1KD14

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kd1400
2OTL3 3CC73 3CMA3 2QA43 1K734 1VQ83 2OTJ3 1Q814 1VQP3 1VQN3 1VQK3 1NJI4 1QVF2 3CD63 3G4S3 3CXC2 3I563 1S723 1VQ93 1YIJ3 1Q864 1M904 3CCS3 3CME3 3CCR3 1JJ22 3G6E3 2QEX3 1VQM3 1M1K4 3CC43 1YIT3 1YJ93 1KC84 1K8A4 1YHQ3 3CCM3 1VQL3 3CC23 1QVG2 3I553 3CCU3 3G713 3CCL3 3CCJ3 1Q824 1VQ63 1YI23 1VQ73 1YJN3 1N8R4 1K9M4 3CCV3 1VQ53 1W2B2 1VQO3 1VQ43 1KD14 1YJW3 3CPW2 3CCQ3 3CCE3 1KQS2 3OW22 1Q7Y4
chains in the Genus database with same CATH superfamily
2WOHA 5G1KA 1HU9A 2KAAA 1RCLA 5HGRA 2SARA 1FUSA 1IV9A 2HMNB 4EW5A 3F14A 5DREA 2FNQA 3G4S3 5BIRA 1EQKA 1W6YA 2K3DA 1MWTA 2R41A 5CK6A 1EKMA 1STFI 4OVMA 4GB5A 2CIUA 1M1XB 2CX1A 3KSPA 2BHMA 4RZMA 1N9EA 2XFSA 3RNTA 1YHQ3 2M7OA 2XSOB 2CW9A 4FR9A 1QVG2 1IQ8A 1IYYA 3FLJA 3IJEB 3Q2PA 2CX0A 3V92A 4I4KA 4J8TA 1UCKA 1ULJB 2CG0A 1D6UA 1K28A 4HAAA 3STDA 2I9WA 2H0HA 2IA7A 3NHXA 5GSPA 1JZOA 4MEIA 3CC73 1T2IA 3F9SA 4HM1B 4N6V0 1Q814 5JBSA 3BNBA 4HVNA 2IUKA 4FMBA 5G2GA 1IVXA 3BU4A 5AIGA 3BLZA 3F7SA 3Q3FA 1W5ZA 2KRTA 1CYVA 2V1LA 2WOFA 3S27A 3WOFB 3WODG 1M1K4 1BAOA 4ILFA 1YJ93 1BUJA 3K7CA 5ELUA 4ZM8A 4J5KA 1TRPA 1BRSA 1FZUA 3AMOA 1IT7A 3ALAA 4PEJA 5IERA 1BNGA 4NREA 4KZ1A 1JNQA 1V74A 3SX1A 1NB5I 1O7WB 1I2FA 2KF3A 5AYSC 2XSHB 1V58A 3T8UA 3CPW2 3DGYA 3BB9A 3WDGB 1K734 4NHFA 1AV4A 1W01A 1LVNA 3FZWA 4XBXA 3UNLA 1RJOA 1ASKA 3HIGA 3NBRA 1RGEA 3VGNA 1C7HA 1RGCA 2F98A 4R4KA 3MWZA 5M1AA 1PYLA 2Y73A 1AVKA 5HOHA 3IPTA 3SVAA 1MWSA 2XGNA 2QGUA 3CCL3 2Q07A 5AIFA 1B2UA 1VQ63 1ZS7A 3OX9A 3WHOA 1GY6A 1JB4A 1YGEA 3D5GA 3KIIA 3LMLA 3WR2A 5CF1A 2RSXA 1FYSA 4AEQA 5KP4A 3T0UA 2GU3A 1RKYA 3B4OA 2OTL3 1BNFA 1OPYA 3ER7A 5IG0A 3ZG0A 4XBYA 2OQEA 3ECFA 1QAFA 3S28A 3EJVA 5IG5A 3KCHA 1A67A 1NNVA 1S723 1BIRA 2CC3A 1RCKA 1UCLA 3NV0A 1IVVA 2FGTA 4LSOA 3D79A 1AQZA 3A76A 2L1SA 3UJMA 3BNDA 3NUVA 1B2MA 3CCM3 2AADA 4X2HA 2BMRB 1GOUA 3K0ZA 3DY5A 3UB1A 3RGAA 3O8YA 3X41A 1IQYA 1M9GA 1TP6A 3EB8A 3GWRA 1UDII 3SEDA 1US1A 1W6GA 1K9M4 2WGQA 2ZA4A 3GZXB 5AEUB 3CNMA 1N9JA 1SARA 5IF6A 2OTJ3 3DH2A 2QA43 3DXOA 1HKXA 1AVLA 5M18A 1KWIA 3HX8A 4H61A 3LT9A 1A2VA 3G16A 3NQZA 4X2OA 3CCS3 4FCMA 1R4YA 2OCTA 2XFTA 3JUPA 1Q9EA 3GZYB 4G1MB 3X3YA 2C11A 2BIRA 4HM2B 2O3OA 5AIIA 1R4CA 3LH4A 1E3VA 1OCVA 1Q40A 1OGZA 2LYXA 1SIHA 3MKIA 4RNZA 3S29A 4BL2A 4EBGA 1GMRA 1IVWA 4EC6A 1RDSA 1AY7A 1WMNA 2KF5A 1IVUA 3PYJA 1MOLA 5EVHA 2MC8A 1J2BA 3WA3A 1JKGA 1W02A 1W4NA 2HOHA 3K9MC 1RTUA 3TDGA 1KD14 1RRHA 4R1KA 2HMKB 2Z76A 3H3HA 3GRDA 4CPKA 2WGOA 1IQXA 1IU7A 2ZHXB 4HYZA 4O3VA 5IG4A 3JUNA 1I70A 5ELJA 2JDIH 3D4AA 1BANA 2PZVA 5D81A 4BIRA 2F4YA 3MHEA 8RNTA 3CCR3 3U97A 1JJ22 2E2UA 2ML6A 1EEJA 3QK9A 4JRFA 2QEX3 3PS8A 1NB3I 3CC43 2GEYA 3N9HA 1SJWA 3EN8A 1LOYA 3I0YA 3UL6A 2CWVA 2P38A 2Z6BA 1JZDA 2CHCA 1RGFA 1RGAA 1UI8A 1N8R4 5AI1A 1AR0A 3NXJA 3JUMA 2GU1A 1OACA 5AEWB 1CH0A 4N6LA 3GSPA 5KP1A 5IENA 3CMA3 3DZLA 2BMOB 3FCSB 2CWTA 4JF8A 5G1LA 5IW9A 1OH0A 4Q53A 1CQSA 1YGWA 3CD63 3OV4A 5STDA 2CFKA 1B2ZA 2CKFB 3CXC2 1RSNA 2XH9A 2F99A 1C54A 1RNBA 1JBRA 3AHSA 1L5GB 1EA2A 1E3RA 3SYUA 1ZGXA 2Y74A 1V57A 1N5PA 2ZDJA 4J5GA 2OOVC 1RGLA 1B2SA 1VQ73 3H51A 1NO3A 4HZ9B 5D82A 2W9PA 3CCV3 2XRXB 5D83A 2IY2A 1YJW3 2C4BA 4IIAA 1FGRA 1QMAA 2GXFA 1RHLA 1X1UA 3EBTA 2MF7A 1FGTA 2PNCA 2BNGA 1X1YA 1ROAA 2R4IA 3MG3A 1OHSA 4GSPA 3LYGA 4MMYB 1NJI4 3I563 3FSDA 1Y4KA 4QWTA 1GOVA 2HMJB 4DKIA 1RGHA 1I3FA 3EE1A 1DETA 3KFQC 3LZAA 4HM8B 4L8OA 4RNYA 3ZFZA 1BRJA 1JN5B 3AGNA 1MGWA 4BTWA 4EXRA 2CH9A 1UI7A 2JQ5A 3V99A 1VQL3 3RGRA 2CFLA 3NX0A 2KXGA 1GY5A 1B21A 3OWSA 3CCJ3 2UUGC 2SBLA 1SPUA 1TTOA 1WQLB 2CFWA 2E2TA 1O7HB 3CNXA 4BU4A 3OWYA 3WOEB 1T3BA 1UGHI 4O02B 3VSYA 2CWUA 4H3UA 1GY7A 3EQQB 3X3XA 2RCDA 4R9LA 5CLKA 