP A;  4WXT A;  1TJD A;  3ZLP A;  2O7K A;  3GMF A;  2IME A;  1W02 A;  1Q98 A;  3LTD A;  6GSU A;  2AAE A;  4CPK A;  1SKW B;  3TRP A;  1OC9 B;  4I2U A;  1WMO A;  5ELU A;  2CFD A;  1IV7 A;  3SYU A;  1VQ8 3;  3EC3 A;  4O2H A;  4PQI A;  1GTB A;  5G1L A;  3LEF A;  3C1S A;  4IGJ A;  1FUT A;  3NIV A;  5LNK e;  2C3N A;  2DKH A;  1FAA A;  1PKW A;  3ZML A;  4G2E A;  5AYS C;  3BBY A;  2IMI A;  4IBP A;  1FZU A;  3I56 3;  5AI1 A;  2LKU A;  2K3D A;  3GKX A;  1GY5 A;  2GGT A;  1BRH A;  2QKE A;  5FHI A;  2P5R A;  4YAP A;  3FR3 A;  4G19 A;  5F0G A;  4PNG A;  1STD A;  3OX9 A;  3IOS A;  4HDE A;  2GS3 A;  4LSO A;  1SJI A;  4GTU A;  1B2Z A;  3QDN A;  5DRE A;  4JU5 A;  1TK0 B;  1Y4K A;  4ECC A;  5JPP A;  3E3E A;  5G5F A;  3ZRE A;  3KSP A;  4FYB A;  4I5Q A;  4CDO A;  2N5F A;  3I55 3;  1Z7P A;  2R41 A;  2H6Y A;  3Q1C A;  4EE0 A;  4ECB A;  3HII A;  1RHL A;  4IQA A;  1SIH A;  2L5O A;  1XBS A;  4F03 A;  1OHS A;  3LFL A;  5CP1 A;  3CXG A;  3DGM A;  5DAK B;  4TRX A;  5EL8 A;  1TXX A;  3CPO A;  2XBI A;  3LGC A;  4I8B A;  3CCV 3;  2PBJ A;  4ORL A;  2PUK C;  2CK3 H;  3CBU A;  4IS0 A;  2HRF A;  4K7I A;  2H1G A;  1M9G A;  1F9M A;  1PX6 A;  2YWI A;  2F51 A;  1SJW A;  1R4C A;  1ZYN A;  1VQ5 3;  1H75 A;  1SKS B;  2YP6 A;  1FW1 A;  2CZ3 A;  6GSV A;  4EV2 A;  2CFK A;  1QVF 2;  3ED3 A;  4HQZ A;  2BIR A;  2HMM B;  1OKD A;  1A8Y A;  1OGZ A;  3EHC A;  1IVW A;  4ZB8 A;  1TDI A;  1SKR B;  4K6X A;  1KSI A;  3VWU A;  4OWY A;  1VQP 3;  1LOW A;  4LYL B;  1YDK A;  1SII A;  2WOF A;  1XWG A;  1UCL A;  3QMX A;  1RTU A;  2KF3 A;  1UCI A;  1B9Y C;  2EIR A;  1JZR A;  3WD6 A;  2H6X A;  1X9W B;  2C3Q A;  4N0V A;  3GH6 A;  2XFS A;  1N5H A;  2O9U X;  3IJE B;  1OC9 A;  3VI7 A;  3U1W A;  1YJ6 A;  4MA9 A;  1B9X C;  3MG3 A;  4XBX A;  3CYN A;  4BA7 A;  2FXT A;  1G7O A;  4POM A;  4XCS A;  18GS A;  2H1D A;  3WOF B;  1X9S B;  2F8F A;  2K8S A;  2MMA A;  3H93 A;  3SBC A;  2XRX B;  4ZXG A;  3K9M C;  2O87 A;  3LQ7 A;  2ML6 A;  5G5E A;  4Z2T A;  2FWG A;  1M99 A;  2DJJ A;  4DVC A;  2JQ5 A;  1GOV A;  1UC7 A;  3UJ1 A;  2XHF A;  1T1V A;  1GMP A;  3NZN A;  4IJ3 A;  2NVL A;  5CK6 A;  3D21 A;  3MDK A;  4MH3 A;  3CMI A;  1BNI A;  1UGI A;  1IQY A;  4XS4 B;  2A2P A;  3WGE A;  4GL6 A;  2FA8 A;  1KC8 4;  3TCO A;  2YFL B;  5HFK A;  6GSP A;  4TR0 A;  2VIM A;  1CQH A;  2PN8 A;  1O7U A;  2GEY A;  3EBT A;  1Z1S A;  4RZM A;  1NO3 A;  2A4H A;  2Z6B