1KD14

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kd1400
3CCL3 1K8A4 3CME3 3CCJ3 1VQ73 3I553 3OW22 1Q824 3CD63 1YJW3 1N8R4 1JJ22 3G4S3 1YHQ3 1VQM3 2OTL3 1YJ93 1KD14 1M1K4 1VQ83 1S723 1K734 3G713 1KC84 1K9M4 1QVF2 3CC23 3CCE3 1YJN3 1VQ53 3CCV3 1W2B2 1VQ93 1Q864 3CCQ3 1VQ63 1VQL3 3CMA3 1NJI4 1M904 3CCR3 2QA43 1QVG2 3CXC2 3CCU3 2OTJ3 1VQO3 1YIJ3 3CC73 1YIT3 3CCM3 3CCS3 1KQS2 1Q7Y4 1VQK3 1VQ43 1YI23 1VQN3 3I563 1VQP3 3G6E3 1Q814 2QEX3 3CC43 3CPW2
chains in the Genus database with same CATH superfamily
1DVCA 4HBRA 1JKGB 1UI7A 4I4KA 4GL6A 3EF8A 1TU5A 2IY2A 3LZAA 3NQYA 1HU9A 3PCRA 4KT3B 2RNTA 3D3LA 4KFDA 3VF1A 1E97A 1V57A 3NBJA 3X3YA 1Q42A 1EEJA 4K1UA 5ELJA 2ML5A 2GBXB 4CJNA 3HX8A 2L4VA 4N6OB 3Q3FA 3D9RA 1EUIC 4EW5A 1BGSA 1BNSA 1GMRA 4ZM8A 1E3VA 3CCR3 2WOHA 2RCDA 2W04A 2CG1A 1IV7A 3K7CA 1T2HA 3UL5A 1RGAA 2H0IA 3A76A 2LQVA 4HOHA 3B4PA 3S27A 3TDGA 1VQP3 5M1AA 4LMIA 4BIRA 4KZ1A 1W4NA 1PU4A 2UX0A 1RDSA 2OQEC 1WMNA 3LTCA 3BB9A 4O2HA 2CWTA 1B2XA 3CD63 1IK3A 4HM7B 2F98A 2BT3A 4ILFA 1JB4A 1A2VA 5JPUA 1HKXA 1MWSA 1BSCA 1GOVA 1YJN3 1J2BA 1TTOA 3BNEA 4FMDA 1BNFA 3K5TA 1CYUA 1FGMA 1N9JA 3AMOA 2XGLA 4HM5B 1IT7A 2CKFB 5M19A 4ORLA 1O7NB 1V74A 2AADA 1LXEA 5EEOA 3EE1A 5BIRA 4MJDA 2L1SA 3Q1CA 2P38A 3S29A 3CC43 3LMLA 4PEJA 4J5KA 1RCKA 3HIIA 3KN4A 2Y74A 1ROVA 1OF5A 1U8CB 4BTYA 7GSPA 5IERA 3KE7A 2CFKA 4HJLB 1RRHA 4LYLB 3PGBA 1B2SA 2WGQA 1TJDA 2PNCA 4FR9A 3DZLA 1RKYA 2OOVA 3SVAA 5CF1A 2KF4A 3WA3A 1NJI4 1O7MB 1ULJB 2XF3A 3EN8A 3FSDA 3WMDA 1I2GA 4L8OA 2F99A 3J7Yd 4X2HA 1SIHA 2Z76A 4NHFA 1HYFA 2W56B 1UUVB 3UB1A 2KF3A 1HZ1A 3DGMA 3S67A 4XB5A 3PYJA 3X3ZA 3CCM3 1FGRA 4AEQA 1UI8A 2IA7A 1KWIA 1I8VA 3NX0A 1B21A 2XH9A 1M1XB 3I553 2OWPA 3PCSA 3GZYB 2JDIH 4OVMA 5LC6A 1N8R4 2JQ5A 4MMYB 1WNHA 4XDWA 2O9UX 3KCHA 1LRAA 4L8PA 1N9EA 1W01A 3F9SA 3DUKA 3BNCA 2WO0A 3LH4A 4GSPA 1ZX2A 1D6UA 2C11A 4HM6B 1L5GB 2STDA 3DGNA 3DMCA 1KSIA 3MG3A 1FA3A 1EA2A 1VQO3 1MWRA 2HMOB 3GZRA 1DMQA 1LOXA 4EXRA 3FH1A 1IYYA 1AY7A 4FCMA 4WWUC 1Y4KA 1VQN3 2HOHA 4IPBA 3PS8A 4HM3B 2BNGA 4K90B 1MNLA 4N6TA 1FW7A 3BNDA 1VZZA 3KFQC 2HMNB 1JN5A 1US1A 1FZUA 1Q40B 2BHMA 5TGNA 4L7KA 3OXAA 1M9GA 3GZXB 3KZTA 3T0UA 3N54B 2E2UA 1QMAA 4RBNA 3NM7A 3LYGA 3SYUA 1ISKA 3PXMA 4GHOA 3X3XA 1W7CA 5EVHA 1LVNA 4FMAA 1TRPA 3IJEB 4WYKA 2ZDJA 1FUWA 1STFI 1I3FA 2IYJA 1IU7A 1B20A 1IDPA 1SQWA 1QAFA 5FW5A 2YFIB 1RSNA 3D79A 2HMLB 1GD4A 1OUNA 1LOYA 4Q53A 1OF5B 5IENA 1SARA 1GSPA 7RNTA 1B3SA 3F14A 3WOFB 1GYBA 4EV2A 3WODG 4JF8A 1NB5I 5ELUA 4FCJA 5AEUB 1Q7HA 1YGWA 1CQSA 1NO3A 5KP4A 1BAOA 1OH0A 3CCV3 3DGOA 5G1LA 3NXJA 5AIFA 5GSPA 1DE3A 4LEHA 1BNRA 3QK9A 1UDII 2XFSA 3LTDA 1SPUA 3WA2X 1QVG2 1MOLA 4NPBA 1C7HA 1UW1A 1AVKA 1LNIA 1QALA 5AYSC 4G1MB 5CXOA 3KKGA 3SXXA 3ALAA 1MWTA 3EJVA 3SX1A 1Q814 5IF6A 4LSOA 4R4KA 1EG9B 1LNHA 1N5PA 2GU1A 2M7OA 3BNBA 3WDGB 4EBGA 5IW9A 1A67A 4BL3A 3X42A 5JBSA 3RGRA 3EHCA 3ECFA 2C10A 2HMMB 7STDA 1YGEA 2D42A 2CK3H 3I0YA 2XFTA 2XSOB 8RNTA 1KD14 2A15A 1VQ83 2R4IA 4BL2A 3CCE3 4HZBB 2QIYA 1T5YA 1RNBA 4HAAA 1K41A 1LQGC 3SEDA 2R41A 4HM8B 1UGIA 3D5IA 3MSOA 1RGGA 1BANA 1GD3A 4MEIA 4N6MA 2XGNA 1AVLA 3AGNA 1IQYA 4N6UA 1YVBI 3EX9A 8CHOA 1BRKA 4QWTA 1O7PB 4RNZA 3RDEA 1YI23 4J9AA 6STDA 3EB8A 3NQZA 1JN5B 2PZVA 3MG2A 5AYRB 1Q40A 2RFRA 1BRSA 1OPYA 2F5MA 5RNTA 6RNTA 1Q824 4K61A 2W9QA 1BSDA 1IVVA 1BRJA 2SBLA 3FLJA 4IIAA 1IV9A 1JNQA 1YHQ3 4KFFA 2SARA 2GEXA 2CWVA 2W03A 9RNTA 1K9M4 3HIGA 1TFKA 3B7CA 4OK0A 5IEPA 1ZS7A 2B1XB 3DGLA 4HM4B 1VQQA 2GXFA 1DETA 2CWUA 3FZWA 1BOXA 4WYKB 1U5OA 5CK6A 5AIIA 3EBYA 2P0MA 3B8LA 3CNMA 2WGOA 4HM0B 3HZPA 1FUTA 1DMNA 3F8XA 1BUJA 2F5WA 1Q7Y4 4EYCA 3EC9A 3BIRA 4O8SA 1JZDA 5KP1A 2K3DA 5FGOA 1ULIB 1S5AA 1UCJA 3FGYA 2BU4A 3RGAA 2F4YA 