1KD14

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kd1400
1Q824 1K8A4 1YIT3 1YIJ3 3CCL3 1Q7Y4 3CCE3 1YJ93 1Q814 1S723 3CCM3 1M904 2QA43 3CD63 1K734 1Q864 1M1K4 2OTL3 3CCV3 1KC84 1QVF2 3G4S3 1VQ43 3CCS3 1VQM3 3G6E3 1VQL3 1VQN3 1VQP3 3CCR3 3CXC2 1VQK3 1KQS2 2OTJ3 1VQO3 3CCQ3 3CME3 3CC73 3I563 1KD14 1VQ73 1VQ93 1W2B2 1YJN3 1VQ53 1VQ83 1YHQ3 3CC23 3CC43 1VQ63 3G713 2QEX3 1NJI4 3I553 3CCU3 1YJW3 1QVG2 3CCJ3 3CMA3 3CPW2 1YI23 1K9M4 1JJ22 3OW22 1N8R4
chains in the Genus database with same CATH superfamily
2JQ5A 1LXEA 5TGNA 3AHWA 8RNTA 3GSPA 4N6OB 3BLZA 3BNEA 4WYKB 1Q7Y4 2ZHXB 1JN5B 1TFOA 2IYJA 5CF1A 1S723 1DVCA 5BIRA 4KZ1A 1Q40A 1W2ZA 1L5GB 1RGKA 3LXUX 2F5MA 1LNHA 1DYUA 2H0GA 1B2ZA 4FCZA 4HM4B 1BAOA 5DRVA 3UL5A 9RNTA 2W2CA 1OGXA 1AV4A 3PXMA 2RSXA 3PCRA 3EN1B 3WOEB 2KCDA 2RCDA 3CCQ3 3MG3A 2AAEA 3KZTA 2CG0A 1QMAA 2HMNB 1IYYA 4R80A 3EN8A 4HM2B 1PFPA 2A15A 1W01A 4HM0B 5EVHA 3UB1A 3ECFA 4FR9A 4BL3A 4HZ9B 1IV9A 2CWVA 3FLJA 3JUOA 3KKGA 3LTBA 3PYJA 4J5KA 3X42A 5IENA 1IQYA 4N3VA 4PEJA 6RNTA 1KWIA 3CCE3 2P38A 1YVBI 3DH2A 2SBLA 4O2HA 4R4KA 4LEHA 3RNTA 2K54A 1YNVX 3ALAA 2K3DA 3FSDA 1QVF2 2H0IA 1RJOA 2YFLB 3A76A 3JUPA 3UJMA 1W4NA 2CK3H 1MNLA 1RN7A 2BMQB 5IG5A 3EHCA 1JB4A 3ZG5A 1MWSA 1I0XA 2Y73A 5M1AA 4KFEA 3NV0B 2CX1A 3CME3 4BU4A 1K28A 1BRSA 1LVNA 2YFIB 2QEX3 3CPOA 4LGQA 4EYCA 3KN4A 3DZLA 5AI1A 4ZM8A 1QAKA 1N8QA 5I97A 4TX4A 1MWUA 3Q2PA 3S28A 3GZBA 7RNTA 3NHXA 1M904 1DMNA 1VZZA 4GHOA 3CD63 2QIYA 2OTL3 3OXAA 5D82A 1PY3A 2BIRA 2ML5A 8CHOA 3SLUA 1BSBA 1GYBA 1TTOA 2KF4A 1B3SA 1TJDA 3BNCA 3FH1A 4OUQA 1W00A 3SXXA 1RGAA 3JVCA 3CXC2 1OCVA 1AY7A 3D9RA 5KP1A 1YGWA 1X1YA 4X2HA 5IEOA 3VSYA 2B24B 4K61A 1BNIA 2CC3A 4WWUC 5AIHA 2R41A 5AYSC 1LQMB 1HU9A 3D5GA 4FMCA 1JBRA 5D83A 2CFDA 1RNBA 5IERA 2F98A 4NHFA 3CC43 4RNTA 4HM3B 2BHMA 2FGTA 4FCJA 1ULIB 4K90B 3EC9A 3LOYA 1CH0A 1TRPA 1BRHA 2D42A 1FGQA 1OUNA 4H61A 4I4KA 1DVDA 5IF6A 2H0HA 1SJWA 4ILFA 2BNGA 4MMXB 5G1LA 1U8CB 3F7XA 1LQGC 2HMJB 1JRQA 3WA2X 1W6YA 3BIRA 3F40A 3PS8A 2SARA 3FCSB 3B4PA 2IY2A 4XDVA 1UI7A 4HZBB 3MKIA 4L8PA 2GU3A 3NQZA 3EX9A 1X1UA 2E2UA 4MJDA 1RGGA 3OX9A 3CCL3 4OK0A 1IDPA 3AGNA 1ZX2A 1US1A 1FUWA 4EW5A 4HM7B 5ELJA 1TU5A 1DE3A 1Q40B 4JF8A 4HJLB 3BB9A 3DGMA 5A0OB 1EA2A 1RGCA 3O8YA 3ZFZA 1SQWA 1IT7A 2M7OA 3AMOB 3LMLA 3NBBA 5M19A 1TFKA 2CFWA 1O7MB 4H3UA 3EB8A 2KF6A 4OVMA 1O7GB 3WOFB 1NB5I 2LYXA 1MWRA 3CC23 1R4CA 2C11A 4EV2A 3KIIA 1QAFA 2KF5A 1T5YA 2BU4A 3BNBA 1FZUA 5FGOA 2IA7A 1N8R4 2F99A 4LZIA 2KXGA 