A;  5DCG A;  5IW9 A;  1X5C A;  3A5W A;  5DAK A;  4FMC A;  3VLN A;  2LRN A;  2H75 A;  9GSS A;  1MDK A;  1IT8 A;  1K9M 4;  4DSQ A;  1OUN A;  2BU4 A;  1OE7 A;  1TU7 A;  2YZU A;  5B8A A;  2LRC A;  1V2A A;  4WBJ A;  4KE3 A;  2C10 A;  4EO3 A;  1DMQ A;  3VGN A;  2FHE A;  3WA3 A;  4I97 A;  3T0U A;  2H0I A;  2H0G A;  4K61 A;  1MGW A;  2WB9 A;  2YWO A;  1XOA A;  4K9Z A;  4NHW A;  1U87 A;  1GUH A;  1MWU A;  3RNT A;  4FCM A;  3F8U A;  4ULX A;  1SD8 A;  3LW9 A;  3G6E 3;  4NXI A;  4GB5 A;  3LOY A;  5E4W A;  1UCK A;  2IUJ A;  1TU8 A;  2K18 A;  2EIQ A;  1DVD A;  1UI7 A;  2UX0 A;  3VSY A;  1ERU A;  3FG3 A;  3K7C A;  1NSW A;  4EXR A;  1FGM A;  2E2T A;  4L8P A;  1GLQ A;  3F4T A;  3RAZ A;  1CEW I;  4OCF A;  2OE1 A;  1R5A A;  4PXO A;  4R9L A;  4KFD A;  5IO2 A;  1YNV X;  3C8E A;  5BVB A;  4DEJ A;  5G2Z A;  16GS A;  1W5Z A;  3A3T A;  5CYY A;  5HFG A;  2KAA A;  1X1Y A;  3GWR A;  3L0R A;  4OO4 A;  3DUK A;  9RNT A;  4LL1 B;  11GS A;  4N6U A;  4KDU A;  2HMK B;  2HML B;  2XSO B;  1VQM 3;  1SL1 B;  2KF6 A;  1BX9 A;  1WWJ A;  1EEM A;  3CD6 3;  4MJD A;  4EXJ A;  2GZZ A;  5F07 A;  3TKQ A;  1O73 A;  3DXO A;  2WZ9 A;  4ISD A;  4X0X A;  1GH2 A;  3GTU B;  3DGQ A;  4HSC X;  2HSY A;  1IVV A;  3WT2 A;  3JUO A;  4XS1 A;  5GSP A;  2O8V B;  3BJ5 A;  3IAS 2;  3APO A;  5IMA A;  4MH2 A;  4NWY A;  2I4A A;  4KH7 A;  1K0D A;  4HOJ A;  4J8T A;  2BO9 B;  1RK4 A;  2C11 A;  1Y6E A;  3ISO A;  2DJK A;  4XS4 A;  4GHO A;  5D96 A;  4OFM A;  4WBR D;  3A76 A;  4FIW A;  1I2E A;  4NHZ A;  1Q40 B;  3F9U A;  1BNS A;  2J8X B;  1U3I A;  2RM6 A;  1WMP A;  3HX8 A;  3QFB C;  3AGN A;  5G31 A;  3WT1 A;  4OCE A;  4MDC A;  4RI7 A;  4EIQ A;  5J9C A;  1OPY A;  1M90 4;  2I1U A;  3QPM A;  3TGZ A;  5INY A;  5CRW A;  1I0X A;  3DGO A;  2V1M A;  1M2D A;  3G7J A;  3EE1 A;  4IEL A;  4ZB9 A;  2CX4 A;  2KP2 A;  3CRT A;  2GST A;  1EG9 B;  2YWM A;  1FYS A;  3Q3F A;  1ZGX A;  5RNT A;  4ML6 A; 
#chains in the Genus database with same CATH homology
 5AIX A;  3RDW A;  2E2M A;  3L0H A;  4D73 B;  1GSE A;  2HLS A;  4GCI A;  4IVF A;  5ECM B;  4ZL7 A;  1ZOF A;  4HEA 2;  1X0R A;  2AUV A;  1XXU A;  1TRV A;  1V58 A;  2CV4 A;  3DRN A;  5DJM A;  3VI5 A;  2O85 A;  2V2G A;  3TJK A;  5J5N A;  5KN0 A;  1F37 A;  2LNT A;  3KEB A;  3G7I A;  3DML A;  4G0L A;  2E0Q A;  4AJ7 A;  2OAD A;  4FYU A;  4RI6 A;  4KB3 A;  1A0R P;  2LST A;  2HE3 A;  4O5R A;  3US3 A;  3IC4 