1KD14

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kd1400
3CD63 1VQL3 1VQK3 1YIT3 1YHQ3 3CCM3 1QVG2 1M1K4 2OTL3 3CC43 3CCL3 3I563 1VQ63 1Q864 3CCE3 3G4S3 1JJ22 3CC23 3G713 1S723 3CME3 3CPW2 1NJI4 1YIJ3 1K8A4 3CCS3 3CCQ3 1KC84 3G6E3 1YJW3 1M904 2OTJ3 1W2B2 1YI23 1VQM3 1VQP3 1Q814 1Q7Y4 3CMA3 1QVF2 3I553 1YJ93 1K734 1Q824 1VQ53 1VQN3 1N8R4 3CCU3 1KQS2 1K9M4 3CC73 1YJN3 1VQ73 1KD14 2QA43 3CXC2 1VQ83 3CCJ3 3OW22 2QEX3 1VQ93 3CCR3 1VQ43 1VQO3 3CCV3
chains in the Genus database with same CATH superfamily
3OWUA 4HM6B 1DETA 1E97A 1WQLB 3X3ZA 1JV2B 1VQL3 1GYBA 2RBIA 3OX9A 3EQQB 1MWTA 1RRHA 5D82A 3DUKA 2QIYA 3G713 3A76A 2W9PA 4GL6A 2BMOB 2W0QA 4HM4B 4PEJA 3WA3A 3GWRA 3K9MC 3LTAA 1DE3A 2LQVA 4N6LA 1B20A 4HM7B 1RRLA 2BHMA 2M7OA 1YGWA 1C7HA 3EBYA 4MEIA 4O2HA 5CXOA 2F5MA 2WOHA 1IVVA 1QALA 1V58A 2XH9A 3BU4A 3HOHA 4NHFA 3WODG 1BNJA 2CX1A 3GSPA 2PZVA 1JZDA 1DMNA 3UB1A 2KF6A 4KFFA 3SYUA 5IERA 4J5KA 3WR2A 4ILFA 3U1WA 3CC43 4TX4A 1ZX2A 3N54B 1VQ63 3DZLA 1HZ1A 3LTCA 2CC3A 4Q53A 1UCKA 2GBWB 2WO0A 5LC6A 1O7HB 2K54A 4R9LA 2ZDJA 1FGTA 2C11A 2FXTA 2HMLB 2JDIH 1JB2A 3HI7A 5AIFA 3TDGA 1W2B2 1MWUA 1O7PB 4EC6A 1ULJB 1BU4A 3LH4A 3IPTA 3OWYA 3UL5A 1YVSA 2O9UX 1DVDA 3ZFZA 1E3VA 1OPYA 3MHEA 1W4NA 2KF4A 1BSAA 5I97A 2STDA 2XF3A 3VSYA 1BUJA 2CG1A 3SOAA 3ZG0A 2OTL3 1CYVA 5BIRA 3NM7A 3WA2X 1UUVB 3X3XA 2P0XA 3LMLA 3IJEB 1B2MA 1B2UA 3AGNA 3FKAA 2W04A 4NPBA 1N9EA 4XBYA 2KCDA 1RSNA 1TRPA 3DXOA 2BO9B 3PZWA 4WP5A 3U97A 3VF1A 4N6NB 1LNHA 2CKFB 4EBGA 1Y4KA 3CU3A 3DH2A 1B3SA 1UCLA 3T0UA 3UJMA 5JBSA 1VZZA 1IYYA 3UL6A 1I0VA 1BNFA 1BSBA 1PYLA 1OUNA 3CCU3 1RCKA 3LTDA 5BU4A 5KP3A 4AKZA 4HZ9B 1BNEA 4IT7A 1I0XA 3VGNA 4MMXB 1N8QA 1LNIA 1LOWA 1WMPA 2ZA4A 1RN7A 2GU1A 2BIRA 3JUQA 1QMAA 3F8HA 3Q3FA 4L7KA 4FCJA 1DYUA 1GD3A 4NREA 1G0TA 1D6YA 1F8NA 1RGLA 3FZWA 3KSPA 3EE1A 1LOXA 3FLJA 1QAKA 1UI8A 1WMNA 3CCQ3 2CFKA 3KN4A 3G6E3 2F99A 3SOYA 2HMMB 5AYSC 1Q7Y4 3CMA3 4BTXA 1RLSA 1A67A 3HX8A 1N5PA 3PCRA 4HM5B 2CH9A 3NHXA 1VQN3 4RNTA 1KQS2 1RGHA 1RTUA 2BU4A 2QGUA 1BRGA 3B8LA 5G1KA 1KD14 3CPOA 5HOHA 1ZGXA 4OK0A 4FCZA 4HKVB 1OCVA 3CCV3 5FW5A 3G16A 2OQEC 4X2OA 2GBXB 3GAXA 1YIT3 3MSOA 2CFGA 5M19A 3WMDA 1FZUA 3A5EA 4XB5A 3NBBA 2O3OA 3FCSB 1RGCA 1ASKA 4K90B 2K0MA 4EV2A 4O8SA 1W6CA 3AHWA 3IMAB 1C54A 4R1KA 1KC84 3PXMA 1BRHA 3RNTA 1Q814 1BSEA 1RN4A 1GY7A 1NB5I 3NQZA 2JQ5A 3ROBA 1TUHA 1JKGB 1A2PA 1S5AA 3FG3A 1BNSA 1N8R4 2CWVA 2CIUA 1LVNA 4N6OB 2Z77A 5FGOA 2XEPA 5ELJA 1VQ83 1B21A 6GSPA 1NB3I 3D9RA 4FMAA 2L1SA 1LOVA 2KRTA 4LEHA 7GSPA 3O8YA 1GS3A 1TIJA 2A15A 3Q2PA 1CYUA 1NJI4 1YIJ3 1WNHA 1K28A 2CX0A 4AEQA 1OHPA 5EVHA 2ML5A 2W03A 2XGLA 1YJW3 2H0HA 1YI23 1VQM3 1VQP3 4MMYB 3J7Yd 2HMNB 2UX0A 1JKGA 5CLKA 4HJLB 1DMQA 1BRIA 1HKXA 3D79A 2MC8A 4HM8B 3QRDA 3NV0B 3S29A 1I3FA 3AMOA 1TJDA 2R41A 2XFTA 3GRDA 3LZAA 2IMJA 1GSPA 3BNEA 1UI7A 3RDEA 3FSDA 1DVCA 1G02A 1MOLA 2W9QA 2IUJA 5IEPA 2ML6A 1AY7A 2E2VA 3X3YA 4HOHA 1NNVA 3EX9A 4I4KA 1A2VA 4BIRA 1KWIA 3NBRA 2KAAA 1ULIB 3MKIA 1R4YA 4WHAA 1TRQA 3CPW2 4BL3A 1UCJA 3B4OA 5G2GA 3EHCA 3S27A 1AVKA 2RCDA 3SVAA 3X41A 1UW1A 5IG5A 3KCHA 1Q40B 1UUWB 5KP1A 3CNMA 1FA3A 2KF3A 3PGBA 3Q1CA 1W02A 4BL2A 2INXA 3I0YA 1OACA 1UGHI 2FGTA 3DM8A 1JB4A 3F7XA 5TGNA 2QEX3 3F14A 1GOVA 1VQ93 1RNBA 2P38A 2Z6BA 1AQZA 1ROVA 1STDA 2FNQA 3FGYA 1UGIA 2BMRB 4AKYA 5EQLA 4EYCA 4MMZB 3H51A 3CCE3 3OXAA 1Q864 1IQYA 1RNTA 1JNQA 4N6V0 3CME3 1PU4A 1EEJA 1TU5A 3N9HA 4KZ1A 1Q824 2SBLA 3GZBA 1AR0A 1QVF2 5CK6A 2KF5A 1BRKA 1V57A 4HM3B 1B2ZA 4MJDA 3STDA 1X1WA 5KP4A 4FMCA 1RJOA 5AI1A 2D42A 2IYJA 2UUGC 3CC73 1YJN3 4GB5A 1RGKA 1HU9A 3B4PA 1IV9A 2YFLB 3K5TA 1TP6A 5DREA 3CCJ3 6RNTA 2I9WA 1PFPA 2SARA 1W6GA 1BVIA 3LYGA 3CCM3 1M1K4 1YNVX 1FW7A 3FH1A 1PY3A 3GZYB 