1KD14

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kd1400
1YJ93 1VQK3 2QA43 1KC84 1QVF2 1Q864 3CC23 1VQ83 1Q7Y4 3G713 3CCJ3 1QVG2 2QEX3 1S723 1Q824 3CCL3 1YIJ3 1K734 1K9M4 3CPW2 3CME3 3CXC2 3CCV3 1VQ73 1VQP3 1YJW3 1KQS2 3CCE3 3CCM3 1YJN3 1M904 3CD63 1VQO3 2OTJ3 3OW22 1W2B2 1VQ43 1KD14 1VQ53 3CC43 3G4S3 1YIT3 3CMA3 3I563 1VQ63 1YI23 3CC73 1N8R4 3G6E3 1JJ22 1VQL3 1YHQ3 1VQ93 1VQN3 3CCR3 1K8A4 3I553 3CCS3 3CCU3 1Q814 1NJI4 1M1K4 1VQM3 3CCQ3 2OTL3
chains in the Genus database with same CATH superfamily
2FGTA 3GWRA 2RNTA 3D3LA 3UL6A 1YJ93 3K7CA 1VQK3 1ZGXA 3FG4A 2E2VA 1Q864 1B2UA 3K63A 3D4AA 1BSCA 2D42A 3EN1B 1J2BA 4HM8B 3CXC2 2XSHB 1DMMA 1ROAA 2W0QA 4EC6A 1LNHA 3CCV3 1SJWA 2XFSA 1OHOA 1TUHA 3LZAA 1S5AA 3DZLA 3X3YA 1RRLA 4Q53A 2YFLB 1BNIA 1C7HA 1FGRA 3GZYB 1ZS7A 4LZIA 1VQ43 1CYUA 3DMCA 2CWVA 3CC73 1B2MA 4HM0B 3AHSA 1ROVA 4X2OA 2XH9A 3KSPA 3X42A 1ULJB 2ZA4A 1W2ZA 3B4OA 1JKGB 1RMSA 4LGQA 4O8SA 3NM7A 3SOYA 4N3VA 3NM2A 1GOUA 4L7KA 2HMMB 2PZVA 3SXXA 1YNVX 4KFDA 1M1XB 4FCJA 1ISKA 1OF5A 1Q42A 3LH4A 3UB1A 3AMOB 1FGMA 4AKYA 3EHCA 3F40A 2H0GA 3SYUA 2W9QA 3MWZA 3WHOA 1EG9B 3GSPA 4J9AA 1I70A 1M904 1UDII 1UCLA 3WOFB 4WFOA 5KP3A 3JUOA 2IYJA 1TJDA 2BNGA 5DREA 2SARA 1YI23 1W01A 3HI7A 3N54B 1MGRA 1VZZA 4GSPA 5IF6A 3ER7A 2A15A 2P0MA 2XF3A 3IJEB 1W00A 2OWPA 2XR8B 4HZ9B 5AIIA 2LYXA 2W56A 2W03A 4GHOA 1D6YA 1RSNA 1EUIC 2P0XA 3PXMA 4J5KA 4ORLA 3K0ZA 4O2HA 5AI1A 1W02A 7GSPA 5FGOA 1JRQA 3LTCA 1QVG2 1S723 1FW7A 4K1UA 3X41A 3S29A 4U13A 3T8UA 3K5TA 1N5PA 4FCZA 1RGLA 4OUQA 1RGEA 2CIUA 1YJN3 3JUPA 1IVWA 1TRQA 3DGNA 4N6NB 5AIFA 1UCIA 1BOXA 4EYCA 5JBSA 5G1LA 4HM3B 3NQZA 3UNLA 2Z77A 2RCDA 1YVSA 3M8CA 4NREA 3GRDA 4IT7A 1X1WA 3FG3A 2I9WA 4EV2A 4R9KA 1F8NA 1OF5B 3N9HA 3BB9A 3KN4A 5IEOA 2KF6A 1IV7A 4XDVA 2CW9A 3EJVA 3FGYA 2XFTA 4N6MA 5EVHA 3NV0A 1IYYA 1QMAA 3MG3A 3UJMA 1FGOA 1TFKA 3F7SA 2Y74A 4CDLA 1OACA 1FYSA 1G96A 1MGWA 1MNLA 1X1YA 2C4BA 2Z7AA 1K734 3OWYA 1JZOA 1MOLA 3H51A 3B7CA 3KFQC 1MWSA 3LYGA 3OWSA 5AYRB 3SLUA 1IVVA 2W9PA 3HK4A 3NBRA 1T2HA 1YVBI 2H0IA 2RFRA 4FMDA 8CHOA 4RNZA 1RGKA 3FZWA 4OK0A 3SEDA 1W6CA 4R9LA 3WODG 3WA2X 2L4VA 3LT9A 4I4KA 2KAAA 4AKZA 1NJI4 1IDPA 1VQM3 3F8XA 1E97A 1PU4A 5BU4A 2XGNA 3DGOA 5CLKA 4H61A 5HOHA 4R4KA 4WYKA 5AEUB 4H3UA 2M7OA 3U97A 1Q7Y4 1RGAA 2KF3A 5I97A 5IG3A 3EB8A 2XRXB 3B4PA 3BNEA 1Q40A 3AGOA 4RNYA 4BL3A 4LYLB 3NUVA 2OOVC 2OOVA 2MF7A 2E2TA 1CQSA 1RTUA 4J5GA 3RGRA 3LTBA 2OTJ3 5DRVA 1FZUA 2F99A 3CC43 1PY3A 5A0OB 2LQVA 1JBRA 3HZPA 4NHFA 5KP4A 1UUVB 3PZWA 1AVLA 3HIGA 2INXA 1SIHA 3F9SA 3NHXA 5BIRA 1Q814 1BUJA 4NPBA 4XBXA 1U5OA 2CFWA 2W04A 3JVCA 4QWTA 3VGNA 1QVF2 3FCSB 5AEWB 3CC23 1O7NB 5G2GA 1B2ZA 3Q90A 4STDA 3V98A 2BO9B 4KZ1A 1VQ73 4K90B 2FNQA 2Z6BA 4FCMA 4FMAA 4K61A 4JRFA 3OWUA 1BSAA 5M1AA 4HM2B 1AQZA 1T3BA 2B1XB 1AR0A 1VQL3 1YGEA 1B21A 3CCR3 2F5WA 2UX0A 4N6OB 4WYKB 1FUWA 1V58A 2OCTA 3CNXA 1EKMA 1W5ZA 3BIRA 9RNTA 1B20A 6GSPA 1I2FA 1Q40B 2R41A 4WHAA 3NQYA 4BTWA 2BMQB 1PFPA 3S28A 2BIRA 2F98A 3NBJA 1JB4A 3ECFA 1N8QA 3LTAA 2P38A 3Q2PA 1O7WB 2CX0A 4N6UA 3D5GA 3MPHA 1C54A 4O02B 3RNTA 1YGWA 3ROBA 3VF1A 4MEIA 1BRJA 2BHMA 3B8LA 4MMXB 2HMOB 5BVBA 2IMJA 1LNIA 1UGIA 3GZRA 2GU3A 1UW1A 4MJDA 1KD14 1GS3A 5GSPA 1LVNA 1OGZA 3DM8A 1EA2A 1BRHA 1IVXA 1JJ22 3BNCA 1JV2B 1OHSA 2CFGA 2GSPA 2P05A 4HJLB 4BTYA 1K8A4 1G0TA 3CCU3 1NU3A 2CWTA 1M9GA 4HM6B 1FA3A 3MG1A 2L1SA 2YFJB 2BMRB 1ASKA 2AADA 3WOEB 2QA43 1GY7A 4KVHA 1RN7A 5BXQA 1BAOA 1NB3I 4HM1B 3PGBA 1Q824 3MSOA 2GBWB 3DXOA 3URPA 1QJGA 3EN8A 1WQLB 2IUJA 4G1MB 3WDGB 1VQP3 1UCKA 2XEPA 3KKGA 1RGGA 3QRDA 3BNBA 1QAKA 1JNQA 1IK3A 3CMA3 4HM4B 1GY6A 1T2IA 1CEWI 1BNFA 3IPTA 3HX8A 3I553 1IQXA 2HMNB 3TDGA 1Z1SA 4TX4A 5LC7A 5IG4A 4WWUC 1LQGC 2WGQA 