A;  1ILO A;  3U5R E;  3CSJ A;  2OE0 A;  4MJA A;  4EL1 A;  4TR3 A;  12GS A;  4PUF C;  1MDJ A;  3KM6 A;  4O5Q A;  3FZA A;  4IQ1 A;  2IPA A;  3GIX A;  6GSX A;  3GTU A;  5F05 A;  4KAE A;  2DLX A;  3F4R A;  5IMF A;  4XIH A;  3IAM 2;  1SYX A;  1WMJ A;  3LXT A;  5A5K A;  3FR6 A;  1Z5Y E;  3J7Y k;  3PPU A;  4OD7 A;  5CNW A;  4MZB A;  2CAI A;  4WR5 A;  2K9F A;  4KSO A;  3ERF A;  3F4S A;  2OBI A;  5CRD A;  2YV9 A;  3HHV A;  2BTO T;  1ACV A;  4MLY A;  4PUR A;  2JL4 A;  3TJJ A;  1JZO A;  4F82 A;  1HD2 A;  2PGT A;  3PGT A;  1MTC A;  1M2A A;  3KTL A;  4OFT A;  3CSH A;  4XRD A;  3FW2 A;  1VF4 A;  3IBH A;  1PL1 A;  1EV4 A;  4CY8 A;  1FVK A;  4D73 A;  2YV7 A;  2JSY A;  1THX A;  3VWV A;  1CQG A;  2MMZ A;  5EPF A;  2LNS A;  3GRX A;  1EP8 A;  3PIN A;  6GSS A;  2E2G A;  4KDX A;  3FRC A;  1QMV A;  1F2E A;  2VO4 A;  1HNA A;  3GHA A;  2MMO A;  5DJL A;  1OC8 A;  2B1L A;  3KTB A;  3QCP A;  2GTU A;  4WET A;  2CAQ A;  2X99 A;  2DJ1 A;  3DVW A;  3LYP A;  1URM A;  1QGV A;  1A2L A;  5GAN D;  1SL0 B;  2LV3 A;  1EGO A;  5LCZ A;  2GSS A;  1XWB A;  1SEN A;  4YQM A;  3GH9 A;  1XW6 A;  2B7K A;  4IP1 A;  3TJF A;  3DIE A;  3N9J A;  1PL2 A;  1AQX A;  4HU9 A;  5IOW A;  3TOU A;  3WGX A;  1AW9 A;  1F3A A;  1YEP A;  1TRW A;  4AF2 A;  1JLV A;  1GNW A;  2X8G A;  5IMD A;  4K5S A;  1ERW A;  1G6W A;  1T7P B;  4MZC A;  2N5A A;  5B8B A;  3KCM A;  5B6N A;  4L0U A;  3KH7 A;  1AQV A;  3IR4 A;  3HVV A;  3HY2 A;  3GL5 A;  3FHK A;  3IPZ A;  1BED A;  3IXR A;  1GTI A;  4Q5R A;  3H1N A;  3I9V 2;  3QAG A;  3GKK A;  1EZK A;  5IPH A;  4G0I A;  2DML A;  2MBS A;  4TXO B;  1B48 A;  3F3R A;  3IHG A;  1J9B A;  2MBT A;  2AHE A;  2FWH A;  4BVX B;  1GRX A;  1EV9 A;  2L5L A;  2YJ7 A;  1M9A A;  3FEU A;  1U3A A;  1TRS A;  3KJY A;  5ECL B;  1A2M A;  2HXK A;  3KZQ A;  1YY7 A;  1O6J A;  1T4Z A;  4IN0 A;  1WOU A;  5C00 A;  4XRA A;  2HT9 A;  5KOW A;  1A0F A;  2IYJ A;  2P0G A;  1ZL9 A;  3QOU A;  1E2Y A;  1OYJ A;  2QA2 A;  5ID2 B;  2HRK A;  1NM3 A;  2R2J A;  2BMX A;  5EY6 A;  3ZL5 A;  3VPQ A;  4YQV A;  4HS1 A;  2L6D A;  1QQ2 A;  3IC8 A;  2PER A;  4L5L A;  1K3O A;  1DE1 A;  2CVK A;  1W89 A;  1DBY A;  4HQS A;  2K6V A;  4K0N A;  4RUV A;  2L59 A;  3GX0 A;  5A4V A;  4EF0 A;  5ECK B;  2Z9S A;  2R0G A;  1FG4 A;  2HZE B;  5A4W A;  2YNX A;  3M1G A;  4I2T A;  2FWF A;  2H74 A;  1DE2 A;  1ERV A;  3KP9 A;  4Z2U A;  1WRY A;  3DXB A;  3A5I A;  1VF1 A;  