4K61A 3HZPA 1IVUA 1SIIA 4N6UA 2E2UA 2Q07A 4H61A 1BRSA 3HIGA 4KT3B 2CG0A 3BNDA 2ZHXB 3UNLA 2F98A 4R80A 1SARA 2F5WA 3D4AA 4HYZA 3KIIA 1JN5B 8CHOA 1OGXA 4L8OA 3EN1B 1ZS7A 4LMIA 1W6YA 3GZXB 3MG1A 5AEUB 3JUMA 2BNGA 2Y73A 4HAAA 2F86B 1T2HA 3EC9A 3F40A 2P0MA 1RMSA 3NQYA 2Z7AA 1JBTA 1I3IA 4XM4A 3CXC2 1GMQA 2D1WA 1ZO2A 2W2CA 3NX0A 5IEOA 1RDSA 5D81A 4J9AA 3CCR3 1VQ43 4K1UA 3M8CA 4CDLA 7STDA 4J8TA 1VQK3 1STFI 1IT7A 3ALAA 2K3DA 1M9GA 3T8NA 3ECFA 5AIGA 3MYTA 2OOVC 1K8A4 3SEDA 1JRQA 3WDGB 1JN5A 2GU3A 2WGOA 1BOXA 3S28A 1RGAA 1MWRA 1NWWA 1MNLA 2CFDA 1FUWA 3DY5A 3LTBA 4U13A 3PCSA 3K63A 1UDII 4WYKA 1E3RA 3NXJA 4EXRA 2F56A 3D3LA 2WGQA 3EJVA 4FR9A 4GSPA 1BANA 3MG3A 2ZL8A 2QA43 4FCMA 3KZTA 1EA2A 2HMJB 1B2SA 3LT9A 3WOFB 1ISKA 3FF2A 1VQO3 4HVNA 1OH0A 2MF7A 1OHOA 2XSHB 3V92A 3CD63 3MPHA 4EV5A 1K41A 1T5YA 4OVMA 3F7SA 3CC23 2YFIB 1UCIA 4XDWA 1QJGA 1I2EA 1W00A 5M18A 1OF5B 1OGZA 1GOYA 3BNCA 1AV4A 5IENA 1TTOA 1W01A 3DGMA 3EN8A 1MGRA 3HK4A 2CFLA 2XGNA 1BUQA 1IQ8A 1LQGC 2GEYA 2C10A 1YJ93 3F8XA 1AVLA 3V98A 1VQ53 3NV0A 3OV4A 2CK3H 3ZG5A 1X1UA 3EF8A 1YVBI 3E99A 2HMOB 1Q9EA 3AMOB 1RGFA 3LXUX 1IDPA 4GHOA 1WTHA 2GXFA 4ZM8A 5BVBA 2WOFA 1FUTA 1LQMB 1TFOA 3GZRA 1UUGB 2CW9A 5RNTA 3AHSA 1VQQA 1T3BA 3KFQC 5IG4A 2CWUA 3T8UA 4WFOA 4FMBA 1D6ZA 4J5GA 1IV7A 6STDA 1S723 1CH0A 1OF5A 1M904 1GMRA 2OWPA 4RNYA 3K0ZA 5JPUA 3BIRA 5DRVA 3F9SA 1I2FA 1RN1A 1MWSA 1FYSA 1RGEA 2W56A 1Q40A 2B24B 1W5ZA 2IA7A 3DGLA 4ORLA 4R4KA 1GY6A 4HM0B 1K734 2BT3A 3JUPA 1BAOA 2C4BA 4HZBB 3EBTA 1CEWI 4WWUC 1FGQA 1IVWA 3URPA 4BTWA 4HM1B 7RNTA 3D5IA 3ER7A 3JUNA 1BSDA 5EEOA 4BTYA 4STDA 3K7CA 1US1A 1IT8A 2XRXB 4CPKA 3OWSA 1RHLA 8RNTA 5IF6A 3CCL3 1BNRA 2RFRA 1BGSA 1SJWA 2GSPA 5AIHA 1BRJA 1N9JA 3V99A 1I8VA 2H0GA 1FUSA 5GSPA 3RGRA 1IQXA 1U5OA 5IG0A 1GOUA 4K1VA 3G8ZA 1WMOA 4R9KA 2W56B 3NUVA 1BIRA 2IY2A 4OUQA 1EG9B 2RSXA 3X40A 4FMDA 2UGIA 2Y74A 4N6MA 1CQSA 4KFDA 1D6UA 1MGWA 3JVCA 2H0IA 4I5QA 4LGQA 5CF2A 1JZOA 1RKYA 1U8CB 3KE7A 3CNXA 3MG2A 3OW22 1KSIA 2V1LA 2KXGA 1LOYA 1A90A 3DMCA 3FF0A 2RNTA 1T2IA 5STDA 1RGGA 1NDOB 3D5GA 2J8XB 1JJ22 3X42A 3NBJA 5ELUA 4EW5A 2P09A 1TFKA 3AGOA 3PS8A 1QAFA 4JRFA 1FGOA 2Z76A 3B7CA 1R4CA 2OCTA 1GD4A 2YFJB 1BNGA 1GY5A 4RBNA 4XDVA 1J2BA 4LSOA 3LOYA 5A0OB 1LXEA 4G1MB 1W2ZA 1G96A 2LYXA 3FG4A 4DKIA 1M1XB 2IUKA 1RCLA 3H3HA 5D83A 2HOHA 3KKGA 4BU4A 3BLZA 3RGAA 3S67A 5BXQA 5CF1A 3WOEB 2OTJ3 2OQEA 4O02B 5JPPA 1Z1SA 3PYJA 2CHCA 3QK9A 1O7MB 4HBRA 4H3UA 4KVHA 3SLUA 4RZMA 4O3VA 1QVG2 2AAEA 1L5GB 2PNCA 3DGYA 5HGRA 2P05A 1SIHA 1GMPA 3G4S3 1NU3A 4N6TA 4CJNA 1JB5A 1ROAA 1BRNL 3SXXA 1N5HA 1SQWA 2CFWA 2B1XB 2R4IA 4L8PA 4LZIA 2XR8B 1HYFA 3BB9A 1YGEA 3CCS3 5AEWB 3HIIA 2RGQA 1SPUA 5LC7A 5IW9A 4X2HA 4XBTA 3I553 1BSCA 1NO3A 1I2GA 2E2TA 1FGMA 2CWTA 4WYKB 2GEXA 3SX1A 1FGRA 3Q90A 1K9M4 1B27A 2HMKB 4HM2B 1IU7A 4JF8A 3JUOA 3MWZA 3EB8A 4RNZA 3S5CA 3N8BA 1EUIC 1B2XA 1V74A 3DGOA 1YHQ3 5AYRB 1X1YA 1Q42A 2AADA 4IIAA 3I563 3LT8A 5IG3A 1EKMA 1JBSA 5AIIA 1Q7HA 4N3VA 2XSOB 3G0KA 1IVXA 3FG1A 1W7CA 5G1LA 2F4YA 2L4VA 9RNTA 1OHSA 3DGNA 4QWTA 5M1AA 3L0RA 4KFEA 3WHOA 4XBXA 3KSED 2OOVA 1IK3A 1JBRA 1O7GB 2W6JH 1O7WB 4CCVA 2BMQB 2XFSA 1LRAA 1BNIA 4LYLB 1I70A 1EQKA 1X1XA 3BNBA 1VQ73 1A2KA 1O7NB 1DMMA 2YX9A 4IPBA 3NM2A
chains in the Genus database with same CATH topology