1OUNA 3BLZA 1TP6A 3KZTA 5ELJA 4BU4A 1X1XA 2HMJB 1VQ83 2CK3H 1UUGB 3S5CA 1TIJA 3ZG0A 3ZG5A 2QEX3 3K9MC 3FKAA 2C10A 4I5QA 4IIAA 1RNBA 2HMLB 3WMDA 1U8CB 1KQS2 3CD63 5D83A 1CYVA 1DETA 1Y4KA 2QIYA 4RNTA 2WOFA 1W2B2 2CG1A 1SPUA 4MMZB 1YIT3 3I563 1NWWA 1STDA 1UI7A 1BRNL 1VQN3 1D6ZA 2CFDA 2B24B 5STDA 1GY5A 2CWUA 3G8ZA 5LC6A 1RGFA 3T0UA 4HOHA 1BRSA 1TTOA 3HIIA 1MWRA 3G16A 2K54A 2STDA 1R4YA 5IG5A 1TFOA 4L8OA 1BRIA 3CCL3 1K9M4 4LSOA 2UUGC 2KF4A 1LXEA 3GZBA 3VSYA 1JZDA 1D6UA 2JQ5A 3JUNA 1N5HA 3JUMA 3PCRA 3N8BA 1VQO3 4R1KA 4HM5B 4WP5A 4DKIA 5G1KA 2HOHA 1G02A 1RRHA 1WNHA 2K0MA 1LOYA 1A2VA 2V1LA 6STDA 1NB5I 1VQ63 3ALAA 2IA7A 3DGYA 4FR9A 1A2KA 2D1WA 1GOVA 1DVDA 1BRKA 1OPYA 2CKFB 3F7XA 5CK6A 1RGCA 2GEXA 3ZFZA 3L0RA 7STDA 3BU4A 2KXGA 1BGSA 2GXFA 1KC84 3S67A 3CCJ3 1RLSA 1BRGA 1O7PB 5D82A 1GMQA 3DH2A 2GEYA 4MMYB 3FSDA 1DMNA 1BIRA 5AYSC 1B27A 4J8TA 1I0XA 4IPBA 2BU4A 1CH0A 3KE7A 1Q9EA 1RCKA 3D5IA 4N6LA 2H0HA 1EEJA 1W4NA 2XGLA 1OH0A 1BVIA 1MWTA 2RSXA 5JPPA 1ZX2A 3NBBA 4XB5A 3LTDA 4EBGA 4CCVA 1N8R4 4RZMA 1JBTA 1JB5A 1TRPA 4KFEA 1UCJA 2KF5A 3CCS3 1DE3A 1GMRA 1I2GA 2Z76A 3T8NA 1VQQA 1RN1A 1E3VA 1FGQA 1GMPA 2IUKA 3WA3A 3V92A 2OTL3 1B2XA 5EQLA 3DUKA 3Q1CA 2CX1A 1Q7HA 1GD3A 1LOWA 1HZ1A 1N9JA 2JDIH 3EBTA 3G0KA 3O8YA 4KFFA 1I8VA 1RDSA 1US1A 2YFIB 3E99A 4HBRA 1I3FA 3RGAA 3S27A 1WTHA 1YIJ3 5ELUA 1K41A 4CPKA 1DYUA 1TU5A 4KT3B 3BNDA 3EX9A 3D9RA 4PEJA 3QK9A 1LQMB 1HYFA 1E3RA 1NO3A 2XSOB 2ZHXB 3OW22 1GSPA 5D81A 1K28A 1STFI 1RGHA 1BNSA 1RCLA 4XBTA 3SVAA 3KCHA 3F8HA 2HMKB 2F5MA 1DVCA 2F86B 3GAXA 3CCQ3 3F14A 4OVMA 2CH9A 1O7GB 1SQWA 3STDA 2SBLA 3FLJA 1UUWB 2J8XB 3EBYA 2CHCA 2BMOB 2BT3A 1HKXA 1NDOB 1R4CA 1WMOA 3NX0A 3OXAA 4EV5A 5IENA 1BU4A 3AHWA 1JBSA 2KRTA 5KP1A 3WR2A 1YJW3 3LXUX 2GBXB 2QGUA 5TGNA 1A2PA 4FMBA 1RHLA 1EQKA 2AAEA 4L8PA 1BSDA 1JB2A 4LMIA 3X40A 1KSIA 3MKIA 5JPUA 3G6E3 3MHEA 1AY7A 1AV4A 1T5YA 3U1WA 1IQYA 8RNTA 1X1UA 3PS8A 3PYJA 2R4IA 1BUQA 4ZM8A 2YX9A 1QAFA 5CXOA 3UL5A 1IU7A 1I3IA 4HM7B 2W2CA 1GD4A 1BNJA 3CU3A 3KIIA 2RGQA 1ZO2A 2PNCA 5RNTA 3LMLA 4XM4A 3J7Yd 3AGNA 1BSBA 4XDWA 5CF1A 1A90A 2WO0A 3CPW2 1JN5A 1N9EA 1RNTA 1WMPA 1DMQA 3EQQB 3SX1A 3FH1A 1NNVA 1SARA 3OV4A 3Q3FA 2Q07A 2WGOA 3LT8A 2CC3A 2CFKA 3D79A 4BTXA 3LOYA 1I0VA 3NXJA 3EE1A 4EW5A 3MYTA 1BANA 1YHQ3 2ZL8A 5IEPA 1MWUA 1RJOA 1FUSA 3H3HA 7RNTA 3FF2A 4BIRA 1OHPA 1M1K4 1BNRA 4ILFA 4HKVB 4RBNA 4N6TA 1B2SA 2IY2A 1HU9A 1O7MB 3I0YA 3DY5A 4JF8A 1LOXA 1UGHI 2OQEC 2OQEA 2WOHA 4CJNA 2UGIA 1B3SA 5CF2A 3G713 3CNMA 3JUQA 1GYBA 2Y73A 3A5EA 5IG0A 1OGXA 4N6V0 5IERA 3X3XA 2E2UA 3IMAB 3CME3 1BSEA 2F56A 6RNTA 2O9UX 1IT8A 1QALA 2O3OA 4X2HA 5IW9A 4LEHA 1OCVA 3CCM3 1AVKA 3FF0A 2ZDJA 5AIHA 3DGMA 2W56B 2P09A 3X3ZA 5FW5A 4GB5A 1VQ93 4GL6A 3HOHA 1L5GB 1IQ8A 1WMNA 1V74A 4R80A 1W6YA 2F4YA 2W6JH 4HAAA 1JN5B 1LRAA 2ML5A 2MC8A 2RBIA 3CPOA 5EEOA 1V57A 2C11A 4BL2A 3DGLA 1GOYA 4O3VA 5HGRA 1FUTA 4XBYA 1JKGA 1W6GA 5M19A 1BNEA 1I2EA 3EF8A 3SOAA 4HVNA 1IT7A 2CG0A 4K1VA 2GU1A 3KSED 2CFLA 2KCDA 3OX9A 4FMCA 3V99A 3CCE3 3FG1A 3PCSA 4EXRA 1VQ53 3AMOA 5M18A 2K3DA 1PYLA 5AIGA 3G4S3 1LOVA 4HZBB 3NV0B 2ML6A 4HYZA 4AEQA 1FGTA 3A76A 3MG2A 3EC9A 2FXTA 3RDEA 1IVUA 1BNGA 1W7CA 1RN4A 1A67A 1IV9A 1RKYA 3GZXB 1O7HB 1UI8A 1KWIA 1ULIB 1SIIA
chains in the Genus database with same CATH topology
