1KD14

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kd1400
3CPW2 1VQ93 1VQK3 1Q814 1M1K4 1N8R4 1K8A4 3I563 3I553 1W2B2 1VQ43 1VQM3 1Q864 3CCV3 1YJW3 3CMA3 3CC73 1YIJ3 3OW22 3G713 1Q7Y4 3CC43 3CCE3 1VQN3 3CCM3 1KQS2 2OTL3 1JJ22 1KD14 3CCR3 1VQO3 3CME3 1VQP3 3CCS3 2QEX3 1K9M4 1YIT3 1VQ83 1Q824 3G4S3 1YI23 1M904 3CCU3 3CCL3 1YJ93 1QVG2 1VQL3 1VQ73 1K734 3CC23 3CCJ3 3CCQ3 1S723 1KC84 1NJI4 1VQ53 2OTJ3 1YJN3 3CXC2 1YHQ3 3CD63 1QVF2 2QA43 1VQ63 3G6E3
chains in the Genus database with same CATH superfamily
1RSNA 1C54A 3N8BA 3HX8A 3MWZA 2F56A 5G1LA 3BB9A 2HOHA 7RNTA 1UUWB 3S27A 1UCIA 3EJVA 3LZAA 1V74A 3LTAA 1A67A 1YNVX 4N6MA 3Q90A 3ZG0A 2GEXA 1IVVA 1ROAA 1V58A 2MF7A 3CME3 5IF6A 3FCSB 1WQLB 2JDIH 3OXAA 2ZDJA 3BLZA 3Q2PA 4LGQA 4CDLA 2K54A 1NO3A 3GAXA 3OWSA 4XM4A 4AEQA 2P0MA 4G1MB 4O02B 2BIRA 1HYFA 1O7MB 2IA7A 5BIRA 3CXC2 2W2CA 4EV5A 2AAEA 3EN1B 3NV0B 2RBIA 1VQ63 1MGWA 1FW7A 1RGLA 1RLSA 4AKYA 2BMQB 1SIIA 2F99A 4R9LA 1RN4A 1JNQA 4NREA 3VF1A 1Q7Y4 2GEYA 3S29A 3DUKA 1Z1SA 3PGBA 1BRNL 1IVXA 5KP3A 1RDSA 1B2SA 4GSPA 1IV7A 3EQQB 4L8PA 2IYJA 3H51A 2MC8A 2Q07A 4XDVA 1DMMA 3D79A 5RNTA 3DH2A 1W6YA 3KIIA 1YVSA 4J5KA 1WNHA 1BSCA 2ZHXB 4HAAA 5IEOA 1ISKA 1FUTA 1N9EA 4HM6B 1YVBI 2PNCA 1W2ZA 1VQQA 2Z77A 1RGGA 4EBGA 2CFKA 2OQEA 2GBWB 3EHCA 1E3VA 3G0KA 3AMOA 3D9RA 4N6OB 1I3FA 1RCLA 1W5ZA 5IENA 1BRKA 2CC3A 1WMNA 3MG1A 2OQEC 3OX9A 4LZIA 1D6UA 1LQGC 1RRLA 2L1SA 3RNTA 5AI1A 1E97A 4FCMA 1RCKA 1RHLA 3CCM3 5FW5A 3WDGB 5AYSC 2HMMB 3FLJA 1BIRA 1BSDA 1IDPA 1KD14 1ULJB 1FUWA 3LTDA 1UCKA 1O7WB 2BMOB 4NHFA 1TJDA 1X1YA 1WMOA 2SARA 3SLUA 7GSPA 1NU3A 4OK0A 1KSIA 3A76A 3LT8A 2Y73A 3KSED 1B2UA 4MJDA 1W00A 1JV2B 3HIIA 1VQL3 1KC84 4CPKA 1FGRA 2CIUA 1BU4A 4BL2A 1JN5A 1UGIA 3RDEA 3A5EA 1B27A 2KF3A 1A2PA 1SIHA 2H0HA 4XDWA 1N8R4 5BXQA 3FH1A 3JUNA 3KFQC 5AIIA 1RNBA 1G96A 3GZBA 3NM2A 3PS8A 4TX4A 1NB3I 1QAFA 1UCJA 1UGHI 2E2VA 3UL5A 4HZBB 3NQZA 2OTL3 1SJWA 3DGYA 3OWUA 4KFEA 1JJ22 3H3HA 2W56A 1DE3A 1MWUA 1D6ZA 3BNBA 3MPHA 3HOHA 3NUVA 3PXMA 2AADA 1BSAA 2K3DA 3PCRA 3SOYA 1VQ83 4OUQA 1BOXA 4XBTA 4CJNA 2I9WA 1BRHA 1OF5B 3Q3FA 4HM1B 4LSOA 1M9GA 1N5PA 3F8XA 4WHAA 1W6CA 2HMNB 2C11A 3LXUX 3X3ZA 1AR0A 1OH0A 6RNTA 2CK3H 5IG5A 5ELUA 1N8QA 2XGNA 4FMCA 1Q814 3B8LA 4L7KA 1UW1A 1RN7A 3LYGA 1B3SA 5I97A 3WHOA 1Q864 3CCV3 2CFWA 4HBRA 1RGHA 1PU4A 3M8CA 1K41A 1MGRA 2P09A 5STDA 5IG3A 5AYRB 3FG3A 2ML5A 3UJMA 5M18A 4FCZA 4RNTA 3AMOB 4HKVB 4X2OA 3B7CA 2W9QA 1M904 2XSOB 1ZGXA 1EA2A 4O2HA 3D3LA 1NDOB 3UL6A 1E3RA 2W0QA 3N54B 1ASKA 1LNIA 3FGYA 5IEPA 3GZXB 5M1AA 1R4CA 4HM2B 1YJN3 4HM3B 1EUIC 1FGTA 2E2TA 2F5WA 3VSYA 4BTYA 5JBSA 3CPW2 2YX9A 1VQK3 1CQSA 3SVAA 3CC73 3I553 3DMCA 1OACA 1LQMB 2F4YA 2HMLB 5AIFA 3AGOA 4Q53A 2F86B 1RGAA 3DGOA 1JN5B 4HVNA 2CKFB 1BUJA 1EQKA 4U13A 1AY7A 4LEHA 1TUHA 1U8CB 5CF2A 1DMQA 2P38A 4FMBA 2KRTA 3MKIA 1QJGA 1GY5A 2RFRA 1B21A 2BT3A 2GU1A 3MSOA 1QVG2 3F7SA 4RNYA 1GYBA 2OWPA 1K734 1G02A 1RGKA 2OOVC 1OPYA 2XGLA 3HK4A 3PYJA 4QWTA 9RNTA 1A90A 2W03A 5CXOA 2B24B 1OHOA 4WWUC 4BU4A 1FUSA 1I0VA 4J8TA 5IW9A 5HOHA 1M1K4 3RGRA 1MWSA 2KXGA 1RKYA 3FZWA 1VZZA 3FF2A 1U5OA 1L5GB 2CWUA 3E99A 3NXJA 4J9AA 3Q1CA 2IY2A 3G713 1BNIA 2CX1A 2WO0A 1GMRA 3QRDA 4XBYA 3D4AA 4NPBA 3BNDA 3ER7A 1X1WA 2KF5A 1IQYA 1FZUA 1AVLA 1Q824 4IPBA 3VGNA 4O8SA 1LNHA 1O7HB 1EEJA 3MG2A 3CCL3 1GY6A 3KN4A 1YJ93 6GSPA 1BRSA 2XRXB 3CCQ3 1VQ53 1KWIA 4N6LA 3JUQA 1W6GA 1TFOA 3KCHA 3S67A 4BIRA 4EYCA 1VQ93 5EEOA 3KSPA 3TDGA 1ZO2A 3NBJA 1WTHA 1VQM3 1X1XA 4GHOA 1YJW3 1FA3A 5KP1A 3EC9A 1KQS2 1BRJA 1IVUA 3F9SA 1UDII 2RNTA 1UCLA 1OUNA 4XBXA 1GS3A 4KVHA 4R1KA 1O7GB 1RNTA 1VQO3 2Y74A 4ILFA 1YIT3 4RZMA 1AQZA 1I2EA 4HM0B 4AKZA 2YFLB 4H3UA 2YFJB 1G0TA 2A15A 1OHPA 3U1WA 3PCSA 