3CME3 1RGLA 1UCIA 3FF2A 1I0VA 4H3UA 1BVIA 2RGQA 3F7SA 3GZBA 1NU3A 4HVNA 2OTL3 1M1K4 1JB2A 3L0RA 2Z6BA 1IVUA 3VGNA 2CX1A 3BU4A 5KP3A 3H51A 1X1YA 1IVXA 1Q864 1BSAA 1UGHI 1VQL3 3CMA3 4JRFA 3STDA 1GMQA 1ZGXA 3OX9A 1I3IA 2K54A 3G16A 2KF5A 5IEOA 1BUQA 1D6YA 2HMJB 3K9MC 3EQQB 2K0MA 4X2OA 4STDA 1JB5A 3DGYA 4EV5A 3LXUX 4HM2B 2GEYA 2OQEA 3G6E3 3NV0A 1CEWI 2E2TA 3X41A 4BTXA 3CCL3 1G02A 1TFOA 1VQ73 3GSPA 1PFPA 3FG4A 5G1KA 1TRQA 4R9LA 1X1UA 1W6YA 2BIRA 4H61A 3LOYA 1FYSA 4N6NB 1WMPA 1PYLA 4J8TA 4CPKA 2KXGA 4I5QA 4RNTA 2B24B 3SOAA 1G0TA 3E99A 1O7GB 1LQMB 1OGXA 4FMCA 3O8YA 1AQZA 3K0ZA 1BNIA 2RSXA 1FGOA 2CX0A 4RNYA 1RN7A 3FG3A 4EC6A 1A90A 6GSPA 1UUWB 2ZA4A 3Q2PA 1BIRA 1OHPA 1W6GA 1JZOA 1E3RA 1VQK3 2Y73A 1I2FA 3RNTA 3X40A 1OACA 3WHOA 4CCVA 4XM4A 3CU3A 1TIJA 1I0XA 2LYXA 4GB5A 3UL6A 4DKIA 3MG1A 1ZO2A 2W9PA 3ER7A 1VQM3 1RRLA 1YJ93 2YX9A 2KAAA 1NDOB 3ZG0A 4HZ9B 1S723 2GBWB 3HOHA 1BNEA 2E2VA 1DYUA 2H0GA 3T8NA 2YFJB 2KRTA 2XEPA 3NHXA 1GY6A 1F8NA 1V58A 2CFGA 3JUPA 3LTAA 3N8BA 2MC8A 1YNVX 2FNQA 2CH9A 3CC73 2CW9A 3UNLA 3D4AA 2ZHXB 2CFDA 1RJOA 1CH0A 1Q9EA 3PZWA 3DM8A 1BU4A 4WP5A 2AAEA 1RGFA 2BMOB 2QGUA 1K8A4 5CLKA 2Q07A 2IUJA 1W5ZA 3DXOA 3OW22 1OCVA 1MGWA 3NBBA 5EQLA 1GMPA 1MGRA 3ROBA 3G4S3 1JJ22 5STDA 1WMOA 1BSBA 3G713 5BVBA 2CC3A 2CFLA 5DRVA 1W6CA 2D1WA 3DY5A 1EKMA 2BMQB 1RN1A 1VQ93 1A2KA 4KFEA 1W00A 3F8HA 3WOEB 3WR2A 5AEWB 2QA43 3KIIA 1LOVA 2ZL8A 4R80A 1OHSA 4XDVA 1W02A 2RBIA 4AKZA 1RGHA 4FCZA 1YIJ3 1STDA 4MMXB 5HGRA 3NV0B 4FMBA 3F7XA 4HYZA 2P09A 3CCS3 1I70A 2V1LA 2W0QA 4LZIA 1KQS2 1JBRA 3V99A 4J5GA 1TP6A 3D5GA 1QAKA 5I97A 1RTUA 2O3OA 1JRQA 1RHLA 1LOWA 3LT8A 1BNGA 1UCKA 4RZMA 2OCTA 3NUVA 3OWSA 1RLSA 2CIUA 1EQKA 2YFLB 3S5CA 4OUQA 2Z77A 5IG0A 4CDLA 3QRDA 4BU4A 1NWWA 2W2CA 3EBTA 3JUQA 2MF7A 2UGIA 1NNVA 5IG3A 1IT8A 3NBRA 4MMZB 3CCU3 2H0HA 5CF2A 1IQXA 1SIIA 5HOHA 1MWUA 3VSYA 2IMJA 1X1WA 1VQ43 1O7WB 1B2ZA 3UJMA 1BRIA 1ASKA 1BSEA 1WTHA 1K28A 1Z1SA 2J8XB 3SLUA 1RNTA 3CPOA 3ZG5A 3CPW2 3CCJ3 5M18A 3KSED 5D82A 4HKVB 3K63A 1RN4A 4NREA 2Z7AA 3AMOB 1FUSA 1JKGA 1R4CA 2INXA 3OWUA 2UUGC 3MHEA 3JUNA 3OV4A 3Q90A 3V92A 1RGCA 1UUGB 3AHWA 1K734 1SJWA 3CC23 1VQ53 2OOVC 1TUHA 4TX4A 3G8ZA 3U97A 1GY7A 3V98A 4WHAA 2P05A 4BTWA 1M904 2HMKB 5AIHA 1RMSA 2CFWA 2GU3A 3JVCA 1I2EA 4IT7A 1DMMA 4O02B 3MWZA 4N3VA 2ML6A 3DH2A 3FG1A 5A0OB 3HI7A 4R9KA 3JUMA 3I563 1X1XA 1IVWA 1OHOA 3HK4A 1BRHA 2FXTA 3H3HA 3GAXA 1CYVA 3MKIA 4K1VA 2CG0A 3BLZA 3M8CA 4N6V0 1N5HA 1OGZA 4XBXA 5AI1A 4XBTA 3LTBA 1FGQA 1GOUA 1PY3A 2BO9B 1B27A 1AR0A 2FGTA 4R1KA 1KC84 1AV4A 4N6LA 1WQLB 5D81A 3MYTA 5BXQA 1B2MA 4U13A 1W2ZA 3LT9A 1BRGA 2KF6A 3KSPA 4HM1B 4LGQA 3T8UA 3G0KA 3CXC2 4WFOA 1YIT3 3AHSA 5AIGA 3U1WA 3FCSB 1A2PA 3A5EA 3FKAA 5LC7A 3B4OA 5G2GA 2C4BA 1GOYA 3URPA 5BU4A 3NM2A 3FF0A 3CNXA 3AGOA 1R4YA 4AKYA 2QEX3 3MPHA 1BNJA 1ROAA 5IG5A 5IG4A 2CHCA 1BRNL 1N8QA 2XSHB 1UCLA 5DREA 1T2IA 1YJW3 3JUOA 5JPPA 1RGKA 2F86B 3SOYA 3S28A 1JV2B 1FGTA 3F40A 3GRDA 3ZFZA 3GWRA 1QVF2 2GSPA 2XRXB 5D83A 1D6ZA 1JBTA 4O3VA 1W2B2 2F56A 4XBYA 1C54A 3CCQ3 3IMAB 1QJGA 3EN1B 1B2UA 1O7HB 3IPTA 3OWYA 1VQ63 1T3BA 1DVDA 1G96A 1GS3A 2OTJ3 1NB3I 2P0XA 1RGEA 1YVSA 1IQ8A 2W6JH 1JBSA 1RCLA 1GY5A 2KCDA 2W56A 3N9HA 2I9WA 2BMRB 2IUKA 2WOFA 2XR8B 4KVHA
chains in the Genus database with same CATH topology