1NB3I 1BRIA 1LOWA 3HIGA 2K0MA 1O7NB 1JBTA 3Q3FA 1BNEA 2W03A 6STDA 3NX0A 1EQKA 1JKGA 4WP5A 3FGYA 4XBYA 1BNJA 3FZWA 1BOXA 3G4S3 3S29A 1FGTA 1RHLA 4N6MA 4HKVB 4BTXA 3KCHA 1GOUA 1SIIA 1OHPA 1B2UA 2Z76A 4EC6A 1A90A 5BVBA 1TIJA 1JB2A 1YVSA 5LC7A 1VQ73 1YJN3 1OH0A 2IUJA 5GSPA 4HVNA 4HAAA 4O8SA 1VQ63 1B20A 1ASKA 1E3RA 5AYRB 3CCU3 3FF0A 3FG4A 3OV4A 4N6LA 3T0UA 3CCJ3 3CMA3 1W7CA 1WTHA 3DY5A 1D6ZA 1AR0A 3H3HA 4RBNA 1TP6A 3NQYA 3QRDA 4CPKA 1V57A 5AIIA 1K8A4 1MOLA 4AEQA 1BRKA 2Z77A 3Q90A 1W6GA 5BXQA 2BO9B 5JPUA 4K1VA 1RTUA 1S5AA 3ROBA 1T2IA 4IPBA 4XM4A 1GY5A 2LQVA 3WODG 4EV5A 1A2VA 3J7Yd 1IT8A 1OF5A 1C54A 1T3BA 4RNYA 3D79A 1NDOB 3NUVA 3UL6A 1OPYA 7GSPA 1GSPA 1STFI 1M9GA 3ZG0A 3LH4A 1BU4A 2BMRB 4L7KA 3I563 4HM6B 5EQLA 1ZGXA 2XGLA 1YHQ3 2Q07A 2CKFB 1LRAA 2CH9A 3CNXA 4RZMA 3PCSA 2W56B 1LOXA 2E2VA 3FG1A 4WYKA 2HMMB 4GB5A 4MMYB 1JN5A 4KFDA 2W6JH 3F8HA 1Q814 4N6UA 1G0TA 3M8CA 1BNRA 1IVVA 1KC84 5AEUB 2CFGA 6GSPA 3KE7A 1IV7A 4N6TA 1Q9EA 3A5EA 4K1UA 1LOYA 2OQEC 1JV2B 3IMAB 1UDII 2FXTA 2JDIH 2P09A 4O02B 4O3VA 4XBXA 2ML6A 2QGUA 3KFQC 4X2OA 1FUTA 1I8VA 3MSOA 1RGEA 5EEOA 3X3XA 3CC73 1A67A 4HM8B 4IT7A 3K7CA 1A2PA 1D6UA 3SX1A 1VQ93 1I0VA 1GMQA 4HM5B 3GAXA 2ZDJA 1FGMA 3SEDA 3NM2A 4HOHA 3HOHA 3CPW2 2UUGC 2F86B 4HM1B 1EKMA 2XR8B 3MHEA 1RGLA 1YIT3 3LTAA 1RRHA 4J8TA 1MWTA 2XFSA 3EBYA 1IVUA 2MF7A 2WGOA 2XFTA 1WMPA 1Q864 3B8LA 4BTWA 3CU3A 1GOYA 2D1WA 1D6YA 2GEXA 1N5PA 1RGHA 1VQM3 1VQN3 1GD3A 3NV0A 2GSPA 1RNTA 2V1LA 2XGNA 3SVAA 3AHSA 1VQO3 1BUQA 3F7SA 3SOAA 1OHSA 2OQEA 3LTCA 2WOFA 4CDLA 4R9LA 3DMCA 1RN4A 5CK6A 3NBJA 1OACA 2Z6BA 3G0KA 1UUVB 4QWTA 4LSOA 4J9AA 2BT3A 5DREA 3GZRA 1BNGA 1GY6A 1DMQA 3LTDA 1B2XA 1B27A 3OWSA 3HX8A 4FMDA 5HGRA 1C7HA 1JB5A 4ORLA 1EEJA 3G16A 1VQL3 3V92A 1QALA 2HMLB 1BGSA 2CW9A 3S67A 1BSEA 2WOHA 3HK4A 3SYUA 3GZYB 3NM7A 1NU3A 1OGZA 1UUGB 4FCMA 1BNFA 3VF1A 4Q53A 3DGLA 3Q1CA 2AADA 3X41A 2GBXB 3K9MC 1IVXA 1NWWA 1YJW3 3NXJA 3X40A 1ROVA 3WMDA 4AKYA 4WHAA 4CCVA 3KSPA 3SOYA 3EBTA 3LT8A 5JPPA 1YI23 1Q824 3PZWA 2HMOB 2CX0A 1G02A 5CLKA 2STDA 5AEWB 2INXA 2WGQA 5AIGA 1TRQA 1DETA 1LOVA 4MEIA 2OWPA 1FYSA 1YGEA 3CCV3 1GOVA 2IMJA 1RCLA 2J8XB 3EE1A 1A2KA 3RGAA 3CCS3 1VQ43 3K63A 3WR2A 3U1WA 2OOVC 2CFLA 2RNTA 4FMBA 1I3FA 1AVKA 2XEPA 1SIHA 4EXRA 2RGQA 3E99A 1WQLB 1RN1A 5IW9A 1HZ1A 1I2FA 1BSCA 2YFJB 1W2B2 1B2SA 4DKIA 1RRLA 2XSOB 1T2HA 4J5GA 1V58A 2L1SA 4CJNA 2CHCA 2PNCA 1KSIA 3HIIA 2UX0A 3D3LA 3RGRA 1JJ22 4KVHA 4MMZB 3D4AA 5LC6A 2ZA4A 4RNZA 1CEWI 3FKAA 1UCLA 1ISKA 2I9WA 