1T2IA 5CF1A 1Q40A 4FCJA 4FR9A 2KAAA 4K61A 2QA43 2BNGA 1YGEA 2XF3A 4N6V0 1RGEA 5CLKA 1R4YA 2W6JH 3K5TA 2XR8B 4IIAA 3KZTA 1FGMA 1DVDA 3B4PA 3FF0A 2CFDA 1VQ43 1LOVA 3NBBA 3X42A 3EN8A 2O9UX 1T2HA 1JB2A 1RGFA 5G1KA 1C7HA 1JBSA 2OOVA 2STDA 1LOXA 1UI8A 4XB5A 2GBXB 3DGNA 1I2FA 2CX0A 1LRAA 2C10A 2F5MA 2QEX3 1Q7HA 1B2ZA 2CH9A 3I0YA 5BU4A 3CPOA 3D5GA 1TU5A 2J8XB 4JF8A 3K7CA 1W02A 1HZ1A 4WFOA 2CW9A 3X41A 4N3VA 1JB5A 1S723 1TRQA 4WYKB 5GSPA 3WR2A 3IJEB 1BNSA 4CCVA 3CD63 1QVF2 1X1UA 3LMLA 2R41A 3JVCA 3DXOA 3AHWA 2BHMA 5BVBA 4EW5A 3CU3A 3JUPA 2B1XB 4KFFA 1N9JA 2UGIA 3MYTA 3OV4A 2XSHB 3MG3A 3OWYA 1SARA 3NQYA 4HM8B 3WODG 3X3YA 1OGXA 1BNFA 2INXA 3CCE3 3GRDA 4EV2A 1RN1A 3WA2X 1GMPA 3NM7A 1GY7A 1K9M4 1W4NA 4FMDA 2O3OA 2CWVA 2JQ5A 3GSPA 4R4KA 2CG1A 1F8NA 3GZRA 1YI23 1A2VA 1BRGA 2QIYA 3V99A 2M7OA 1JKGB 2GSPA 4LMIA 3URPA 2WGQA 5DRVA 1JRQA 5KP4A 1GOVA 1YHQ3 1ROVA 2CHCA 3DGMA 3MHEA 3HZPA 5D82A 1SPUA 1TTOA 3STDA 1EG9B 3EF8A 1IQ8A 1NNVA 2UX0A 2XH9A 1W2B2 3BNCA 1QAKA 1IYYA 1T5YA 2OCTA 1GMQA 1BGSA 1BSEA 1TIJA 3LTCA 3FSDA 5D83A 4EXRA 4HZ9B 1Q40B 1QMAA 1EKMA 2ZL8A 1A2KA 1GOUA 3LH4A 3WA3A 4HOHA 2CG0A 3FG1A 5CK6A 2WOFA 2RSXA 3SX1A 2ZA4A 2CFGA 1JB4A 2KF4A 4K1UA 1FYSA 2V1LA 2W04A 4BTXA 1T3BA 1IU7A 1N5HA 4I4KA 2FXTA 2IMJA 1PFPA 4K90B 3NV0A 2W56B 1MOLA 5G2GA 3UB1A 4BL3A 1M1XB 3SXXA 3CCS3 1UI7A 1OF5A 4GB5A 3KE7A 2YFIB 3CNMA 3LTBA 1LVNA 2L4VA 4K1VA 2W9PA 2FNQA 3S28A 8RNTA 5AEWB 1MNLA 1WMPA 2PZVA 5AIHA 1ZS7A 2BMRB 3OW22 2C4BA 1DVCA 1TP6A 3NX0A 1VQN3 5AIGA 4WYKA 3AHSA 3WMDA 4BTWA 2HMKB 3EX9A 3EE1A 1JZOA 3JUMA 2LQVA 1TRPA 4HM5B 4WP5A 1NWWA 2BU4A 3EBYA 2CFLA 3K0ZA 5JPPA 2H0IA 4JRFA 3ROBA 3NBRA 1B20A 1RGCA 1ULIB 3IPTA 2KCDA 4HJLB 5IERA 1I2GA 4ORLA 1IVWA 2XEPA 3NHXA 4MMYB 8CHOA 1OCVA 1GD4A 1NB5I 2GU3A 3X40A 3WOEB 5HGRA 5M19A 1IT7A 1STFI 1B2MA 1JBTA 3WOFB 5ELJA 1AVKA 3K9MC 3ZG5A 3EBTA 1K28A 5FGOA 3GZYB 1CH0A 1HU9A 2WOHA 3HI7A 3CC43 1BSBA 3B4OA 4DKIA 3F40A 4IT7A 3ZFZA 4I5QA 1LXEA 1DETA 1RMSA 3D5IA 3IMAB 3K63A 1O7NB 4L8OA 1W01A 1LOWA 1Q9EA 7STDA 1DYUA 4X2HA 3JUOA 5LC6A 2OTJ3 2HMJB 4LYLB 1BVIA 1UUGB 1AV4A 3T8UA 3G16A 3G6E3 1SQWA 2BO9B 3V98A 1YGWA 1K8A4 4R9KA 1BANA 4KT3B 6STDA 1D6YA 1BNEA 3GWRA 3RGAA 1RTUA 3EB8A 2IUJA 1STDA 2HMOB 2K0MA 1JZDA 2ML6A 2WGOA 5D81A 3DY5A 1GD3A 3CCR3 1RRHA 3S5CA 3G8ZA 2F98A 4H61A 4EC6A 1I3IA 5EQLA 5AEUB 1IT8A 2KF6A 3CCU3 1GSPA 1QALA 2Z76A 5IG0A 3ALAA 3CC23 3T0UA 1UUVB 3KKGA 1BRIA 1HKXA 1TFKA 3U97A 4R80A 1O7PB 1I8VA 3LT9A 2GXFA 4HYZA 2Z6BA 4RBNA 3F8HA 4OVMA 3X3XA 4STDA 2RGQA 3PZWA 4PEJA 3HIGA 1DMNA 2D42A 3O8YA 4N6TA 5TGNA 1LOYA 4MMZB 1ZX2A 4MEIA 2H0GA 2RCDA 3L0RA 1GOYA 1RJOA 1S5AA 1W7CA 5DREA 1J2BA 3G4S3 1OGZA 1IV9A 3AGNA 3BIRA 1MWTA 3CNXA 3LOYA 1I70A 3T8NA 4GL6A 1BNGA 2LYXA 1VQ73 5LC7A 1PY3A 2XFTA 3SYUA 3FKAA 1CYVA 1I0XA 1FGQA 2QGUA 4KZ1A 3SOAA 1Y4KA 2E2UA 5EVHA 3I563 3N9HA 2SBLA 5IG4A 2UUGC 3SEDA 2R4IA 4FMAA 3DGLA 1JBRA 3CMA3 1CEWI 1B2XA 1YIJ3 3DZLA 1US1A 4RNZA 3BNEA 3V92A 2XFSA 3UNLA 1BNJA 2D1WA 1OHSA 1V57A 3DM8A 1MWRA 1VQP3 2P0XA 4KFDA 2P05A 2Z7AA 4N6UA 1BUQA 3FG4A 1CYUA 1BAOA 2CWTA 3F7XA 4N6NB 4O3VA 4HM4B 3J7Yd 1BNRA 2IUKA 5A0OB 1FGOA 1PYLA 3CCJ3 3QK9A 1NJI4 4MMXB 4HM7B 4J5GA 1IK3A 3BU4A 5JPUA 1Q42A 3ECFA 2FGTA 1IQXA 4ZM8A 3F14A 1JKGA
chains in the Genus database with same CATH topology