2FGTA 3GWRA 3D3LA 3UL6A 1YJ93 3K7CA 1VQK3 3FG4A 2E2VA 1Q864 3K63A 1J2BA 2D42A 3EN1B 4HM8B 3CXC2 2XSHB 1DMMA 1ROAA 2W0QA 4EC6A 1LNHA 3CCV3 1SJWA 2XFSA 1OHOA 1TUHA 3LZAA 1S5AA 3DZLA 3X3YA 1RRLA 4Q53A 2YFLB 1C7HA 3GZYB 1FGRA 4LZIA 1VQ43 1CYUA 3DMCA 2CWVA 3CC73 4HM0B 1ROVA 4X2OA 2XH9A 3KSPA 3X42A 1ULJB 1W2ZA 3B4OA 1JKGB 4O8SA 4LGQA 3SOYA 3NM7A 4N3VA 3NM2A 4L7KA 2HMMB 2PZVA 3SXXA 4KFDA 1M1XB 4FCJA 1ISKA 1OF5A 1Q42A 3LH4A 3UB1A 3AMOB 1FGMA 4AKYA 3EHCA 3F40A 2W9QA 3MWZA 1EG9B 4J9AA 1M904 3WOFB 4WFOA 5KP3A 3JUOA 2BNGA 5DREA 1YI23 1W01A 3HI7A 3N54B 1VZZA 5IF6A 3ER7A 2A15A 2P0MA 2XF3A 3IJEB 1W00A 2OWPA 2XR8B 4HZ9B 5AIIA 2LYXA 2W56A 2W03A 1D6YA 2P0XA 4ORLA 3PXMA 3K0ZA 4O2HA 5AI1A 1W02A 5FGOA 1JRQA 3LTCA 1QVG2 1S723 4K1UA 3X41A 3S29A 4U13A 3T8UA 3K5TA 1N5PA 4FCZA 4OUQA 2CIUA 1YJN3 3JUPA 1IVWA 3DGNA 4N6NB 5AIFA 4EYCA 5JBSA 4HM3B 3NQZA 3UNLA 2Z77A 2RCDA 3M8CA 4NREA 3GRDA 4IT7A 3FG3A 2I9WA 4EV2A 4R9KA 1F8NA 1OF5B 3N9HA 3BB9A 3KN4A 5IEOA 1IV7A 4XDVA 2CW9A 3EJVA 3FGYA 2XFTA 4N6MA 5EVHA 3NV0A 1QMAA 3MG3A 3UJMA 1FGOA 1TFKA 3F7SA 2Y74A 4CDLA 1OACA 1G96A 1MNLA 2Z7AA 1K734 3OWYA 1MOLA 3H51A 3B7CA 3KFQC 3LYGA 3OWSA 5AYRB 3SLUA 1IVVA 2W9PA 3HK4A 3NBRA 2RFRA 1YVBI 4FMDA 8CHOA 4RNZA 3FZWA 4OK0A 3SEDA 1W6CA 4R9LA 3WODG 3WA2X 2L4VA 3LT9A 4I4KA 4AKZA 1NJI4 1IDPA 1VQM3 3F8XA 1E97A 1PU4A 2XGNA 3DGOA 5CLKA 4H61A 4R4KA 4WYKA 5AEUB 4H3UA 2M7OA 3U97A 1Q7Y4 5I97A 5IG3A 3EB8A 2XRXB 3B4PA 3BNEA 1Q40A 4RNYA 3NUVA 2OOVC 2OOVA 2MF7A 2E2TA 1CQSA 3RGRA 3LTBA 2OTJ3 5DRVA 2F99A 3CC43 5A0OB 2LQVA 3HZPA 4NHFA 5KP4A 1UUVB 3PZWA 1AVLA 3HIGA 2INXA 1SIHA 3F9SA 3NHXA 1Q814 4XBXA 1U5OA 2CFWA 2W04A 3JVCA 4QWTA 3VGNA 1QVF2 3FCSB 5AEWB 3CC23 1O7NB 5G2GA 3Q90A 4STDA 3V98A 2BO9B 4KZ1A 1VQ73 4K90B 2FNQA 2Z6BA 4FCMA 4FMAA 4K61A 4JRFA 3OWUA 4HM2B 2B1XB 1AR0A 1VQL3 1YGEA 3CCR3 2UX0A 4WYKB 4N6OB 1FUWA 2OCTA 3CNXA 1EKMA 1W5ZA 1Q40B 4WHAA 3NQYA 4BTWA 2BMQB 1PFPA 3S28A 2F98A 3NBJA 1JB4A 3ECFA 1N8QA 3LTAA 2P38A 3Q2PA 1O7WB 4N6UA 3MPHA 4O02B 3ROBA 3VF1A 4MEIA 2BHMA 3B8LA 4MMXB 2HMOB 5BVBA 2IMJA 3GZRA 2GU3A 1UW1A 4MJDA 1KD14 1GS3A 1LVNA 1OGZA 3DM8A 1EA2A 1IVXA 1JJ22 3BNCA 1JV2B 1OHSA 2CFGA 2P05A 4HJLB 4BTYA 1K8A4 3CCU3 1NU3A 2CWTA 1M9GA 4HM6B 1FA3A 3MG1A 2YFJB 2BMRB 1ASKA 3WOEB 2QA43 1GY7A 4KVHA 1RN7A 5BXQA 1NB3I 4HM1B 3PGBA 1Q824 3MSOA 2GBWB 3DXOA 1QJGA 3EN8A 1WQLB 2IUJA 4G1MB 3WDGB 1VQP3 3KKGA 2XEPA 3QRDA 3BNBA 1QAKA 1JNQA 1IK3A 3CMA3 4HM4B 1GY6A 1CEWI 3IPTA 3HX8A 3I553 1IQXA 2HMNB 3TDGA 1Z1SA 4TX4A 5LC7A 5IG4A 4WWUC 2WGQA 1OUNA 3BLZA 1TP6A 3KZTA 5ELJA 1VQ83 2HMJB 2CK3H 2QEX3 3S5CA 1TIJA 3K9MC 3FKAA 2C10A 4IIAA 2HMLB 3WMDA 1U8CB 1KQS2 3CD63 5D83A 1CYVA 1Y4KA 2QIYA 2WOFA 1W2B2 2CG1A 1SPUA 4MMZB 1YIT3 3I563 1NWWA 1STDA 1UI7A 1VQN3 1D6ZA 2CFDA 2B24B 5STDA 1GY5A 2CWUA 3G8ZA 5LC6A 3T0UA 3HIIA 3G16A 2K54A 2STDA 5IG5A 1TFOA 4L8OA 3CCL3 1K9M4 4LSOA 1LXEA 3GZBA 3VSYA 1D6UA 2JQ5A 3JUNA 1N5HA 3JUMA 3PCRA 3N8BA 1VQO3 4R1KA 4HM5B 4WP5A 1RRHA 2K0MA 1WNHA 6STDA 1VQ63 1A2VA 2V1LA 1NB5I 3ALAA 2IA7A 4FR9A 1A2KA 2D1WA 1DVDA 1OPYA 2CKFB 5CK6A 3F7XA 2GEXA 3L0RA 7STDA 2KXGA 2GXFA 1KC84 3S67A 3CCJ3 1O7PB 5D82A 2GEYA 4MMYB 3FSDA 1DMNA 5AYSC 4J8TA 4IPBA 3KE7A 4N6LA 1W4NA 2XGLA 1OH0A 2RSXA 5JPPA 1ZX2A 3NBBA 4XB5A 3LTDA 4EBGA 4CCVA 1N8R4 4RZMA 1JB5A 4KFEA 3CCS3 2Z76A 3T8NA 1E3VA 1FGQA 2IUKA 3WA3A 3V92A 2OTL3 5EQLA 3DUKA 3Q1CA 1GD3A 1N9JA 3G0KA 2JDIH 3EBTA 3O8YA 4KFFA 1US1A 2YFIB 3E99A 4HBRA 3RGAA 3S27A 1WTHA 1YIJ3 5ELUA 1K41A 1DYUA 1TU5A 3BNDA 3EX9A 3D9RA 4PEJA 3QK9A 1NO3A 1E3RA 3OW22 2XSOB 5D81A 1K28A 1STFI 4XBTA 3SVAA 3F8HA 2HMKB 1DVCA 2F86B 3GAXA 3CCQ3 3F14A 4OVMA 2CH9A 1O7GB 1SQWA 3STDA 2SBLA 3FLJA 1UUWB 3EBYA 2CHCA 2BMOB 2BT3A 1HKXA 1NDOB 1R4CA 1WMOA 3NX0A 3OXAA 4EV5A 5IENA 2KRTA 5KP1A 1YJW3 3LXUX 2GBXB 2QGUA 5TGNA 4FMBA 1EQKA 4L8PA 1JB2A 4LMIA 3X40A 1KSIA 3MKIA 5JPUA 3G6E3 3MHEA 1AV4A 1T5YA 3U1WA 1IQYA 3PS8A 3PYJA 2R4IA 1BUQA 4ZM8A 2YX9A 1QAFA 5CXOA 3UL5A 1IU7A 4HM7B 2W2CA 1GD4A 3CU3A 3KIIA 2RGQA 1ZO2A 2PNCA 3J7Yd 3LMLA 4XM4A 4XDWA 5CF1A 1A90A 2WO0A 3CPW2 1JN5A 1N9EA 1WMPA 3EQQB 1DMQA 3SX1A 3FH1A 3OV4A 2Q07A 2WGOA 3LT8A 2CC3A 2CFKA 4BTXA 