5CF2A 3CCQ3 1KQS2 1U5OA 1HZ1A 1QAKA 1VQQA 1G96A 2XEPA 3MG1A 4HM5B 4EV2A 1WMPA 3N8BA 2F56A 4U13A 3L0RA 1W2ZA 5A0OB 3KN4A 2YX9A 2F86B 2CK3H 4NPBA 1BNJA 1BRIA 1MNLA 1JB2A 3S5CA 4J9AA 4R80A 2P09A 3DGLA 1YVSA 4HM0B 1PFPA 1JB5A 1I0VA 3FH1A 4O8SA 1CEWI 1I8VA 1U8CB 5AYRB 2D1WA 3LT8A 1YI23 1LOXA 1BSEA 2QIYA 1LQGC 4WWUC 1RMSA 3DGOA 4KT3B 3GAXA 3LXUX 1VQO3 3FF2A 3J7Yd 1OGXA 7RNTA 1I0XA 3AHWA 1O7MB 1JV2B 4L7KA 1GMPA 3SOAA 3Q1CA 3WMDA 1VQK3 1VQN3 3EF8A 5LC6A 1BSDA 3DGMA 2CFDA 1FGMA 1RGKA 1BOXA 3NBJA 4HM3B 4KFEA 4HBRA 3HIIA 3CME3 3OWUA 1W00A 5I97A 1YIT3 1N5HA 1RN4A 6RNTA 1GD3A 3EX9A 2IUJA 4IT7A 4MJDA 5LC7A 2IMJA 4N6OB 3SLUA 2BT3A 1I2EA 1GSPA 4XBTA 4O2HA 2O9UX 5EQLA 3K63A 4BTYA 1N8QA 1WNHA 1UW1A 4RNTA 1RN7A 1Z1SA 1FUWA 2STDA 4XDWA 3LTCA 1A90A 1IDPA 1UCIA 1JBSA 2RFRA 1TRQA 4WHAA 5IEOA 1X1XA 3VF1A 3EBYA 1BRNL 1YNVX 3ROBA 2YFLB 1VQM3 4FMDA 9RNTA 2CFGA 1JKGB 2AAEA 2GBXB 1B27A 2K54A 3KZTA 4K90B 1BRGA 4OUQA 2RGQA 1LNIA 4KVHA 4LMIA 1PY3A 1LXEA 3BNCA 2E2VA 2W56B 1DVDA 2WO0A 2H0GA 5CXOA 1TU5A 1G02A 2IYJA 3NM7A 1STDA 1JRQA 3F7XA 3LTDA 4LEHA 7STDA 1BSCA 2A15A 5BXQA 1F8NA 5JPPA 4HM7B 1VQ53 3WA2X 3G0KA 1VQ43 3NM2A 4HKVB 3OW22 1EUIC 1X1WA 3MPHA 3D9RA 3X3ZA 4MMZB 1B20A 3M8CA 2B1XB 3LTBA 2F5WA 2W9QA 1NU3A 4LYLB 3BNEA 3EN1B 4N6MA 2P0MA 1BGSA 3F8HA 4K1UA 1BSAA 3G6E3 1FUTA 3SOYA 1OHPA 1KC84 2W2CA 3FG3A 1K8A4 1WTHA 1LOVA 4HOHA 4FMAA 3NQYA 1LOWA 3X40A 3CC23 1E97A 4LGQA 1Q7HA 3G713 3CPOA 3PCRA 1BNIA 1TUHA 3HZPA 5EEOA 1ZX2A 1OUNA 2GEXA 1D6YA 6GSPA 3DMCA 1DMNA 4XB5A 1TIJA 1RLSA 3JVCA 5IEPA 3PZWA 4N3VA 8CHOA 3V98A 3URPA 1Q7Y4 1BNEA 5RNTA 1GYBA 2BU4A 3GZRA 1BUQA 2GSPA 5KP3A 1BVIA 4N6UA 4L8PA 5BU4A 1ROVA 3S67A 3HI7A 1I3IA 3MYTA 4FMCA 3HOHA 4GHOA 2K0MA 2LQVA 3RDEA 1TFKA 1RGGA 2H0IA 5JPUA 1JN5A 1LNHA 2ZL8A 3KE7A 2W0QA 4HM4B 1RRLA 3N54B 4N6NB 1RNTA 1GD4A 3GZBA 3MG2A 3JUOA 3AMOB 3CCU3 3CU3A 4I5QA 2OQEC 4IPBA 3DGNA 1YJN3 3EHCA 1MWRA 1DYUA 5FW5A 2GBWB 4RBNA 3CCE3 3EC9A 1GMQA 1G0TA 3BIRA 1W2B2 3OXAA 3LOYA 3PXMA 2P0XA 3IMAB 4FCZA 4LZIA 1BNRA 1GOYA 2OOVA 4WP5A 1DMQA 1BU4A 4XDVA 1QVF2 1CYUA 5IG3A 1VQ93 1LQMB 2RNTA 1EG9B 2CG1A 1IV7A 1RN1A 1W7CA 4AKYA 1K41A 3G8ZA 2INXA 3JUQA 1O7NB 4STDA 2ML5A 1LRAA 1ZO2A 3FF0A 1ULIB 4GL6A 6STDA 1TJDA 3NBBA 3D3LA 3Q90A 4WFOA 5M19A 3I553 1A2PA 4K61A 1YVBI 4HJLB 2YFIB 4AKZA 3LTAA 2KCDA 1FGOA 1GS3A 1D6ZA 1SIIA 2BMQB 1MGRA 4MMXB 3SXXA 2HMOB 1DMMA 4HM6B 1UCJA 2P05A 2Z77A 4HZBB 2KF6A 1T5YA 1VQ83 1IT8A 1S5AA 2UGIA 3K5TA 1QALA 4EYCA 1FW7A 1B3SA 1BRHA 1ISKA 2KF4A 1I2GA 2HMLB 1UUWB 4CDLA 5BVBA 3MSOA 1HYFA 1Q864 1M904 1BNSA 1O7GB 1FA3A 3NV0B 5DRVA 2FXTA 4BTXA 1DE3A 2YFJB 3X42A 2F5MA 2XR8B 3PCSA 3ZG5A 1TFOA 2C10A 3UL5A 1UUGB 3F40A 4R9KA 1Q824 4TX4A 1JBTA 3KSED 2HMMB 1NDOB 2UX0A 1IK3A 3FG1A 3KKGA 1FGQA 3T8NA 1BSBA 3B8LA 4ORLA 3HK4A 1VZZA 5FGOA 2W6JH 3B4PA 4WYKA 1A2KA 4OK0A 1O7PB 1UGIA 4WYKB 1VQP3 1OHOA 4CCVA 2D42A 1UUVB 4BL3A 1QJGA 1BRKA 2W03A 1NWWA 3B7CA 2XF3A 2Z7AA 3QRDA 4FCJA 1YIJ3 3DUKA 1DVCA 1SQWA 3AGOA 1PU4A 4K1VA 2B24B 2XGLA 2L4VA 1MWUA 3FKAA 3FG4A 4N6TA 4XM4A 2W04A 1B2XA 3PGBA 1WMOA 2RBIA 2W56A 5TGNA 2OWPA 4CJNA 1KSIA 1OF5A 3FGYA 1Q40B 7GSPA 4EV5A 2BO9B 3E99A 1T2HA 1OF5B 2J8XB 1W6CA 3A5EA 3DM8A 3F8XA 4KFFA 5AIHA 1Q42A 4KFDA 3D5IA 3U1WA
chains in the Genus database with same CATH topology