3N8BA 3HX8A 3MWZA 3BB9A 1UUWB 3S27A 3EJVA 3LZAA 1V74A 3LTAA 1A67A 4N6MA 3Q90A 2GEXA 1IVVA 1ROAA 2MF7A 3CME3 5IF6A 3FCSB 1WQLB 2JDIH 3OXAA 2ZDJA 3BLZA 3Q2PA 4LGQA 4CDLA 2K54A 1NO3A 3GAXA 3OWSA 4XM4A 4AEQA 2P0MA 4G1MB 4O02B 1O7MB 2IA7A 3CXC2 2W2CA 4EV5A 3EN1B 3NV0B 1VQ63 4AKYA 2BMQB 1SIIA 2F99A 4R9LA 1JNQA 4NREA 3VF1A 1Q7Y4 2GEYA 3S29A 3DUKA 1Z1SA 3PGBA 1IVXA 5KP3A 4L8PA 1IV7A 3EQQB 3H51A 2MC8A 2Q07A 4XDVA 1DMMA 3KIIA 1W6YA 1WNHA 5IEOA 1ISKA 1N9EA 4HM6B 1YVBI 2PNCA 1W2ZA 2Z77A 4EBGA 2CFKA 2OQEA 2GBWB 3EHCA 1E3VA 3G0KA 3AMOA 3D9RA 4N6OB 1W5ZA 5IENA 2CC3A 1WMNA 3MG1A 2OQEC 3OX9A 4LZIA 1D6UA 1RRLA 5AI1A 1E97A 4FCMA 3CCM3 5FW5A 3WDGB 5AYSC 2HMMB 3FLJA 1IDPA 1KD14 1ULJB 1FUWA 3LTDA 1O7WB 2BMOB 4NHFA 1WMOA 3SLUA 1NU3A 4OK0A 1KSIA 3A76A 3LT8A 2Y73A 3KSED 4MJDA 7STDA 1W00A 1JV2B 3HIIA 1VQL3 1KC84 1FGRA 2CIUA 1JN5A 3RDEA 1SIHA 4XDWA 1N8R4 5BXQA 3FH1A 3JUNA 3KFQC 5AIIA 1G96A 3GZBA 3NM2A 3PS8A 4TX4A 1NB3I 1QAFA 2E2VA 3UL5A 4HZBB 3NQZA 2OTL3 1SJWA 3OWUA 4KFEA 1JJ22 3H3HA 2W56A 1D6ZA 3BNBA 3MPHA 3NUVA 3PXMA 3SOYA 3PCRA 1VQ83 4OUQA 4XBTA 2I9WA 1OF5B 4HM1B 4LSOA 1M9GA 1N5PA 3F8XA 4WHAA 1W6CA 2HMNB 2C11A 3LXUX 3X3ZA 1AR0A 1OH0A 2CK3H 5IG5A 5ELUA 1N8QA 2XGNA 4FMCA 1Q814 3B8LA 4L7KA 1UW1A 1RN7A 3LYGA 5I97A 1Q864 3CCV3 2CFWA 4HBRA 1PU4A 3M8CA 1K41A 2P09A 5STDA 5IG3A 5AYRB 3FG3A 2ML5A 3UJMA 4FCZA 3AMOB 4HKVB 4X2OA 3B7CA 2W9QA 1M904 2XSOB 1EA2A 4O2HA 3D3LA 1NDOB 3UL6A 1E3RA 2W0QA 3N54B 1ASKA 3FGYA 5IEPA 3GZXB 1R4CA 4HM2B 1YJN3 4HM3B 1FGTA 2E2TA 3VSYA 4BTYA 3CPW2 5JBSA 1VQK3 2YX9A 1CQSA 3SVAA 3I553 3DMCA 1OACA 2HMLB 5AIFA 4Q53A 2F86B 3DGOA 4HVNA 1JN5B 1EQKA 2CKFB 4U13A 4LEHA 1TUHA 1U8CB 5CF2A 1DMQA 2P38A 4FMBA 2KRTA 3MKIA 1QJGA 1GY5A 2RFRA 2BT3A 3MSOA 2GU1A 1QVG2 3F7SA 4RNYA 1GYBA 2OWPA 1K734 2OOVC 2XGLA 1OPYA 3HK4A 3PYJA 4QWTA 1A90A 2W03A 5CXOA 2B24B 1OHOA 4WWUC 5IW9A 4J8TA 1M1K4 3RGRA 2KXGA 1RKYA 3FZWA 1VZZA 3FF2A 1U5OA 1L5GB 2CWUA 3E99A 3NXJA 4J9AA 3Q1CA 3G713 2WO0A 3QRDA 4XBYA 3BNDA 3ER7A 1IQYA 1AVLA 1Q824 4IPBA 3VGNA 4O8SA 1LNHA 1O7HB 3MG2A 3CCL3 1GY6A 3KN4A 1YJ93 2XRXB 3CCQ3 1VQ53 1KWIA 4N6LA 3JUQA 1W6GA 1TFOA 3S67A 4EYCA 1VQ93 5EEOA 3KSPA 3TDGA 1ZO2A 3NBJA 1WTHA 1VQM3 1YJW3 1FA3A 5KP1A 3EC9A 1KQS2 1IVUA 3F9SA 1OUNA 4XBXA 1GS3A 4KVHA 4R1KA 1O7GB 1VQO3 2Y74A 1YIT3 4RZMA 4HM0B 4AKZA 2YFLB 4H3UA 2YFJB 2A15A 1OHPA 3U1WA 3PCSA 5CF1A 1Q40A 4FCJA 4FR9A 4K61A 2QA43 2BNGA 1YGEA 2XF3A 4N6V0 5CLKA 2W6JH 3K5TA 2XR8B 4IIAA 3KZTA 1FGMA 1DVDA 3B4PA 3FF0A 2CFDA 1VQ43 3NBBA 3X42A 3EN8A 2O9UX 1JB2A 1C7HA 2OOVA 2STDA 1LOXA 1UI8A 4XB5A 2GBXB 3DGNA 2C10A 2QEX3 2CH9A 3I0YA 3CPOA 1TU5A 4JF8A 3K7CA 1W02A 4WFOA 2CW9A 3X41A 4N3VA 1JB5A 1S723 4WYKB 4CCVA 3CD63 3IJEB 1QVF2 3LMLA 3JVCA 3DXOA 2BHMA 5BVBA 3CU3A 3JUPA 2B1XB 4KFFA 1N9JA 3CC73 3MYTA 3OV4A 2XSHB 3MG3A 3OWYA 4HM8B 3NQYA 3X3YA 3WODG 3CCE3 1OGXA 2INXA 3GRDA 4EV2A 3WA2X 3NM7A 1GY7A 1K9M4 1W4NA 4FMDA 2O3OA 2CWVA 2JQ5A 4R4KA 2CG1A 1F8NA 3GZRA 1YI23 1A2VA 2QIYA 3V99A 2M7OA 1JKGB 4LMIA 2WGQA 5DRVA 1JRQA 5KP4A 1YHQ3 1ROVA 2CHCA 3DGMA 3MHEA 3HZPA 5D82A 1SPUA 3STDA 1EG9B 3EF8A 1IQ8A 2XH9A 2UX0A 1W2B2 3BNCA 1QAKA 1T5YA 2OCTA 1TIJA 3LTCA 3FSDA 5D83A 4EXRA 4HZ9B 1Q40B 1QMAA 1EKMA 2ZL8A 1A2KA 3LH4A 3WA3A 2CG0A 3FG1A 5CK6A 2WOFA 2RSXA 3SX1A 1JB4A 2CFGA 4K1UA 2V1LA 2W04A 4BTXA 1IU7A 1N5HA 4I4KA 2FXTA 2IMJA 1PFPA 4K90B 3NV0A 2W56B 1MOLA 5G2GA 3UB1A 1M1XB 3SXXA 3CCS3 1UI7A 1OF5A 4GB5A 3KE7A 2YFIB 3CNMA 3LTBA 1LVNA 2L4VA 4K1VA 2W9PA 2FNQA 3S28A 5AEWB 1MNLA 1WMPA 2PZVA 5AIHA 2BMRB 3OW22 1VQN3 1DVCA 1TP6A 3NX0A 5AIGA 4WYKA 3WMDA 4BTWA 2HMKB 3EX9A 3EE1A 3JUMA 2LQVA 4HM5B 4WP5A 1NWWA 3EBYA 3K0ZA 2CFLA 5JPPA 4JRFA 3ROBA 3NBRA 1ULIB 3IPTA 2KCDA 4HJLB 5IERA 4ORLA 1IVWA 2XEPA 3NHXA 4MMYB 8CHOA 1OCVA 1GD4A 1NB5I 2GU3A 3X40A 3WOEB 5HGRA 1IT7A 1STFI 3WOFB 5ELJA 1AVKA 3K9MC 3EBTA 1K28A 5FGOA 3GZYB 1HU9A 2WOHA 3HI7A 3CC43 3B4OA 3F40A 4IT7A 1LXEA 3IMAB 3K63A 1O7NB 4L8OA 1W01A 1DYUA 4X2HA 3JUOA 5LC6A 2OTJ3 2HMJB 1AV4A 3T8UA 3G16A 3G6E3 1SQWA 2BO9B 3V98A 1K8A4 4R9KA 6STDA 1D6YA 3GWRA 3RGAA 3EB8A 2IUJA 1STDA 2HMOB 2K0MA 2ML6A 2WGOA 5D81A 3DY5A 1GD3A 3CCR3 1RRHA 3S5CA 3G8ZA 