1DVCA 4HBRA 1JKGB 1UI7A 4I4KA 4GL6A 3EF8A 1TU5A 3NQYA 3LZAA 1HU9A 3PCRA 3D3LA 4KFDA 3VF1A 1E97A 3NBJA 3X3YA 1Q42A 5ELJA 4K1UA 2ML5A 2GBXB 3HX8A 2L4VA 4N6OB 3D9RA 4ZM8A 1E3VA 3CCR3 2WOHA 2RCDA 2W04A 2CG1A 1IV7A 3K7CA 3UL5A 3A76A 2LQVA 3TDGA 3B4PA 3S27A 1VQP3 4LMIA 1PU4A 4KZ1A 1W4NA 2UX0A 2OQEC 1WMNA 3LTCA 3BB9A 4O2HA 2CWTA 3CD63 1IK3A 4HM7B 2F98A 2BT3A 1JB4A 1A2VA 5JPUA 1HKXA 1YJN3 1J2BA 3BNEA 4FMDA 3K5TA 1CYUA 1FGMA 1N9JA 3AMOA 2XGLA 4HM5B 1IT7A 2CKFB 4ORLA 1O7NB 1V74A 1LXEA 5EEOA 3EE1A 4MJDA 3Q1CA 2P38A 3S29A 3CC43 3LMLA 4PEJA 3HIIA 3KN4A 2Y74A 1ROVA 1OF5A 1U8CB 4BTYA 5IERA 3KE7A 2CFKA 4HJLB 1RRHA 3PGBA 2WGQA 2PNCA 4FR9A 3DZLA 1RKYA 2OOVA 3SVAA 5CF1A 3WA3A 1NJI4 1O7MB 1ULJB 2XF3A 3EN8A 3FSDA 3WMDA 3J7Yd 4L8OA 2F99A 4X2HA 1SIHA 2Z76A 4NHFA 2W56B 1UUVB 3UB1A 3S67A 3DGMA 3CCM3 4XB5A 3PYJA 3X3ZA 1FGRA 4AEQA 1UI8A 2IA7A 1KWIA 3NX0A 2XH9A 1M1XB 3I553 2OWPA 3PCSA 3GZYB 2JDIH 4OVMA 5LC6A 1N8R4 2JQ5A 4MMYB 1WNHA 4XDWA 2O9UX 4L8PA 1N9EA 1W01A 3F9SA 3DUKA 3BNCA 2WO0A 3LH4A 1ZX2A 1D6UA 2C11A 4HM6B 1L5GB 2STDA 3DGNA 3DMCA 1KSIA 3MG3A 1FA3A 1EA2A 1VQO3 2HMOB 3GZRA 4EXRA 1DMQA 1LOXA 3FH1A 4FCMA 4WWUC 1Y4KA 1VQN3 4IPBA 3PS8A 4HM3B 2BNGA 4K90B 1MNLA 4N6TA 3BNDA 1VZZA 3KFQC 2HMNB 1JN5A 1US1A 1Q40B 2BHMA 5TGNA 4L7KA 3OXAA 1M9GA 3GZXB 3KZTA 3T0UA 3N54B 2E2UA 1QMAA 4RBNA 3NM7A 3LYGA 1ISKA 3PXMA 3X3XA 1W7CA 5EVHA 1LVNA 4FMAA 3IJEB 4WYKA 2ZDJA 1FUWA 1STFI 1IU7A 1SQWA 1IDPA 5FW5A 1QAFA 2YFIB 2HMLB 1GD4A 1OUNA 4Q53A 1OF5B 5IENA 1NB5I 3F14A 3WOFB 1GYBA 4EV2A 3WODG 4JF8A 5ELUA 4FCJA 5AEUB 1CQSA 1NO3A 5KP4A 1OH0A 3CCV3 3DGOA 3NXJA 5AIFA 4LEHA 3QK9A 2XFSA 3LTDA 1QVG2 1SPUA 3WA2X 1MOLA 1C7HA 1UW1A 1AVKA 1QALA 5AYSC 4G1MB 5CXOA 3KKGA 3SXXA 3ALAA 3EJVA 3SX1A 1Q814 5IF6A 4LSOA 4R4KA 1LNHA 1EG9B 1N5PA 2GU1A 2M7OA 3BNBA 3WDGB 4EBGA 5IW9A 1A67A 5JBSA 3X42A 3RGRA 3EHCA 3ECFA 2C10A 2HMMB 7STDA 1YGEA 2D42A 2CK3H 3I0YA 2XFTA 2XSOB 1KD14 1VQ83 2A15A 2R4IA 3CCE3 4HZBB 2QIYA 1T5YA 1K41A 3SEDA 4HM8B 4MEIA 4N6MA 3MSOA 1GD3A 2XGNA 1AVLA 1IQYA 4N6UA 1YVBI 3EX9A 8CHOA 4QWTA 1YI23 1O7PB 4RNZA 3RDEA 4J9AA 6STDA 3EB8A 3NQZA 1JN5B 2PZVA 3MG2A 5AYRB 1Q40A 2RFRA 1OPYA 1Q824 4K61A 2W9QA 1IVVA 1YHQ3 2SBLA 3FLJA 4IIAA 1IV9A 1JNQA 4KFFA 2GEXA 2CWVA 2W03A 1K9M4 3HIGA 1TFKA 3B7CA 4OK0A 5IEPA 2B1XB 3DGLA 4HM4B 2GXFA 2CWUA 3FZWA 4WYKB 1U5OA 5CK6A 5AIIA 3EBYA 3B8LA 3CNMA 2P0MA 2WGOA 4HM0B 3HZPA 1DMNA 3F8XA 1Q7Y4 4EYCA 3EC9A 4O8SA 5KP1A 5FGOA 1ULIB 1S5AA 3FGYA 3RGAA 3CME3 3FF2A 4H3UA 2RGQA 3F7SA 3GZBA 1NU3A 4HVNA 2OTL3 1M1K4 1JB2A 3L0RA 2Z6BA 1IVUA 3VGNA 5KP3A 3H51A 1IVXA 1Q864 1VQL3 3CMA3 4JRFA 3STDA 3OX9A 2K54A 3G16A 5IEOA 1BUQA 1D6YA 2HMJB 3K9MC 3EQQB 2K0MA 4X2OA 4STDA 1JB5A 4EV5A 3LXUX 4HM2B 2GEYA 2OQEA 3G6E3 3NV0A 1CEWI 2E2TA 3X41A 4BTXA 3CCL3 1TFOA 1VQ73 1PFPA 3FG4A 4R9LA 1W6YA 4H61A 3LOYA 4N6NB 1WMPA 4J8TA 2KXGA 3SOAA 2B24B 3E99A 1O7GB 4FMCA 1OGXA 3O8YA 3K0ZA 2RSXA 1FGOA 4RNYA 1RN7A 3FG3A 4EC6A 1A90A 1UUWB 3Q2PA 1OHPA 1W6GA 1E3RA 1VQK3 2Y73A 3X40A 1OACA 4CCVA 4XM4A 3CU3A 1TIJA 2LYXA 4GB5A 3UL6A 3MG1A 1ZO2A 2W9PA 3ER7A 1VQM3 1RRLA 1YJ93 2YX9A 1S723 1NDOB 4HZ9B 2GBWB 3T8NA 2E2VA 1DYUA 2YFJB 2KRTA 2XEPA 3NHXA 1GY6A 1F8NA 2CFGA 3JUPA 3LTAA 3N8BA 2MC8A 2FNQA 2CH9A 3CC73 2CW9A 3UNLA 2CFDA 1RJOA 3PZWA 3DM8A 4WP5A 2BMOB 2QGUA 1K8A4 5CLKA 2Q07A 2IUJA 1W5ZA 3DXOA 3OW22 1OCVA 3NBBA 5EQLA 3ROBA 1JJ22 3G4S3 5STDA 1WMOA 3G713 5BVBA 2CC3A 2CFLA 5DRVA 1W6CA 2D1WA 3DY5A 1EKMA 2BMQB 1VQ93 1A2KA 4KFEA 1W00A 3F8HA 3WOEB 5AEWB 2QA43 3KIIA 4R80A 2ZL8A 4XDVA 1OHSA 4AKZA 1W02A 1YIJ3 4FCZA 1STDA 4MMXB 5HGRA 3NV0B 4FMBA 3F7XA 4HYZA 2P09A 3CCS3 2W0QA 2V1LA 4LZIA 1KQS2 3V99A 1TP6A 1QAKA 5I97A 2O3OA 1JRQA 3LT8A 4RZMA 2OCTA 3NUVA 3OWSA 2CIUA 1EQKA 2YFLB 3S5CA 4OUQA 2Z77A 5IG0A 4CDLA 3QRDA 1NWWA 2W2CA 3EBTA 3JUQA 2MF7A 5IG3A 1IT8A 3NBRA 4MMZB 3CCU3 5CF2A 1IQXA 1SIIA 3VSYA 2IMJA 1VQ43 1O7WB 3UJMA 1ASKA 1WTHA 1K28A 1Z1SA 3SLUA 3CPW2 3CPOA 3CCJ3 3KSED 5D82A 4HKVB 3K63A 4NREA 2Z7AA 3AMOB 1JKGA 1R4CA 2INXA 3OWUA 3MHEA 3JUNA 3OV4A 3Q90A 3V92A 1K734 1SJWA 3CC23 1VQ53 2OOVC 1TUHA 4TX4A 3G8ZA 3U97A 1GY7A 3V98A 4WHAA 2P05A 4BTWA 1M904 2HMKB 5AIHA 