1TRU A;  2HSM A;  1K0O A;  3FZ9 A;  4ECJ A;  4TKY A;  3TKS E;  2AYT A;  4X43 A;  4GQC A;  4MMM A;  2GQM A;  1K3L A;  5E59 A;  5HR3 A;  3E0U A;  3AY8 A;  3KMN A;  3M9K A;  4YKG A;  1HNC A;  1XW5 A;  2HI7 A;  3J7Y b;  3GNJ A;  4TXO A;  2MZC A;  5BRT A;  3HD5 A;  4BVX A;  1OC3 A;  1I5G A;  2C0D A;  1S3A A;  4JZQ A;  2G0F A;  4PUA A;  2WCI A;  17GS A;  4CW9 A;  3H4K A;  3F6F A;  4K1F A;  1AAZ A;  1K0N A;  4IHU A;  1U88 A;  2X49 A;  2YWN A;  3UMA A;  1A23 A;  3A2W A;  1BAY A;  2CX3 A;  2VM1 A;  3TRX A;  1PA3 A;  4MJB A;  2ON5 A;  3C73 A;  5ID2 A;  4GQF A;  3UL3 A;  2B7J A;  2REM A;  5J3R A;  3FKF A;  4MNN A;  2GZY A;  3HVX A;  5JWQ B;  2FLS A;  5D9W A;  5D8I A;  1GSQ A;  3F3Q A;  5JWR B;  1B4Q A;  4N30 A;  1JFU A;  2PVO C;  5HR0 A;  2IWT A;  3GKM A;  1KTE A;  3I43 A;  3CSI A;  4HU7 A;  3EVI A;  6GSW A;  3U6V A;  4O7H A;  3UBK A;  3FYG A;  4JE1 A;  4NAX A;  4TR4 A;  1GUK A;  3D6I A;  3DEX A;  3BOA A;  4TOP A;  1FO5 A;  2OJL A;  2HZE A;  3HJM A;  1T8E B;  3KXO A;  4V1A p;  1W4V A;  4KX4 A;  1MEK A;  4PGT A;  2P31 A;  5FT3 A;  3EU4 A;  3VFI A;  3VUR A;  2IIY A;  4FO5 A;  5DVB A;  5ECS A;  2R0P A;  3V1W A;  4TW5 A;  5LD0 A;  2C8U A;  5HFI A;  4GRF A;  4BL7 B;  1WJK A;  4FQU A;  2HNL A;  3F0I A;  3TKR A;  4J2F A;  4Q5N A;  4K2X A;  4H86 A;  8GSS A;  3D4T A;  1WIK A;  2MMN A;  3HZ4 A;  2I9H A;  3TJG A;  2RUF A;  1IYH A;  4KGI A;  2LJK A;  2IMF A;  2YZH A;  2LS5 A;  2GQL A;  1R4W A;  4IW9 A;  1YKA A;  1BQ7 A;  2KOK A;  1S3C A;  3FZ5 A;  3HJP A;  5ECR B;  4ZB6 A;  3UIW A;  3ZZX A;  3RPN A;  4HUA A;  1ZCP A;  1FB6 A;  2MYG A;  3ZTL A;  3FZ4 A;  3IDV A;  4ZIJ A;  1Q4J A;  4Q5F A;  3QR6 A;  5FWG A;  5KOX A;  1G7E A;  4X1U A;  3L9S A;  2AAW A;  1M0U A;  2VD0 A;  2ZNM A;  3M9J A;  3O3T A;  5ELA A;  1PGT A;  2IN3 A;  4MF7 A;  5J4U A;  14GS A;  2ZUP A;  1YEX A;  1B8X A;  1AC1 A;  2NBS A;  4WF5 A;  2GSR A;  3IE3 A;  1Y25 A;  3LYK A;  2VL2 C;  1V40 A;  5F06 A;  4PQ1 A;  1XPV A;  3KP8 A;  3APS A;  1K0C A;  1NW2 A;  2DSA A;  2RUE A;  5L71 A;  1E6B A;  1PRX A;  1G6Y A;  1NHY A;  4BL7 A;  4P3Y B;  1Z3E A;  4V2N A;  2FA4 A;  2JAC A;  3BCI A;  4K5R A;  3EMP A;  3P7X A;  1ZYE A;  5DDL A;  2M80 A;  3BCK A;  3KD0 A;  3A2X A;  2C0G A;  3PH9 A;  1OE8 A;  2LRT A;  2RII A;  5ECN B;  20GS A;  3KH9 A;  3TDG A;  1TW9 A;  4QL9 A;  2CVB A;  3WGD A;  3GV1 A;  1GTU A;  5GAP D;  3ERG A;  4ICY A;  