2F98A 4H61A 4EC6A 5EQLA 5AEUB 1IT8A 3CCU3 1QALA 2Z76A 5IG0A 3ALAA 3CC23 3T0UA 1UUVB 3KKGA 1HKXA 1TFKA 3U97A 4R80A 1O7PB 3LT9A 2GXFA 4HYZA 2Z6BA 4RBNA 3F8HA 4OVMA 3X3XA 4STDA 2RGQA 3PZWA 4PEJA 3HIGA 1DMNA 2D42A 3O8YA 4N6TA 5TGNA 4MMZB 1ZX2A 4MEIA 2RCDA 3L0RA 1RJOA 1S5AA 1W7CA 5DREA 1J2BA 3G4S3 1OGZA 1IV9A 3LOYA 3CNXA 3T8NA 4GL6A 2LYXA 1VQ73 5LC7A 2XFTA 3FKAA 1CYVA 1FGQA 2QGUA 4KZ1A 3SOAA 1Y4KA 2E2UA 5EVHA 3I563 3N9HA 2SBLA 5IG4A 3SEDA 2R4IA 4FMAA 3DGLA 3CMA3 1CEWI 1YIJ3 3DZLA 1US1A 4RNZA 3BNEA 3V92A 2XFSA 3UNLA 2D1WA 1OHSA 3DM8A 1VQP3 2P0XA 4KFDA 2P05A 2Z7AA 4N6UA 1BUQA 3FG4A 1CYUA 2CWTA 3F7XA 4N6NB 4O3VA 4HM4B 3J7Yd 2IUKA 5A0OB 1FGOA 3CCJ3 3QK9A 1NJI4 4MMXB 4HM7B 1IK3A 5JPUA 1Q42A 3ECFA 2FGTA 1IQXA 4ZM8A 3F14A 1JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW 2;  1VQ9 3;  1VQK 3;  1Q81 4;  1M1K 4;  1N8R 4;  1K8A 4;  3I56 3;  3I55 3;  1W2B 2;  1VQ4 3;  1VQM 3;  1Q86 4;  3CCV 3;  1YJW 3;  3CMA 3;  3CC7 3;  1YIJ 3;  3OW2 2;  3G71 3;  1Q7Y 4;  3CC4 3;  3CCE 3;  1VQN 3;  3CCM 3;  1KQS 2;  2OTL 3;  1JJ2 2;  1KD1 4;  3CCR 3;  1VQO 3;  3CME 3;  1VQP 3;  3CCS 3;  2QEX 3;  1K9M 4;  1YIT 3;  1VQ8 3;  1Q82 4;  3G4S 3;  1YI2 3;  1M90 4;  3CCU 3;  3CCL 3;  1YJ9 3;  1QVG 2;  1VQL 3;  1VQ7 3;  1K73 4;  3CC2 3;  3CCJ 3;  3CCQ 3;  1S72 3;  1KC8 4;  1NJI 4;  1VQ5 3;  2OTJ 3;  1YJN 3;  3CXC 2;  1YHQ 3;  3CD6 3;  1QVF 2;  2QA4 3;  1VQ6 3;  3G6E 3; 
#chains in the Genus database with same CATH topology
 1RSN A;  1C54 A;  3N8B A;  3HX8 A;  3MWZ A;  2F56 A;  5G1L A;  3BB9 A;  2HOH A;  7RNT A;  1UUW B;  3S27 A;  1UCI A;  3EJV A;  3LZA A;  1V74 A;  3LTA A;  1A67 A;  1YNV X;  4N6M A;  3Q90 A;  3ZG0 A;  2GEX A;  1IVV A;  1ROA A;  1V58 A;  2MF7 A;  3CME 3;  5IF6 A;  3FCS B;  1WQL B;  2JDI H;  3OXA A;  2ZDJ A;  3BLZ A;  3Q2P A;  4LGQ A;  4CDL A;  2K54 A;  1NO3 A;  3GAX A;  3OWS A;  4XM4 A;  4AEQ A;  2P0M A;  4G1M B;  4O02 B;  2BIR A;  1HYF A;  1O7M B;  2IA7 A;  5BIR A;  3CXC 2;  2W2C A;  4EV5 A;  2AAE A;  3EN1 B;  3NV0 B;  2RBI A;  1VQ6 3;  1MGW A;  1FW7 A;  1RGL A;  1RLS A;  4AKY A;  2BMQ B;  1SII A;  2F99 A;  4R9L A;  1RN4 A;  1JNQ A;  4NRE A;  3VF1 A;  1Q7Y 4;  2GEY A;  3S29 A;  3DUK A;  1Z1S A;  3PGB A;  1BRN L;  1IVX A;  5KP3 A;  1RDS A;  1B2S A;  4GSP A;  1IV7 A;  3EQQ B;  4L8P A;  2IYJ A;  3H51 A;  2MC8 A;  2Q07 A;  4XDV A;  1DMM A;  3D79 A;  5RNT A;  3DH2 A;  1W6Y A;  3KII A;  1YVS A;  4J5K A;  1WNH A;  1BSC A;  2ZHX B;  4HAA A;  5IEO A;  1ISK A;  1FUT A;  1N9E A;  4HM6 B;  1YVB I;  2PNC A;  1W2Z A;  1VQQ A;  2Z77 A;  1RGG A;  4EBG A;  2CFK A;  2OQE A;  2GBW B;  3EHC A;  1E3V A;  3G0K A;  3AMO A;  3D9R A;  4N6O B;  1I3F A;  1RCL A;  1W5Z A;  5IEN A;  1BRK A;  2CC3 A;  1WMN A;  3MG1 A;  2OQE C;  3OX9 A;  4LZI A;  1D6U A;  1LQG C;  1RRL A;  2L1S A;  3RNT A;  5AI1 A;  1E97 A;  4FCM A;  1RCK A;  1RHL A;  3CCM 3;  5FW5 A;  3WDG B;  5AYS C;  2HMM B;  3FLJ A;  1BIR A;  1BSD A;  1IDP A;  1KD1 4;  1ULJ B;  1FUW A;  3LTD A;  1UCK A;  1O7W B;  2BMO B;  4NHF A;  1TJD A;  1X1Y A;  1WMO A;  2SAR A;  3SLU A;  7GSP A;  1NU3 A;  4OK0 A;  1KSI A;  3A76 A;  3LT8 A;  2Y73 A;  3KSE D;  1B2U A;  4MJD A;  1W00 A;  1JV2 B;  3HII A;  1VQL 3;  1KC8 4;  4CPK A;  1FGR A;  2CIU A;  1BU4 A;  4BL2 A;  1JN5 A;  1UGI A;  3RDE A;  3A5E A;  1B27 A;  2KF3 A;  1A2P A;  1SIH A;  2H0H A;  4XDW A;  1N8R 4;  5BXQ A;  3FH1 A;  3JUN A;  3KFQ C;  5AII A;  1RNB A;  1G96 A;  3GZB A;  3NM2 A;  3PS8 A;  4TX4 A;  1NB3 I;  1QAF A;  1UCJ A;  1UGH I;  2E2V A;  3UL5 A;  4HZB B;  3NQZ A;  2OTL 3;  1SJW A;  3DGY A;  3OWU A;  4KFE A;  1JJ2 2;  3H3H A;  2W56 A;  1DE3 A;  1MWU A;  1D6Z A;  3BNB A;  3MPH A;  3HOH A;  3NUV A;  