2WOHA 1HU9A 5HGRA 1IV9A 2HMNB 3F14A 5DREA 2FNQA 3G4S3 1EQKA 1W6YA 5CK6A 1EKMA 1STFI 4OVMA 4GB5A 2CIUA 1M1XB 3KSPA 4RZMA 2BHMA 1N9EA 2XFSA 1YHQ3 2M7OA 2XSOB 2CW9A 4FR9A 1QVG2 1IQ8A 3FLJA 3IJEB 3Q2PA 3V92A 4I4KA 4J8TA 1ULJB 2CG0A 1D6UA 1K28A 3STDA 2I9WA 2IA7A 3NHXA 4MEIA 3CC73 3F9SA 4HM1B 4N6V0 1Q814 5JBSA 3BNBA 4HVNA 2IUKA 4FMBA 5G2GA 1IVXA 5AIGA 3BLZA 3F7SA 1W5ZA 2KRTA 1CYVA 2V1LA 2WOFA 3S27A 3WOFB 3WODG 1M1K4 1YJ93 3K7CA 5ELUA 4ZM8A 3ALAA 3AMOA 4PEJA 1IT7A 5IERA 4NREA 4KZ1A 1JNQA 1V74A 3SX1A 1NB5I 1O7WB 5AYSC 2XSHB 3T8UA 3CPW2 3BB9A 3WDGB 1K734 4NHFA 1AV4A 1W01A 1LVNA 3FZWA 4XBXA 3UNLA 1RJOA 1ASKA 3HIGA 3NBRA 3VGNA 1C7HA 2F98A 4R4KA 3MWZA 2Y73A 1AVKA 3IPTA 3SVAA 2XGNA 2QGUA 3CCL3 2Q07A 5AIFA 1VQ63 3OX9A 1GY6A 1JB4A 1YGEA 3KIIA 3LMLA 5CF1A 2RSXA 4AEQA 5KP4A 3T0UA 2GU3A 1RKYA 3B4OA 2OTL3 1OPYA 3ER7A 5IG0A 4XBYA 2OQEA 3ECFA 1QAFA 3S28A 3EJVA 5IG5A 1A67A 1S723 2CC3A 3NV0A 1IVVA 2FGTA 4LSOA 3A76A 3UJMA 3BNDA 3NUVA 3CCM3 4X2HA 2BMRB 3K0ZA 3DY5A 3UB1A 3RGAA 3O8YA 3X41A 1IQYA 1M9GA 1TP6A 3EB8A 3GWRA 3SEDA 1US1A 1W6GA 1K9M4 2WGQA 3GZXB 5AEUB 3CNMA 1N9JA 5IF6A 2OTJ3 2QA43 3DXOA 1HKXA 1AVLA 1KWIA 3HX8A 4H61A 3LT9A 1A2VA 3G16A 3NQZA 4X2OA 3CCS3 4FCMA 2OCTA 2XFTA 3JUPA 3GZYB 4G1MB 3X3YA 2C11A 4HM2B 2O3OA 5AIIA 1R4CA 3LH4A 1E3VA 1OCVA 1Q40A 1OGZA 2LYXA 1SIHA 3MKIA 4RNZA 3S29A 4EBGA 1IVWA 4EC6A 1WMNA 3PYJA 1IVUA 1MOLA 5EVHA 2MC8A 1J2BA 3WA3A 1JKGA 1W02A 1W4NA 3K9MC 1KD14 3TDGA 1RRHA 4R1KA 2HMKB 2Z76A 3H3HA 3GRDA 2WGOA 1IQXA 1IU7A 4HYZA 4O3VA 5IG4A 3JUNA 5ELJA 2JDIH 2PZVA 5D81A 3MHEA 3CCR3 3U97A 1JJ22 2E2UA 2ML6A 2QEX3 3QK9A 4JRFA 3CC43 3PS8A 1NB3I 2GEYA 3N9HA 1SJWA 3EN8A 3I0YA 3UL6A 2CWVA 2P38A 2Z6BA 2CHCA 1UI8A 1N8R4 5AI1A 1AR0A 3NXJA 3JUMA 2GU1A 1OACA 5AEWB 4N6LA 5KP1A 5IENA 3CMA3 3DZLA 2BMOB 3FCSB 2CWTA 4JF8A 5IW9A 1OH0A 4Q53A 1CQSA 3CD63 3OV4A 5STDA 2CFKA 2CKFB 3CXC2 2XH9A 2F99A 1L5GB 1EA2A 1E3RA 2Y74A 1N5PA 2ZDJA 2OOVC 1VQ73 3H51A 1NO3A 4HZ9B 5D82A 2W9PA 3CCV3 2XRXB 5D83A 1YJW3 4IIAA 1FGRA 1QMAA 2GXFA 3EBTA 2MF7A 1FGTA 2PNCA 2BNGA 1ROAA 2R4IA 3MG3A 1OHSA 4MMYB 3LYGA 1NJI4 3I563 3FSDA 1Y4KA 4QWTA 2HMJB 4L8OA 3EE1A 3KFQC 3LZAA 4HM8B 4RNYA 1JN5B 4BTWA 4EXRA 2CH9A 1UI7A 2JQ5A 3V99A 1VQL3 3RGRA 2CFLA 3NX0A 2KXGA 1GY5A 3OWSA 3CCJ3 2SBLA 2E2TA 1SPUA 1WQLB 2CFWA 3CNXA 1O7HB 3OWYA 3WOEB 4O02B 3VSYA 2CWUA 4H3UA 1GY7A 3EQQB 3X3XA 2RCDA 4R9LA 5CLKA 5CF2A 3CCQ3 1KQS2 1U5OA 1QAKA 1G96A 2XEPA 3MG1A 4HM5B 4EV2A 1WMPA 3N8BA 4U13A 3L0RA 1W2ZA 5A0OB 3KN4A 2YX9A 2F86B 2CK3H 1MNLA 1JB2A 3S5CA 4J9AA 4R80A 2P09A 3DGLA 4HM0B 1PFPA 1JB5A 4O8SA 3FH1A 1CEWI 1U8CB 5AYRB 2D1WA 3LT8A 1YI23 1LOXA 2QIYA 4WWUC 3DGOA 3GAXA 3LXUX 1VQO3 3FF2A 3J7Yd 1OGXA 1O7MB 1JV2B 4L7KA 3SOAA 3Q1CA 3WMDA 1VQK3 1VQN3 3EF8A 5LC6A 3DGMA 2CFDA 1FGMA 3NBJA 4HM3B 4KFEA 4HBRA 3HIIA 3CME3 3OWUA 1W00A 5I97A 1YIT3 1N5HA 1GD3A 3EX9A 2IUJA 4IT7A 4MJDA 5LC7A 2IMJA 4N6OB 3SLUA 2BT3A 4XBTA 4O2HA 2O9UX 5EQLA 3K63A 4BTYA 1N8QA 1WNHA 1UW1A 1RN7A 1Z1SA 1FUWA 2STDA 4XDWA 3LTCA 1A90A 1IDPA 2RFRA 4WHAA 5IEOA 3VF1A 3EBYA 3ROBA 2YFLB 4FMDA 2CFGA 1JKGB 2GBXB 2K54A 3KZTA 4K90B 4OUQA 2RGQA 4KVHA 4LMIA 1LXEA 3BNCA 2E2VA 2W56B 1DVDA 2WO0A 5CXOA 1TU5A 3NM7A 1STDA 1JRQA 3F7XA 3LTDA 4LEHA 7STDA 2A15A 5BXQA 1F8NA 5JPPA 4HM7B 1VQ53 3WA2X 3G0KA 1VQ43 3NM2A 4HKVB 3OW22 3MPHA 3D9RA 3X3ZA 4MMZB 3M8CA 2B1XB 3LTBA 2W9QA 1NU3A 3BNEA 3EN1B 4N6MA 2P0MA 3F8HA 4K1UA 3G6E3 3SOYA 1OHPA 1KC84 2W2CA 3FG3A 1K8A4 1WTHA 3X40A 4FMAA 3NQYA 3CC23 1E97A 4LGQA 3G713 3CPOA 3PCRA 1TUHA 3HZPA 5EEOA 1OUNA 1ZX2A 2GEXA 1D6YA 3DMCA 1DMNA 4XB5A 1TIJA 3JVCA 5IEPA 3PZWA 4N3VA 8CHOA 3V98A 1Q7Y4 1GYBA 3GZRA 1BUQA 5KP3A 4N6UA 4L8PA 1ROVA 3S67A 3HI7A 3MYTA 4FMCA 3RDEA 2K0MA 2LQVA 1TFKA 5JPUA 1JN5A 1LNHA 2ZL8A 3KE7A 2W0QA 4HM4B 1RRLA 3N54B 4N6NB 1GD4A 3GZBA 3MG2A 3JUOA 3AMOB 3CCU3 3CU3A 2OQEC 4IPBA 3DGNA 1YJN3 3EHCA 1DYUA 5FW5A 2GBWB 4RBNA 3CCE3 3EC9A 1W2B2 3OXAA 3LOYA 3PXMA 2P0XA 3IMAB 4FCZA 4LZIA 2OOVA 4WP5A 1DMQA 1QVF2 4XDVA 1CYUA 5IG3A 1VQ93 1EG9B 2CG1A 1IV7A 1W7CA 4AKYA 1K41A 3G8ZA 2INXA 3JUQA 1O7NB 4STDA 2ML5A 1ZO2A 3FF0A 1ULIB 4GL6A 6STDA 3NBBA 3D3LA 3Q90A 4WFOA 3I553 4K61A 