4JED A;  2CT6 A;  4JRR A;  1V98 A;  1AUC A;  3L78 A;  4EIP A;  3K8N A;  1XWA A;  3A2V A;  3BD2 A;  4EDZ A;  2GZP A;  4ACS A;  2TRX A;  1X5E A;  4O92 A;  3GFK A;  5DQY A;  4XTS A;  3UOM A;  4MK3 A;  2HRA A;  4LMW A;  1BJX A;  1PSQ A;  3VWW A;  1SK0 A;  5CRE A;  4EUY A;  5HR1 A;  3MNG A;  6GST A;  2CVD A;  1PKZ A;  2GQK A;  4HJM A;  5AGY A;  2FUG 2;  2IL3 A;  4CHS A;  4O5U A;  2RLI A;  2ZCT A;  1O8W A;  2FCH A;  2IJY A;  2K8V A;  4TVE A;  3EPT A;  4EKZ A;  3TB2 A;  1A24 A;  2HYX A;  1I9D A;  3DWV A;  2B5X A;  5CRG A;  5B6M A;  2WJU A;  2DIY A;  2YCD A;  3CTG A;  1XWK A;  1S3D A;  3GUR A;  2G2Q A;  2VCV A;  4MZW A;  1ERT A;  3HZ8 A;  1PN9 A;  1ST9 A;  1ZYP A;  1Z6N A;  4RQR A;  3UVT A;  3HA9 A;  2LJR A;  4EVM A;  2VOC A;  3GX8 A;  3C1R A;  5ECP B;  2OBK A;  2N5B A;  3D0Z A;  5GSS A;  3IK9 A;  4A5P A;  2E7P A;  2LQQ A;  4GSS A;  1GSY A;  2H66 A;  3LG6 A;  5ECQ B;  3GL3 A;  4BWS A;  4O32 A;  4F0C A;  2D2Z A;  2PVQ A;  5CRH A;  1J0F A;  4K7N A;  3P2A A;  4TR1 B;  2NTO A;  1M9B A;  1QFN A;  2XBQ A;  6GSY A;  1GNE A;  2M46 A;  4POK A;  3IHQ A;  5EVO A;  3EE2 A;  2DKI A;  4OO5 A;  3O76 A;  2ON7 A;  1NHO A;  4RQX A;  4ECI A;  2C0E A;  3QD9 A;  4BVY B;  1PX7 A;  10GS A;  2ES7 A;  3LOR A;  4GST A;  5CO3 A;  3L9V A;  4KUN A;  1TKD B;  4HJ2 A;  5AN1 A;  4K2D A;  2PU9 C;  1PD2 1;  1PMT A;  2V32 A;  2IMK A;  3OR5 A;  4WR4 A;  5F8B A;  1TOF A;  1AXD A;  5ECH B;  4CY6 A;  4KCE A;  2F3M A;  1SL2 B;  13GS A;  3RBT A;  2I3Y A;  4WF4 A;  2BJX A;  2YOI A;  5KN2 A;  19GS A;  4E8H A;  4F0B A;  1M7T A;  3RHB A;  1MD3 A;  2GLR A;  7GSS A;  3JCM L;  3G9B A;  2VM2 A;  1BG5 A;  1UA5 A;  3HCZ A;  4QL7 A;  4K7O A;  2OKA A;  2R37 A;  4MF6 A;  1TI1 A;  3CTF A;  4XHM A;  3TRQ A;  4G0K A;  1Z9H A;  4ZBA A;  2YAN A;  3M8N A;  1H4O A;  4MJE A;  1MDI A;  1THO A;  3KMO A;  5DAL B;  3Q19 A;  1ML6 A;  4IJI A;  1JZD A;  1OKT A;  1SYR A;  3IK7 A;  5IMV A;  4V2L A;  1Z7R A;  1EEJ A;  1LBK A;  3UAR A;  3M3M A;  4TR1 A;  4J56 E;  1ZYQ B;  3VPT A;  1OVN A;  3HXS A;  5KN3 A;  3Q6O A;  4NV5 A;  4PX1 A;  2JZR A;  2HRN A;  2H76 A;  2VL2 A;  1JHB A;  2LUS A;  4LA1 A;  1EWX A;  2H1B A;  1XZO A;  3ME8 A;  2A2R A;  2VD1 A;  1GLP A;  3VK9 A;  1QUW A;  4IKH A;  5CAX A;  1C72 A;  1O81 A;  1MD4 A;  2PMT A;  1QK8 A;  2XC2 A;  2X4A A;  2GT6 A;  1RW1 A;  3ZRD A;  1UN2 A;  4N0Z A;  1VRS D;  4BVY A;  2H01 A;  4PTS A;  2VCW