3PXM A;  2AAD A;  1BSA A;  2K3D A;  3PCR A;  3SOY A;  1VQ8 3;  4OUQ A;  1BOX A;  4XBT A;  4CJN A;  2I9W A;  1BRH A;  1OF5 B;  3Q3F A;  4HM1 B;  4LSO A;  1M9G A;  1N5P A;  3F8X A;  4WHA A;  1W6C A;  2HMN B;  2C11 A;  3LXU X;  3X3Z A;  1AR0 A;  1OH0 A;  6RNT A;  2CK3 H;  5IG5 A;  5ELU A;  1N8Q A;  2XGN A;  4FMC A;  1Q81 4;  3B8L A;  4L7K A;  1UW1 A;  1RN7 A;  3LYG A;  1B3S A;  5I97 A;  3WHO A;  1Q86 4;  3CCV 3;  2CFW A;  4HBR A;  1RGH A;  1PU4 A;  3M8C A;  1K41 A;  1MGR A;  2P09 A;  5STD A;  5IG3 A;  5AYR B;  3FG3 A;  2ML5 A;  3UJM A;  5M18 A;  4FCZ A;  4RNT A;  3AMO B;  4HKV B;  4X2O A;  3B7C A;  2W9Q A;  1M90 4;  2XSO B;  1ZGX A;  1EA2 A;  4O2H A;  3D3L A;  1NDO B;  3UL6 A;  1E3R A;  2W0Q A;  3N54 B;  1ASK A;  1LNI A;  3FGY A;  5IEP A;  3GZX B;  5M1A A;  1R4C A;  4HM2 B;  1YJN 3;  4HM3 B;  1EUI C;  1FGT A;  2E2T A;  2F5W A;  3VSY A;  4BTY A;  5JBS A;  3CPW 2;  2YX9 A;  1VQK 3;  1CQS A;  3SVA A;  3CC7 3;  3I55 3;  3DMC A;  1OAC A;  1LQM B;  2F4Y A;  2HML B;  5AIF A;  3AGO A;  4Q53 A;  2F86 B;  1RGA A;  3DGO A;  1JN5 B;  4HVN A;  2CKF B;  1BUJ A;  1EQK A;  4U13 A;  1AY7 A;  4LEH A;  1TUH A;  1U8C B;  5CF2 A;  1DMQ A;  2P38 A;  4FMB A;  2KRT A;  3MKI A;  1QJG A;  1GY5 A;  2RFR A;  1B21 A;  2BT3 A;  2GU1 A;  3MSO A;  1QVG 2;  3F7S A;  4RNY A;  1GYB A;  2OWP A;  1K73 4;  1G02 A;  1RGK A;  2OOV C;  1OPY A;  2XGL A;  3HK4 A;  3PYJ A;  4QWT A;  9RNT A;  1A90 A;  2W03 A;  5CXO A;  2B24 B;  1OHO A;  4WWU C;  4BU4 A;  1FUS A;  1I0V A;  4J8T A;  5IW9 A;  5HOH A;  1M1K 4;  3RGR A;  1MWS A;  2KXG A;  1RKY A;  3FZW A;  1VZZ A;  3FF2 A;  1U5O A;  1L5G B;  2CWU A;  3E99 A;  3NXJ A;  4J9A A;  3Q1C A;  2IY2 A;  3G71 3;  1BNI A;  2CX1 A;  2WO0 A;  1GMR A;  3QRD A;  4XBY A;  3D4A A;  4NPB A;  3BND A;  3ER7 A;  1X1W A;  2KF5 A;  1IQY A;  1FZU A;  1AVL A;  1Q82 4;  4IPB A;  3VGN A;  4O8S A;  1LNH A;  1O7H B;  1EEJ A;  3MG2 A;  3CCL 3;  1GY6 A;  3KN4 A;  1YJ9 3;  6GSP A;  1BRS A;  2XRX B;  3CCQ 3;  1VQ5 3;  1KWI A;  4N6L A;  3JUQ A;  1W6G A;  1TFO A;  3KCH A;  3S67 A;  4BIR A;  4EYC A;  1VQ9 3;  5EEO A;  3KSP A;  3TDG A;  1ZO2 A;  3NBJ A;  1WTH A;  1VQM 3;  1X1X A;  4GHO A;  1YJW 3;  1FA3 A;  5KP1 A;  3EC9 A;  1KQS 2;  1BRJ A;  1IVU A;  3F9S A;  1UDI I;  2RNT A;  1UCL A;  1OUN A;  4XBX A;  1GS3 A;  4KVH A;  4R1K A;  1O7G B;  1RNT A;  1VQO 3;  2Y74 A;  4ILF A;  1YIT 3;  4RZM A;  1AQZ A;  1I2E A;  4HM0 B;  4AKZ A;  2YFL B;  4H3U A;  2YFJ B;  1G0T A;  2A15 A;  1OHP A;  3U1W A;  3PCS A;  1T2I A;  5CF1 A;  1Q40 A;  4FCJ A;  4FR9 A;  2KAA A;  4K61 A;  2QA4 3;  2BNG A;  1YGE A;  2XF3 A;  4N6V 0;  1RGE A;  5CLK A;  1R4Y A;  2W6J H;  3K5T A;  2XR8 B;  4IIA A;  3KZT A;  1FGM A;  1DVD A;  3B4P A;  3FF0 A;  2CFD A;  1VQ4 3;  1LOV A;  3NBB A;  3X42 A;  3EN8 A;  2O9U X;  1T2H A;  1JB2 A;  1RGF A;  5G1K A;  1C7H A;  1JBS A;  2OOV A;  2STD A;  1LOX A;  1UI8 A;  4XB5 A;  2GBX B;  3DGN A;  1I2F A;  2CX0 A;  1LRA A;  2C10 A;  2F5M A;  2QEX 3;  1Q7H A;  1B2Z A;  2CH9 A;  3I0Y A;  5BU4 A;  3CPO A;  3D5G A;  1TU5 A;  2J8X B;  4JF8 A;  3K7C A;  1W02 A;  1HZ1 A;  4WFO A;  2CW9 A;  3X41 A;  4N3V A;  1JB5 A;  1S72 3;  1TRQ A;  4WYK B;  5GSP A;  3WR2 A;  3IJE B;  1BNS A;  4CCV A;  3CD6 3;  1QVF 2;  1X1U A;  3LML A;  2R41 A;  3JVC A;  3DXO A;  3AHW A;  2BHM A;  5BVB A;  4EW5 A;  3CU3 A;  3JUP A;  2B1X B;  4KFF A;  1N9J A;  2UGI A;  3MYT A;  3OV4 A;  2XSH B;  3MG3 A;  3OWY A;  1SAR A;  3NQY A;  4HM8 B;  3WOD G;  3X3Y A;  1OGX A;  1BNF A;  2INX A;  3CCE 3;  3GRD A;  4EV2 A;  1RN1 A;  3WA2 X;  1GMP A;  3NM7 A;  1GY7 A;  1K9M 4;  1W4N A;  4FMD A;  2O3O A;  2CWV A;  2JQ5 A;  3GSP A;  4R4K A;  2CG1 A;  1F8N A;  3GZR