3OWUA 4HM6B 1E97A 1WQLB 3X3ZA 1JV2B 1VQL3 1GYBA 3OX9A 3EQQB 1RRHA 5D82A 3DUKA 2QIYA 3G713 3A76A 2W9PA 4GL6A 2BMOB 2W0QA 4HM4B 4PEJA 3WA3A 3GWRA 3K9MC 3LTAA 2LQVA 4N6LA 4HM7B 1RRLA 2BHMA 2M7OA 4MEIA 1C7HA 3EBYA 4O2HA 5CXOA 2WOHA 1IVVA 1QALA 2XH9A 4NHFA 3WODG 2PZVA 3UB1A 1DMNA 4KFFA 5IERA 3U1WA 3CC43 4TX4A 1ZX2A 3N54B 1VQ63 3DZLA 3LTCA 2CC3A 4Q53A 2GBWB 2WO0A 5LC6A 1O7HB 2K54A 4R9LA 2ZDJA 1FGTA 2C11A 2FXTA 2HMLB 2JDIH 1JB2A 3HI7A 5AIFA 3TDGA 1W2B2 1O7PB 4EC6A 1ULJB 3LH4A 3IPTA 3OWYA 3UL5A 2O9UX 1DVDA 1E3VA 1OPYA 3MHEA 1W4NA 5I97A 2STDA 2XF3A 3VSYA 2CG1A 3SOAA 2OTL3 1CYVA 3NM7A 3WA2X 1UUVB 3X3XA 2P0XA 3LMLA 3IJEB 3FKAA 2W04A 1N9EA 4XBYA 2KCDA 3U97A 3PZWA 3DXOA 2BO9B 4WP5A 3VF1A 4N6NB 1LNHA 2CKFB 4EBGA 1Y4KA 3CU3A 3T0UA 3UJMA 5JBSA 1VZZA 3UL6A 1OUNA 3CCU3 3LTDA 5KP3A 4AKZA 4HZ9B 4IT7A 3VGNA 4MMXB 1N8QA 1WMPA 1RN7A 2GU1A 3JUQA 1QMAA 3F8HA 4L7KA 4FCJA 1DYUA 1GD3A 4NREA 1D6YA 1F8NA 3FZWA 3KSPA 3EE1A 1LOXA 3FLJA 1QAKA 1UI8A 1WMNA 3CCQ3 2CFKA 3KN4A 3G6E3 2F99A 3SOYA 2HMMB 5AYSC 1Q7Y4 3CMA3 4BTXA 1A67A 3HX8A 1N5PA 3PCRA 4HM5B 2CH9A 3NHXA 1VQN3 1KQS2 2QGUA 3B8LA 1KD14 3CPOA 4OK0A 4FCZA 4HKVB 1OCVA 3CCV3 5FW5A 3G16A 2OQEC 4X2OA 2GBXB 3GAXA 1YIT3 3MSOA 2CFGA 3WMDA 4XB5A 3NBBA 2O3OA 3FCSB 4K90B 1ASKA 4EV2A 2K0MA 4O8SA 1W6CA 3IMAB 4R1KA 1KC84 3PXMA 1Q814 1GY7A 1NB5I 3NQZA 2JQ5A 3ROBA 1TUHA 1JKGB 1S5AA 3FG3A 1N8R4 2CWVA 2CIUA 1LVNA 4N6OB 2Z77A 5FGOA 2XEPA 5ELJA 1VQ83 1NB3I 3D9RA 4FMAA 2KRTA 4LEHA 3O8YA 1GS3A 1TIJA 2A15A 3Q2PA 1CYUA 1NJI4 1YIJ3 1WNHA 1K28A 4AEQA 1OHPA 5EVHA 2ML5A 2W03A 2XGLA 1YJW3 1YI23 1VQM3 1VQP3 4MMYB 3J7Yd 2HMNB 2UX0A 1JKGA 5CLKA 4HJLB 1DMQA 1HKXA 2MC8A 4HM8B 3QRDA 3NV0B 3S29A 3AMOA 3GRDA 3LZAA 2XFTA 2IMJA 3BNEA 1UI7A 3RDEA 3FSDA 1DVCA 1MOLA 2W9QA 5IEPA 2IUJA 2ML6A 2E2VA 3X3YA 3EX9A 4I4KA 1A2VA 1KWIA 3NBRA 1ULIB 3MKIA 4WHAA 3CPW2 3B4OA 5G2GA 3EHCA 3S27A 1AVKA 2RCDA 3SVAA 3X41A 1UW1A 5IG5A 1M904 1Q40B 1UUWB 5KP1A 3CNMA 1FA3A 3PGBA 3Q1CA 1W02A 2INXA 3I0YA 1OACA 2FGTA 3DM8A 1JB4A 3F7XA 5TGNA 2QEX3 3F14A 1VQ93 2P38A 2Z6BA 1ROVA 1STDA 2FNQA 3FGYA 2BMRB 4AKYA 5EQLA 4EYCA 4MMZB 3H51A 3CCE3 3OXAA 1Q864 1IQYA 1JNQA 4N6V0 3CME3 1PU4A 1TU5A 3N9HA 4KZ1A 2SBLA 3GZBA 1AR0A 1QVF2 5CK6A 4HM3B 5KP4A 4MJDA 3STDA 4FMCA 1RJOA 5AI1A 2D42A 3CC73 1YJN3 4GB5A 3B4PA 1HU9A 1IV9A 2YFLB 3K5TA 1TP6A 5DREA 3CCJ3 2I9WA 1PFPA 1W6GA 3LYGA 3CCM3 1M1K4 3FH1A 3GZYB 4K61A 3HZPA 1IVUA 1SIIA 4N6UA 2E2UA 2Q07A 4H61A 3HIGA 2CG0A 3BNDA 3UNLA 2F98A 4R80A 4HYZA 8CHOA 3KIIA 1JN5B 1OGXA 4L8OA 3EN1B 4LMIA 1W6YA 3GZXB 3MG1A 5AEUB 3JUMA 2BNGA 2Y73A 2F86B 3EC9A 3F40A 2P0MA 3NQYA 2Z7AA 4XM4A 3CXC2 2D1WA 1ZO2A 2W2CA 3NX0A 5IEOA 3CCR3 5D81A 4J9AA 1VQ43 4K1UA 3M8CA 4CDLA 7STDA 4J8TA 1VQK3 1STFI 1IT7A 3ALAA 1M9GA 3T8NA 3ECFA 5AIGA 3MYTA 2OOVC 1K8A4 3SEDA 1JRQA 3WDGB 1JN5A 2GU3A 2WGOA 3S28A 1NWWA 1MNLA 2CFDA 1FUWA 3DY5A 3LTBA 4U13A 3PCSA 3K63A 4WYKA 1E3RA 3NXJA 4EXRA 3D3LA 2WGQA 3EJVA 4FR9A 2QA43 3MG3A 2ZL8A 4FCMA 3KZTA 1EA2A 2HMJB 3LT9A 1ISKA 3WOFB 3FF2A 1VQO3 4HVNA 1OH0A 2MF7A 1OHOA 2XSHB 3V92A 3CD63 3MPHA 4EV5A 1K41A 1T5YA 4OVMA 3F7SA 3CC23 2YFIB 4XDWA 1QJGA 1W00A 1OF5B 1OGZA 3BNCA 1AV4A 5IENA 1W01A 3DGMA 3EN8A 3HK4A 2CFLA 2XGNA 1BUQA 1IQ8A 2GEYA 2C10A 1YJ93 3F8XA 1AVLA 3V98A 1VQ53 3NV0A 3OV4A 2CK3H 3EF8A 1YVBI 3E99A 2HMOB 3AMOB 3LXUX 1IDPA 1WTHA 2GXFA 4ZM8A 5BVBA 2WOFA 1TFOA 3GZRA 2CW9A 3KFQC 5IG4A 2CWUA 3T8UA 4WFOA 4FMBA 1D6ZA 6STDA 1IV7A 1S723 1OF5A 2OWPA 4RNYA 3K0ZA 5JPUA 5DRVA 3F9SA 2W56A 1Q40A 2B24B 1W5ZA 2IA7A 3DGLA 4ORLA 4R4KA 1GY6A 4HM0B 1K734 2BT3A 3JUPA 4HZBB 3EBTA 1CEWI 4WWUC 1FGQA 1IVWA 4BTWA 4HM1B 3ER7A 3JUNA 5EEOA 4BTYA 4STDA 3K7CA 1US1A 1IT8A 2XRXB 3OWSA 5IF6A 3CCL3 2RFRA 1SJWA 5AIHA 1N9JA 3V99A 3RGRA 1IQXA 1U5OA 5IG0A 4K1VA 3G8ZA 1WMOA 4R9KA 2W56B 3NUVA 4OUQA 1EG9B 2RSXA 3X40A 4FMDA 2Y74A 4N6MA 1CQSA 4KFDA 1D6UA 3JVCA 5CF2A 4LGQA 1RKYA 1U8CB 3KE7A 3CNXA 3MG2A 3OW22 1KSIA 2V1LA 2KXGA 1A90A 3DMCA 3FF0A 5STDA 1NDOB 1JJ22 3X42A 3NBJA 5ELUA 2P09A 1TFKA 3PS8A 1QAFA 4JRFA 1FGOA 2Z76A 3B7CA 1R4CA 2OCTA 1GD4A 2YFJB 1GY5A 4RBNA 4XDVA 1J2BA 4LSOA 3LOYA 5A0OB 1LXEA 4G1MB 1W2ZA 1G96A 2LYXA 3FG4A 