3LOYA 3NXJA 3EE1A 3MYTA 1YHQ3 2ZL8A 5IEPA 1RJOA 3H3HA 3FF2A 1OHPA 1M1K4 4HKVB 4RBNA 4N6TA 1HU9A 1O7MB 3I0YA 3DY5A 4JF8A 1LOXA 2OQEC 2OQEA 2WOHA 5CF2A 3G713 3CNMA 3JUQA 1GYBA 2Y73A 5IG0A 5IERA 1OGXA 4N6V0 3X3XA 2E2UA 3IMAB 3CME3 2O9UX 1IT8A 1QALA 2O3OA 4X2HA 5IW9A 4LEHA 1OCVA 3CCM3 1AVKA 3FF0A 2ZDJA 5AIHA 3DGMA 2W56B 2P09A 3X3ZA 5FW5A 4GB5A 1VQ93 4GL6A 1L5GB 1IQ8A 1WMNA 1V74A 4R80A 1W6YA 2W6JH 2MC8A 1JN5B 2ML5A 3CPOA 5EEOA 2C11A 3DGLA 4O3VA 5HGRA 4XBYA 1JKGA 1W6GA 3EF8A 3SOAA 4HVNA 1IT7A 2CG0A 4K1VA 2GU1A 3KSED 2CFLA 2KCDA 3OX9A 4FMCA 3V99A 3CCE3 3FG1A 3PCSA 4EXRA 1VQ53 3AMOA 5AIGA 3G4S3 4HZBB 3NV0B 2ML6A 4HYZA 4AEQA 1FGTA 3A76A 3MG2A 3EC9A 2FXTA 3RDEA 1IVUA 1W7CA 1A67A 1IV9A 1RKYA 3GZXB 1O7HB 1UI8A 1KWIA 1ULIB 1SIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 3;  1VQK 3;  2QA4 3;  1KC8 4;  1QVF 2;  1Q86 4;  3CC2 3;  1VQ8 3;  1Q7Y 4;  3G71 3;  3CCJ 3;  1QVG 2;  2QEX 3;  1S72 3;  1Q82 4;  3CCL 3;  1YIJ 3;  1K73 4;  1K9M 4;  3CPW 2;  3CME 3;  3CXC 2;  3CCV 3;  1VQ7 3;  1VQP 3;  1YJW 3;  1KQS 2;  3CCE 3;  3CCM 3;  1YJN 3;  1M90 4;  3CD6 3;  1VQO 3;  2OTJ 3;  3OW2 2;  1W2B 2;  1VQ4 3;  1KD1 4;  1VQ5 3;  3CC4 3;  3G4S 3;  1YIT 3;  3CMA 3;  3I56 3;  1VQ6 3;  1YI2 3;  3CC7 3;  1N8R 4;  3G6E 3;  1JJ2 2;  1VQL 3;  1YHQ 3;  1VQ9 3;  1VQN 3;  3CCR 3;  1K8A 4;  3I55 3;  3CCS 3;  3CCU 3;  1Q81 4;  1NJI 4;  1M1K 4;  1VQM 3;  3CCQ 3;  2OTL 3; 
#chains in the Genus database with same CATH topology
 2FGT A;  3GWR A;  2RNT A;  3D3L A;  3UL6 A;  1YJ9 3;  3K7C A;  1VQK 3;  1ZGX A;  3FG4 A;  2E2V A;  1Q86 4;  1B2U A;  3K63 A;  3D4A A;  1BSC A;  2D42 A;  3EN1 B;  1J2B A;  4HM8 B;  3CXC 2;  2XSH B;  1DMM A;  1ROA A;  2W0Q A;  4EC6 A;  1LNH A;  3CCV 3;  1SJW A;  2XFS A;  1OHO A;  1TUH A;  3LZA A;  1S5A A;  3DZL A;  3X3Y A;  1RRL A;  4Q53 A;  2YFL B;  1BNI A;  1C7H A;  1FGR A;  3GZY B;  1ZS7 A;  4LZI A;  1VQ4 3;  1CYU A;  3DMC A;  2CWV A;  3CC7 3;  1B2M A;  4HM0 B;  3AHS A;  1ROV A;  4X2O A;  2XH9 A;  3KSP A;  3X42 A;  1ULJ B;  2ZA4 A;  1W2Z A;  3B4O A;  1JKG B;  1RMS A;  4LGQ A;  4O8S A;  3NM7 A;  3SOY A;  4N3V A;  3NM2 A;  1GOU A;  4L7K A;  2HMM B;  2PZV A;  3SXX A;  1YNV X;  4KFD A;  1M1X B;  4FCJ A;  1ISK A;  1OF5 A;  1Q42 A;  3LH4 A;  3UB1 A;  3AMO B;  1FGM A;  4AKY A;  3EHC A;  3F40 A;  2H0G A;  3SYU A;  2W9Q A;  3MWZ A;  3WHO A;  1EG9 B;  3GSP A;  4J9A A;  1I70 A;  1M90 4;  1UDI I;  1UCL A;  3WOF B;  4WFO A;  5KP3 A;  3JUO A;  2IYJ A;  1TJD A;  2BNG A;  5DRE A;  2SAR A;  1YI2 3;  1W01 A;  3HI7 A;  3N54 B;  1MGR A;  1VZZ A;  4GSP A;  5IF6 A;  3ER7 A;  2A15 A;  2P0M A;  2XF3 A;  3IJE B;  1W00 A;  2OWP A;  2XR8 B;  4HZ9 B;  5AII A;  2LYX A;  2W56 A;  2W03 A;  4GHO A;  1D6Y A;  1RSN A;  1EUI C;  2P0X A;  3PXM A;  4J5K A;  4ORL A;  3K0Z A;  4O2H A;  5AI1 A;  1W02 A;  7GSP A;  5FGO A;  1JRQ A;  3LTC A;  1QVG 2;  1S72 3;  1FW7 A;  4K1U A;  3X41 A;  3S29 A;  4U13 A;  3T8U A;  3K5T A;  1N5P A;  4FCZ A;  1RGL A;  4OUQ A;  1RGE A;  2CIU A;  1YJN 3;  3JUP A;  1IVW A;  1TRQ A;  3DGN A;  4N6N B;  5AIF A;  1UCI A;  1BOX A;  4EYC A;  5JBS A;  5G1L A;  4HM3 B;  3NQZ A;  3UNL A;  2Z77 A;  2RCD A;  1YVS A;  3M8C A;  4NRE A;  3GRD A;  4IT7 A;  1X1W A;  3FG3 A;  2I9W A;  4EV2 A;  4R9K A;  1F8N A;  1OF5 B;  3N9H A;  3BB9 A;  3KN4 A;  5IEO A;  2KF6 A;  1IV7 A;  4XDV A;  2CW9 A;  3EJV A;  3FGY A;  2XFT A;  4N6M A;  5EVH A;  3NV0 A;  1IYY A;  1QMA A;  3MG3 A;  3UJM A;  1FGO A;  1TFK A;  3F7S A;  2Y74 A;  4CDL A;  1OAC A;  1FYS A;  1G96 A;  1MGW A;  1MNL A;  1X1Y A;  2C4B A;  2Z7A A;  1K73 4;  3OWY A;  1JZO A;  1MOL A;  3H51 A;  3B7C A;  3KFQ C;  1MWS A;  3LYG A;  3OWS A;  5AYR B;  3SLU A;  1IVV