1YVBI 4HJLB 2YFIB 4AKZA 3LTAA 2KCDA 1FGOA 1GS3A 1D6ZA 1SIIA 2BMQB 4MMXB 3SXXA 2HMOB 1DMMA 4HM6B 2Z77A 2P05A 4HZBB 1T5YA 1VQ83 1IT8A 1S5AA 3K5TA 4EYCA 1QALA 1ISKA 2HMLB 1UUWB 4CDLA 5BVBA 3MSOA 1Q864 1M904 1FA3A 1O7GB 3NV0B 5DRVA 2FXTA 4BTXA 2YFJB 3X42A 2XR8B 3PCSA 1TFOA 2C10A 3UL5A 3F40A 4R9KA 1Q824 4TX4A 3KSED 2HMMB 1NDOB 2UX0A 1IK3A 3FG1A 3KKGA 1FGQA 3T8NA 3B8LA 4ORLA 3HK4A 1VZZA 5FGOA 2W6JH 3B4PA 4WYKA 1A2KA 4OK0A 1O7PB 4WYKB 1VQP3 1OHOA 4CCVA 2D42A 1UUVB 1QJGA 3B7CA 2W03A 1NWWA 3QRDA 2XF3A 2Z7AA 4FCJA 1YIJ3 3DUKA 1DVCA 1SQWA 1PU4A 4K1VA 2B24B 2XGLA 2L4VA 3FKAA 3FG4A 4N6TA 4XM4A 1VQM3 2W04A 3PGBA 1WMOA 5TGNA 2W56A 2OWPA 1KSIA 1OF5A 3FGYA 1Q40B 4EV5A 2BO9B 3E99A 1OF5B 1W6CA 3DM8A 3F8XA 4KFFA 5AIHA 1Q42A 4KFDA 3U1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL 3;  3CC7 3;  3CMA 3;  2QA4 3;  1K73 4;  1VQ8 3;  2OTJ 3;  1Q81 4;  1VQP 3;  1VQN 3;  1VQK 3;  1NJI 4;  1QVF 2;  3CD6 3;  3G4S 3;  3CXC 2;  3I56 3;  1S72 3;  1VQ9 3;  1YIJ 3;  1Q86 4;  1M90 4;  3CCS 3;  3CME 3;  3CCR 3;  1JJ2 2;  3G6E 3;  2QEX 3;  1VQM 3;  1M1K 4;  3CC4 3;  1YIT 3;  1YJ9 3;  1KC8 4;  1K8A 4;  1YHQ 3;  3CCM 3;  1VQL 3;  3CC2 3;  1QVG 2;  3I55 3;  3CCU 3;  3G71 3;  3CCL 3;  3CCJ 3;  1Q82 4;  1VQ6 3;  1YI2 3;  1VQ7 3;  1YJN 3;  1N8R 4;  1K9M 4;  3CCV 3;  1VQ5 3;  1W2B 2;  1VQO 3;  1VQ4 3;  1KD1 4;  1YJW 3;  3CPW 2;  3CCQ 3;  3CCE 3;  1KQS 2;  3OW2 2;  1Q7Y 4; 
#chains in the Genus database with same CATH topology
 2WOH A;  5G1K A;  1HU9 A;  2KAA A;  1RCL A;  5HGR A;  2SAR A;  1FUS A;  1IV9 A;  2HMN B;  4EW5 A;  3F14 A;  5DRE A;  2FNQ A;  3G4S 3;  5BIR A;  1EQK A;  1W6Y A;  2K3D A;  1MWT A;  2R41 A;  5CK6 A;  1EKM A;  1STF I;  4OVM A;  4GB5 A;  2CIU A;  1M1X B;  2CX1 A;  3KSP A;  2BHM A;  4RZM A;  1N9E A;  2XFS A;  3RNT A;  1YHQ 3;  2M7O A;  2XSO B;  2CW9 A;  4FR9 A;  1QVG 2;  1IQ8 A;  1IYY A;  3FLJ A;  3IJE B;  3Q2P A;  2CX0 A;  3V92 A;  4I4K A;  4J8T A;  1UCK A;  1ULJ B;  2CG0 A;  1D6U A;  1K28 A;  4HAA A;  3STD A;  2I9W A;  2H0H A;  2IA7 A;  3NHX A;  5GSP A;  1JZO A;  4MEI A;  3CC7 3;  1T2I A;  3F9S A;  4HM1 B;  4N6V 0;  1Q81 4;  5JBS A;  3BNB A;  4HVN A;  2IUK A;  4FMB A;  5G2G A;  1IVX A;  3BU4 A;  5AIG A;  3BLZ A;  3F7S A;  3Q3F A;  1W5Z A;  2KRT A;  1CYV A;  2V1L A;  2WOF A;  3S27 A;  3WOF B;  3WOD G;  1M1K 4;  1BAO A;  4ILF A;  1YJ9 3;  1BUJ A;  3K7C A;  5ELU A;  4ZM8 A;  4J5K A;  1TRP A;  1BRS A;  1FZU A;  3AMO A;  1IT7 A;  3ALA A;  4PEJ A;  5IER A;  1BNG A;  4NRE A;  4KZ1 A;  1JNQ A;  1V74 A;  3SX1 A;  1NB5 I;  1O7W B;  1I2F A;  2KF3 A;  5AYS C;  2XSH B;  1V58 A;  3T8U A;  3CPW 2;  3DGY A;  3BB9 A;  3WDG B;  1K73 4;  4NHF A;  1AV4 A;  1W01 A;  1LVN A;  3FZW A;  4XBX A;  3UNL A;  1RJO A;  1ASK A;  3HIG A;  3NBR A;  1RGE A;  3VGN A;  1C7H A;  1RGC A;  2F98 A;  4R4K A;  3MWZ A;  5M1A A;  1PYL A;  2Y73 A;  1AVK A;  5HOH A;  3IPT A;  3SVA A;  1MWS A;  2XGN A;  2QGU A;  3CCL 3;  2Q07 A;  5AIF A;  1B2U A;  1VQ6 3;  1ZS7 A;  3OX9 A;  3WHO A;  1GY6 A;  1JB4 A;  1YGE A;  3D5G A;  3KII A;  3LML A;  3WR2 A;  5CF1 A;  2RSX A;  1FYS A;  4AEQ A;  5KP4 A;  3T0U A;  2GU3 A;  1RKY A;  3B4O A;  2OTL 3;  1BNF A;  1OPY A;  3ER7 A;  5IG0 A;  3ZG0 A;  4XBY A;  2OQE A;  3ECF A;  1QAF A;  3S28 A;  3EJV A;  5IG5 A;  3KCH A;  1A67 A;  1NNV A;  1S72 3;  1BIR A;  2CC3 A;  1RCK A;  1UCL A;  3NV0 A;  1IVV A;  2FGT A;  4LSO A;  3D79 A;  1AQZ A;  3A76 A;  2L1S A;  3UJM A;  3BND A;  3NUV A;  1B2M A;  3CCM 3;  2AAD A;  4X2H A;  2BMR B;  1GOU A;  3K0Z A;  3DY5 A;  3UB1 A;  3RGA A;  3O8Y A;  3X41 A;  1IQY A;  1M9G A;  1TP6 A;  3EB8 A;  3GWR A;  1UDI I;  3SED A;  1US1 A;  1W6G A;  1K9M 4;  2WGQ A;  2ZA4 A;  