2CFWA 2GU3A 3JVCA 4IT7A 1DMMA 4O02B 3MWZA 4N3VA 2ML6A 3FG1A 5A0OB 3HI7A 4R9KA 3JUMA 3I563 1IVWA 1OHOA 3HK4A 3H3HA 2FXTA 3GAXA 1CYVA 3MKIA 4K1VA 2CG0A 3BLZA 3M8CA 4N6V0 1N5HA 1OGZA 4XBXA 5AI1A 4XBTA 3LTBA 1FGQA 2BO9B 1AR0A 2FGTA 4R1KA 1KC84 1AV4A 4N6LA 1WQLB 5D81A 3MYTA 5BXQA 4U13A 1W2ZA 3LT9A 3KSPA 4HM1B 4LGQA 3T8UA 3G0KA 3CXC2 4WFOA 1YIT3 5AIGA 3U1WA 3FCSB 3FKAA 5LC7A 3B4OA 5G2GA 3NM2A 3FF0A 3CNXA 4AKYA 2QEX3 3MPHA 1ROAA 5IG5A 5IG4A 2CHCA 1N8QA 2XSHB 5DREA 1YJW3 3JUOA 5JPPA 2F86B 3SOYA 3S28A 1JV2B 1FGTA 3F40A 3GRDA 3GWRA 1QVF2 5D83A 2XRXB 1D6ZA 4O3VA 1W2B2 4XBYA 3CCQ3 3IMAB 3EN1B 1QJGA 3IPTA 1O7HB 3OWYA 1VQ63 1DVDA 1G96A 1GS3A 2OTJ3 1NB3I 2P0XA 1IQ8A 2W6JH 1GY5A 2KCDA 2W56A 3N9HA 2I9WA 2BMRB 2IUKA 2WOFA 2XR8B 4KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL 3;  1K8A 4;  3CME 3;  3CCJ 3;  1VQ7 3;  3I55 3;  3OW2 2;  1Q82 4;  3CD6 3;  1YJW 3;  1N8R 4;  1JJ2 2;  3G4S 3;  1YHQ 3;  1VQM 3;  2OTL 3;  1YJ9 3;  1KD1 4;  1M1K 4;  1VQ8 3;  1S72 3;  1K73 4;  3G71 3;  1KC8 4;  1K9M 4;  1QVF 2;  3CC2 3;  3CCE 3;  1YJN 3;  1VQ5 3;  3CCV 3;  1W2B 2;  1VQ9 3;  1Q86 4;  3CCQ 3;  1VQ6 3;  1VQL 3;  3CMA 3;  1NJI 4;  1M90 4;  3CCR 3;  2QA4 3;  1QVG 2;  3CXC 2;  3CCU 3;  2OTJ 3;  1VQO 3;  1YIJ 3;  3CC7 3;  1YIT 3;  3CCM 3;  3CCS 3;  1KQS 2;  1Q7Y 4;  1VQK 3;  1VQ4 3;  1YI2 3;  1VQN 3;  3I56 3;  1VQP 3;  3G6E 3;  1Q81 4;  2QEX 3;  3CC4 3;  3CPW 2; 
#chains in the Genus database with same CATH topology
 1DVC A;  4HBR A;  1JKG B;  1UI7 A;  4I4K A;  4GL6 A;  3EF8 A;  1TU5 A;  2IY2 A;  3LZA A;  3NQY A;  1HU9 A;  3PCR A;  4KT3 B;  2RNT A;  3D3L A;  4KFD A;  3VF1 A;  1E97 A;  1V57 A;  3NBJ A;  3X3Y A;  1Q42 A;  1EEJ A;  4K1U A;  5ELJ A;  2ML5 A;  2GBX B;  4CJN A;  3HX8 A;  2L4V A;  4N6O B;  3Q3F A;  3D9R A;  1EUI C;  4EW5 A;  1BGS A;  1BNS A;  1GMR A;  4ZM8 A;  1E3V A;  3CCR 3;  2WOH A;  2RCD A;  2W04 A;  2CG1 A;  1IV7 A;  3K7C A;  1T2H A;  3UL5 A;  1RGA A;  2H0I A;  3A76 A;  2LQV A;  4HOH A;  3B4P A;  3S27 A;  3TDG A;  1VQP 3;  5M1A A;  4LMI A;  4BIR A;  4KZ1 A;  1W4N A;  1PU4 A;  2UX0 A;  1RDS A;  2OQE C;  1WMN A;  3LTC A;  3BB9 A;  4O2H A;  2CWT A;  1B2X A;  3CD6 3;  1IK3 A;  4HM7 B;  2F98 A;  2BT3 A;  4ILF A;  1JB4 A;  1A2V A;  5JPU A;  1HKX A;  1MWS A;  1BSC A;  1GOV A;  1YJN 3;  1J2B A;  1TTO A;  3BNE A;  4FMD A;  1BNF A;  3K5T A;  1CYU A;  1FGM A;  1N9J A;  3AMO A;  2XGL A;  4HM5 B;  1IT7 A;  2CKF B;  5M19 A;  4ORL A;  1O7N B;  1V74 A;  2AAD A;  1LXE A;  5EEO A;  3EE1 A;  5BIR A;  4MJD A;  2L1S A;  3Q1C A;  2P38 A;  3S29 A;  3CC4 3;  3LML A;  4PEJ A;  4J5K A;  1RCK A;  3HII A;  3KN4 A;  2Y74 A;  1ROV A;  1OF5 A;  1U8C B;  4BTY A;  7GSP A;  5IER A;  3KE7 A;  2CFK A;  4HJL B;  1RRH A;  4LYL B;  3PGB A;  1B2S A;  2WGQ A;  1TJD A;  2PNC A;  4FR9 A;  3DZL A;  1RKY A;  2OOV A;  3SVA A;  5CF1 A;  2KF4 A;  3WA3 A;  1NJI 4;  1O7M B;  1ULJ B;  2XF3 A;  3EN8 A;  3FSD A;  3WMD A;  1I2G A;  4L8O A;  2F99 A;  3J7Y d;  4X2H A;  1SIH A;  2Z76 A;  4NHF A;  1HYF A;  2W56 B;  1UUV B;  3UB1 A;  2KF3 A;  1HZ1 A;  3DGM A;  3S67 A;  4XB5 A;  3PYJ A;  3X3Z A;  3CCM 3;  1FGR A;  4AEQ A;  1UI8 A;  2IA7 A;  1KWI A;  1I8V A;  3NX0 A;  1B21 A;  2XH9 A;  1M1X B;  3I55 3;  2OWP A;  3PCS A;  3GZY B;  2JDI H;  4OVM A;  5LC6 A;  1N8R 4;  2JQ5 A;  4MMY B;  1WNH A;  4XDW A;  2O9U X;  3KCH A;  1LRA A;  4L8P A;  1N9E A;  1W01 A;  3F9S A;  3DUK A;  3BNC A;  2WO0 A;  3LH4 A;  4GSP A;  1ZX2 A;  1D6U A;  2C11 A;  4HM6 B;  1L5G B;  2STD A;  3DGN A;  3DMC A;  1KSI A;  3MG3 A;  1FA3 A;  1EA2 A;  1VQO 3;  1MWR A;  2HMO B;  3GZR A;  1DMQ A;  1LOX A;  4EXR A;  3FH1 A;  1IYY A;  1AY7 A;  4FCM A;  4WWU C;  1Y4K A;  