4JRFA 1WMNA 1G96A 1MGRA 2XH9A 3JUQA 1K734 1VQQA 2W9QA 3DM8A 4LYLB 1M1XB 1BRNL 2W9PA 1FA3A 3F14A 1N9EA 2L4VA 2F5WA 3AGOA 3AMOA 1HYFA 1VQP3 3OWYA 1EG9B 3V98A 4U13A 1JBSA 4STDA 3CCR3 3I0YA 4BL2A 3BNDA 1BUJA 1EUIC 1UGIA 4XDWA 3WHOA 2OOVA 1O7HB 1V74A 1VQ83 3CNMA 2XF3A 3MYTA 1X1XA 2BMOB 3G713 2E2TA 1UCIA 1AQZA 2W0QA 2Y74A 5AIFA 2GXFA 1K9M4 3LZAA 1RSNA 1K41A 1FGRA 3OWUA 5IEPA 1CYUA 2W04A 2CFKA 2RBIA 3FF2A 2IUKA 3QK9A 2GU1A 3F9SA 1W5ZA 2CWTA 1YIJ3 2WO0A 3MPHA 1JZDA 2HMKB 4GL6A 2KRTA 3STDA 3LT9A 1B2MA 1M1K4 2B1XB 1I2EA 1RLSA 1NNVA 1ULJB 4L8OA 4XBTA 3IPTA 4N6NB 2KF3A 2MC8A 2KAAA 4HYZA 3G8ZA 3GWRA 3D5IA 3V99A 5M18A 1SARA 4BIRA 5KP3A 1ROAA 2HOHA 2P0XA 5STDA 1HKXA 1VQ53 2CIUA 3EJVA 2CG1A 1IK3A 1DMMA 4XB5A 3DGNA 3B7CA 3DXOA 1NJI4 2FNQA 1QVG2 4AKZA 4KT3B 3EF8A 5FW5A 3S5CA 4G1MB 1BRGA 3MG2A 1ZS7A 3HI7A 3CCM3 7STDA 3RDEA 2QA43 1RCKA 1FGOA 1UCJA 2OCTA 3N9HA 5BU4A 1I70A 4LMIA 3K0ZA 3N8BA 2UGIA 1MGWA 3U97A 3X3YA 1CYVA 1BVIA 1LNIA 1O7PB 3DUKA 2R4IA 1WNHA 1BRJA 1FW7A 2ZL8A 3BU4A 2Z7AA 1QJGA 1F8NA 5RNTA 2OTJ3 4EBGA 2O3OA 1GD4A 1Z1SA 3DGOA 1CQSA 1BSDA 1JZOA 1I2GA 1OHOA 5HOHA 3JUMA 2W56A 1SPUA 5CXOA 1GS3A 1W02A 3ER7A 1R4YA 4BTYA 1JNQA 1NO3A 2GBWB 5JBSA 3T8NA 3GZXB 1RMSA 1J2BA 1RDSA 3WA3A 3WDGB 1AVLA 2RFRA 2CWUA 3UNLA 1JKGB 3H51A 3N54B 3K5TA 2P0MA 4FMAA 2C10A 1FUSA 3G6E3 3URPA 1IQ8A 5G2GA 1BANA 1STDA 2F56A 3L0RA 1B21A 1UUWB 4R9KA 3VGNA 1VQK3 1KQS2 3PGBA 1E97A 3FG3A 1KD14 1BNSA 3GRDA 1W6CA 1UCKA 1IQXA 1GMPA 1IU7A 1N9JA 1UW1A 1ZO2A 2XRXB 4I5QA 4NPBA 4WFOA 5D81A 1PYLA 5G1KA 5IG3A 3I553 2O9UX 4NREA 1RKYA 1Y4KA 2GEYA 1UI8A 4GSPA 1GY7A 4IIAA 5IG0A 1U5OA 3F8XA 5CF2A 3EQQB 3DGYA 4N6V0 1X1WA 1YJ93 1E3VA 3S27A 3MG1A 4HBRA 1IVWA 3KSED 3TDGA 2XSHB 2YX9A 1BSAA 4KFFA 1RGFA 1OF5B 1GMRA 1WMOA 1Q42A 1UGHI 1O7WB 1PU4A 3X3ZA 1I3IA 4R1KA 2F4YA 1N5HA 3T8UA 3HZPA 3B4OA 3MWZA 1BIRA 3LYGA 2P05A 5ELUA 2C4BA 3NBRA 1Q7HA 5IG4A 5KP4A 3JUNA 1TUHA 3IJEB 3OW22 2PZVA
chains in the Genus database with same CATH topology
2JQ5A 1LXEA 5TGNA 4N6OB 1Q7Y4 3BLZA 3BNEA 4WYKB 1JN5B 1TFOA 5CF1A 1S723 1DVCA 4KZ1A 1Q40A 1W2ZA 1L5GB 3LXUX 1LNHA 1DYUA 4FCZA 4HM4B 5DRVA 3UL5A 2W2CA 1OGXA 1AV4A 3PXMA 2RSXA 3PCRA 3EN1B 3WOEB 2KCDA 2RCDA 3CCQ3 3MG3A 3KZTA 2CG0A 1QMAA 2HMNB 4R80A 3EN8A 4HM2B 1PFPA 2A15A 1W01A 4HM0B 5EVHA 3UB1A 3ECFA 4FR9A 4HZ9B 1IV9A 2CWVA 3FLJA 3JUOA 3KKGA 3LTBA 3PYJA 3X42A 5IENA 1IQYA 4N3VA 4PEJA 1KWIA 3CCE3 2P38A 1YVBI 2SBLA 4O2HA 4R4KA 4LEHA 2K54A 3ALAA 3FSDA 1QVF2 1RJOA 2YFLB 3A76A 3JUPA 