3GZX B;  5AEU B;  3CNM A;  1N9J A;  1SAR A;  5IF6 A;  2OTJ 3;  3DH2 A;  2QA4 3;  3DXO A;  1HKX A;  1AVL A;  5M18 A;  1KWI A;  3HX8 A;  4H61 A;  3LT9 A;  1A2V A;  3G16 A;  3NQZ A;  4X2O A;  3CCS 3;  4FCM A;  1R4Y A;  2OCT A;  2XFT A;  3JUP A;  1Q9E A;  3GZY B;  4G1M B;  3X3Y A;  2C11 A;  2BIR A;  4HM2 B;  2O3O A;  5AII A;  1R4C A;  3LH4 A;  1E3V A;  1OCV A;  1Q40 A;  1OGZ A;  2LYX A;  1SIH A;  3MKI A;  4RNZ A;  3S29 A;  4BL2 A;  4EBG A;  1GMR A;  1IVW A;  4EC6 A;  1RDS A;  1AY7 A;  1WMN A;  2KF5 A;  1IVU A;  3PYJ A;  1MOL A;  5EVH A;  2MC8 A;  1J2B A;  3WA3 A;  1JKG A;  1W02 A;  1W4N A;  2HOH A;  3K9M C;  1RTU A;  3TDG A;  1KD1 4;  1RRH A;  4R1K A;  2HMK B;  2Z76 A;  3H3H A;  3GRD A;  4CPK A;  2WGO A;  1IQX A;  1IU7 A;  2ZHX B;  4HYZ A;  4O3V A;  5IG4 A;  3JUN A;  1I70 A;  5ELJ A;  2JDI H;  3D4A A;  1BAN A;  2PZV A;  5D81 A;  4BIR A;  2F4Y A;  3MHE A;  8RNT A;  3CCR 3;  3U97 A;  1JJ2 2;  2E2U A;  2ML6 A;  1EEJ A;  3QK9 A;  4JRF A;  2QEX 3;  3PS8 A;  1NB3 I;  3CC4 3;  2GEY A;  3N9H A;  1SJW A;  3EN8 A;  1LOY A;  3I0Y A;  3UL6 A;  2CWV A;  2P38 A;  2Z6B A;  1JZD A;  2CHC A;  1RGF A;  1RGA A;  1UI8 A;  1N8R 4;  5AI1 A;  1AR0 A;  3NXJ A;  3JUM A;  2GU1 A;  1OAC A;  5AEW B;  1CH0 A;  4N6L A;  3GSP A;  5KP1 A;  5IEN A;  3CMA 3;  3DZL A;  2BMO B;  3FCS B;  2CWT A;  4JF8 A;  5G1L A;  5IW9 A;  1OH0 A;  4Q53 A;  1CQS A;  1YGW A;  3CD6 3;  3OV4 A;  5STD A;  2CFK A;  1B2Z A;  2CKF B;  3CXC 2;  1RSN A;  2XH9 A;  2F99 A;  1C54 A;  1RNB A;  1JBR A;  3AHS A;  1L5G B;  1EA2 A;  1E3R A;  3SYU A;  1ZGX A;  2Y74 A;  1V57 A;  1N5P A;  2ZDJ A;  4J5G A;  2OOV C;  1RGL A;  1B2S A;  1VQ7 3;  3H51 A;  1NO3 A;  4HZ9 B;  5D82 A;  2W9P A;  3CCV 3;  2XRX B;  5D83 A;  2IY2 A;  1YJW 3;  2C4B A;  4IIA A;  1FGR A;  1QMA A;  2GXF A;  1RHL A;  1X1U A;  3EBT A;  2MF7 A;  1FGT A;  2PNC A;  2BNG A;  1X1Y A;  1ROA A;  2R4I A;  3MG3 A;  1OHS A;  4GSP A;  3LYG A;  4MMY B;  1NJI 4;  3I56 3;  3FSD A;  1Y4K A;  4QWT A;  1GOV A;  2HMJ B;  4DKI A;  1RGH A;  1I3F A;  3EE1 A;  1DET A;  3KFQ C;  3LZA A;  4HM8 B;  4L8O A;  4RNY A;  3ZFZ A;  1BRJ A;  1JN5 B;  3AGN A;  1MGW A;  4BTW A;  4EXR A;  2CH9 A;  1UI7 A;  2JQ5 A;  3V99 A;  1VQL 3;  3RGR A;  2CFL A;  3NX0 A;  2KXG A;  1GY5 A;  1B21 A;  3OWS A;  3CCJ 3;  2UUG C;  2SBL A;  1SPU A;  1TTO A;  1WQL B;  2CFW A;  2E2T A;  1O7H B;  3CNX A;  4BU4 A;  3OWY A;  3WOE B;  1T3B A;  1UGH I;  4O02 B;  3VSY A;  2CWU A;  4H3U A;  1GY7 A;  3EQQ B;  3X3X A;  2RCD A;  4R9L A;  5CLK A;  5CF2 A;  3CCQ 3;  1KQS 2;  1U5O A;  1HZ1 A;  1QAK A;  1VQQ A;  1G96 A;  2XEP A;  3MG1 A;  4HM5 B;  4EV2 A;  1WMP A;  3N8B A;  2F56 A;  4U13 A;  3L0R A;  1W2Z A;  5A0O B;  3KN4 A;  2YX9 A;  2F86 B;  2CK3 H;  4NPB A;  1BNJ A;  1BRI A;  1MNL A;  1JB2 A;  3S5C A;  4J9A A;  4R80 A;  2P09 A;  3DGL A;  1YVS A;  4HM0 B;  1PFP A;  1JB5 A;  1I0V A;  3FH1 A;  4O8S A;  1CEW I;  1I8V A;  1U8C B;  5AYR B;  2D1W A;  3LT8 A;  1YI2 3;  1LOX A;  1BSE A;  2QIY A;  1LQG C;  4WWU C;  1RMS A;  3DGO A;  4KT3 B;  3GAX A;  3LXU X;  1VQO 3;  3FF2 A;  3J7Y d;  1OGX A;  7RNT A;  1I0X A;  3AHW A;  1O7M B;  1JV2 B;  4L7K A;  1GMP A;  3SOA A;  3Q1C A;  3WMD A;  1VQK 3;  1VQN 3;  3EF8 A;  5LC6 A;  1BSD A;  3DGM A;  2CFD A;  1FGM A;  1RGK A;  1BOX A;  3NBJ A;  4HM3 B;  4KFE A;  4HBR A;  3HII A;  3CME 3;  3OWU A;  1W00 A;  5I97 A;  1YIT 3;  1N5H A;  1RN4 A;  6RNT A;  1GD3 A;  3EX9 A;  2IUJ A;  4IT7 A;  4MJD A;  5LC7 A;  2IMJ A;  4N6O B;  3SLU A;  2BT3 A;  1I2E A;  1GSP A;  4XBT A;  4O2H A;  2O9U X;  5EQL A;  3K63 A;  4BTY A;  1N8Q A;  1WNH A;  1UW1 A;  4RNT A;  1RN7 A;  1Z1S A;  1FUW A;  2STD A;  4XDW A;  3LTC A;  1A90 A;  1IDP