A;  2W9P A;  3HK4 A;  3NBR A;  1T2H A;  1YVB I;  2H0I A;  2RFR A;  4FMD A;  8CHO A;  4RNZ A;  1RGK A;  3FZW A;  4OK0 A;  3SED A;  1W6C A;  4R9L A;  3WOD G;  3WA2 X;  2L4V A;  3LT9 A;  4I4K A;  2KAA A;  4AKZ A;  1NJI 4;  1IDP A;  1VQM 3;  3F8X A;  1E97 A;  1PU4 A;  5BU4 A;  2XGN A;  3DGO A;  5CLK A;  4H61 A;  5HOH A;  4R4K A;  4WYK A;  5AEU B;  4H3U A;  2M7O A;  3U97 A;  1Q7Y 4;  1RGA A;  2KF3 A;  5I97 A;  5IG3 A;  3EB8 A;  2XRX B;  3B4P A;  3BNE A;  1Q40 A;  3AGO A;  4RNY A;  4BL3 A;  4LYL B;  3NUV A;  2OOV C;  2OOV A;  2MF7 A;  2E2T A;  1CQS A;  1RTU A;  4J5G A;  3RGR A;  3LTB A;  2OTJ 3;  5DRV A;  1FZU A;  2F99 A;  3CC4 3;  1PY3 A;  5A0O B;  2LQV A;  1JBR A;  3HZP A;  4NHF A;  5KP4 A;  1UUV B;  3PZW A;  1AVL A;  3HIG A;  2INX A;  1SIH A;  3F9S A;  3NHX A;  5BIR A;  1Q81 4;  1BUJ A;  4NPB A;  4XBX A;  1U5O A;  2CFW A;  2W04 A;  3JVC A;  4QWT A;  3VGN A;  1QVF 2;  3FCS B;  5AEW B;  3CC2 3;  1O7N B;  5G2G A;  1B2Z A;  3Q90 A;  4STD A;  3V98 A;  2BO9 B;  4KZ1 A;  1VQ7 3;  4K90 B;  2FNQ A;  2Z6B A;  4FCM A;  4FMA A;  4K61 A;  4JRF A;  3OWU A;  1BSA A;  5M1A A;  4HM2 B;  1AQZ A;  1T3B A;  2B1X B;  1AR0 A;  1VQL 3;  1YGE A;  1B21 A;  3CCR 3;  2F5W A;  2UX0 A;  4N6O B;  4WYK B;  1FUW A;  1V58 A;  2OCT A;  3CNX A;  1EKM A;  1W5Z A;  3BIR A;  9RNT A;  1B20 A;  6GSP A;  1I2F A;  1Q40 B;  2R41 A;  4WHA A;  3NQY A;  4BTW A;  2BMQ B;  1PFP A;  3S28 A;  2BIR A;  2F98 A;  3NBJ A;  1JB4 A;  3ECF A;  1N8Q A;  3LTA A;  2P38 A;  3Q2P A;  1O7W B;  2CX0 A;  4N6U A;  3D5G A;  3MPH A;  1C54 A;  4O02 B;  3RNT A;  1YGW A;  3ROB A;  3VF1 A;  4MEI A;  1BRJ A;  2BHM A;  3B8L A;  4MMX B;  2HMO B;  5BVB A;  2IMJ A;  1LNI A;  1UGI A;  3GZR A;  2GU3 A;  1UW1 A;  4MJD A;  1KD1 4;  1GS3 A;  5GSP A;  1LVN A;  1OGZ A;  3DM8 A;  1EA2 A;  1BRH A;  1IVX A;  1JJ2 2;  3BNC A;  1JV2 B;  1OHS A;  2CFG A;  2GSP A;  2P05 A;  4HJL B;  4BTY A;  1K8A 4;  1G0T A;  3CCU 3;  1NU3 A;  2CWT A;  1M9G A;  4HM6 B;  1FA3 A;  3MG1 A;  2L1S A;  2YFJ B;  2BMR B;  1ASK A;  2AAD A;  3WOE B;  2QA4 3;  1GY7 A;  4KVH A;  1RN7 A;  5BXQ A;  1BAO A;  1NB3 I;  4HM1 B;  3PGB A;  1Q82 4;  3MSO A;  2GBW B;  3DXO A;  3URP A;  1QJG A;  3EN8 A;  1WQL B;  2IUJ A;  4G1M B;  3WDG B;  1VQP 3;  1UCK A;  2XEP A;  3KKG A;  1RGG A;  3QRD A;  3BNB A;  1QAK A;  1JNQ A;  1IK3 A;  3CMA 3;  4HM4 B;  1GY6 A;  1T2I A;  1CEW I;  1BNF A;  3IPT A;  3HX8 A;  3I55 3;  1IQX A;  2HMN B;  3TDG A;  1Z1S A;  4TX4 A;  5LC7 A;  5IG4 A;  4WWU C;  1LQG C;  2WGQ A;  1OUN A;  3BLZ A;  1TP6 A;  3KZT A;  5ELJ A;  4BU4 A;  1X1X A;  2HMJ B;  1VQ8 3;  2CK3 H;  1UUG B;  3S5C A;  1TIJ A;  3ZG0 A;  3ZG5 A;  2QEX 3;  3K9M C;  3FKA A;  2C10 A;  4I5Q A;  4IIA A;  1RNB A;  2HML B;  3WMD A;  1U8C B;  1KQS 2;  3CD6 3;  5D83 A;  1CYV A;  1DET A;  1Y4K A;  2QIY A;  4RNT A;  2WOF A;  1W2B 2;  2CG1 A;  1SPU A;  4MMZ B;  1YIT 3;  3I56 3;  1NWW A;  1STD A;  1UI7 A;  1BRN L;  1VQN 3;  1D6Z A;  2CFD A;  2B24 B;  5STD A;  1GY5 A;  2CWU A;  3G8Z A;  5LC6 A;  1RGF A;  3T0U A;  4HOH A;  1BRS A;  1TTO A;  3HII A;  1MWR A;  3G16 A;  2K54 A;  2STD A;  1R4Y A;  5IG5 A;  1TFO A;  4L8O A;  1BRI A;  3CCL 3;  1K9M 4;  4LSO A;  2UUG C;  2KF4 A;  1LXE A;  3GZB A;  3VSY A;  1JZD A;  1D6U A;  2JQ5 A;  3JUN A;  1N5H A;  3JUM A;  3PCR A;  3N8B A;  1VQO 3;  4R1K A;  4HM5 B;  4WP5 A;  4DKI A;  5G1K A;  2HOH A;  1G02 A;  1RRH A;  1WNH A;  2K0M A;  1LOY A;  1A2V A;  2V1L A;  6STD A;  1NB5 I;  1VQ6 3;  3ALA A;  2IA7 A;  3DGY A;  4FR9 A;  1A2K A;  2D1W A;  1GOV A;  1DVD A;  1BRK A;  1OPY A;  2CKF B;  3F7X A;  5CK6 A;  1RGC A;  2GEX A;  3ZFZ A;  3L0R A;  7STD A;  3BU4 A;  2KXG A;  1BGS A;  2GXF A;  1KC8 