1VQN 3;  2HOH A;  4IPB A;  3PS8 A;  4HM3 B;  2BNG A;  4K90 B;  1MNL A;  4N6T A;  1FW7 A;  3BND A;  1VZZ A;  3KFQ C;  2HMN B;  1JN5 A;  1US1 A;  1FZU A;  1Q40 B;  2BHM A;  5TGN A;  4L7K A;  3OXA A;  1M9G A;  3GZX B;  3KZT A;  3T0U A;  3N54 B;  2E2U A;  1QMA A;  4RBN A;  3NM7 A;  3LYG A;  3SYU A;  1ISK A;  3PXM A;  4GHO A;  3X3X A;  1W7C A;  5EVH A;  1LVN A;  4FMA A;  1TRP A;  3IJE B;  4WYK A;  2ZDJ A;  1FUW A;  1STF I;  1I3F A;  2IYJ A;  1IU7 A;  1B20 A;  1IDP A;  1SQW A;  1QAF A;  5FW5 A;  2YFI B;  1RSN A;  3D79 A;  2HML B;  1GD4 A;  1OUN A;  1LOY A;  4Q53 A;  1OF5 B;  5IEN A;  1SAR A;  1GSP A;  7RNT A;  1B3S A;  3F14 A;  3WOF B;  1GYB A;  4EV2 A;  3WOD G;  4JF8 A;  1NB5 I;  5ELU A;  4FCJ A;  5AEU B;  1Q7H A;  1YGW A;  1CQS A;  1NO3 A;  5KP4 A;  1BAO A;  1OH0 A;  3CCV 3;  3DGO A;  5G1L A;  3NXJ A;  5AIF A;  5GSP A;  1DE3 A;  4LEH A;  1BNR A;  3QK9 A;  1UDI I;  2XFS A;  3LTD A;  1SPU A;  3WA2 X;  1QVG 2;  1MOL A;  4NPB A;  1C7H A;  1UW1 A;  1AVK A;  1LNI A;  1QAL A;  5AYS C;  4G1M B;  5CXO A;  3KKG A;  3SXX A;  3ALA A;  1MWT A;  3EJV A;  3SX1 A;  1Q81 4;  5IF6 A;  4LSO A;  4R4K A;  1EG9 B;  1LNH A;  1N5P A;  2GU1 A;  2M7O A;  3BNB A;  3WDG B;  4EBG A;  5IW9 A;  1A67 A;  4BL3 A;  3X42 A;  5JBS A;  3RGR A;  3EHC A;  3ECF A;  2C10 A;  2HMM B;  7STD A;  1YGE A;  2D42 A;  2CK3 H;  3I0Y A;  2XFT A;  2XSO B;  8RNT A;  1KD1 4;  2A15 A;  1VQ8 3;  2R4I A;  4BL2 A;  3CCE 3;  4HZB B;  2QIY A;  1T5Y A;  1RNB A;  4HAA A;  1K41 A;  1LQG C;  3SED A;  2R41 A;  4HM8 B;  1UGI A;  3D5I A;  3MSO A;  1RGG A;  1BAN A;  1GD3 A;  4MEI A;  4N6M A;  2XGN A;  1AVL A;  3AGN A;  1IQY A;  4N6U A;  1YVB I;  3EX9 A;  8CHO A;  1BRK A;  4QWT A;  1O7P B;  4RNZ A;  3RDE A;  1YI2 3;  4J9A A;  6STD A;  3EB8 A;  3NQZ A;  1JN5 B;  2PZV A;  3MG2 A;  5AYR B;  1Q40 A;  2RFR A;  1BRS A;  1OPY A;  2F5M A;  5RNT A;  6RNT A;  1Q82 4;  4K61 A;  2W9Q A;  1BSD A;  1IVV A;  1BRJ A;  2SBL A;  3FLJ A;  4IIA A;  1IV9 A;  1JNQ A;  1YHQ 3;  4KFF A;  2SAR A;  2GEX A;  2CWV A;  2W03 A;  9RNT A;  1K9M 4;  3HIG A;  1TFK A;  3B7C A;  4OK0 A;  5IEP A;  1ZS7 A;  2B1X B;  3DGL A;  4HM4 B;  1VQQ A;  2GXF A;  1DET A;  2CWU A;  3FZW A;  1BOX A;  4WYK B;  1U5O A;  5CK6 A;  5AII A;  3EBY A;  2P0M A;  3B8L A;  3CNM A;  2WGO A;  4HM0 B;  3HZP A;  1FUT A;  1DMN A;  3F8X A;  1BUJ A;  2F5W A;  1Q7Y 4;  4EYC A;  3EC9 A;  3BIR A;  4O8S A;  1JZD A;  5KP1 A;  2K3D A;  5FGO A;  1ULI B;  1S5A A;  1UCJ A;  3FGY A;  2BU4 A;  3RGA A;  2F4Y A;  3CME 3;  1RGL A;  1UCI A;  3FF2 A;  1I0V A;  4H3U A;  1BVI A;  2RGQ A;  3F7S A;  3GZB A;  1NU3 A;  4HVN A;  2OTL 3;  1M1K 4;  1JB2 A;  3L0R A;  2Z6B A;  1IVU A;  3VGN A;  2CX1 A;  3BU4 A;  5KP3 A;  3H51 A;  1X1Y A;  1IVX A;  1Q86 4;  1BSA A;  1UGH I;  1VQL 3;  3CMA 3;  4JRF A;  3STD A;  1GMQ A;  1ZGX A;  3OX9 A;  1I3I A;  2K54 A;  3G16 A;  2KF5 A;  5IEO A;  1BUQ A;  1D6Y A;  2HMJ B;  3K9M C;  3EQQ B;  2K0M A;  4X2O A;  4STD A;  1JB5 A;  3DGY A;  4EV5 A;  3LXU X;  4HM2 B;  2GEY A;  2OQE A;  3G6E 3;  3NV0 A;  1CEW I;  2E2T A;  3X41 A;  4BTX A;  3CCL 3;  1G02 A;  1TFO A;  1VQ7 3;  3GSP A;  1PFP A;  3FG4 A;  5G1K A;  1TRQ A;  4R9L A;  1X1U A;  1W6Y A;  2BIR A;  4H61 A;  3LOY A;  1FYS A;  4N6N B;  1WMP A;  1PYL A;  4J8T A;  4CPK A;  2KXG A;  4I5Q A;  4RNT A;  2B24 B;  3SOA A;  1G0T A;  3E99 A;  1O7G B;  1LQM B;  1OGX A;  4FMC A;  3O8Y A;  1AQZ A;  3K0Z A;  1BNI A;  2RSX A;  1FGO A;  2CX0 A;  4RNY A;  1RN7 A;  3FG3 A;  4EC6 A;  1A90 A;  6GSP A;  1UUW B;  2ZA4 A;  3Q2P A;  1BIR A;  1OHP A;  1W6G A;  1JZO A;  1E3R A;  1VQK 3;  2Y73 A;  1I2F A;  3RNT A;  3X40 A;  1OAC A;  3WHO A;  4CCV A;  4XM4 A;  3CU3 A;  1TIJ A;  1I0X A;  2LYX A;  4GB5 A;  3UL6 A;  4DKI A;  3MG1 A;  1ZO2 A;  2W9P A;  3ER7 A;  1VQM 3;  1RRL A;  1YJ9 3;  2YX9 A;  2KAA A;  1NDO B;  3ZG0 A;  4HZ9 B;  1S72 3;  2GBW B;  3HOH A;  1BNE A;  2E2V A;  1DYU A;  2H0G A;  3T8N A;  2YFJ B;  2KRT A;  2XEP A;  3NHX A;  1GY6 A;  1F8N A;  1V58 A;  2CFG A;  3JUP A;  3LTA A;  3N8B A;  2MC8 A;  1YNV X;  2FNQ A;  2CH9 A;  3CC7 3;  2CW9 A;  3UNL A;  3D4A A;  2ZHX B;  2CFD A;  1RJO A;  1CH0 A;  1Q9E A;  3PZW A;  3DM8 A;  1BU4 A;  4WP5 A;  2AAE A;  1RGF A;  2BMO B;  2QGU A;  1K8A 4;  5CLK A;  2Q07 A;  2IUJ A;  1W5Z A;  3DXO A;  3OW2 2;  1OCV A;  1MGW A;  3NBB A;  5EQL A;  1GMP A;  1MGR A;  3ROB A;  3G4S 3;  1JJ2 2;  5STD A;  1WMO A;  1BSB A;  3G71 3;  5BVB A;  2CC3 A;  2CFL A;  5DRV A;  1W6C A;  2D1W A;  3DY5 A;  1EKM A;  2BMQ B;  1RN1 A;  1VQ9 3;  1A2K A;  4KFE A;  1W00 A;  3F8H A;  3WOE B;  3WR2 A;  5AEW B;  2QA4 3;  3KII A;  1LOV A;  2ZL8 A;  4R80 A;  1OHS A;  4XDV A;  1W02 A;  2RBI A;  4AKZ A;  1RGH A;  4FCZ A;  1YIJ 3;  1STD A;  4MMX B;  5HGR A;  3NV0 B;  4FMB A;  3F7X A;  4HYZ A;  2P09 A;  3CCS 3;  1I70 A;  2V1L A;  2W0Q A;  4LZI A;  1KQS 2;  1JBR A;  3V99 A;  4J5G A;  1TP6 A;  3D5G A;  1QAK A;  5I97 A;  1RTU A;  2O3O A;  1JRQ A;  1RHL A;  1LOW A;  3LT8 A;  1BNG A;  1UCK A;  4RZM A;  2OCT A;  3NUV A;  3OWS A;  1RLS A;  2CIU A;  1EQK A;  2YFL B;  3S5C A;  4OUQ A;  2Z77 A;  5IG0 A;  4CDL A;  3QRD A;  4BU4 A;  1NWW A;  2W2C A;  3EBT A;  3JUQ A;  2MF7 A;  2UGI A;  1NNV A;  5IG3 A;  1IT8 A;  3NBR A;  4MMZ B;  3CCU 3;  2H0H A;  5CF2 A;  1IQX A;  1SII A;  5HOH A;  1MWU A;  3VSY A;  2IMJ A;  1X1W A;  1VQ4 3;  1O7W B;  1B2Z A;  3UJM A;  1BRI A;  1ASK A;  1BSE A;  1WTH A;  1K28 A;  1Z1S A;  2J8X B;  3SLU A;  1RNT A;  3CPO A;  3ZG5 A;  3CPW 2;  3CCJ 3;  5M18 A;  3KSE D;  5D82 A;  4HKV B;  3K63 A;  1RN4 A;  4NRE A;  2Z7A A;  3AMO B;  1FUS A;  1JKG A;  1R4C A;  2INX A;  3OWU A;  2UUG C;  3MHE A;  3JUN A;  3OV4 A;  3Q90 A;  3V92 A;  1RGC A;  1UUG B;  3AHW A;  1K73 4;  1SJW A;  3CC2 3;  1VQ5 3;  2OOV C;  1TUH A;  4TX4 A;  3G8Z A;  3U97 A;  1GY7 A;  3V98 A;  4WHA A;  2P05 A;  4BTW A;  1M90 4;  2HMK B;  5AIH A;  1RMS A;  2CFW A;  2GU3 A;  3JVC A;  1I2E A;  4IT7 A;  1DMM A;  4O02 B;  3MWZ A;  4N3V A;  2ML6 A;  3DH2 A;  3FG1 A;  5A0O B;  3HI7 A;  4R9K A;  3JUM A;  3I56 3;  1X1X A;  1IVW A;  1OHO A;  3HK4 A;  1BRH A;  2FXT A;  3H3H A;  3GAX A;  1CYV A;  3MKI A;  4K1V A;  2CG0 A;  3BLZ A;  3M8C A;  4N6V 0;  1N5H A;  1OGZ A;  4XBX A;  5AI1 A;  4XBT A;  3LTB A;  1FGQ A;  1GOU A;  1PY3 A;  2BO9 B;  1B27 A;  1AR0 A;  2FGT A;  4R1K A;  1KC8 4;  1AV4 A;  4N6L A;  1WQL B;  5D81 A;  3MYT A;  5BXQ A;  1B2M A;  4U13 A;  1W2Z A;  3LT9 A;  1BRG A;  2KF6 A;  3KSP A;  4HM1 B;  4LGQ A;  3T8U A;  3G0K A;  3CXC 2;  4WFO A;  1YIT 3;  3AHS A;  5AIG A;  3U1W A;  3FCS B;  1A2P A;  3A5E A;  3FKA A;  5LC7 A;  3B4O A;  5G2G A;  2C4B A;  1GOY A;  3URP A;  5BU4 A;  3NM2 A;  3FF0 A;  3CNX A;  3AGO A;  1R4Y A;  4AKY A;  2QEX 3;  3MPH A;  1BNJ A;  1ROA A;  5IG5 A;  5IG4 A;  2CHC A;  1BRN L;  1N8Q A;  2XSH B;  1UCL A;  5DRE A;  1T2I A;  1YJW 3;  3JUO A;  5JPP A;  1RGK A;  2F86 B;  3SOY A;  3S28 A;  1JV2 B;  1FGT A;  3F40 A;  3GRD A;  3ZFZ A;  3GWR A;  1QVF 2;  2GSP A;  2XRX B;  5D83 A;  1D6Z A;  1JBT A;  4O3V A;  1W2B 2;  2F56 A;  4XBY A;  1C54 A;  3CCQ 3;  3IMA B;  1QJG A;  3EN1 B;  1B2U A;  1O7H B;  3IPT A;  3OWY A;  1VQ6 3;  1T3B A;  1DVD A;  1G96 A;  1GS3 A;  2OTJ 3;  1NB3 I;  2P0X A;  1RGE A;  1YVS A;  1IQ8 A;  2W6J H;  1JBS A;  1RCL A;  1GY5 A;  2KCD A;  2W56 A;  3N9H A;  2I9W A;  2BMR B;  2IUK A;  2WOF A;  2XR8 B;  4KVH A; 
#chains in the Genus database with same CATH homology