A;  1YI2 3;  1A2V A;  1BRG A;  2QIY A;  3V99 A;  2M7O A;  1JKG B;  2GSP A;  4LMI A;  3URP A;  2WGQ A;  5DRV A;  1JRQ A;  5KP4 A;  1GOV A;  1YHQ 3;  1ROV A;  2CHC A;  3DGM A;  3MHE A;  3HZP A;  5D82 A;  1SPU A;  1TTO A;  3STD A;  1EG9 B;  3EF8 A;  1IQ8 A;  1NNV A;  2UX0 A;  2XH9 A;  1W2B 2;  3BNC A;  1QAK A;  1IYY A;  1T5Y A;  2OCT A;  1GMQ A;  1BGS A;  1BSE A;  1TIJ A;  3LTC A;  3FSD A;  5D83 A;  4EXR A;  4HZ9 B;  1Q40 B;  1QMA A;  1EKM A;  2ZL8 A;  1A2K A;  1GOU A;  3LH4 A;  3WA3 A;  4HOH A;  2CG0 A;  3FG1 A;  5CK6 A;  2WOF A;  2RSX A;  3SX1 A;  2ZA4 A;  2CFG A;  1JB4 A;  2KF4 A;  4K1U A;  1FYS A;  2V1L A;  2W04 A;  4BTX A;  1T3B A;  1IU7 A;  1N5H A;  4I4K A;  2FXT A;  2IMJ A;  1PFP A;  4K90 B;  3NV0 A;  2W56 B;  1MOL A;  5G2G A;  3UB1 A;  4BL3 A;  1M1X B;  3SXX A;  3CCS 3;  1UI7 A;  1OF5 A;  4GB5 A;  3KE7 A;  2YFI B;  3CNM A;  3LTB A;  1LVN A;  2L4V A;  4K1V A;  2W9P A;  2FNQ A;  3S28 A;  8RNT A;  5AEW B;  1MNL A;  1WMP A;  2PZV A;  5AIH A;  1ZS7 A;  2BMR B;  3OW2 2;  2C4B A;  1DVC A;  1TP6 A;  3NX0 A;  1VQN 3;  5AIG A;  4WYK A;  3AHS A;  3WMD A;  4BTW A;  2HMK B;  3EX9 A;  3EE1 A;  1JZO A;  3JUM A;  2LQV A;  1TRP A;  4HM5 B;  4WP5 A;  1NWW A;  2BU4 A;  3EBY A;  2CFL A;  3K0Z A;  5JPP A;  2H0I A;  4JRF A;  3ROB A;  3NBR A;  1B20 A;  1RGC A;  1ULI B;  3IPT A;  2KCD A;  4HJL B;  5IER A;  1I2G A;  4ORL A;  1IVW A;  2XEP A;  3NHX A;  4MMY B;  8CHO A;  1OCV A;  1GD4 A;  1NB5 I;  2GU3 A;  3X40 A;  3WOE B;  5HGR A;  5M19 A;  1IT7 A;  1STF I;  1B2M A;  1JBT A;  3WOF B;  5ELJ A;  1AVK A;  3K9M C;  3ZG5 A;  3EBT A;  1K28 A;  5FGO A;  3GZY B;  1CH0 A;  1HU9 A;  2WOH A;  3HI7 A;  3CC4 3;  1BSB A;  3B4O A;  4DKI A;  3F40 A;  4IT7 A;  3ZFZ A;  4I5Q A;  1LXE A;  1DET A;  1RMS A;  3D5I A;  3IMA B;  3K63 A;  1O7N B;  4L8O A;  1W01 A;  1LOW A;  1Q9E A;  7STD A;  1DYU A;  4X2H A;  3JUO A;  5LC6 A;  2OTJ 3;  2HMJ B;  4LYL B;  1BVI A;  1UUG B;  1AV4 A;  3T8U A;  3G16 A;  3G6E 3;  1SQW A;  2BO9 B;  3V98 A;  1YGW A;  1K8A 4;  4R9K A;  1BAN A;  4KT3 B;  6STD A;  1D6Y A;  1BNE A;  3GWR A;  3RGA A;  1RTU A;  3EB8 A;  2IUJ A;  1STD A;  2HMO B;  2K0M A;  1JZD A;  2ML6 A;  2WGO A;  5D81 A;  3DY5 A;  1GD3 A;  3CCR 3;  1RRH A;  3S5C A;  3G8Z A;  2F98 A;  4H61 A;  4EC6 A;  1I3I A;  5EQL A;  5AEU B;  1IT8 A;  2KF6 A;  3CCU 3;  1GSP A;  1QAL A;  2Z76 A;  5IG0 A;  3ALA A;  3CC2 3;  3T0U A;  1UUV B;  3KKG A;  1BRI A;  1HKX A;  1TFK A;  3U97 A;  4R80 A;  1O7P B;  1I8V A;  3LT9 A;  2GXF A;  4HYZ A;  2Z6B A;  4RBN A;  3F8H A;  4OVM A;  3X3X A;  4STD A;  2RGQ A;  3PZW A;  4PEJ A;  3HIG A;  1DMN A;  2D42 A;  3O8Y A;  4N6T A;  5TGN A;  1LOY A;  4MMZ B;  1ZX2 A;  4MEI A;  2H0G A;  2RCD A;  3L0R A;  1GOY A;  1RJO A;  1S5A A;  1W7C A;  5DRE A;  1J2B A;  3G4S 3;  1OGZ A;  1IV9 A;  3AGN A;  3BIR A;  1MWT A;  3CNX A;  3LOY A;  1I70 A;  3T8N A;  4GL6 A;  1BNG A;  2LYX A;  1VQ7 3;  5LC7 A;  1PY3 A;  2XFT A;  3SYU A;  3FKA A;  1CYV A;  1I0X A;  1FGQ A;  2QGU A;  4KZ1 A;  3SOA A;  1Y4K A;  2E2U A;  5EVH A;  3I56 3;  3N9H A;  2SBL A;  5IG4 A;  2UUG C;  3SED A;  2R4I A;  4FMA A;  3DGL A;  1JBR A;  3CMA 3;  1CEW I;  1B2X A;  1YIJ 3;  3DZL A;  1US1 A;  4RNZ A;  3BNE A;  3V92 A;  2XFS A;  3UNL A;  1BNJ A;  2D1W A;  1OHS A;  1V57 A;  3DM8 A;  1MWR A;  1VQP 3;  2P0X A;  4KFD A;  2P05 A;  2Z7A A;  4N6U A;  1BUQ A;  3FG4 A;  1CYU A;  1BAO A;  2CWT A;  3F7X A;  4N6N B;  4O3V A;  4HM4 B;  3J7Y d;  1BNR A;  2IUK A;  5A0O B;  1FGO A;  1PYL A;  3CCJ 3;  3QK9 A;  1NJI 4;  4MMX B;  4HM7 B;  4J5G A;  1IK3 A;  3BU4 A;  5JPU A;  1Q42 A;  3ECF A;  2FGT A;  1IQX A;  4ZM8 A;  3F14 A;  1JKG A; 
#chains in the Genus database with same CATH homology