4;  3S67 A;  3CCJ 3;  1RLS A;  1BRG A;  1O7P B;  5D82 A;  1GMQ A;  3DH2 A;  2GEY A;  4MMY B;  3FSD A;  1DMN A;  1BIR A;  5AYS C;  1B27 A;  4J8T A;  1I0X A;  4IPB A;  2BU4 A;  1CH0 A;  3KE7 A;  1Q9E A;  1RCK A;  3D5I A;  4N6L A;  2H0H A;  1EEJ A;  1W4N A;  2XGL A;  1OH0 A;  1BVI A;  1MWT A;  2RSX A;  5JPP A;  1ZX2 A;  3NBB A;  4XB5 A;  3LTD A;  4EBG A;  4CCV A;  1N8R 4;  4RZM A;  1JBT A;  1JB5 A;  1TRP A;  4KFE A;  1UCJ A;  2KF5 A;  3CCS 3;  1DE3 A;  1GMR A;  1I2G A;  2Z76 A;  3T8N A;  1VQQ A;  1RN1 A;  1E3V A;  1FGQ A;  1GMP A;  2IUK A;  3WA3 A;  3V92 A;  2OTL 3;  1B2X A;  5EQL A;  3DUK A;  3Q1C A;  2CX1 A;  1Q7H A;  1GD3 A;  1LOW A;  1HZ1 A;  1N9J A;  2JDI H;  3EBT A;  3G0K A;  3O8Y A;  4KFF A;  1I8V A;  1RDS A;  1US1 A;  2YFI B;  3E99 A;  4HBR A;  1I3F A;  3RGA A;  3S27 A;  1WTH A;  1YIJ 3;  5ELU A;  1K41 A;  4CPK A;  1DYU A;  1TU5 A;  4KT3 B;  3BND A;  3EX9 A;  3D9R A;  4PEJ A;  3QK9 A;  1LQM B;  1HYF A;  1E3R A;  1NO3 A;  2XSO B;  2ZHX B;  3OW2 2;  1GSP A;  5D81 A;  1K28 A;  1STF I;  1RGH A;  1BNS A;  1RCL A;  4XBT A;  3SVA A;  3KCH A;  3F8H A;  2HMK B;  2F5M A;  1DVC A;  2F86 B;  3GAX A;  3CCQ 3;  3F14 A;  4OVM A;  2CH9 A;  1O7G B;  1SQW A;  3STD A;  2SBL A;  3FLJ A;  1UUW B;  2J8X B;  3EBY A;  2CHC A;  2BMO B;  2BT3 A;  1HKX A;  1NDO B;  1R4C A;  1WMO A;  3NX0 A;  3OXA A;  4EV5 A;  5IEN A;  1BU4 A;  3AHW A;  1JBS A;  2KRT A;  5KP1 A;  3WR2 A;  1YJW 3;  3LXU X;  2GBX B;  2QGU A;  5TGN A;  1A2P A;  4FMB A;  1RHL A;  1EQK A;  2AAE A;  4L8P A;  1BSD A;  1JB2 A;  4LMI A;  3X40 A;  1KSI A;  3MKI A;  5JPU A;  3G6E 3;  3MHE A;  1AY7 A;  1AV4 A;  1T5Y A;  3U1W A;  1IQY A;  8RNT A;  1X1U A;  3PS8 A;  3PYJ A;  2R4I A;  1BUQ A;  4ZM8 A;  2YX9 A;  1QAF A;  5CXO A;  3UL5 A;  1IU7 A;  1I3I A;  4HM7 B;  2W2C A;  1GD4 A;  1BNJ A;  3CU3 A;  3KII A;  2RGQ A;  1ZO2 A;  2PNC A;  5RNT A;  3LML A;  4XM4 A;  3J7Y d;  3AGN A;  1BSB A;  4XDW A;  5CF1 A;  1A90 A;  2WO0 A;  3CPW 2;  1JN5 A;  1N9E A;  1RNT A;  1WMP A;  1DMQ A;  3EQQ B;  3SX1 A;  3FH1 A;  1NNV A;  1SAR A;  3OV4 A;  3Q3F A;  2Q07 A;  2WGO A;  3LT8 A;  2CC3 A;  2CFK A;  3D79 A;  4BTX A;  3LOY A;  1I0V A;  3NXJ A;  3EE1 A;  4EW5 A;  3MYT A;  1BAN A;  1YHQ 3;  2ZL8 A;  5IEP A;  1MWU A;  1RJO A;  1FUS A;  3H3H A;  7RNT A;  3FF2 A;  4BIR A;  1OHP A;  1M1K 4;  1BNR A;  4ILF A;  4HKV B;  4RBN A;  4N6T A;  1B2S A;  2IY2 A;  1HU9 A;  1O7M B;  3I0Y A;  3DY5 A;  4JF8 A;  1LOX A;  1UGH I;  2OQE C;  2OQE A;  2WOH A;  4CJN A;  2UGI A;  1B3S A;  5CF2 A;  3G71 3;  3CNM A;  3JUQ A;  1GYB A;  2Y73 A;  3A5E A;  5IG0 A;  1OGX A;  4N6V 0;  5IER A;  3X3X A;  2E2U A;  3IMA B;  3CME 3;  1BSE A;  2F56 A;  6RNT A;  2O9U X;  1IT8 A;  1QAL A;  2O3O A;  4X2H A;  5IW9 A;  4LEH A;  1OCV A;  3CCM 3;  1AVK A;  3FF0 A;  2ZDJ A;  5AIH A;  3DGM A;  2W56 B;  2P09 A;  3X3Z A;  5FW5 A;  4GB5 A;  1VQ9 3;  4GL6 A;  3HOH A;  1L5G B;  1IQ8 A;  1WMN A;  1V74 A;  4R80 A;  1W6Y A;  2F4Y A;  2W6J H;  4HAA A;  1JN5 B;  1LRA A;  2ML5 A;  2MC8 A;  2RBI A;  3CPO A;  5EEO A;  1V57 A;  2C11 A;  4BL2 A;  3DGL A;  1GOY A;  4O3V A;  5HGR A;  1FUT A;  4XBY A;  1JKG A;  1W6G A;  5M19 A;  1BNE A;  1I2E A;  3EF8 A;  3SOA A;  4HVN A;  1IT7 A;  2CG0 A;  4K1V A;  2GU1 A;  3KSE D;  2CFL A;  2KCD A;  3OX9 A;  4FMC A;  3V99 A;  3CCE 3;  3FG1 A;  3PCS A;  4EXR A;  1VQ5 3;  3AMO A;  5M18 A;  2K3D A;  1PYL A;  5AIG A;  3G4S 3;  1LOV A;  4HZB B;  3NV0 B;  2ML6 A;  4HYZ A;  4AEQ A;  1FGT A;  3A76 A;  3MG2 A;  3EC9 A;  2FXT A;  3RDE A;  1IVU A;  1BNG A;  1W7C A;  1RN4 A;  1A67 A;  1IV9 A;  1RKY A;  3GZX B;  1O7H B;  1UI8 A;  1KWI A;  1ULI B;  1SII A; 
#chains in the Genus database with same CATH homology