1M1XB 2IUKA 3H3HA 5D83A 1Q824 3KKGA 3BLZA 3RGAA 3S67A 5BXQA 5CF1A 3WOEB 2OTJ3 2OQEA 4O02B 5JPPA 1Z1SA 3PYJA 2CHCA 3QK9A 1O7MB 4HBRA 4H3UA 4KVHA 3SLUA 4RZMA 4O3VA 1QVG2 1L5GB 2PNCA 5HGRA 2P05A 1SIHA 3G4S3 1NU3A 4N6TA 1JB5A 1ROAA 3SXXA 1N5HA 1SQWA 2CFWA 2B1XB 2R4IA 4L8PA 4LZIA 2XR8B 3BB9A 1YGEA 3CCS3 5AEWB 3HIIA 2RGQA 1SPUA 5LC7A 5IW9A 4X2HA 4XBTA 3I553 1NO3A 2CWTA 1FGMA 2E2TA 4WYKB 2GEXA 3SX1A 1FGRA 3Q90A 1K9M4 2HMKB 4HM2B 1IU7A 4JF8A 3JUOA 3MWZA 3EB8A 4RNZA 3S5CA 3N8BA 1V74A 3DGOA 1YHQ3 5AYRB 1Q42A 4IIAA 3I563 3LT8A 5IG3A 1EKMA 5AIIA 4N3VA 2XSOB 3G0KA 1IVXA 3FG1A 1W7CA 2L4VA 1OHSA 3DGNA 4QWTA 3L0RA 4KFEA 4XBXA 3KSED 2OOVA 1IK3A 1O7GB 2W6JH 1O7WB 4CCVA 2BMQB 2XFSA 1EQKA 3BNBA 1VQ73 1A2KA 1O7NB 1DMMA 2YX9A 4IPBA 3NM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 3;  1VQL 3;  1VQK 3;  1YIT 3;  1YHQ 3;  3CCM 3;  1QVG 2;  1M1K 4;  2OTL 3;  3CC4 3;  3CCL 3;  3I56 3;  1VQ6 3;  1Q86 4;  3CCE 3;  3G4S 3;  1JJ2 2;  3CC2 3;  3G71 3;  1S72 3;  3CME 3;  3CPW 2;  1NJI 4;  1YIJ 3;  1K8A 4;  3CCS 3;  3CCQ 3;  1KC8 4;  3G6E 3;  1YJW 3;  1M90 4;  2OTJ 3;  1W2B 2;  1YI2 3;  1VQM 3;  1VQP 3;  1Q81 4;  1Q7Y 4;  3CMA 3;  1QVF 2;  3I55 3;  1YJ9 3;  1K73 4;  1Q82 4;  1VQ5 3;  1VQN 3;  1N8R 4;  3CCU 3;  1KQS 2;  1K9M 4;  3CC7 3;  1YJN 3;  1VQ7 3;  1KD1 4;  2QA4 3;  3CXC 2;  1VQ8 3;  3CCJ 3;  3OW2 2;  2QEX 3;  1VQ9 3;  3CCR 3;  1VQ4 3;  1VQO 3;  3CCV 3; 
#chains in the Genus database with same CATH topology
 3OWU A;  4HM6 B;  1DET A;  1E97 A;  1WQL B;  3X3Z A;  1JV2 B;  1VQL 3;  1GYB A;  2RBI A;  3OX9 A;  3EQQ B;  1MWT A;  1RRH A;  5D82 A;  3DUK A;  2QIY A;  3G71 3;  3A76 A;  2W9P A;  4GL6 A;  2BMO B;  2W0Q A;  4HM4 B;  4PEJ A;  3WA3 A;  3GWR A;  3K9M C;  3LTA A;  1DE3 A;  2LQV A;  4N6L A;  1B20 A;  4HM7 B;  1RRL A;  2BHM A;  2M7O A;  1YGW A;  1C7H A;  3EBY A;  4MEI A;  4O2H A;  5CXO A;  2F5M A;  2WOH A;  1IVV A;  1QAL A;  1V58 A;  2XH9 A;  3BU4 A;  3HOH A;  4NHF A;  3WOD G;  1BNJ A;  2CX1 A;  3GSP A;  2PZV A;  1JZD A;  1DMN A;  3UB1 A;  2KF6 A;  4KFF A;  3SYU A;  5IER A;  4J5K A;  3WR2 A;  4ILF A;  3U1W A;  3CC4 3;  4TX4 A;  1ZX2 A;  3N54 B;  1VQ6 3;  3DZL A;  1HZ1 A;  3LTC A;  2CC3 A;  4Q53 A;  1UCK A;  2GBW B;  2WO0 A;  5LC6 A;  1O7H B;  2K54 A;  4R9L A;  2ZDJ A;  1FGT A;  2C11 A;  2FXT A;  2HML B;  2JDI H;  1JB2 A;  3HI7 A;  5AIF A;  3TDG A;  1W2B 2;  1MWU A;  1O7P B;  4EC6 A;  1ULJ B;  1BU4 A;  3LH4 A;  3IPT A;  3OWY A;  3UL5 A;  1YVS A;  2O9U X;  1DVD A;  3ZFZ A;  1E3V A;  1OPY A;  3MHE A;  1W4N A;  2KF4 A;  1BSA A;  5I97 A;  2STD A;  2XF3 A;  3VSY A;  1BUJ A;  2CG1 A;  3SOA A;  3ZG0 A;  2OTL 3;  1CYV A;  5BIR A;  3NM7 A;  3WA2 X;  1UUV B;  3X3X A;  2P0X A;  3LML A;  3IJE B;  1B2M A;  1B2U A;  3AGN A;  3FKA A;  2W04 A;  4NPB A;  1N9E A;  4XBY A;  2KCD A;  1RSN A;  1TRP A;  3DXO A;  2BO9 B;  3PZW A;  4WP5 A;  3U97 A;  3VF1 A;  4N6N B;  1LNH A;  2CKF B;  4EBG A;  1Y4K A;  3CU3 A;  3DH2 A;  1B3S A;  1UCL A;  3T0U A;  3UJM A;  5JBS A;  1VZZ A;  1IYY A;  3UL6 A;  1I0V A;  1BNF A;  1BSB A;  1PYL A;  1OUN A;  3CCU 3;  1RCK A;  3LTD A;  5BU4 A;  5KP3 A;  4AKZ A;  4HZ9 B;  1BNE A;  4IT7 A;  1I0X A;  3VGN A;  4MMX B;  1N8Q A;  1LNI A;  1LOW A;  1WMP A;  2ZA4 A;  1RN7 A;  2GU1 A;  2BIR A;  3JUQ A;  1QMA A;  3F8H A;  3Q3F A;  4L7K A;  4FCJ A;  1DYU A;  1GD3 A;  4NRE A;  1G0T A;  1D6Y A;  1F8N A;  1RGL A;  3FZW A;  3KSP A;  3EE1 A;  1LOX A;  3FLJ A;  1QAK A;  1UI8 A;  1WMN A;  3CCQ 3;  2CFK A;  3KN4 A;  3G6E 3;  2F99 A;  3SOY A;  2HMM B;  5AYS C;  1Q7Y 4;  3CMA 3;  4BTX A;  1RLS A;  1A67 A;  3HX8 A;  1N5P A;  3PCR A;  4HM5 B;  2CH9 A;  3NHX A;  1VQN 3;  4RNT A;  1KQS 2;  1RGH A;  