 3N8B A;  3HX8 A;  3MWZ A;  3BB9 A;  1UUW B;  3S27 A;  3EJV A;  3LZA A;  1V74 A;  3LTA A;  1A67 A;  4N6M A;  3Q90 A;  2GEX A;  1IVV A;  1ROA A;  2MF7 A;  3CME 3;  5IF6 A;  3FCS B;  1WQL B;  2JDI H;  3OXA A;  2ZDJ A;  3BLZ A;  3Q2P A;  4LGQ A;  4CDL A;  2K54 A;  1NO3 A;  3GAX A;  3OWS A;  4XM4 A;  4AEQ A;  2P0M A;  4G1M B;  4O02 B;  1O7M B;  2IA7 A;  3CXC 2;  2W2C A;  4EV5 A;  3EN1 B;  3NV0 B;  1VQ6 3;  4AKY A;  2BMQ B;  1SII A;  2F99 A;  4R9L A;  1JNQ A;  4NRE A;  3VF1 A;  1Q7Y 4;  2GEY A;  3S29 A;  3DUK A;  1Z1S A;  3PGB A;  1IVX A;  5KP3 A;  4L8P A;  1IV7 A;  3EQQ B;  3H51 A;  2MC8 A;  2Q07 A;  4XDV A;  1DMM A;  3KII A;  1W6Y A;  1WNH A;  5IEO A;  1ISK A;  1N9E A;  4HM6 B;  1YVB I;  2PNC A;  1W2Z A;  2Z77 A;  4EBG A;  2CFK A;  2OQE A;  2GBW B;  3EHC A;  1E3V A;  3G0K A;  3AMO A;  3D9R A;  4N6O B;  1W5Z A;  5IEN A;  2CC3 A;  1WMN A;  3MG1 A;  2OQE C;  3OX9 A;  4LZI A;  1D6U A;  1RRL A;  5AI1 A;  1E97 A;  4FCM A;  3CCM 3;  5FW5 A;  3WDG B;  5AYS C;  2HMM B;  3FLJ A;  1IDP A;  1KD1 4;  1ULJ B;  1FUW A;  3LTD A;  1O7W B;  2BMO B;  4NHF A;  1WMO A;  3SLU A;  1NU3 A;  4OK0 A;  1KSI A;  3A76 A;  3LT8 A;  2Y73 A;  3KSE D;  4MJD A;  7STD A;  1W00 A;  1JV2 B;  3HII A;  1VQL 3;  1KC8 4;  1FGR A;  2CIU A;  1JN5 A;  3RDE A;  1SIH A;  4XDW A;  1N8R 4;  5BXQ A;  3FH1 A;  3JUN A;  3KFQ C;  5AII A;  1G96 A;  3GZB A;  3NM2 A;  3PS8 A;  4TX4 A;  1NB3 I;  1QAF A;  2E2V A;  3UL5 A;  4HZB B;  3NQZ A;  2OTL 3;  1SJW A;  3OWU A;  4KFE A;  1JJ2 2;  3H3H A;  2W56 A;  1D6Z A;  3BNB A;  3MPH A;  3NUV A;  3PXM A;  3SOY A;  3PCR A;  1VQ8 3;  4OUQ A;  4XBT A;  2I9W A;  1OF5 B;  4HM1 B;  4LSO A;  1M9G A;  1N5P A;  3F8X A;  4WHA A;  1W6C A;  2HMN B;  2C11 A;  3LXU X;  3X3Z A;  1AR0 A;  1OH0 A;  2CK3 H;  5IG5 A;  5ELU A;  1N8Q A;  2XGN A;  4FMC A;  1Q81 4;  3B8L A;  4L7K A;  1UW1 A;  1RN7 A;  3LYG A;  5I97 A;  1Q86 4;  3CCV 3;  2CFW A;  4HBR A;  1PU4 A;  3M8C A;  1K41 A;  2P09 A;  5STD A;  5IG3 A;  5AYR B;  3FG3 A;  2ML5 A;  3UJM A;  4FCZ A;  3AMO B;  4HKV B;  4X2O A;  3B7C A;  2W9Q A;  1M90 4;  2XSO B;  1EA2 A;  4O2H A;  3D3L A;  1NDO B;  3UL6 A;  1E3R A;  2W0Q A;  3N54 B;  1ASK A;  3FGY A;  5IEP A;  3GZX B;  1R4C A;  4HM2 B;  1YJN 3;  4HM3 B;  1FGT A;  2E2T A;  3VSY A;  4BTY A;  3CPW 2;  5JBS A;  1VQK 3;  2YX9 A;  1CQS A;  3SVA A;  3I55 3;  3DMC A;  1OAC A;  2HML B;  5AIF A;  4Q53 A;  2F86 B;  3DGO A;  4HVN A;  1JN5 B;  1EQK A;  2CKF B;  4U13 A;  4LEH A;  1TUH A;  1U8C B;  5CF2 A;  1DMQ A;  2P38 A;  4FMB A;  2KRT A;  3MKI A;  1QJG A;  1GY5 A;  2RFR A;  2BT3 A;  3MSO A;  2GU1 A;  1QVG 2;  3F7S A;  4RNY A;  1GYB A;  2OWP A;  1K73 4;  2OOV C;  2XGL A;  1OPY A;  3HK4 A;  3PYJ A;  4QWT A;  1A90 A;  2W03 A;  5CXO A;  2B24 B;  1OHO A;  4WWU C;  5IW9 A;  4J8T A;  1M1K 4;  3RGR A;  2KXG A;  1RKY A;  3FZW A;  1VZZ A;  3FF2 A;  1U5O A;  1L5G B;  2CWU A;  3E99 A;  3NXJ A;  4J9A A;  3Q1C A;  3G71 3;  2WO0 A;  3QRD A;  4XBY A;  3BND A;  3ER7 A;  1IQY A;  1AVL A;  1Q82 4;  4IPB A;  3VGN A;  4O8S A;  1LNH A;  1O7H B;  3MG2 A;  3CCL 3;  1GY6 A;  3KN4 A;  1YJ9 3;  2XRX B;  3CCQ 3;  1VQ5 3;  1KWI A;  4N6L A;  3JUQ A;  1W6G A;  1TFO A;  3S67 A;  4EYC A;  1VQ9 3;  5EEO A;  3KSP A;  3TDG A;  1ZO2 A;  3NBJ A;  1WTH A;  1VQM 3;  1YJW 3;  1FA3 A;  5KP1 A;  3EC9 A;  1KQS 2;  1IVU A;  3F9S A;  1OUN A;  4XBX A;  1GS3 A;  4KVH A;  4R1K A;  1O7G B;  1VQO 3;  2Y74 A;  1YIT 3;  4RZM A;  4HM0 B;  4AKZ A;  2YFL B;  4H3U A;  2YFJ B;  2A15 A;  1OHP A;  3U1W A;  3PCS A;  5CF1 A;  1Q40 A;  4FCJ A;  4FR9 A;  4K61 A;  2QA4 3;  2BNG A;  1YGE A;  2XF3 A;  4N6V 0;  5CLK A;  2W6J H;  3K5T A;  2XR8 B;  4IIA A;  