 2FGT A;  3GWR A;  3D3L A;  3UL6 A;  1YJ9 3;  3K7C A;  1VQK 3;  3FG4 A;  2E2V A;  1Q86 4;  3K63 A;  1J2B A;  2D42 A;  3EN1 B;  4HM8 B;  3CXC 2;  2XSH B;  1DMM A;  1ROA A;  2W0Q A;  4EC6 A;  1LNH A;  3CCV 3;  1SJW A;  2XFS A;  1OHO A;  1TUH A;  3LZA A;  1S5A A;  3DZL A;  3X3Y A;  1RRL A;  4Q53 A;  2YFL B;  1C7H A;  3GZY B;  1FGR A;  4LZI A;  1VQ4 3;  1CYU A;  3DMC A;  2CWV A;  3CC7 3;  4HM0 B;  1ROV A;  4X2O A;  2XH9 A;  3KSP A;  3X42 A;  1ULJ B;  1W2Z A;  3B4O A;  1JKG B;  4O8S A;  4LGQ A;  3SOY A;  3NM7 A;  4N3V A;  3NM2 A;  4L7K A;  2HMM B;  2PZV A;  3SXX A;  4KFD A;  1M1X B;  4FCJ A;  1ISK A;  1OF5 A;  1Q42 A;  3LH4 A;  3UB1 A;  3AMO B;  1FGM A;  4AKY A;  3EHC A;  3F40 A;  2W9Q A;  3MWZ A;  1EG9 B;  4J9A A;  1M90 4;  3WOF B;  4WFO A;  5KP3 A;  3JUO A;  2BNG A;  5DRE A;  1YI2 3;  1W01 A;  3HI7 A;  3N54 B;  1VZZ A;  5IF6 A;  3ER7 A;  2A15 A;  2P0M A;  2XF3 A;  3IJE B;  1W00 A;  2OWP A;  2XR8 B;  4HZ9 B;  5AII A;  2LYX A;  2W56 A;  2W03 A;  1D6Y A;  2P0X A;  4ORL A;  3PXM A;  3K0Z A;  4O2H A;  5AI1 A;  1W02 A;  5FGO A;  1JRQ A;  3LTC A;  1QVG 2;  1S72 3;  4K1U A;  3X41 A;  3S29 A;  4U13 A;  3T8U A;  3K5T A;  1N5P A;  4FCZ A;  4OUQ A;  2CIU A;  1YJN 3;  3JUP A;  1IVW A;  3DGN A;  4N6N B;  5AIF A;  4EYC A;  5JBS A;  4HM3 B;  3NQZ A;  3UNL A;  2Z77 A;  2RCD A;  3M8C A;  4NRE A;  3GRD A;  4IT7 A;  3FG3 A;  2I9W A;  4EV2 A;  4R9K A;  1F8N A;  1OF5 B;  3N9H A;  3BB9 A;  3KN4 A;  5IEO A;  1IV7 A;  4XDV A;  2CW9 A;  3EJV A;  3FGY A;  2XFT A;  4N6M A;  5EVH A;  3NV0 A;  1QMA A;  3MG3 A;  3UJM A;  1FGO A;  1TFK A;  3F7S A;  2Y74 A;  4CDL A;  1OAC A;  1G96 A;  1MNL A;  2Z7A A;  1K73 4;  3OWY A;  1MOL A;  3H51 A;  3B7C A;  3KFQ C;  3LYG A;  3OWS A;  5AYR B;  3SLU A;  1IVV A;  2W9P A;  3HK4 A;  3NBR A;  2RFR A;  1YVB I;  4FMD A;  8CHO A;  4RNZ A;  3FZW A;  4OK0 A;  3SED A;  1W6C A;  4R9L A;  3WOD G;  3WA2 X;  2L4V A;  3LT9 A;  4I4K A;  4AKZ A;  1NJI 4;  1IDP A;  1VQM 3;  3F8X A;  1E97 A;  1PU4 A;  2XGN A;  3DGO A;  5CLK A;  4H61 A;  4R4K A;  4WYK A;  5AEU B;  4H3U A;  2M7O A;  3U97 A;  1Q7Y 4;  5I97 A;  5IG3 A;  3EB8 A;  2XRX B;  3B4P A;  3BNE A;  1Q40 A;  4RNY A;  3NUV A;  2OOV C;  2OOV A;  2MF7 A;  2E2T A;  1CQS A;  3RGR A;  3LTB A;  2OTJ 3;  5DRV A;  2F99 A;  3CC4 3;  5A0O B;  2LQV A;  3HZP A;  4NHF A;  5KP4 A;  1UUV B;  3PZW A;  1AVL A;  3HIG A;  2INX A;  1SIH A;  3F9S A;  3NHX A;  1Q81 4;  4XBX A;  1U5O A;  2CFW A;  2W04 A;  3JVC A;  4QWT A;  3VGN A;  1QVF 2;  3FCS B;  5AEW B;  3CC2 3;  1O7N B;  5G2G A;  3Q90 A;  4STD A;  3V98 A;  2BO9 B;  4KZ1 A;  1VQ7 3;  4K90 B;  2FNQ A;  2Z6B A;  4FCM A;  4FMA A;  4K61 A;  4JRF A;  3OWU A;  4HM2 B;  2B1X B;  1AR0 A;  1VQL 3;  1YGE A;  3CCR 3;  2UX0 A;  4WYK B;  4N6O B;  1FUW A;  2OCT A;  3CNX A;  1EKM A;  1W5Z A;  1Q40 B;  4WHA A;  3NQY A;  4BTW A;  2BMQ B;  1PFP A;  3S28 A;  2F98 A;  3NBJ A;  1JB4 A;  3ECF A;  1N8Q A;  3LTA A;  2P38 A;  3Q2P A;  1O7W B;  4N6U A;  3MPH A;  4O02 B;  3ROB A;  3VF1 A;  4MEI A;  2BHM A;  3B8L A;  4MMX B;  2HMO B;  5BVB A;  2IMJ A;  3GZR A;  2GU3 A;  1UW1 A;  4MJD A;  1KD1 4;  1GS3 A;  1LVN A;  1OGZ A;  3DM8 A;  1EA2 A;  1IVX A;  1JJ2 2;  3BNC A;  1JV2 B;  1OHS A;  2CFG A;  2P05 A;  4HJL B;  4BTY A;  1K8A 4;  3CCU 3;  1NU3 A;  2CWT A;  1M9G A;  4HM6 B;  1FA3 A;  3MG1 A;  2YFJ B;  2BMR B;  1ASK A;  3WOE B;  2QA4 3;  1GY7 A;  4KVH A;  1RN7 A;  5BXQ A;  1NB3 I;  4HM1 B;  3PGB A;  1Q82 4;  3MSO A;  2GBW B;  3DXO A;  1QJG A;  3EN8 A;  1WQL B;  2IUJ A;  4G1M B;  3WDG B;  1VQP 3;  3KKG A;  2XEP A;  3QRD A;  3BNB A;  1QAK A;  1JNQ A;  1IK3 A;  3CMA 3;  4HM4 B;  1GY6 A;  1CEW I;  3IPT A;  3HX8 