1RTU A;  2BU4 A;  2QGU A;  1BRG A;  3B8L A;  5G1K A;  1KD1 4;  3CPO A;  5HOH A;  1ZGX A;  4OK0 A;  4FCZ A;  4HKV B;  1OCV A;  3CCV 3;  5FW5 A;  3G16 A;  2OQE C;  4X2O A;  2GBX B;  3GAX A;  1YIT 3;  3MSO A;  2CFG A;  5M19 A;  3WMD A;  1FZU A;  3A5E A;  4XB5 A;  3NBB A;  2O3O A;  3FCS B;  1RGC A;  1ASK A;  4K90 B;  2K0M A;  4EV2 A;  4O8S A;  1W6C A;  3AHW A;  3IMA B;  1C54 A;  4R1K A;  1KC8 4;  3PXM A;  1BRH A;  3RNT A;  1Q81 4;  1BSE A;  1RN4 A;  1GY7 A;  1NB5 I;  3NQZ A;  2JQ5 A;  3ROB A;  1TUH A;  1JKG B;  1A2P A;  1S5A A;  3FG3 A;  1BNS A;  1N8R 4;  2CWV A;  2CIU A;  1LVN A;  4N6O B;  2Z77 A;  5FGO A;  2XEP A;  5ELJ A;  1VQ8 3;  1B21 A;  6GSP A;  1NB3 I;  3D9R A;  4FMA A;  2L1S A;  1LOV A;  2KRT A;  4LEH A;  7GSP A;  3O8Y A;  1GS3 A;  1TIJ A;  2A15 A;  3Q2P A;  1CYU A;  1NJI 4;  1YIJ 3;  1WNH A;  1K28 A;  2CX0 A;  4AEQ A;  1OHP A;  5EVH A;  2ML5 A;  2W03 A;  2XGL A;  1YJW 3;  2H0H A;  1YI2 3;  1VQM 3;  1VQP 3;  4MMY B;  3J7Y d;  2HMN B;  2UX0 A;  1JKG A;  5CLK A;  4HJL B;  1DMQ A;  1BRI A;  1HKX A;  3D79 A;  2MC8 A;  4HM8 B;  3QRD A;  3NV0 B;  3S29 A;  1I3F A;  3AMO A;  1TJD A;  2R41 A;  2XFT A;  3GRD A;  3LZA A;  2IMJ A;  1GSP A;  3BNE A;  1UI7 A;  3RDE A;  3FSD A;  1DVC A;  1G02 A;  1MOL A;  2W9Q A;  2IUJ A;  5IEP A;  2ML6 A;  1AY7 A;  2E2V A;  3X3Y A;  4HOH A;  1NNV A;  3EX9 A;  4I4K A;  1A2V A;  4BIR A;  1KWI A;  3NBR A;  2KAA A;  1ULI B;  3MKI A;  1R4Y A;  4WHA A;  1TRQ A;  3CPW 2;  4BL3 A;  1UCJ A;  3B4O A;  5G2G A;  3EHC A;  3S27 A;  1AVK A;  2RCD A;  3SVA A;  3X41 A;  1UW1 A;  5IG5 A;  3KCH A;  1Q40 B;  1UUW B;  5KP1 A;  3CNM A;  1FA3 A;  2KF3 A;  3PGB A;  3Q1C A;  1W02 A;  4BL2 A;  2INX A;  3I0Y A;  1OAC A;  1UGH I;  2FGT A;  3DM8 A;  1JB4 A;  3F7X A;  5TGN A;  2QEX 3;  3F14 A;  1GOV A;  1VQ9 3;  1RNB A;  2P38 A;  2Z6B A;  1AQZ A;  1ROV A;  1STD A;  2FNQ A;  3FGY A;  1UGI A;  2BMR B;  4AKY A;  5EQL A;  4EYC A;  4MMZ B;  3H51 A;  3CCE 3;  3OXA A;  1Q86 4;  1IQY A;  1RNT A;  1JNQ A;  4N6V 0;  3CME 3;  1PU4 A;  1EEJ A;  1TU5 A;  3N9H A;  4KZ1 A;  1Q82 4;  2SBL A;  3GZB A;  1AR0 A;  1QVF 2;  5CK6 A;  2KF5 A;  1BRK A;  1V57 A;  4HM3 B;  1B2Z A;  4MJD A;  3STD A;  1X1W A;  5KP4 A;  4FMC A;  1RJO A;  5AI1 A;  2D42 A;  2IYJ A;  2UUG C;  3CC7 3;  1YJN 3;  4GB5 A;  1RGK A;  1HU9 A;  3B4P A;  1IV9 A;  2YFL B;  3K5T A;  1TP6 A;  5DRE A;  3CCJ 3;  6RNT A;  2I9W A;  1PFP A;  2SAR A;  1W6G A;  1BVI A;  3LYG A;  3CCM 3;  1M1K 4;  1YNV X;  1FW7 A;  3FH1 A;  1PY3 A;  3GZY B;  4K61 A;  3HZP A;  1IVU A;  1SII A;  4N6U A;  2E2U A;  2Q07 A;  4H61 A;  1BRS A;  3HIG A;  4KT3 B;  2CG0 A;  3BND A;  2ZHX B;  3UNL A;  2F98 A;  4R80 A;  1SAR A;  2F5W A;  3D4A A;  4HYZ A;  3KII A;  1JN5 B;  8CHO A;  1OGX A;  4L8O A;  3EN1 B;  1ZS7 A;  4LMI A;  1W6Y A;  3GZX B;  3MG1 A;  5AEU B;  3JUM A;  2BNG A;  2Y73 A;  4HAA A;  2F86 B;  1T2H A;  3EC9 A;  3F40 A;  2P0M A;  1RMS A;  3NQY A;  2Z7A A;  1JBT A;  1I3I A;  4XM4 A;  3CXC 2;  1GMQ A;  2D1W A;  1ZO2 A;  2W2C A;  3NX0 A;  5IEO A;  1RDS A;  5D81 A;  4J9A A;  3CCR 3;  1VQ4 3;  4K1U A;  3M8C A;  4CDL A;  7STD A;  4J8T A;  1VQK 3;  1STF I;  1IT7 A;  3ALA A;  2K3D A;  1M9G A;  3T8N A;  3ECF A;  5AIG A;  3MYT A;  2OOV C;  1K8A 4;  3SED A;  1JRQ A;  3WDG B;  1JN5 A;  2GU3 A;  2WGO A;  1BOX A;  3S28 A;  1RGA A;  1MWR A;  1NWW A;  1MNL A;  2CFD A;  1FUW A;  3DY5 A;  3LTB A;  4U13 A;  3PCS A;  3K63 A;  1UDI I;  4WYK A;  1E3R A;  3NXJ A;  4EXR A;  2F56 A;  3D3L A;  2WGQ A;  3EJV A;  4FR9 A;  4GSP A;  1BAN A;  3MG3 A;  2ZL8 A;  2QA4 3;  4FCM A;  3KZT A;  1EA2 A;  2HMJ B;  1B2S A;  3LT9 A;  3WOF B;  1ISK A;  3FF2 A;  1VQO 3;  4HVN A;  1OH0 A;  2MF7 