A;  1UCI A;  1JBS A;  2RFR A;  1TRQ A;  4WHA A;  5IEO A;  1X1X A;  3VF1 A;  3EBY A;  1BRN L;  1YNV X;  3ROB A;  2YFL B;  1VQM 3;  4FMD A;  9RNT A;  2CFG A;  1JKG B;  2AAE A;  2GBX B;  1B27 A;  2K54 A;  3KZT A;  4K90 B;  1BRG A;  4OUQ A;  2RGQ A;  1LNI A;  4KVH A;  4LMI A;  1PY3 A;  1LXE A;  3BNC A;  2E2V A;  2W56 B;  1DVD A;  2WO0 A;  2H0G A;  5CXO A;  1TU5 A;  1G02 A;  2IYJ A;  3NM7 A;  1STD A;  1JRQ A;  3F7X A;  3LTD A;  4LEH A;  7STD A;  1BSC A;  2A15 A;  5BXQ A;  1F8N A;  5JPP A;  4HM7 B;  1VQ5 3;  3WA2 X;  3G0K A;  1VQ4 3;  3NM2 A;  4HKV B;  3OW2 2;  1EUI C;  1X1W A;  3MPH A;  3D9R A;  3X3Z A;  4MMZ B;  1B20 A;  3M8C A;  2B1X B;  3LTB A;  2F5W A;  2W9Q A;  1NU3 A;  4LYL B;  3BNE A;  3EN1 B;  4N6M A;  2P0M A;  1BGS A;  3F8H A;  4K1U A;  1BSA A;  3G6E 3;  1FUT A;  3SOY A;  1OHP A;  1KC8 4;  2W2C A;  3FG3 A;  1K8A 4;  1WTH A;  1LOV A;  4HOH A;  4FMA A;  3NQY A;  1LOW A;  3X40 A;  3CC2 3;  1E97 A;  4LGQ A;  1Q7H A;  3G71 3;  3CPO A;  3PCR A;  1BNI A;  1TUH A;  3HZP A;  5EEO A;  1ZX2 A;  1OUN A;  2GEX A;  1D6Y A;  6GSP A;  3DMC A;  1DMN A;  4XB5 A;  1TIJ A;  1RLS A;  3JVC A;  5IEP A;  3PZW A;  4N3V A;  8CHO A;  3V98 A;  3URP A;  1Q7Y 4;  1BNE A;  5RNT A;  1GYB A;  2BU4 A;  3GZR A;  1BUQ A;  2GSP A;  5KP3 A;  1BVI A;  4N6U A;  4L8P A;  5BU4 A;  1ROV A;  3S67 A;  3HI7 A;  1I3I A;  3MYT A;  4FMC A;  3HOH A;  4GHO A;  2K0M A;  2LQV A;  3RDE A;  1TFK A;  1RGG A;  2H0I A;  5JPU A;  1JN5 A;  1LNH A;  2ZL8 A;  3KE7 A;  2W0Q A;  4HM4 B;  1RRL A;  3N54 B;  4N6N B;  1RNT A;  1GD4 A;  3GZB A;  3MG2 A;  3JUO A;  3AMO B;  3CCU 3;  3CU3 A;  4I5Q A;  2OQE C;  4IPB A;  3DGN A;  1YJN 3;  3EHC A;  1MWR A;  1DYU A;  5FW5 A;  2GBW B;  4RBN A;  3CCE 3;  3EC9 A;  1GMQ A;  1G0T A;  3BIR A;  1W2B 2;  3OXA A;  3LOY A;  3PXM A;  2P0X A;  3IMA B;  4FCZ A;  4LZI A;  1BNR A;  1GOY A;  2OOV A;  4WP5 A;  1DMQ A;  1BU4 A;  4XDV A;  1QVF 2;  1CYU A;  5IG3 A;  1VQ9 3;  1LQM B;  2RNT A;  1EG9 B;  2CG1 A;  1IV7 A;  1RN1 A;  1W7C A;  4AKY A;  1K41 A;  3G8Z A;  2INX A;  3JUQ A;  1O7N B;  4STD A;  2ML5 A;  1LRA A;  1ZO2 A;  3FF0 A;  1ULI B;  4GL6 A;  6STD A;  1TJD A;  3NBB A;  3D3L A;  3Q90 A;  4WFO A;  5M19 A;  3I55 3;  1A2P A;  4K61 A;  1YVB I;  4HJL B;  2YFI B;  4AKZ A;  3LTA A;  2KCD A;  1FGO A;  1GS3 A;  1D6Z A;  1SII A;  2BMQ B;  1MGR A;  4MMX B;  3SXX A;  2HMO B;  1DMM A;  4HM6 B;  1UCJ A;  2P05 A;  2Z77 A;  4HZB B;  2KF6 A;  1T5Y A;  1VQ8 3;  1IT8 A;  1S5A A;  2UGI A;  3K5T A;  1QAL A;  4EYC A;  1FW7 A;  1B3S A;  1BRH A;  1ISK A;  2KF4 A;  1I2G A;  2HML B;  1UUW B;  4CDL A;  5BVB A;  3MSO A;  1HYF A;  1Q86 4;  1M90 4;  1BNS A;  1O7G B;  1FA3 A;  3NV0 B;  5DRV A;  2FXT A;  4BTX A;  1DE3 A;  2YFJ B;  3X42 A;  2F5M A;  2XR8 B;  3PCS A;  3ZG5 A;  1TFO A;  2C10 A;  3UL5 A;  1UUG B;  3F40 A;  4R9K A;  1Q82 4;  4TX4 A;  1JBT A;  3KSE D;  2HMM B;  1NDO B;  2UX0 A;  1IK3 A;  3FG1 A;  3KKG A;  1FGQ A;  3T8N A;  1BSB A;  3B8L A;  4ORL A;  3HK4 A;  1VZZ A;  5FGO A;  2W6J H;  3B4P A;  4WYK A;  1A2K A;  4OK0 A;  1O7P B;  1UGI A;  4WYK B;  1VQP 3;  1OHO A;  4CCV A;  2D42 A;  1UUV B;  4BL3 A;  1QJG A;  1BRK A;  2W03 A;  1NWW A;  3B7C A;  2XF3 A;  2Z7A A;  3QRD A;  4FCJ A;  1YIJ 3;  3DUK A;  1DVC A;  1SQW A;  3AGO A;  1PU4 A;  4K1V A;  2B24 B;  2XGL A;  2L4V A;  1MWU A;  3FKA A;  3FG4 A;  4N6T A;  4XM4 A;  2W04 A;  1B2X A;  3PGB A;  1WMO A;  2RBI A;  2W56 A;  5TGN A;  2OWP A;  4CJN A;  1KSI A;  1OF5 A;  3FGY A;  1Q40 B;  7GSP A;  4EV5 A;  2BO9 B;  3E99 A;  1T2H A;  1OF5 B;  2J8X B;  1W6C A;  3A5E A;  3DM8 A;  3F8X A;  4KFF A;  5AIH A;  1Q42 A;  4KFD A;  3D5I A;  3U1W A; 
#chains in the Genus database with same CATH homology