A;  2YN1 A;  4ID0 A;  2QSI A;  3KGK A;  5J9B A;  3MYD A;  3LXZ A;  3E9J B;  5IOX A;  1YQ1 A;  4HZ4 A;  3TJB A;  4Z7X A;  3KIJ A;  2I81 A;  4QQ7 A;  1PN0 A;  2R4V A;  3FK8 A;  5GST A;  2DIZ A;  2X8H A;  4K8M A;  2LQO A;  1TI3 A;  1GUL A;  1R26 A;  2FGX A;  4ZIL A;  3I6A A;  3F63 A;  3L9U A;  2AJQ B;  2C1Y A;  3C71 A;  5IPG A;  3UEM A;  1GSS A;  1KNG A;  4L8E A;  2CQ9 A;  1GSF A;  4XS6 A;  4ILF A;  1EOH A;  2DBC A;  3GSS A;  3QAW A;  3O6T A;  1O85 A;  4MAB A;  1GSU A;  3W8J A;  2QGV A;  3L4N A;  2R3X A;  1XVW A;  3EYT A;  3FY7 A;  2C3T A;  1T3B A;  4KF9 A;  4J57 E;  2VLV A;  4WEY A;  2YJH A;  3HJO A;  4HI7 A;  5DAL A;  2V41 A;  4HZ2 A;  3MSZ A;  5D9V A;  4MP4 A;  2B6M A;  5COH A;  1GP1 A;  5H5S A;  2R0C A;  3DVX A;  1R5P A;  2L4C A;  2VL3 A;  2J9H A;  4Q5Q A;  1DSB A;  2H72 A;  3TKS C;  3ERW A;  2H73 A;  2OA7 A;  4ZL9 A;  5ECI B;  3W6G A;  4JBB A;  3SWL A;  4V2M A;  2JZT A;  3ZFB A;  3ZFL A;  2ALB A;  1WP0 A;  2C0F A;  4AJ6 A;  1K0A A;  2UZ8 A;  1SJ6 A;  2LJA A;  3EMX A;  5ABR A;  2DC5 A;  1HNB A;  1XW9 A;  4MPG A;  4NMU A;  2CZ2 A;  4GLT A;  2JZS A;  5IMC A;  2IY2 A;  4BPY A;  1GWC A;  4EC0 A;  5HQP A;  5ENU A;  1O8X A;  4DSS B;  2R5G A;  4IP6 A;  4N10 A;  3TOT A;  2LTK A;  5DCH A;  1OAZ A;  2FNO A;  4G10 A;  2TRC P;  5A4U A;  3G7Y A;  1XVQ A;  1YF1 A;  3ZYW A;  1AIU A;  4Z2R A;  3GN3 A;  1LJR A;  4KA0 A;  5JCG A;  4F2I A;  1XOB A;  1SK2 A;  1F3B A;  2R6K A;  2B1K A;  2PWJ A;  4N11 A;  1IYI A;  1RQM A;  5JCU A;  4I6X A;  2HSH A;  3C7M A;  3D5J A;  5H5R A;  3FMW A;  1FOV A;  2HZF A;  2KUC A;  4USS A;  2CA8 A;  4L0W A;  5JCW A;  4YQU A;  4TXV A;  1PQN A;  2VUP A;  1ZGN A;  3IA1 A;  3P90 A;  3Q18 A;  2O89 A;  1VF2 A;  2LEG A;  1GUM A;  3CRU A;  4DSR A;  1SJZ A;  3DYR A;  3NOF A;  2IMD A;  4V1A g;  3EU3 A;  4JR4 A;  2WGR A;  2JSZ A;  3HYP A;  4KDY A;  2NPB A;  3GA4 A;  1GSD A;  2X8C A;  2KP1 A;  2H8L A;  3HVS A;  2HFD A;  3ME7 A;  3TKP A;  1FB0 A;  1K0B A;  5GZZ B;  1AQW A;  5KEJ A;  1SK1 A;  4K0G A;  3UVH A;  4X4J A;  1EP7 A;  1GTA A;  2H19 A;  2L6C A;  3GUS A;  1KBN A;  2M72 A;  5IIZ A;  3PR8 A;  1HYU A;  3F6D A;  2EC4 A;  3ZVJ A;  4F9Z A;  1GL8 A;  1V9W A;  4DSS A;  1ON4 A;  2A4V A;  1K0M A;  4YH2 A;  5DQS A;  2J23 A;  1BYE A;  4LMV A;  2V6K A;  5C04 A;  2AV4 A;  4ZL8 A;  4AJ8 A;  3LSZ A;  3Q74 A;  2VAF A;  2KLX A;  1X5D A;  3ZMK A;  3RPP A;  2WS2 A;  1X9M B;  