3UJMA 1W4NA 2CK3H 1MNLA 1RN7A 2BMQB 5IG5A 3EHCA 1JB4A 2Y73A 4KFEA 3NV0B 3CME3 1K28A 1LVNA 2YFIB 2QEX3 3CPOA 4LGQA 4EYCA 3KN4A 3DZLA 5AI1A 4ZM8A 1QAKA 1N8QA 5I97A 4TX4A 3Q2PA 3S28A 3GZBA 3NHXA 1M904 1DMNA 1VZZA 3CD63 2QIYA 2OTL3 3OXAA 5D82A 2ML5A 8CHOA 3SLUA 1GYBA 3BNCA 4OUQA 3FH1A 3SXXA 1W00A 3JVCA 3CXC2 1OCVA 3D9RA 5KP1A 4X2HA 5IEOA 3VSYA 2B24B 4K61A 2CC3A 4WWUC 5AIHA 5AYSC 1HU9A 4FMCA 5D83A 2CFDA 5IERA 2F98A 4NHFA 4HM3B 2BHMA 2FGTA 4FCJA 1ULIB 4K90B 3EC9A 3LOYA 2D42A 1FGQA 1OUNA 4H61A 4I4KA 1DVDA 5IF6A 4MMXB 1SJWA 2BNGA 1U8CB 3F7XA 2HMJB 1JRQA 3WA2X 1W6YA 3F40A 3PS8A 3FCSB 3B4PA 4XDVA 1UI7A 4HZBB 3MKIA 4L8PA 2GU3A 3NQZA 3EX9A 2E2UA 4MJDA 3OX9A 3CCL3 4OK0A 1IDPA 1ZX2A 1US1A 1FUWA 4HM7B 5ELJA 1TU5A 1Q40B 4JF8A 4HJLB 3BB9A 3DGMA 5A0OB 1EA2A 3O8YA 1SQWA 1IT7A 2M7OA 3AMOB 3LMLA 3NBBA 1TFKA 2CFWA 1O7MB 4H3UA 3EB8A 4OVMA 1O7GB 3WOFB 1NB5I 2LYXA 3CC23 1R4CA 2C11A 4EV2A 3KIIA 1QAFA 1T5YA 3BNBA 5FGOA 2IA7A 2F99A 4LZIA 2KXGA 1NB3I 3HIGA 2K0MA 1O7NB 2W03A 6STDA 3NX0A 1EQKA 1JKGA 4WP5A 3FGYA 4XBYA 3FZWA 3G4S3 3S29A 1FGTA 4N6MA 4HKVB 4BTXA 1SIIA 1OHPA 2Z76A 4EC6A 1A90A 5BVBA 1TIJA 1JB2A 5LC7A 1VQ73 1YJN3 1OH0A 2IUJA 4HVNA 4O8SA 1VQ63 5AYRB 1ASKA 1E3RA 3CCU3 3FF0A 3FG4A 3OV4A 4N6LA 3T0UA 3CCJ3 3CMA3 1W7CA 1WTHA 3DY5A 1D6ZA 1AR0A 3H3HA 4RBNA 1TP6A 3NQYA 3QRDA 1N8R4 1K8A4 5AIIA 1MOLA 4AEQA 2Z77A 3Q90A 1W6GA 5BXQA 2BO9B 5JPUA 4K1VA 1S5AA 3ROBA 4IPBA 4XM4A 1GY5A 2LQVA 3WODG 4EV5A 1A2VA 3J7Yd 1IT8A 1OF5A 4RNYA 1NDOB 3NUVA 3UL6A 1OPYA 1STFI 1M9GA 3LH4A 2BMRB 4L7KA 3I563 4HM6B 5EQLA 2XGLA 1YHQ3 2Q07A 2CKFB 3CNXA 2CH9A 4RZMA 3PCSA 2W56B 1LOXA 2E2VA 3FG1A 4WYKA 2HMMB 4GB5A 4MMYB 1JN5A 4KFDA 2W6JH 3F8HA 1Q814 4N6UA 3M8CA 1IVVA 1KC84 5AEUB 2CFGA 3KE7A 1IV7A 4N6TA 4K1UA 2OQEC 1JV2B 3IMAB 2P09A 2FXTA 2JDIH 4O02B 4O3VA 4XBXA 2ML6A 2QGUA 3KFQC 4X2OA 3MSOA 5EEOA 3X3XA 3CC73 1A67A 4HM8B 4IT7A 3K7CA 1D6UA 3SX1A 1VQ93 4HM5B 3GAXA 2ZDJA 1FGMA 3SEDA 3NM2A 3CPW2 4HM1B 2F86B 1EKMA 2XR8B 3MHEA 1YIT3 3LTAA 1RRHA 4J8TA 2XFSA 3EBYA 1IVUA 2MF7A 2WGOA 2XFTA 1WMPA 1Q864 3B8LA 4BTWA 3CU3A 2D1WA 1D6YA 2GEXA 1N5PA 1VQM3 1VQN3 1GD3A 3NV0A 3SVAA 2V1LA 2XGNA 1VQO3 1BUQA 3F7SA 3SOAA 1OHSA 2OQEA 3LTCA 2WOFA 4CDLA 4R9LA 3DMCA 5CK6A 3NBJA 1OACA 2Z6BA 3G0KA 1UUVB 4QWTA 4LSOA 4J9AA 2BT3A 5DREA 3GZRA 1GY6A 1DMQA 3LTDA 3OWSA 3HX8A 4FMDA 5HGRA 1C7HA 1JB5A 4ORLA 3G16A 1VQL3 3V92A 1QALA 2HMLB 2CW9A 3S67A 2WOHA 3HK4A 3GZYB 3NM7A 1NU3A 1OGZA 4FCMA 3X41A 3VF1A 4Q53A 3DGLA 3Q1CA 2GBXB 3K9MC 1IVXA 