 2WOH A;  1HU9 A;  5HGR A;  1IV9 A;  2HMN B;  3F14 A;  5DRE A;  2FNQ A;  3G4S 3;  1EQK A;  1W6Y A;  5CK6 A;  1EKM A;  1STF I;  4OVM A;  4GB5 A;  2CIU A;  1M1X B;  3KSP A;  4RZM A;  2BHM A;  1N9E A;  2XFS A;  1YHQ 3;  2M7O A;  2XSO B;  2CW9 A;  4FR9 A;  1QVG 2;  1IQ8 A;  3FLJ A;  3IJE B;  3Q2P A;  3V92 A;  4I4K A;  4J8T A;  1ULJ B;  2CG0 A;  1D6U A;  1K28 A;  3STD A;  2I9W A;  2IA7 A;  3NHX A;  4MEI A;  3CC7 3;  3F9S A;  4HM1 B;  4N6V 0;  1Q81 4;  5JBS A;  3BNB A;  4HVN A;  2IUK A;  4FMB A;  5G2G A;  1IVX A;  5AIG A;  3BLZ A;  3F7S A;  1W5Z A;  2KRT A;  1CYV A;  2V1L A;  2WOF A;  3S27 A;  3WOF B;  3WOD G;  1M1K 4;  1YJ9 3;  3K7C A;  5ELU A;  4ZM8 A;  3ALA A;  3AMO A;  4PEJ A;  1IT7 A;  5IER A;  4NRE A;  4KZ1 A;  1JNQ A;  1V74 A;  3SX1 A;  1NB5 I;  1O7W B;  5AYS C;  2XSH B;  3T8U A;  3CPW 2;  3BB9 A;  3WDG B;  1K73 4;  4NHF A;  1AV4 A;  1W01 A;  1LVN A;  3FZW A;  4XBX A;  3UNL A;  1RJO A;  1ASK A;  3HIG A;  3NBR A;  3VGN A;  1C7H A;  2F98 A;  4R4K A;  3MWZ A;  2Y73 A;  1AVK A;  3IPT A;  3SVA A;  2XGN A;  2QGU A;  3CCL 3;  2Q07 A;  5AIF A;  1VQ6 3;  3OX9 A;  1GY6 A;  1JB4 A;  1YGE A;  3KII A;  3LML A;  5CF1 A;  2RSX A;  4AEQ A;  5KP4 A;  3T0U A;  2GU3 A;  1RKY A;  3B4O A;  2OTL 3;  1OPY A;  3ER7 A;  5IG0 A;  4XBY A;  2OQE A;  3ECF A;  1QAF A;  3S28 A;  3EJV A;  5IG5 A;  1A67 A;  1S72 3;  2CC3 A;  3NV0 A;  1IVV A;  2FGT A;  4LSO A;  3A76 A;  3UJM A;  3BND A;  3NUV A;  3CCM 3;  4X2H A;  2BMR B;  3K0Z A;  3DY5 A;  3UB1 A;  3RGA A;  3O8Y A;  3X41 A;  1IQY A;  1M9G A;  1TP6 A;  3EB8 A;  3GWR A;  3SED A;  1US1 A;  1W6G A;  1K9M 4;  2WGQ A;  3GZX B;  5AEU B;  3CNM A;  1N9J A;  5IF6 A;  2OTJ 3;  2QA4 3;  3DXO A;  1HKX A;  1AVL A;  1KWI A;  3HX8 A;  4H61 A;  3LT9 A;  1A2V A;  3G16 A;  3NQZ A;  4X2O A;  3CCS 3;  4FCM A;  2OCT A;  2XFT A;  3JUP A;  3GZY B;  4G1M B;  3X3Y A;  2C11 A;  4HM2 B;  2O3O A;  5AII A;  1R4C A;  3LH4 A;  1E3V A;  1OCV A;  1Q40 A;  1OGZ A;  2LYX A;  1SIH A;  3MKI A;  4RNZ A;  3S29 A;  4EBG A;  1IVW A;  4EC6 A;  1WMN A;  3PYJ A;  1IVU A;  1MOL A;  5EVH A;  2MC8 A;  1J2B A;  3WA3 A;  1JKG A;  1W02 A;  1W4N A;  3K9M C;  1KD1 4;  3TDG A;  1RRH A;  4R1K A;  2HMK B;  2Z76 A;  3H3H A;  3GRD A;  2WGO A;  1IQX A;  1IU7 A;  4HYZ A;  4O3V A;  5IG4 A;  3JUN A;  5ELJ A;  2JDI H;  2PZV A;  5D81 A;  3MHE A;  3CCR 3;  3U97 A;  1JJ2 2;  2E2U A;  2ML6 A;  2QEX 3;  3QK9 A;  4JRF A;  3CC4 3;  3PS8 A;  1NB3 I;  2GEY A;  3N9H A;  1SJW A;  3EN8 A;  3I0Y A;  3UL6 A;  2CWV A;  2P38 A;  2Z6B A;  2CHC A;  1UI8 A;  1N8R 4;  5AI1 A;  1AR0 A;  3NXJ A;  3JUM A;  2GU1 A;  1OAC A;  5AEW B;  4N6L A;  5KP1 A;  5IEN A;  3CMA 3;  3DZL A;  2BMO B;  3FCS B;  2CWT A;  4JF8 A;  5IW9 A;  1OH0 A;  4Q53 A;  1CQS A;  3CD6 3;  3OV4 A;  5STD A;  2CFK A;  2CKF B;  3CXC 2;  2XH9 A;  2F99 A;  1L5G B;  1EA2 A;  1E3R A;  2Y74 A;  1N5P A;  2ZDJ A;  2OOV C;  1VQ7 3;  3H51 A;  1NO3 A;  4HZ9 B;  5D82 A;  2W9P A;  3CCV 3;  2XRX B;  5D83 A;  1YJW 3;  4IIA A;  1FGR A;  1QMA A;  2GXF A;  3EBT A;  2MF7 A;  1FGT A;  2PNC A;  2BNG A;  1ROA A;  2R4I A;  3MG3 A;  1OHS A;  4MMY B;  3LYG A;  1NJI 4;  3I56 3;  3FSD A;  1Y4K A;  4QWT A;  2HMJ B;  4L8O A;  3EE1 A;  3KFQ C;  3LZA A;  4HM8 B;  4RNY A;  1JN5 B;  4BTW A;  4EXR A;  2CH9 A;  1UI7 A;  2JQ5 A;  3V99 A;  1VQL 3;  3RGR A;  2CFL A;  3NX0 A;  2KXG A;  1GY5 A;  3OWS A;  3CCJ 3;  2SBL A;  2E2T A;  1SPU A;  1WQL B;  2CFW A;  3CNX A;  1O7H B;  3OWY A;  3WOE B;  4O02 B;  3VSY A;  2CWU A;  4H3U A;  1GY7 A;  3EQQ B;  3X3X A;  2RCD A;  4R9L A;  5CLK A;  5CF2 A;  3CCQ 3;  1KQS 2;  1U5O A;  1QAK A;  1G96 A;  2XEP A;  3MG1 A;  4HM5 B;  4EV2 A;  1WMP A;  