1N8J A;  1A8L A;  2V6O A;  3W8S A;  4GWR A;  1N2A A;  1FHE A;  3LJR A;  1A2J A;  1T4Y A;  5H5Q A;  5DBQ A;  3ZIV A;  4NPB A;  2WUL A;  2H70 A;  2DJ0 A;  4WKW A;  4G9H A;  1M2B A;  3FR9 A;  3I69 A;  4POB A;  1R7H A;  4YKF A;  4POL A;  2OE3 A;  1SD9 A;  2EIO A;  1B4P A;  2H71 A;  1U6T A;  2AB6 A;  1YZX A;  4PNF A;  5J41 A;  5G1K A;  1WE0 A;  4JR6 A;  1EOG A;  1YKC A;  5BMU A;  1WPI A;  2WFC A;  1ZMA A;  2DJ3 A;  1XIY A;  1YF0 A;  3R3E A;  2L57 A;  2VCT A;  3ZVJ D;  3DD3 A;  1TTZ A;  2VCQ A;  1F6M C;  2L4Q A;  3WYW A;  1J08 A;  1EGR A;  2B3S A;  4FH8 A;  1V57 A;  3D4M A;  3MWH A;  3DKS A;  2TIR A;  2YPM A;  3HKR A;  2H1A A;  2VCZ A;  3TUE A;  4BWQ A;  4EDY A;  3GYK A;  3H79 A;  2XPD A;  5ELG A;  2JAD A;  4ML1 A;  1VF3 A;  1KEB A;  2FWE A;  2IFQ B;  3IV4 A;  2H0H A;  5IO0 A;  1JZW A;  4ZBD A;  1JLW A;  1HQO A;  2F8A A;  4FYC A;  1FOH A;  1DUG A;  5B7C A;  3GKN A;  3M0F A;  4YAV A;  3ZIJ A;  2B5Y A;  2QC7 A;  2GDR A;  4E8E A;  3D22 A;  3R2Q A;  2GVP A;  3GST A;  4GSN A;  3QFA C;  2PPT A;  4NV2 A;  2XPE A;  3EWL A;  4LLR A;  3H8Q A;  1TK5 B;  2NDO A;  4PQH A;  3TKS A;  5IMZ A;  3HDC A;  4TN8 A;  4AGS A;  1T00 A;  2B5E A;  4OMV A;  4MJC A;  4L5O A;  2C4J A;  1USB A;  2OAC A;  5HR2 A;  2RM5 A;  4KW6 A;  3S9F A;  3APQ A;  1ZZY A;  2VLT A;  1XWC A;  1VGL A;  1TP9 A;  4MCU A;  5IQY A;  1LU4 A;  5KN1 A;  4KCA A;  2H30 A;  2H6Z A;  4KSM A;  3N5O A;  2FD3 A;  4MPF A;  4ZBB A;  4GXZ A;  3P8W A;  5D93 A;  2JU5 A;  1XCC A;  4GF0 A;  2WRT A;  2WDU A;  1QXH A;  3MIX A;  3QAV A;  1UVZ A;  5IM9 A;  5D9T A;  5JWO B;  1XFL A;  3RHC A;  3ZIT A;  2X64 A;  2GSQ A;  3LWA A;  1K3Y A;  5AIV A;  2C80 A;  1SU9 A;  2A2S A;  5D9X A;  3UAP A;  2VL9 A;  3IRA A;  1TK8 B;  2DJ2 A;  4KND A;  2F9S A;  3EIN A;  2P5Q A;  5G30 A;  1ABA A;  2GT5 A;  2FY6 A;  3VWX A;  3EUR A;  2IFQ A;  5D73 A;  3MAK A;  4MF5 A;  2VCX A;  1FVJ A;  3UBL A;  2DMM A;  2QA1 A;  4LL4 B;  1G0T A;  4OFN A;  2VLU A;  22GS A;  5AIS A;  1Z6M A;  2KHP A;  4WXT A;  1TJD A;  3ZLP A;  2O7K A;  3GMF A;  2IME A;  1Q98 A;  6GSU A;  1SKW B;  3TRP A;  1OC9 B;  4I2U A;  3EC3 A;  4PQI A;  1GTB A;  5G1L A;  3LEF A;  3C1S A;  4IGJ A;  3NIV A;  5LNK e;  2C3N A;  2DKH A;  1FAA A;  1PKW A;  3ZML A;  4G2E A;  3BBY A;  2IMI A;  4IBP A;  2LKU A;  3GKX A;  2GGT A;  5FHI A;  2QKE A;  2P5R A;  4YAP A;  3FR3 A;  4G19 A;  5F0G A;  4PNG A;  3IOS A;  