1NWWA 1YJW3 3NXJA 3X40A 1ROVA 3WMDA 4AKYA 4WHAA 4CCVA 3KSPA 3SOYA 3EBTA 3LT8A 5JPPA 1YI23 1Q824 3PZWA 2HMOB 5CLKA 2STDA 5AEWB 2INXA 2WGQA 5AIGA 4MEIA 2OWPA 1YGEA 3CCV3 2IMJA 3EE1A 3RGAA 1A2KA 1VQ43 3CCS3 3K63A 3U1WA 2OOVC 2CFLA 4FMBA 1AVKA 2XEPA 1SIHA 4EXRA 2RGQA 3E99A 1WQLB 5IW9A 2YFJB 1W2B2 1RRLA 2XSOB 2CHCA 2PNCA 1KSIA 3HIIA 2UX0A 3D3LA 3RGRA 1JJ22 4KVHA 4MMZB 5LC6A 4RNZA 1CEWI 3FKAA 1ISKA 2I9WA 4JRFA 1WMNA 1G96A 3JUQA 2XH9A 1K734 2W9QA 3DM8A 1FA3A 1M1XB 2W9PA 3F14A 1N9EA 2L4VA 3AMOA 1VQP3 3OWYA 1EG9B 3V98A 4U13A 4STDA 3CCR3 3I0YA 3BNDA 4XDWA 2OOVA 1O7HB 1V74A 1VQ83 3CNMA 2XF3A 3MYTA 2BMOB 3G713 2E2TA 2W0QA 2Y74A 5AIFA 2GXFA 1K9M4 3LZAA 1FGRA 1K41A 3OWUA 5IEPA 1CYUA 2W04A 2CFKA 3FF2A 2IUKA 3QK9A 2GU1A 3F9SA 1W5ZA 2CWTA 1YIJ3 2WO0A 3MPHA 2HMKB 4GL6A 2KRTA 3STDA 3LT9A 1M1K4 2B1XB 1ULJB 4L8OA 4XBTA 3IPTA 4N6NB 2MC8A 4HYZA 3G8ZA 3GWRA 3V99A 5KP3A 1ROAA 2P0XA 5STDA 1HKXA 1VQ53 2CIUA 3EJVA 2CG1A 1IK3A 1DMMA 4XB5A 3DGNA 3B7CA 3DXOA 1NJI4 2FNQA 1QVG2 4AKZA 3EF8A 5FW5A 3S5CA 4G1MB 3MG2A 3HI7A 3CCM3 7STDA 3RDEA 2QA43 1FGOA 2OCTA 3N9HA 4LMIA 3K0ZA 3N8BA 3U97A 3X3YA 1CYVA 1O7PB 3DUKA 2R4IA 1WNHA 2ZL8A 2Z7AA 1QJGA 1F8NA 2OTJ3 4EBGA 2O3OA 1GD4A 1Z1SA 3DGOA 1CQSA 1OHOA 3JUMA 2W56A 1SPUA 5CXOA 1GS3A 1W02A 3ER7A 4BTYA 1JNQA 1NO3A 2GBWB 5JBSA 3T8NA 3GZXB 1J2BA 3WA3A 3WDGB 1AVLA 2RFRA 2CWUA 3UNLA 1JKGB 3H51A 3N54B 3K5TA 2P0MA 4FMAA 2C10A 3G6E3 1IQ8A 5G2GA 1STDA 3L0RA 4R9KA 1UUWB 3VGNA 1VQK3 1KQS2 3PGBA 1E97A 3FG3A 1KD14 3GRDA 1W6CA 1IQXA 1N9JA 1IU7A 1UW1A 2XRXB 1ZO2A 4WFOA 3CC43 5D81A 5IG3A 3I553 2O9UX 4NREA 1RKYA 1Y4KA 2GEYA 1UI8A 1GY7A 4IIAA 5IG0A 1U5OA 3F8XA 5CF2A 3EQQB 4N6V0 1YJ93 1E3VA 3S27A 3MG1A 4HBRA 1IVWA 3KSED 3TDGA 2XSHB 2YX9A 4KFFA 1OF5B 1WMOA 1Q42A 1O7WB 1PU4A 3X3ZA 4R1KA 1N5HA 3T8UA 3HZPA 3B4OA 3MWZA 3LYGA 2P05A 5ELUA 3NBRA 5IG4A 5KP4A 3JUNA 1TUHA 3IJEB 3OW22 2PZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 4;  1K8A 4;  1YIT 3;  1YIJ 3;  3CCL 3;  1Q7Y 4;  3CCE 3;  1YJ9 3;  1Q81 4;  1S72 3;  3CCM 3;  1M90 4;  2QA4 3;  3CD6 3;  1K73 4;  1Q86 4;  1M1K 4;  2OTL 3;  3CCV 3;  1KC8 4;  1QVF 2;  3G4S 3;  1VQ4 3;  3CCS 3;  1VQM 3;  3G6E 3;  1VQL 3;  1VQN 3;  1VQP 3;  3CCR 3;  3CXC 2;  1VQK 3;  1KQS 2;  2OTJ 3;  1VQO 3;  3CCQ 3;  3CME 3;  3CC7 3;  3I56 3;  1KD1 4;  1VQ7 3;  1VQ9 3;  1W2B 2;  1YJN 3;  1VQ5 3;  1VQ8 3;  1YHQ 3;  3CC2 3;  3CC4 3;  1VQ6 3;  3G71 3;  2QEX 3;  1NJI 4;  3I55 3;  3CCU 3;  1YJW 3;  1QVG 2;  3CCJ 3;  3CMA 3;  3CPW 2;  1YI2 3;  1K9M 4;  1JJ2 2;  3OW2 2;  1N8R 4; 