A;  1OHO A;  2XSH B;  3V92 A;  3CD6 3;  3MPH A;  4EV5 A;  1K41 A;  1T5Y A;  4OVM A;  3F7S A;  3CC2 3;  2YFI B;  1UCI A;  4XDW A;  1QJG A;  1I2E A;  1W00 A;  5M18 A;  1OF5 B;  1OGZ A;  1GOY A;  3BNC A;  1AV4 A;  5IEN A;  1TTO A;  1W01 A;  3DGM A;  3EN8 A;  1MGR A;  3HK4 A;  2CFL A;  2XGN A;  1BUQ A;  1IQ8 A;  1LQG C;  2GEY A;  2C10 A;  1YJ9 3;  3F8X A;  1AVL A;  3V98 A;  1VQ5 3;  3NV0 A;  3OV4 A;  2CK3 H;  3ZG5 A;  1X1U A;  3EF8 A;  1YVB I;  3E99 A;  2HMO B;  1Q9E A;  3AMO B;  1RGF A;  3LXU X;  1IDP A;  4GHO A;  1WTH A;  2GXF A;  4ZM8 A;  5BVB A;  2WOF A;  1FUT A;  1LQM B;  1TFO A;  3GZR A;  1UUG B;  2CW9 A;  5RNT A;  3AHS A;  1VQQ A;  1T3B A;  3KFQ C;  5IG4 A;  2CWU A;  3T8U A;  4WFO A;  4FMB A;  1D6Z A;  4J5G A;  1IV7 A;  6STD A;  1S72 3;  1CH0 A;  1OF5 A;  1M90 4;  1GMR A;  2OWP A;  4RNY A;  3K0Z A;  5JPU A;  3BIR A;  5DRV A;  3F9S A;  1I2F A;  1RN1 A;  1MWS A;  1FYS A;  1RGE A;  2W56 A;  1Q40 A;  2B24 B;  1W5Z A;  2IA7 A;  3DGL A;  4ORL A;  4R4K A;  1GY6 A;  4HM0 B;  1K73 4;  2BT3 A;  3JUP A;  1BAO A;  2C4B A;  4HZB B;  3EBT A;  1CEW I;  4WWU C;  1FGQ A;  1IVW A;  3URP A;  4BTW A;  4HM1 B;  7RNT A;  3D5I A;  3ER7 A;  3JUN A;  1BSD A;  5EEO A;  4BTY A;  4STD A;  3K7C A;  1US1 A;  1IT8 A;  2XRX B;  4CPK A;  3OWS A;  1RHL A;  8RNT A;  5IF6 A;  3CCL 3;  1BNR A;  2RFR A;  1BGS A;  1SJW A;  2GSP A;  5AIH A;  1BRJ A;  1N9J A;  3V99 A;  1I8V A;  2H0G A;  1FUS A;  5GSP A;  3RGR A;  1IQX A;  1U5O A;  5IG0 A;  1GOU A;  4K1V A;  3G8Z A;  1WMO A;  4R9K A;  2W56 B;  3NUV A;  1BIR A;  2IY2 A;  4OUQ A;  1EG9 B;  2RSX A;  3X40 A;  4FMD A;  2UGI A;  2Y74 A;  4N6M A;  1CQS A;  4KFD A;  1D6U A;  1MGW A;  3JVC A;  2H0I A;  4I5Q A;  4LGQ A;  5CF2 A;  1JZO A;  1RKY A;  1U8C B;  3KE7 A;  3CNX A;  3MG2 A;  3OW2 2;  1KSI A;  2V1L A;  2KXG A;  1LOY A;  1A90 A;  3DMC A;  3FF0 A;  2RNT A;  1T2I A;  5STD A;  1RGG A;  1NDO B;  3D5G A;  2J8X B;  1JJ2 2;  3X42 A;  3NBJ A;  5ELU A;  4EW5 A;  2P09 A;  1TFK A;  3AGO A;  3PS8 A;  1QAF A;  4JRF A;  1FGO A;  2Z76 A;  3B7C A;  1R4C A;  2OCT A;  1GD4 A;  2YFJ B;  1BNG A;  1GY5 A;  4RBN A;  4XDV A;  1J2B A;  4LSO A;  3LOY A;  5A0O B;  1LXE A;  4G1M B;  1W2Z A;  1G96 A;  2LYX A;  3FG4 A;  4DKI A;  1M1X B;  2IUK A;  1RCL A;  3H3H A;  5D83 A;  2HOH A;  3KKG A;  4BU4 A;  3BLZ A;  3RGA A;  3S67 A;  5BXQ A;  5CF1 A;  3WOE B;  2OTJ 3;  2OQE A;  4O02 B;  5JPP A;  1Z1S A;  3PYJ A;  2CHC A;  3QK9 A;  1O7M B;  4HBR A;  4H3U A;  4KVH A;  3SLU A;  4RZM A;  4O3V A;  1QVG 2;  2AAE A;  1L5G B;  2PNC A;  3DGY A;  5HGR A;  2P05 A;  1SIH A;  1GMP A;  3G4S 3;  1NU3 A;  4N6T A;  4CJN A;  1JB5 A;  1ROA A;  1BRN L;  3SXX A;  1N5H A;  1SQW A;  2CFW A;  2B1X B;  2R4I A;  4L8P A;  4LZI A;  2XR8 B;  1HYF A;  3BB9 A;  1YGE A;  3CCS 3;  5AEW B;  3HII A;  2RGQ A;  1SPU A;  5LC7 A;  5IW9 A;  4X2H A;  4XBT A;  3I55 3;  1BSC A;  1NO3 A;  1I2G A;  2E2T A;  1FGM A;  2CWT A;  4WYK B;  2GEX A;  3SX1 A;  1FGR A;  3Q90 A;  1K9M 4;  1B27 A;  2HMK B;  4HM2 B;  1IU7 A;  4JF8 A;  3JUO A;  3MWZ A;  3EB8 A;  4RNZ A;  3S5C A;  3N8B A;  1EUI C;  1B2X A;  1V74 A;  3DGO A;  1YHQ 3;  5AYR B;  1X1Y A;  1Q42 A;  2AAD A;  4IIA A;  3I56 3;  3LT8 A;  5IG3 A;  1EKM A;  1JBS A;  5AII A;  1Q7H A;  4N3V A;  2XSO B;  3G0K A;  1IVX A;  3FG1 A;  1W7C A;  5G1L A;  2F4Y A;  2L4V A;  9RNT A;  1OHS A;  3DGN A;  4QWT A;  5M1A A;  3L0R A;  4KFE A;  3WHO A;  4XBX A;  3KSE D;  2OOV A;  1IK3 A;  1JBR A;  1O7G B;  2W6J H;  1O7W B;  4CCV A;  2BMQ B;  2XFS A;  1LRA A;  1BNI A;  4LYL B;  1I70 A;  1EQK A;  1X1X A;  3BNB A;  1VQ7 3;  1A2K A;  1O7N B;  1DMM A;  2YX9 A;  4IPB A;  3NM2 A; 
#chains in the Genus database with same CATH homology
 3OWU A;  4HM6 B;  1E97 A;  1WQL B;  3X3Z A;  1JV2 B;  1VQL 3;  1GYB A;  3OX9 A;  3EQQ B;  1RRH A;  5D82 A;  3DUK A;  2QIY A;  3G71 3;  3A76 A;  2W9P A;  4GL6 A;  2BMO B;  2W0Q A;  4HM4 B;  4PEJ A;  3WA3 A;  3GWR A;  3K9M C;  3LTA A;  2LQV A;  4N6L A;  4HM7 B;  1RRL A;  2BHM A;  2M7O A;  4MEI A;  1C7H A;  3EBY A;  4O2H A;  5CXO A;  2WOH A;  1IVV A;  1QAL A;  2XH9 A;  4NHF A;  3WOD G;  2PZV A;  3UB1 A;  1DMN A;  4KFF A;  5IER A;  3U1W A;  3CC4 3;  4TX4 A;  1ZX2 A;  3N54 B;  1VQ6 3;  3DZL A;  3LTC A;  2CC3 A;  4Q53 A;  2GBW B;  2WO0 A;  5LC6 A;  1O7H B;  2K54 A;  4R9L A;  2ZDJ A;  1FGT A;  2C11 A;  2FXT A;  2HML B;  2JDI H;  1JB2 A;  3HI7 A;  5AIF A;  3TDG A;  1W2B 2;  1O7P B;  4EC6 A;  1ULJ B;  3LH4 A;  3IPT A;  3OWY A;  3UL5 A;  2O9U X;  1DVD A;  1E3V A;  1OPY A;  3MHE A;  1W4N A;  5I97 A;  2STD A;  2XF3 A;  3VSY A;  2CG1 A;  3SOA A;  2OTL 3;  1CYV A;  3NM7 A;  3WA2 X;  1UUV B;  3X3X A;  2P0X A;  3LML A;  3IJE B;  3FKA A;  2W04 A;  1N9E A;  4XBY A;  2KCD A;  3U97 A;  3PZW A;  3DXO A;  2BO9 B;  4WP5 A;  3VF1 A;  4N6N B;  1LNH A;  2CKF B;  4EBG A;  1Y4K A;  3CU3 A;  3T0U A;  3UJM A;  5JBS A;  1VZZ A;  3UL6 A;  1OUN A;  3CCU 3;  3LTD A;  5KP3 A;  4AKZ A;  4HZ9 B;  4IT7 A;  3VGN A;  4MMX B;  1N8Q A;  1WMP A;  1RN7 A;  2GU1 A;  3JUQ A;  1QMA A;  3F8H A;  4L7K A;  4FCJ A;  1DYU A;  1GD3 A;  4NRE A;  1D6Y A;  1F8N A;  3FZW A;  3KSP A;  3EE1 A;  1LOX A;  3FLJ A;  1QAK A;  1UI8 A;  1WMN A;  3CCQ 3;  2CFK A;  3KN4 A;  3G6E 3;  2F99 A;  3SOY A;  2HMM B;  5AYS C;  1Q7Y 4;  3CMA 3;  4BTX A;  1A67 A;  3HX8 A;  1N5P A;  3PCR A;  4HM5 B;  2CH9 A;  3NHX A;  1VQN 3;  1KQS 2;  2QGU A;  3B8L A;  1KD1 4;  3CPO A;  4OK0 A;  4FCZ A;  4HKV B;  1OCV A;  3CCV 3;  5FW5 A;  3G16 A;  2OQE C;  4X2O A;  2GBX B;  3GAX A;  1YIT 3;  3MSO A;  2CFG A;  3WMD A;  4XB5 A;  3NBB A;  2O3O A;  3FCS B;  4K90 B;  1ASK A;  4EV2 A;  2K0M A;  4O8S A;  1W6C A;  3IMA B;  4R1K A;  1KC8 4;  3PXM A;  1Q81 4;  1GY7 A;  1NB5 I;  3NQZ A;  2JQ5 A;  3ROB A;  1TUH A;  1JKG B;  1S5A A;  3FG3 A;  1N8R 4;  2CWV A;  2CIU A;  1LVN A;  4N6O B;  2Z77 A;  5FGO A;  2XEP A;  5ELJ A;  1VQ8 3;  1NB3 I;  3D9R A;  4FMA A;  2KRT A;  4LEH A;  3O8Y A;  1GS3 A;  1TIJ A;  2A15 A;  3Q2P A;  1CYU A;  1NJI 4;  1YIJ 3;  1WNH A;  1K28 A;  4AEQ A;  1OHP A;  5EVH A;  2ML5 A;  2W03 A;  2XGL A;  1YJW 3;  1YI2 3;  1VQM 3;  1VQP 3;  4MMY B;  3J7Y d;  2HMN B;  2UX0 A;  1JKG A;  5CLK A;  4HJL B;  1DMQ A;  1HKX A;  2MC8 A;  4HM8 B;  3QRD A;  3NV0 B;  3S29 A;  3AMO A;  3GRD A;  3LZA A;  2XFT A;  2IMJ A;  3BNE A;  1UI7 A;  3RDE A;  3FSD A;  1DVC A;  1MOL A;  2W9Q A;  5IEP A;  2IUJ A;  2ML6 A;  2E2V A;  3X3Y A;  3EX9 A;  4I4K A;  1A2V A;  1KWI A;  3NBR A;  1ULI B;  3MKI A;  4WHA A;  3CPW 2;  3B4O A;  5G2G A;  3EHC A;  3S27 A;  1AVK A;  2RCD A;  3SVA A;  3X41 A;  1UW1 A;  5IG5 A;  1M90 4;  1Q40 B;  1UUW B;  5KP1 A;  3CNM A;  1FA3 A;  3PGB A;  3Q1C A;  1W02 A;  2INX A;  3I0Y A;  1OAC A;  2FGT A;  3DM8 A;  1JB4 A;  3F7X A;  5TGN A;  2QEX 3;  3F14 A;  1VQ9 3;  2P38 A;  2Z6B A;  1ROV A;  1STD A;  2FNQ A;  3FGY A;  2BMR B;  4AKY A;  5EQL A;  4EYC A;  4MMZ B;  3H51 A;  3CCE 3;  3OXA A;  1Q86 4;  1IQY A;  1JNQ A;  4N6V 0;  3CME 3;  1PU4 A;  1TU5 A;  3N9H A;  4KZ1 A;  2SBL A;  3GZB A;  1AR0 A;  1QVF 2;  5CK6 A;  4HM3 B;  5KP4 A;  4MJD A;  3STD A;  4FMC A;  1RJO A;  5AI1 A;  2D42 A;  3CC7 3;  1YJN 3;  4GB5 A;  3B4P A;  1HU9 A;  1IV9 A;  2YFL B;  3K5T A;  1TP6 A;  5DRE A;  3CCJ 3;  2I9W A;  1PFP A;  1W6G A;  3LYG A;  3CCM 3;  1M1K 4;  3FH1 A;  3GZY B;  4K61 A;  3HZP A;  1IVU A;  1SII A;  4N6U A;  2E2U A;  2Q07 A;  4H61 A;  3HIG A;  2CG0 A;  