4HDE A;  2GS3 A;  1SJI A;  4GTU A;  3QDN A;  4JU5 A;  1TK0 B;  4ECC A;  3E3E A;  5G5F A;  3ZRE A;  4FYB A;  4I5Q A;  4CDO A;  2N5F A;  1Z7P A;  2H6Y A;  4EE0 A;  4ECB A;  4IQA A;  2L5O A;  1XBS A;  4F03 A;  3LFL A;  5CP1 A;  3CXG A;  5DAK B;  4TRX A;  5EL8 A;  1TXX A;  2XBI A;  3LGC A;  4I8B A;  2PBJ A;  2PUK C;  3CBU A;  4IS0 A;  2HRF A;  4K7I A;  2H1G A;  1PX6 A;  1F9M A;  2YWI A;  2F51 A;  1ZYN A;  1H75 A;  1SKS B;  2YP6 A;  1FW1 A;  2CZ3 A;  6GSV A;  4HQZ A;  3ED3 A;  1OKD A;  1A8Y A;  4ZB8 A;  1TDI A;  1SKR B;  4K6X A;  3VWU A;  4OWY A;  1YDK A;  1XWG A;  3QMX A;  1B9Y C;  2EIR A;  1JZR A;  3WD6 A;  2H6X A;  1X9W B;  2C3Q A;  4N0V A;  3GH6 A;  1OC9 A;  3VI7 A;  1YJ6 A;  4MA9 A;  1B9X C;  3CYN A;  4BA7 A;  1G7O A;  4POM A;  4XCS A;  18GS A;  2H1D A;  1X9S B;  2F8F A;  2K8S A;  2MMA A;  3H93 A;  3SBC A;  4ZXG A;  3LQ7 A;  2O87 A;  5G5E A;  4Z2T A;  2FWG A;  1M99 A;  2DJJ A;  4DVC A;  1UC7 A;  3UJ1 A;  2XHF A;  1T1V A;  3NZN A;  4IJ3 A;  2NVL A;  3D21 A;  3MDK A;  4MH3 A;  3CMI A;  4XS4 B;  2A2P A;  3WGE A;  2FA8 A;  3TCO A;  5HFK A;  4TR0 A;  2VIM A;  1CQH A;  2PN8 A;  1O7U A;  2A4H A;  5DCG A;  1X5C A;  3A5W A;  5DAK A;  3VLN A;  2LRN A;  2H75 A;  9GSS A;  1MDK A;  4DSQ A;  1TU7 A;  1OE7 A;  2YZU A;  5B8A A;  2LRC A;  1V2A A;  4WBJ A;  4KE3 A;  4EO3 A;  2FHE A;  4I97 A;  2H0I A;  2H0G A;  2WB9 A;  2YWO A;  1XOA A;  4K9Z A;  4NHW A;  1U87 A;  1GUH A;  3F8U A;  4ULX A;  1SD8 A;  3LW9 A;  4NXI A;  5E4W A;  1TU8 A;  2K18 A;  2EIQ A;  1ERU A;  1NSW A;  1GLQ A;  3F4T A;  3RAZ A;  4OCF A;  2OE1 A;  1R5A A;  4PXO A;  5IO2 A;  3C8E A;  4DEJ A;  5G2Z A;  16GS A;  3A3T A;  5CYY A;  5HFG A;  4OO4 A;  4LL1 B;  11GS A;  4KDU A;  1SL1 B;  1BX9 A;  1WWJ A;  1EEM A;  4EXJ A;  2GZZ A;  5F07 A;  3TKQ A;  1O73 A;  2WZ9 A;  4ISD A;  4X0X A;  1GH2 A;  3GTU B;  3DGQ A;  2HSY A;  3WT2 A;  4XS1 A;  2O8V B;  3BJ5 A;  3IAS 2;  3APO A;  5IMA A;  4MH2 A;  4NWY A;  2I4A A;  4KH7 A;  1K0D A;  4HOJ A;  1RK4 A;  1Y6E A;  3ISO A;  2DJK A;  4XS4 A;  5D96 A;  4OFM A;  4WBR D;  4FIW A;  4NHZ A;  3F9U A;  1U3I A;  2RM6 A;  3QFB C;  3WT1 A;  5G31 A;  4OCE A;  4MDC A;  4RI7 A;  4EIQ A;  5J9C A;  2I1U A;  3QPM A;  3TGZ A;  5INY A;  5CRW A;  2V1M A;  1M2D A;  3G7J A;  4IEL A;  4ZB9 A;  2CX4 A;  2KP2 A;  3CRT A;  2GST A;  2YWM A;  5ECO B;  4ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...