3N8B A;  4U13 A;  3L0R A;  1W2Z A;  5A0O B;  3KN4 A;  2YX9 A;  2F86 B;  2CK3 H;  1MNL A;  1JB2 A;  3S5C A;  4J9A A;  4R80 A;  2P09 A;  3DGL A;  4HM0 B;  1PFP A;  1JB5 A;  4O8S A;  3FH1 A;  1CEW I;  1U8C B;  5AYR B;  2D1W A;  3LT8 A;  1YI2 3;  1LOX A;  2QIY A;  4WWU C;  3DGO A;  3GAX A;  3LXU X;  1VQO 3;  3FF2 A;  3J7Y d;  1OGX A;  1O7M B;  1JV2 B;  4L7K A;  3SOA A;  3Q1C A;  3WMD A;  1VQK 3;  1VQN 3;  3EF8 A;  5LC6 A;  3DGM A;  2CFD A;  1FGM A;  3NBJ A;  4HM3 B;  4KFE A;  4HBR A;  3HII A;  3CME 3;  3OWU A;  1W00 A;  5I97 A;  1YIT 3;  1N5H A;  1GD3 A;  3EX9 A;  2IUJ A;  4IT7 A;  4MJD A;  5LC7 A;  2IMJ A;  4N6O B;  3SLU A;  2BT3 A;  4XBT A;  4O2H A;  2O9U X;  5EQL A;  3K63 A;  4BTY A;  1N8Q A;  1WNH A;  1UW1 A;  1RN7 A;  1Z1S A;  1FUW A;  2STD A;  4XDW A;  3LTC A;  1A90 A;  1IDP A;  2RFR A;  4WHA A;  5IEO A;  3VF1 A;  3EBY A;  3ROB A;  2YFL B;  4FMD A;  2CFG A;  1JKG B;  2GBX B;  2K54 A;  3KZT A;  4K90 B;  4OUQ A;  2RGQ A;  4KVH A;  4LMI A;  1LXE A;  3BNC A;  2E2V A;  2W56 B;  1DVD A;  2WO0 A;  5CXO A;  1TU5 A;  3NM7 A;  1STD A;  1JRQ A;  3F7X A;  3LTD A;  4LEH A;  7STD A;  2A15 A;  5BXQ A;  1F8N A;  5JPP A;  4HM7 B;  1VQ5 3;  3WA2 X;  3G0K A;  1VQ4 3;  3NM2 A;  4HKV B;  3OW2 2;  3MPH A;  3D9R A;  3X3Z A;  4MMZ B;  3M8C A;  2B1X B;  3LTB A;  2W9Q A;  1NU3 A;  3BNE A;  3EN1 B;  4N6M A;  2P0M A;  3F8H A;  4K1U A;  3G6E 3;  3SOY A;  1OHP A;  1KC8 4;  2W2C A;  3FG3 A;  1K8A 4;  1WTH A;  3X40 A;  4FMA A;  3NQY A;  3CC2 3;  1E97 A;  4LGQ A;  3G71 3;  3CPO A;  3PCR A;  1TUH A;  3HZP A;  5EEO A;  1OUN A;  1ZX2 A;  2GEX A;  1D6Y A;  3DMC A;  1DMN A;  4XB5 A;  1TIJ A;  3JVC A;  5IEP A;  3PZW A;  4N3V A;  8CHO A;  3V98 A;  1Q7Y 4;  1GYB A;  3GZR A;  1BUQ A;  5KP3 A;  4N6U A;  4L8P A;  1ROV A;  3S67 A;  3HI7 A;  3MYT A;  4FMC A;  3RDE A;  2K0M A;  2LQV A;  1TFK A;  5JPU A;  1JN5 A;  1LNH A;  2ZL8 A;  3KE7 A;  2W0Q A;  4HM4 B;  1RRL A;  3N54 B;  4N6N B;  1GD4 A;  3GZB A;  3MG2 A;  3JUO A;  3AMO B;  3CCU 3;  3CU3 A;  2OQE C;  4IPB A;  3DGN A;  1YJN 3;  3EHC A;  1DYU A;  5FW5 A;  2GBW B;  4RBN A;  3CCE 3;  3EC9 A;  1W2B 2;  3OXA A;  3LOY A;  3PXM A;  2P0X A;  3IMA B;  4FCZ A;  4LZI A;  2OOV A;  4WP5 A;  1DMQ A;  1QVF 2;  4XDV A;  1CYU A;  5IG3 A;  1VQ9 3;  1EG9 B;  2CG1 A;  1IV7 A;  1W7C A;  4AKY A;  1K41 A;  3G8Z A;  2INX A;  3JUQ A;  1O7N B;  4STD A;  2ML5 A;  1ZO2 A;  3FF0 A;  1ULI B;  4GL6 A;  6STD A;  3NBB A;  3D3L A;  3Q90 A;  4WFO A;  3I55 3;  4K61 A;  1YVB I;  4HJL B;  2YFI B;  4AKZ A;  3LTA A;  2KCD A;  1FGO A;  1GS3 A;  1D6Z A;  1SII A;  2BMQ B;  4MMX B;  3SXX A;  2HMO B;  1DMM A;  4HM6 B;  2Z77 A;  2P05 A;  4HZB B;  1T5Y A;  1VQ8 3;  1IT8 A;  1S5A A;  3K5T A;  4EYC A;  1QAL A;  1ISK A;  2HML B;  1UUW B;  4CDL A;  5BVB A;  3MSO A;  1Q86 4;  1M90 4;  1FA3 A;  1O7G B;  3NV0 B;  5DRV A;  2FXT A;  4BTX A;  2YFJ B;  3X42 A;  2XR8 B;  3PCS A;  1TFO A;  2C10 A;  3UL5 A;  3F40 A;  4R9K A;  1Q82 4;  4TX4 A;  3KSE D;  2HMM B;  1NDO B;  2UX0 A;  1IK3 A;  3FG1 A;  3KKG A;  1FGQ A;  3T8N A;  3B8L A;  4ORL A;  3HK4 A;  1VZZ A;  5FGO A;  2W6J H;  3B4P A;  4WYK A;  1A2K A;  4OK0 A;  1O7P B;  4WYK B;  1VQP 3;  1OHO A;  4CCV A;  2D42 A;  1UUV B;  1QJG A;  3B7C A;  2W03 A;  1NWW A;  3QRD A;  2XF3 A;  2Z7A A;  4FCJ A;  1YIJ 3;  3DUK A;  1DVC A;  1SQW A;  1PU4 A;  4K1V A;  2B24 B;  2XGL A;  2L4V A;  3FKA A;  3FG4 A;  4N6T A;  4XM4 A;  1VQM 3;  2W04 A;  3PGB A;  1WMO A;  5TGN A;  2W56 A;  2OWP A;  1KSI A;  1OF5 A;  3FGY A;  1Q40 B;  4EV5 A;  2BO9 B;  3E99 A;  1OF5 B;  1W6C A;  3DM8 A;  3F8X A;  4KFF A;  5AIH A;  1Q42 A;  4KFD A;  3U1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...