3KZT A;  1FGM A;  1DVD A;  3B4P A;  3FF0 A;  2CFD A;  1VQ4 3;  3NBB A;  3X42 A;  3EN8 A;  2O9U X;  1JB2 A;  1C7H A;  2OOV A;  2STD A;  1LOX A;  1UI8 A;  4XB5 A;  2GBX B;  3DGN A;  2C10 A;  2QEX 3;  2CH9 A;  3I0Y A;  3CPO A;  1TU5 A;  4JF8 A;  3K7C A;  1W02 A;  4WFO A;  2CW9 A;  3X41 A;  4N3V A;  1JB5 A;  1S72 3;  4WYK B;  4CCV A;  3CD6 3;  3IJE B;  1QVF 2;  3LML A;  3JVC A;  3DXO A;  2BHM A;  5BVB A;  3CU3 A;  3JUP A;  2B1X B;  4KFF A;  1N9J A;  3CC7 3;  3MYT A;  3OV4 A;  2XSH B;  3MG3 A;  3OWY A;  4HM8 B;  3NQY A;  3X3Y A;  3WOD G;  3CCE 3;  1OGX A;  2INX A;  3GRD A;  4EV2 A;  3WA2 X;  3NM7 A;  1GY7 A;  1K9M 4;  1W4N A;  4FMD A;  2O3O A;  2CWV A;  2JQ5 A;  4R4K A;  2CG1 A;  1F8N A;  3GZR A;  1YI2 3;  1A2V A;  2QIY A;  3V99 A;  2M7O A;  1JKG B;  4LMI A;  2WGQ A;  5DRV A;  1JRQ A;  5KP4 A;  1YHQ 3;  1ROV A;  2CHC A;  3DGM A;  3MHE A;  3HZP A;  5D82 A;  1SPU A;  3STD A;  1EG9 B;  3EF8 A;  1IQ8 A;  2XH9 A;  2UX0 A;  1W2B 2;  3BNC A;  1QAK A;  1T5Y A;  2OCT A;  1TIJ A;  3LTC A;  3FSD A;  5D83 A;  4EXR A;  4HZ9 B;  1Q40 B;  1QMA A;  1EKM A;  2ZL8 A;  1A2K A;  3LH4 A;  3WA3 A;  2CG0 A;  3FG1 A;  5CK6 A;  2WOF A;  2RSX A;  3SX1 A;  1JB4 A;  2CFG A;  4K1U A;  2V1L A;  2W04 A;  4BTX A;  1IU7 A;  1N5H A;  4I4K A;  2FXT A;  2IMJ A;  1PFP A;  4K90 B;  3NV0 A;  2W56 B;  1MOL A;  5G2G A;  3UB1 A;  1M1X B;  3SXX A;  3CCS 3;  1UI7 A;  1OF5 A;  4GB5 A;  3KE7 A;  2YFI B;  3CNM A;  3LTB A;  1LVN A;  2L4V A;  4K1V A;  2W9P A;  2FNQ A;  3S28 A;  5AEW B;  1MNL A;  1WMP A;  2PZV A;  5AIH A;  2BMR B;  3OW2 2;  1VQN 3;  1DVC A;  1TP6 A;  3NX0 A;  5AIG A;  4WYK A;  3WMD A;  4BTW A;  2HMK B;  3EX9 A;  3EE1 A;  3JUM A;  2LQV A;  4HM5 B;  4WP5 A;  1NWW A;  3EBY A;  3K0Z A;  2CFL A;  5JPP A;  4JRF A;  3ROB A;  3NBR A;  1ULI B;  3IPT A;  2KCD A;  4HJL B;  5IER A;  4ORL A;  1IVW A;  2XEP A;  3NHX A;  4MMY B;  8CHO A;  1OCV A;  1GD4 A;  1NB5 I;  2GU3 A;  3X40 A;  3WOE B;  5HGR A;  1IT7 A;  1STF I;  3WOF B;  5ELJ A;  1AVK A;  3K9M C;  3EBT A;  1K28 A;  5FGO A;  3GZY B;  1HU9 A;  2WOH A;  3HI7 A;  3CC4 3;  3B4O A;  3F40 A;  4IT7 A;  1LXE A;  3IMA B;  3K63 A;  1O7N B;  4L8O A;  1W01 A;  1DYU A;  4X2H A;  3JUO A;  5LC6 A;  2OTJ 3;  2HMJ B;  1AV4 A;  3T8U A;  3G16 A;  3G6E 3;  1SQW A;  2BO9 B;  3V98 A;  1K8A 4;  4R9K A;  6STD A;  1D6Y A;  3GWR A;  3RGA A;  3EB8 A;  2IUJ A;  1STD A;  2HMO B;  2K0M A;  2ML6 A;  2WGO A;  5D81 A;  3DY5 A;  1GD3 A;  3CCR 3;  1RRH A;  3S5C A;  3G8Z A;  2F98 A;  4H61 A;  4EC6 A;  5EQL A;  5AEU B;  1IT8 A;  3CCU 3;  1QAL A;  2Z76 A;  5IG0 A;  3ALA A;  3CC2 3;  3T0U A;  1UUV B;  3KKG A;  1HKX A;  1TFK A;  3U97 A;  4R80 A;  1O7P B;  3LT9 A;  2GXF A;  4HYZ A;  2Z6B A;  4RBN A;  3F8H A;  4OVM A;  3X3X A;  4STD A;  2RGQ A;  3PZW A;  4PEJ A;  3HIG A;  1DMN A;  2D42 A;  3O8Y A;  4N6T A;  5TGN A;  4MMZ B;  1ZX2 A;  4MEI A;  2RCD A;  3L0R A;  1RJO A;  1S5A A;  1W7C A;  5DRE A;  1J2B A;  3G4S 3;  1OGZ A;  1IV9 A;  3LOY A;  3CNX A;  3T8N A;  4GL6 A;  2LYX A;  1VQ7 3;  5LC7 A;  2XFT A;  3FKA A;  1CYV A;  1FGQ A;  2QGU A;  4KZ1 A;  3SOA A;  1Y4K A;  2E2U A;  5EVH A;  3I56 3;  3N9H A;  2SBL A;  5IG4 A;  3SED A;  2R4I A;  4FMA A;  3DGL A;  3CMA 3;  1CEW I;  1YIJ 3;  3DZL A;  1US1 A;  4RNZ A;  3BNE A;  3V92 A;  2XFS A;  3UNL A;  2D1W A;  1OHS A;  3DM8 A;  1VQP 3;  2P0X A;  4KFD A;  2P05 A;  2Z7A A;  4N6U A;  1BUQ A;  3FG4 A;  1CYU A;  2CWT A;  3F7X A;  4N6N B;  4O3V A;  4HM4 B;  3J7Y d;  2IUK A;  5A0O B;  1FGO A;  3CCJ 3;  3QK9 A;  1NJI 4;  4MMX B;  4HM7 B;  1IK3 A;  5JPU A;  1Q42 A;  3ECF A;  2FGT A;  1IQX A;  4ZM8 A;  3F14 A;  1JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...