#chains in the Genus database with same CATH topology
 2JQ5 A;  1LXE A;  5TGN A;  3AHW A;  8RNT A;  3GSP A;  4N6O B;  3BLZ A;  3BNE A;  4WYK B;  1Q7Y 4;  2ZHX B;  1JN5 B;  1TFO A;  2IYJ A;  5CF1 A;  1S72 3;  1DVC A;  5BIR A;  4KZ1 A;  1Q40 A;  1W2Z A;  1L5G B;  1RGK A;  3LXU X;  2F5M A;  1LNH A;  1DYU A;  2H0G A;  1B2Z A;  4FCZ A;  4HM4 B;  1BAO A;  5DRV A;  3UL5 A;  9RNT A;  2W2C A;  1OGX A;  1AV4 A;  3PXM A;  2RSX A;  3PCR A;  3EN1 B;  3WOE B;  2KCD A;  2RCD A;  3CCQ 3;  3MG3 A;  2AAE A;  3KZT A;  2CG0 A;  1QMA A;  2HMN B;  1IYY A;  4R80 A;  3EN8 A;  4HM2 B;  1PFP A;  2A15 A;  1W01 A;  4HM0 B;  5EVH A;  3UB1 A;  3ECF A;  4FR9 A;  4BL3 A;  4HZ9 B;  1IV9 A;  2CWV A;  3FLJ A;  3JUO A;  3KKG A;  3LTB A;  3PYJ A;  4J5K A;  3X42 A;  5IEN A;  1IQY A;  4N3V A;  4PEJ A;  6RNT A;  1KWI A;  3CCE 3;  2P38 A;  1YVB I;  3DH2 A;  2SBL A;  4O2H A;  4R4K A;  4LEH A;  3RNT A;  2K54 A;  1YNV X;  3ALA A;  2K3D A;  3FSD A;  1QVF 2;  2H0I A;  1RJO A;  2YFL B;  3A76 A;  3JUP A;  3UJM A;  1W4N A;  2CK3 H;  1MNL A;  1RN7 A;  2BMQ B;  5IG5 A;  3EHC A;  1JB4 A;  3ZG5 A;  1MWS A;  1I0X A;  2Y73 A;  5M1A A;  4KFE A;  3NV0 B;  2CX1 A;  3CME 3;  4BU4 A;  1K28 A;  1BRS A;  1LVN A;  2YFI B;  2QEX 3;  3CPO A;  4LGQ A;  4EYC A;  3KN4 A;  3DZL A;  5AI1 A;  4ZM8 A;  1QAK A;  1N8Q A;  5I97 A;  4TX4 A;  1MWU A;  3Q2P A;  3S28 A;  3GZB A;  7RNT A;  3NHX A;  1M90 4;  1DMN A;  1VZZ A;  4GHO A;  3CD6 3;  2QIY A;  2OTL 3;  3OXA A;  5D82 A;  1PY3 A;  2BIR A;  2ML5 A;  8CHO A;  3SLU A;  1BSB A;  1GYB A;  1TTO A;  2KF4 A;  1B3S A;  1TJD A;  3BNC A;  3FH1 A;  4OUQ A;  1W00 A;  3SXX A;  1RGA A;  3JVC A;  3CXC 2;  1OCV A;  1AY7 A;  3D9R A;  5KP1 A;  1YGW A;  1X1Y A;  4X2H A;  5IEO A;  3VSY A;  2B24 B;  4K61 A;  1BNI A;  2CC3 A;  4WWU C;  5AIH A;  2R41 A;  5AYS C;  1LQM B;  1HU9 A;  3D5G A;  4FMC A;  1JBR A;  5D83 A;  2CFD A;  1RNB A;  5IER A;  2F98 A;  4NHF A;  3CC4 3;  4RNT A;  4HM3 B;  2BHM A;  2FGT A;  4FCJ A;  1ULI B;  4K90 B;  3EC9 A;  3LOY A;  1CH0 A;  1TRP A;  1BRH A;  2D42 A;  1FGQ A;  1OUN A;  4H61 A;  4I4K A;  1DVD A;  5IF6 A;  2H0H A;  1SJW A;  4ILF A;  2BNG A;  4MMX B;  5G1L A;  1U8C B;  3F7X A;  1LQG C;  2HMJ B;  1JRQ A;  3WA2 X;  1W6Y A;  3BIR A;  3F40 A;  3PS8 A;  2SAR A;  3FCS B;  3B4P A;  2IY2 A;  4XDV A;  1UI7 A;  4HZB B;  3MKI A;  4L8P A;  2GU3 A;  3NQZ A;  3EX9 A;  1X1U A;  2E2U A;  4MJD A;  1RGG A;  3OX9 A;  