A;  3I55 3;  1IQX A;  2HMN B;  3TDG A;  1Z1S A;  4TX4 A;  5LC7 A;  5IG4 A;  4WWU C;  2WGQ A;  1OUN A;  3BLZ A;  1TP6 A;  3KZT A;  5ELJ A;  1VQ8 3;  2HMJ B;  2CK3 H;  2QEX 3;  3S5C A;  1TIJ A;  3K9M C;  3FKA A;  2C10 A;  4IIA A;  2HML B;  3WMD A;  1U8C B;  1KQS 2;  3CD6 3;  5D83 A;  1CYV A;  1Y4K A;  2QIY A;  2WOF A;  1W2B 2;  2CG1 A;  1SPU A;  4MMZ B;  1YIT 3;  3I56 3;  1NWW A;  1STD A;  1UI7 A;  1VQN 3;  1D6Z A;  2CFD A;  2B24 B;  5STD A;  1GY5 A;  2CWU A;  3G8Z A;  5LC6 A;  3T0U A;  3HII A;  3G16 A;  2K54 A;  2STD A;  5IG5 A;  1TFO A;  4L8O A;  3CCL 3;  1K9M 4;  4LSO A;  1LXE A;  3GZB A;  3VSY A;  1D6U A;  2JQ5 A;  3JUN A;  1N5H A;  3JUM A;  3PCR A;  3N8B A;  1VQO 3;  4R1K A;  4HM5 B;  4WP5 A;  1RRH A;  2K0M A;  1WNH A;  6STD A;  1VQ6 3;  1A2V A;  2V1L A;  1NB5 I;  3ALA A;  2IA7 A;  4FR9 A;  1A2K A;  2D1W A;  1DVD A;  1OPY A;  2CKF B;  5CK6 A;  3F7X A;  2GEX A;  3L0R A;  7STD A;  2KXG A;  2GXF A;  1KC8 4;  3S67 A;  3CCJ 3;  1O7P B;  5D82 A;  2GEY A;  4MMY B;  3FSD A;  1DMN A;  5AYS C;  4J8T A;  4IPB A;  3KE7 A;  4N6L A;  1W4N A;  2XGL A;  1OH0 A;  2RSX A;  5JPP A;  1ZX2 A;  3NBB A;  4XB5 A;  3LTD A;  4EBG A;  4CCV A;  1N8R 4;  4RZM A;  1JB5 A;  4KFE A;  3CCS 3;  2Z76 A;  3T8N A;  1E3V A;  1FGQ A;  2IUK A;  3WA3 A;  3V92 A;  2OTL 3;  5EQL A;  3DUK A;  3Q1C A;  1GD3 A;  1N9J A;  3G0K A;  2JDI H;  3EBT A;  3O8Y A;  4KFF A;  1US1 A;  2YFI B;  3E99 A;  4HBR A;  3RGA A;  3S27 A;  1WTH A;  1YIJ 3;  5ELU A;  1K41 A;  1DYU A;  1TU5 A;  3BND A;  3EX9 A;  3D9R A;  4PEJ A;  3QK9 A;  1NO3 A;  1E3R A;  3OW2 2;  2XSO B;  5D81 A;  1K28 A;  1STF I;  4XBT A;  3SVA A;  3F8H A;  2HMK B;  1DVC A;  2F86 B;  3GAX A;  3CCQ 3;  3F14 A;  4OVM A;  2CH9 A;  1O7G B;  1SQW A;  3STD A;  2SBL A;  3FLJ A;  1UUW B;  3EBY A;  2CHC A;  2BMO B;  2BT3 A;  1HKX A;  1NDO B;  1R4C A;  1WMO A;  3NX0 A;  3OXA A;  4EV5 A;  5IEN A;  2KRT A;  5KP1 A;  1YJW 3;  3LXU X;  2GBX B;  2QGU A;  5TGN A;  4FMB A;  1EQK A;  4L8P A;  1JB2 A;  4LMI A;  3X40 A;  1KSI A;  3MKI A;  5JPU A;  3G6E 3;  3MHE A;  1AV4 A;  1T5Y A;  3U1W A;  1IQY A;  3PS8 A;  3PYJ A;  2R4I A;  1BUQ A;  4ZM8 A;  2YX9 A;  1QAF A;  5CXO A;  3UL5 A;  1IU7 A;  4HM7 B;  2W2C A;  1GD4 A;  3CU3 A;  3KII A;  2RGQ A;  1ZO2 A;  2PNC A;  3J7Y d;  3LML A;  4XM4 A;  4XDW A;  5CF1 A;  1A90 A;  2WO0 A;  3CPW 2;  1JN5 A;  1N9E A;  1WMP A;  3EQQ B;  1DMQ A;  3SX1 A;  3FH1 A;  3OV4 A;  2Q07 A;  2WGO A;  3LT8 A;  2CC3 A;  2CFK A;  4BTX A;  3LOY A;  3NXJ A;  3EE1 A;  3MYT A;  1YHQ 3;  2ZL8 A;  5IEP A;  1RJO A;  3H3H A;  3FF2 A;  1OHP A;  1M1K 4;  4HKV B;  4RBN A;  4N6T A;  1HU9 A;  1O7M B;  3I0Y A;  3DY5 A;  4JF8 A;  1LOX A;  2OQE C;  2OQE A;  2WOH A;  5CF2 A;  3G71 3;  3CNM A;  3JUQ A;  1GYB A;  2Y73 A;  5IG0 A;  5IER A;  1OGX A;  4N6V 0;  3X3X A;  2E2U A;  3IMA B;  3CME 3;  2O9U X;  1IT8 A;  1QAL A;  2O3O A;  4X2H A;  5IW9 A;  4LEH A;  1OCV A;  3CCM 3;  1AVK A;  3FF0 A;  2ZDJ A;  5AIH A;  3DGM A;  2W56 B;  2P09 A;  3X3Z A;  5FW5 A;  4GB5 A;  1VQ9 3;  4GL6 A;  1L5G B;  1IQ8 A;  1WMN A;  1V74 A;  4R80 A;  1W6Y A;  2W6J H;  2MC8 A;  1JN5 B;  2ML5 A;  3CPO A;  5EEO A;  2C11 A;  3DGL A;  4O3V A;  5HGR A;  4XBY A;  1JKG A;  1W6G A;  3EF8 A;  3SOA A;  4HVN A;  1IT7 A;  2CG0 A;  4K1V A;  2GU1 A;  3KSE D;  2CFL A;  2KCD A;  3OX9 A;  4FMC A;  3V99 A;  3CCE 3;  3FG1 A;  3PCS A;  4EXR A;  1VQ5 3;  3AMO A;  5AIG A;  3G4S 3;  4HZB B;  3NV0 B;  2ML6 A;  4HYZ A;  4AEQ A;  1FGT A;  3A76 A;  3MG2 A;  3EC9 A;  2FXT A;  3RDE A;  1IVU A;  1W7C A;  1A67 A;  1IV9 A;  1RKY A;  3GZX B;  1O7H B;  1UI8 A;  1KWI A;  1ULI B;  1SII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...