 1DVC A;  4HBR A;  1JKG B;  1UI7 A;  4I4K A;  4GL6 A;  3EF8 A;  1TU5 A;  3NQY A;  3LZA A;  1HU9 A;  3PCR A;  3D3L A;  4KFD A;  3VF1 A;  1E97 A;  3NBJ A;  3X3Y A;  1Q42 A;  5ELJ A;  4K1U A;  2ML5 A;  2GBX B;  3HX8 A;  2L4V A;  4N6O B;  3D9R A;  4ZM8 A;  1E3V A;  3CCR 3;  2WOH A;  2RCD A;  2W04 A;  2CG1 A;  1IV7 A;  3K7C A;  3UL5 A;  3A76 A;  2LQV A;  3TDG A;  3B4P A;  3S27 A;  1VQP 3;  4LMI A;  1PU4 A;  4KZ1 A;  1W4N A;  2UX0 A;  2OQE C;  1WMN A;  3LTC A;  3BB9 A;  4O2H A;  2CWT A;  3CD6 3;  1IK3 A;  4HM7 B;  2F98 A;  2BT3 A;  1JB4 A;  1A2V A;  5JPU A;  1HKX A;  1YJN 3;  1J2B A;  3BNE A;  4FMD A;  3K5T A;  1CYU A;  1FGM A;  1N9J A;  3AMO A;  2XGL A;  4HM5 B;  1IT7 A;  2CKF B;  4ORL A;  1O7N B;  1V74 A;  1LXE A;  5EEO A;  3EE1 A;  4MJD A;  3Q1C A;  2P38 A;  3S29 A;  3CC4 3;  3LML A;  4PEJ A;  3HII A;  3KN4 A;  2Y74 A;  1ROV A;  1OF5 A;  1U8C B;  4BTY A;  5IER A;  3KE7 A;  2CFK A;  4HJL B;  1RRH A;  3PGB A;  2WGQ A;  2PNC A;  4FR9 A;  3DZL A;  1RKY A;  2OOV A;  3SVA A;  5CF1 A;  3WA3 A;  1NJI 4;  1O7M B;  1ULJ B;  2XF3 A;  3EN8 A;  3FSD A;  3WMD A;  3J7Y d;  4L8O A;  2F99 A;  4X2H A;  1SIH A;  2Z76 A;  4NHF A;  2W56 B;  1UUV B;  3UB1 A;  3S67 A;  3DGM A;  3CCM 3;  4XB5 A;  3PYJ A;  3X3Z A;  1FGR A;  4AEQ A;  1UI8 A;  2IA7 A;  1KWI A;  3NX0 A;  2XH9 A;  1M1X B;  3I55 3;  2OWP A;  3PCS A;  3GZY B;  2JDI H;  4OVM A;  5LC6 A;  1N8R 4;  2JQ5 A;  4MMY B;  1WNH A;  4XDW A;  2O9U X;  4L8P A;  1N9E A;  1W01 A;  3F9S A;  3DUK A;  3BNC A;  2WO0 A;  3LH4 A;  1ZX2 A;  1D6U A;  2C11 A;  4HM6 B;  1L5G B;  2STD A;  3DGN A;  3DMC A;  1KSI A;  3MG3 A;  1FA3 A;  1EA2 A;  1VQO 3;  2HMO B;  3GZR A;  4EXR A;  1DMQ A;  1LOX A;  3FH1 A;  4FCM A;  4WWU C;  1Y4K A;  1VQN 3;  4IPB A;  3PS8 A;  4HM3 B;  2BNG A;  4K90 B;  1MNL A;  4N6T A;  3BND A;  1VZZ A;  3KFQ C;  2HMN B;  1JN5 A;  1US1 A;  1Q40 B;  2BHM A;  5TGN A;  4L7K A;  3OXA A;  1M9G A;  3GZX B;  3KZT A;  3T0U A;  3N54 B;  2E2U A;  1QMA A;  4RBN A;  3NM7 A;  3LYG A;  1ISK A;  3PXM A;  3X3X A;  1W7C A;  5EVH A;  1LVN A;  4FMA A;  3IJE B;  4WYK A;  2ZDJ A;  1FUW A;  1STF I;  1IU7 A;  1SQW A;  1IDP A;  5FW5 A;  1QAF A;  2YFI B;  2HML B;  1GD4 A;  1OUN A;  4Q53 A;  1OF5 B;  5IEN A;  1NB5 I;  3F14 A;  3WOF B;  1GYB A;  4EV2 A;  3WOD G;  4JF8 A;  5ELU A;  4FCJ A;  5AEU B;  1CQS A;  1NO3 A;  5KP4 A;  1OH0 A;  3CCV 3;  3DGO A;  3NXJ A;  5AIF A;  4LEH A;  3QK9 A;  2XFS A;  3LTD A;  1QVG 2;  1SPU A;  3WA2 X;  1MOL A;  1C7H A;  1UW1 A;  1AVK A;  1QAL A;  5AYS C;  4G1M B;  5CXO A;  3KKG A;  3SXX A;  3ALA A;  3EJV A;  3SX1 A;  1Q81 4;  5IF6 A;  4LSO A;  4R4K A;  1LNH A;  1EG9 B;  1N5P A;  2GU1 A;  2M7O A;  3BNB A;  3WDG B;  4EBG A;  5IW9 A;  1A67 A;  5JBS A;  3X42 A;  3RGR A;  3EHC A;  3ECF A;  2C10 A;  2HMM B;  7STD A;  1YGE A;  2D42 A;  2CK3 H;  3I0Y A;  2XFT A;  2XSO B;  1KD1 4;  1VQ8 3;  2A15 A;  2R4I A;  3CCE 3;  4HZB B;  2QIY A;  1T5Y A;  1K41 A;  3SED A;  4HM8 B;  4MEI A;  4N6M A;  3MSO A;  1GD3 A;  2XGN A;  1AVL A;  1IQY A;  4N6U A;  1YVB I;  3EX9 A;  8CHO A;  4QWT A;  1YI2 3;  1O7P B;  4RNZ A;  3RDE A;  4J9A A;  6STD A;  3EB8 A;  3NQZ A;  1JN5 B;  2PZV A;  3MG2 A;  5AYR B;  1Q40 A;  2RFR A;  1OPY A;  1Q82 4;  4K61 A;  2W9Q A;  1IVV A;  1YHQ 3;  2SBL A;  3FLJ A;  4IIA A;  1IV9 A;  1JNQ A;  4KFF A;  2GEX A;  2CWV A;  2W03 A;  1K9M 4;  3HIG A;  1TFK A;  3B7C A;  4OK0 A;  5IEP A;  2B1X B;  3DGL A;  4HM4 B;  2GXF A;  2CWU A;  3FZW A;  4WYK B;  1U5O A;  5CK6 A;  5AII A;  3EBY A;  3B8L A;  3CNM A;  2P0M A;  2WGO A;  4HM0 B;  3HZP A;  1DMN A;  3F8X A;  1Q7Y 4;  4EYC A;  3EC9 A;  4O8S A;  5KP1 A;  5FGO A;  1ULI B;  1S5A A;  