3CCL 3;  4OK0 A;  1IDP A;  3AGN A;  1ZX2 A;  1US1 A;  1FUW A;  4EW5 A;  4HM7 B;  5ELJ A;  1TU5 A;  1DE3 A;  1Q40 B;  4JF8 A;  4HJL B;  3BB9 A;  3DGM A;  5A0O B;  1EA2 A;  1RGC A;  3O8Y A;  3ZFZ A;  1SQW A;  1IT7 A;  2M7O A;  3AMO B;  3LML A;  3NBB A;  5M19 A;  1TFK A;  2CFW A;  1O7M B;  4H3U A;  3EB8 A;  2KF6 A;  4OVM A;  1O7G B;  3WOF B;  1NB5 I;  2LYX A;  1MWR A;  3CC2 3;  1R4C A;  2C11 A;  4EV2 A;  3KII A;  1QAF A;  2KF5 A;  1T5Y A;  2BU4 A;  3BNB A;  1FZU A;  5FGO A;  2IA7 A;  1N8R 4;  2F99 A;  4LZI A;  2KXG A;  1NB3 I;  1BRI A;  1LOW A;  3HIG A;  2K0M A;  1O7N B;  1JBT A;  3Q3F A;  1BNE A;  2W03 A;  6STD A;  3NX0 A;  1EQK A;  1JKG A;  4WP5 A;  3FGY A;  4XBY A;  1BNJ A;  3FZW A;  1BOX A;  3G4S 3;  3S29 A;  1FGT A;  1RHL A;  4N6M A;  4HKV B;  4BTX A;  3KCH A;  1GOU A;  1SII A;  1OHP A;  1B2U A;  2Z76 A;  4EC6 A;  1A90 A;  5BVB A;  1TIJ A;  1JB2 A;  1YVS A;  5LC7 A;  1VQ7 3;  1YJN 3;  1OH0 A;  2IUJ A;  5GSP A;  4HVN A;  4HAA A;  4O8S A;  1VQ6 3;  1B20 A;  1ASK A;  1E3R A;  5AYR B;  3CCU 3;  3FF0 A;  3FG4 A;  3OV4 A;  4N6L A;  3T0U A;  3CCJ 3;  3CMA 3;  1W7C A;  1WTH A;  3DY5 A;  1D6Z A;  1AR0 A;  3H3H A;  4RBN A;  1TP6 A;  3NQY A;  3QRD A;  4CPK A;  1V57 A;  5AII A;  1K8A 4;  1MOL A;  4AEQ A;  1BRK A;  2Z77 A;  3Q90 A;  1W6G A;  5BXQ A;  2BO9 B;  5JPU A;  4K1V A;  1RTU A;  1S5A A;  3ROB A;  1T2I A;  4IPB A;  4XM4 A;  1GY5 A;  2LQV A;  3WOD G;  4EV5 A;  1A2V A;  3J7Y d;  1IT8 A;  1OF5 A;  1C54 A;  1T3B A;  4RNY A;  3D79 A;  1NDO B;  3NUV A;  3UL6 A;  1OPY A;  7GSP A;  1GSP A;  1STF I;  1M9G A;  3ZG0 A;  3LH4 A;  1BU4 A;  2BMR B;  4L7K A;  3I56 3;  4HM6 B;  5EQL A;  1ZGX A;  2XGL A;  1YHQ 3;  2Q07 A;  2CKF B;  1LRA A;  2CH9 A;  3CNX A;  4RZM A;  3PCS A;  2W56 B;  1LOX A;  2E2V A;  3FG1 A;  4WYK A;  2HMM B;  4GB5 A;  4MMY B;  1JN5 A;  4KFD A;  2W6J H;  3F8H A;  1Q81 4;  4N6U A;  1G0T A;  3M8C A;  1BNR A;  1IVV A;  1KC8 4;  5AEU B;  2CFG A;  6GSP A;  3KE7 A;  1IV7 A;  4N6T A;  1Q9E A;  3A5E A;  4K1U A;  1LOY A;  2OQE C;  1JV2 B;  3IMA B;  1UDI I;  2FXT A;  2JDI H;  2P09 A;  4O02 B;  4O3V A;  4XBX A;  2ML6 A;  2QGU A;  3KFQ C;  4X2O A;  1FUT A;  1I8V A;  3MSO A;  1RGE A;  5EEO A;  3X3X A;  3CC7 3;  1A67 A;  4HM8 B;  4IT7 A;  3K7C A;  1A2P A;  1D6U A;  3SX1 A;  1VQ9 3;  1I0V A;  1GMQ A;  4HM5 B;  3GAX A;  2ZDJ A;  1FGM A;  3SED A;  3NM2 A;  4HOH A;  3HOH A;  3CPW 2;  2UUG C;  2F86 B;  4HM1 B;  1EKM A;  2XR8 B;  3MHE A;  1RGL A;  1YIT 3;  