3BND A;  3UNL A;  2F98 A;  4R80 A;  4HYZ A;  8CHO A;  3KII A;  1JN5 B;  1OGX A;  4L8O A;  3EN1 B;  4LMI A;  1W6Y A;  3GZX B;  3MG1 A;  5AEU B;  3JUM A;  2BNG A;  2Y73 A;  2F86 B;  3EC9 A;  3F40 A;  2P0M A;  3NQY A;  2Z7A A;  4XM4 A;  3CXC 2;  2D1W A;  1ZO2 A;  2W2C A;  3NX0 A;  5IEO A;  3CCR 3;  5D81 A;  4J9A A;  1VQ4 3;  4K1U A;  3M8C A;  4CDL A;  7STD A;  4J8T A;  1VQK 3;  1STF I;  1IT7 A;  3ALA A;  1M9G A;  3T8N A;  3ECF A;  5AIG A;  3MYT A;  2OOV C;  1K8A 4;  3SED A;  1JRQ A;  3WDG B;  1JN5 A;  2GU3 A;  2WGO A;  3S28 A;  1NWW A;  1MNL A;  2CFD A;  1FUW A;  3DY5 A;  3LTB A;  4U13 A;  3PCS A;  3K63 A;  4WYK A;  1E3R A;  3NXJ A;  4EXR A;  3D3L A;  2WGQ A;  3EJV A;  4FR9 A;  2QA4 3;  3MG3 A;  2ZL8 A;  4FCM A;  3KZT A;  1EA2 A;  2HMJ B;  3LT9 A;  1ISK A;  3WOF B;  3FF2 A;  1VQO 3;  4HVN A;  1OH0 A;  2MF7 A;  1OHO A;  2XSH B;  3V92 A;  3CD6 3;  3MPH A;  4EV5 A;  1K41 A;  1T5Y A;  4OVM A;  3F7S A;  3CC2 3;  2YFI B;  4XDW A;  1QJG A;  1W00 A;  1OF5 B;  1OGZ A;  3BNC A;  1AV4 A;  5IEN A;  1W01 A;  3DGM A;  3EN8 A;  3HK4 A;  2CFL A;  2XGN A;  1BUQ A;  1IQ8 A;  2GEY A;  2C10 A;  1YJ9 3;  3F8X A;  1AVL A;  3V98 A;  1VQ5 3;  3NV0 A;  3OV4 A;  2CK3 H;  3EF8 A;  1YVB I;  3E99 A;  2HMO B;  3AMO B;  3LXU X;  1IDP A;  1WTH A;  2GXF A;  4ZM8 A;  5BVB A;  2WOF A;  1TFO A;  3GZR A;  2CW9 A;  3KFQ C;  5IG4 A;  2CWU A;  3T8U A;  4WFO A;  4FMB A;  1D6Z A;  6STD A;  1IV7 A;  1S72 3;  1OF5 A;  2OWP A;  4RNY A;  3K0Z A;  5JPU A;  5DRV A;  3F9S A;  2W56 A;  1Q40 A;  2B24 B;  1W5Z A;  2IA7 A;  3DGL A;  4ORL A;  4R4K A;  1GY6 A;  4HM0 B;  1K73 4;  2BT3 A;  3JUP A;  4HZB B;  3EBT A;  1CEW I;  4WWU C;  1FGQ A;  1IVW A;  4BTW A;  4HM1 B;  3ER7 A;  3JUN A;  5EEO A;  4BTY A;  4STD A;  3K7C A;  1US1 A;  1IT8 A;  2XRX B;  3OWS A;  5IF6 A;  3CCL 3;  2RFR A;  1SJW A;  5AIH A;  1N9J A;  3V99 A;  3RGR A;  1IQX A;  1U5O A;  5IG0 A;  4K1V A;  3G8Z A;  1WMO A;  4R9K A;  2W56 B;  3NUV A;  4OUQ A;  1EG9 B;  2RSX A;  3X40 A;  4FMD A;  2Y74 A;  4N6M A;  1CQS A;  4KFD A;  1D6U A;  3JVC A;  5CF2 A;  4LGQ A;  1RKY A;  1U8C B;  3KE7 A;  3CNX A;  3MG2 A;  3OW2 2;  1KSI A;  2V1L A;  2KXG A;  1A90 A;  3DMC A;  3FF0 A;  5STD A;  1NDO B;  1JJ2 2;  3X42 A;  3NBJ A;  5ELU A;  2P09 A;  1TFK A;  3PS8 A;  1QAF A;  4JRF A;  1FGO A;  2Z76 A;  3B7C A;  1R4C A;  2OCT A;  1GD4 A;  2YFJ B;  1GY5 A;  4RBN A;  4XDV A;  1J2B A;  4LSO A;  3LOY A;  5A0O B;  1LXE A;  4G1M B;  1W2Z A;  1G96 A;  2LYX A;  3FG4 A;  1M1X B;  2IUK A;  3H3H A;  5D83 A;  1Q82 4;  3KKG A;  3BLZ A;  3RGA A;  3S67 A;  5BXQ A;  5CF1 A;  3WOE B;  2OTJ 3;  2OQE A;  4O02 B;  5JPP A;  1Z1S A;  3PYJ A;  2CHC A;  3QK9 A;  1O7M B;  4HBR A;  4H3U A;  4KVH A;  3SLU A;  4RZM A;  4O3V A;  1QVG 2;  1L5G B;  2PNC A;  5HGR A;  2P05 A;  1SIH A;  3G4S 3;  1NU3 A;  4N6T A;  1JB5 A;  1ROA A;  3SXX A;  1N5H A;  1SQW A;  2CFW A;  2B1X B;  2R4I A;  4L8P A;  4LZI A;  2XR8 B;  3BB9 A;  1YGE A;  3CCS 3;  5AEW B;  3HII A;  2RGQ A;  1SPU A;  5LC7 A;  5IW9 A;  4X2H A;  4XBT A;  3I55 3;  1NO3 A;  2CWT A;  1FGM A;  2E2T A;  4WYK B;  2GEX A;  3SX1 A;  1FGR A;  3Q90 A;  1K9M 4;  2HMK B;  4HM2 B;  1IU7 A;  4JF8 A;  3JUO A;  3MWZ A;  3EB8 A;  4RNZ A;  3S5C A;  3N8B A;  1V74 A;  3DGO A;  1YHQ 3;  5AYR B;  1Q42 A;  4IIA A;  3I56 3;  3LT8 A;  5IG3 A;  1EKM A;  5AII A;  4N3V A;  2XSO B;  3G0K A;  1IVX A;  3FG1 A;  1W7C A;  2L4V A;  1OHS A;  3DGN A;  4QWT A;  3L0R A;  4KFE A;  4XBX A;  3KSE D;  2OOV A;  1IK3 A;  1O7G B;  2W6J H;  1O7W B;  4CCV A;  2BMQ B;  2XFS A;  1EQK A;  3BNB A;  1VQ7 3;  1A2K A;  1O7N B;  1DMM A;  2YX9 A;  4IPB A;  3NM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...