3FGY A;  3RGA A;  3CME 3;  3FF2 A;  4H3U A;  2RGQ A;  3F7S A;  3GZB A;  1NU3 A;  4HVN A;  2OTL 3;  1M1K 4;  1JB2 A;  3L0R A;  2Z6B A;  1IVU A;  3VGN A;  5KP3 A;  3H51 A;  1IVX A;  1Q86 4;  1VQL 3;  3CMA 3;  4JRF A;  3STD A;  3OX9 A;  2K54 A;  3G16 A;  5IEO A;  1BUQ A;  1D6Y A;  2HMJ B;  3K9M C;  3EQQ B;  2K0M A;  4X2O A;  4STD A;  1JB5 A;  4EV5 A;  3LXU X;  4HM2 B;  2GEY A;  2OQE A;  3G6E 3;  3NV0 A;  1CEW I;  2E2T A;  3X41 A;  4BTX A;  3CCL 3;  1TFO A;  1VQ7 3;  1PFP A;  3FG4 A;  4R9L A;  1W6Y A;  4H61 A;  3LOY A;  4N6N B;  1WMP A;  4J8T A;  2KXG A;  3SOA A;  2B24 B;  3E99 A;  1O7G B;  4FMC A;  1OGX A;  3O8Y A;  3K0Z A;  2RSX A;  1FGO A;  4RNY A;  1RN7 A;  3FG3 A;  4EC6 A;  1A90 A;  1UUW B;  3Q2P A;  1OHP A;  1W6G A;  1E3R A;  1VQK 3;  2Y73 A;  3X40 A;  1OAC A;  4CCV A;  4XM4 A;  3CU3 A;  1TIJ A;  2LYX A;  4GB5 A;  3UL6 A;  3MG1 A;  1ZO2 A;  2W9P A;  3ER7 A;  1VQM 3;  1RRL A;  1YJ9 3;  2YX9 A;  1S72 3;  1NDO B;  4HZ9 B;  2GBW B;  3T8N A;  2E2V A;  1DYU A;  2YFJ B;  2KRT A;  2XEP A;  3NHX A;  1GY6 A;  1F8N A;  2CFG A;  3JUP A;  3LTA A;  3N8B A;  2MC8 A;  2FNQ A;  2CH9 A;  3CC7 3;  2CW9 A;  3UNL A;  2CFD A;  1RJO A;  3PZW A;  3DM8 A;  4WP5 A;  2BMO B;  2QGU A;  1K8A 4;  5CLK A;  2Q07 A;  2IUJ A;  1W5Z A;  3DXO A;  3OW2 2;  1OCV A;  3NBB A;  5EQL A;  3ROB A;  1JJ2 2;  3G4S 3;  5STD A;  1WMO A;  3G71 3;  5BVB A;  2CC3 A;  2CFL A;  5DRV A;  1W6C A;  2D1W A;  3DY5 A;  1EKM A;  2BMQ B;  1VQ9 3;  1A2K A;  4KFE A;  1W00 A;  3F8H A;  3WOE B;  5AEW B;  2QA4 3;  3KII A;  4R80 A;  2ZL8 A;  4XDV A;  1OHS A;  4AKZ A;  1W02 A;  1YIJ 3;  4FCZ A;  1STD A;  4MMX B;  5HGR A;  3NV0 B;  4FMB A;  3F7X A;  4HYZ A;  2P09 A;  3CCS 3;  2W0Q A;  2V1L A;  4LZI A;  1KQS 2;  3V99 A;  1TP6 A;  1QAK A;  5I97 A;  2O3O A;  1JRQ A;  3LT8 A;  4RZM A;  2OCT A;  3NUV A;  3OWS A;  2CIU A;  1EQK A;  2YFL B;  3S5C A;  4OUQ A;  2Z77 A;  5IG0 A;  4CDL A;  3QRD A;  1NWW A;  2W2C A;  3EBT A;  3JUQ A;  2MF7 A;  5IG3 A;  1IT8 A;  3NBR A;  4MMZ B;  3CCU 3;  5CF2 A;  1IQX A;  1SII A;  3VSY A;  2IMJ A;  1VQ4 3;  1O7W B;  3UJM A;  1ASK A;  1WTH A;  1K28 A;  1Z1S A;  3SLU A;  3CPW 2;  3CPO A;  3CCJ 3;  3KSE D;  5D82 A;  4HKV B;  3K63 A;  4NRE A;  2Z7A A;  3AMO B;  1JKG A;  1R4C A;  2INX A;  3OWU A;  3MHE A;  3JUN A;  3OV4 A;  3Q90 A;  3V92 A;  1K73 4;  1SJW A;  3CC2 3;  1VQ5 3;  2OOV C;  1TUH A;  4TX4 A;  3G8Z A;  3U97 A;  1GY7 A;  3V98 A;  4WHA A;  2P05 A;  4BTW A;  1M90 4;  2HMK B;  5AIH A;  2CFW A;  2GU3 A;  3JVC A;  4IT7 A;  1DMM A;  4O02 B;  3MWZ A;  4N3V A;  2ML6 A;  3FG1 A;  5A0O B;  3HI7 A;  4R9K A;  3JUM A;  3I56 3;  1IVW A;  1OHO A;  3HK4 A;  3H3H A;  2FXT A;  3GAX A;  1CYV A;  3MKI A;  4K1V A;  2CG0 A;  3BLZ A;  3M8C A;  4N6V 0;  1N5H A;  1OGZ A;  4XBX A;  5AI1 A;  4XBT A;  3LTB A;  1FGQ A;  2BO9 B;  1AR0 A;  2FGT A;  4R1K A;  1KC8 4;  1AV4 A;  4N6L A;  1WQL B;  5D81 A;  3MYT A;  5BXQ A;  4U13 A;  1W2Z A;  3LT9 A;  3KSP A;  4HM1 B;  4LGQ A;  3T8U A;  3G0K A;  3CXC 2;  4WFO A;  1YIT 3;  5AIG A;  3U1W A;  3FCS B;  3FKA A;  5LC7 A;  3B4O A;  5G2G A;  3NM2 A;  3FF0 A;  3CNX A;  4AKY A;  2QEX 3;  3MPH A;  1ROA A;  5IG5 A;  5IG4 A;  2CHC A;  1N8Q A;  2XSH B;  5DRE A;  1YJW 3;  3JUO A;  5JPP A;  2F86 B;  3SOY A;  3S28 A;  1JV2 B;  1FGT A;  3F40 A;  3GRD A;  3GWR A;  1QVF 2;  5D83 A;  2XRX B;  1D6Z A;  4O3V A;  1W2B 2;  4XBY A;  3CCQ 3;  3IMA B;  3EN1 B;  1QJG A;  3IPT A;  1O7H B;  3OWY A;  1VQ6 3;  1DVD A;  1G96 A;  1GS3 A;  2OTJ 3;  1NB3 I;  2P0X A;  1IQ8 A;  2W6J H;  1GY5 A;  2KCD A;  2W56 A;  3N9H A;  2I9W A;  2BMR B;  2IUK A;  2WOF A;  2XR8 B;  4KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...