3LTA A;  1RRH A;  4J8T A;  1MWT A;  2XFS A;  3EBY A;  1IVU A;  2MF7 A;  2WGO A;  2XFT A;  1WMP A;  1Q86 4;  3B8L A;  4BTW A;  3CU3 A;  1GOY A;  2D1W A;  1D6Y A;  2GEX A;  1N5P A;  1RGH A;  1VQM 3;  1VQN 3;  1GD3 A;  3NV0 A;  2GSP A;  1RNT A;  2V1L A;  2XGN A;  3SVA A;  3AHS A;  1VQO 3;  1BUQ A;  3F7S A;  3SOA A;  1OHS A;  2OQE A;  3LTC A;  2WOF A;  4CDL A;  4R9L A;  3DMC A;  1RN4 A;  5CK6 A;  3NBJ A;  1OAC A;  2Z6B A;  3G0K A;  1UUV B;  4QWT A;  4LSO A;  4J9A A;  2BT3 A;  5DRE A;  3GZR A;  1BNG A;  1GY6 A;  1DMQ A;  3LTD A;  1B2X A;  1B27 A;  3OWS A;  3HX8 A;  4FMD A;  5HGR A;  1C7H A;  1JB5 A;  4ORL A;  1EEJ A;  3G16 A;  1VQL 3;  3V92 A;  1QAL A;  2HML B;  1BGS A;  2CW9 A;  3S67 A;  1BSE A;  2WOH A;  3HK4 A;  3SYU A;  3GZY B;  3NM7 A;  1NU3 A;  1OGZ A;  1UUG B;  4FCM A;  1BNF A;  3VF1 A;  4Q53 A;  3DGL A;  3Q1C A;  2AAD A;  3X41 A;  2GBX B;  3K9M C;  1IVX A;  1NWW A;  1YJW 3;  3NXJ A;  3X40 A;  1ROV A;  3WMD A;  4AKY A;  4WHA A;  4CCV A;  3KSP A;  3SOY A;  3EBT A;  3LT8 A;  5JPP A;  1YI2 3;  1Q82 4;  3PZW A;  2HMO B;  2CX0 A;  1G02 A;  5CLK A;  2STD A;  5AEW B;  2INX A;  2WGQ A;  5AIG A;  1TRQ A;  1DET A;  1LOV A;  4MEI A;  2OWP A;  1FYS A;  1YGE A;  3CCV 3;  1GOV A;  2IMJ A;  1RCL A;  2J8X B;  3EE1 A;  1A2K A;  3RGA A;  3CCS 3;  1VQ4 3;  3K63 A;  3WR2 A;  3U1W A;  2OOV C;  2CFL A;  2RNT A;  4FMB A;  1I3F A;  1AVK A;  2XEP A;  1SIH A;  4EXR A;  2RGQ A;  3E99 A;  1WQL B;  1RN1 A;  5IW9 A;  1HZ1 A;  1I2F A;  1BSC A;  2YFJ B;  1W2B 2;  1B2S A;  4DKI A;  1RRL A;  2XSO B;  1T2H A;  4J5G A;  1V58 A;  2L1S A;  4CJN A;  2CHC A;  2PNC A;  1KSI A;  3HII A;  2UX0 A;  3D3L A;  3RGR A;  1JJ2 2;  4KVH A;  4MMZ B;  3D4A A;  5LC6 A;  2ZA4 A;  4RNZ A;  1CEW I;  3FKA A;  1UCL A;  1ISK A;  2I9W A;  4JRF A;  1WMN A;  1G96 A;  1MGR A;  2XH9 A;  3JUQ A;  1K73 4;  1VQQ A;  2W9Q A;  3DM8 A;  4LYL B;  1M1X B;  1BRN L;  2W9P A;  1FA3 A;  3F14 A;  1N9E A;  2L4V A;  2F5W A;  3AGO A;  3AMO A;  1HYF A;  1VQP 3;  3OWY A;  1EG9 B;  3V98 A;  4U13 A;  1JBS A;  4STD A;  3CCR 3;  3I0Y A;  4BL2 A;  3BND A;  1BUJ A;  1EUI C;  1UGI A;  4XDW A;  3WHO A;  2OOV A;  1O7H B;  1V74 A;  1VQ8 3;  3CNM A;  2XF3 A;  3MYT A;  1X1X A;  2BMO B;  3G71 3;  2E2T A;  1UCI A;  1AQZ A;  2W0Q A;  2Y74 A;  5AIF A;  2GXF A;  1K9M 4;  3LZA A;  1RSN A;  1K41 A;  1FGR A;  3OWU A;  5IEP A;  1CYU A;  2W04 A;  2CFK A;  2RBI A;  3FF2 A;  2IUK A;  3QK9 A;  2GU1 A;  3F9S A;  1W5Z A;  2CWT A;  1YIJ 3;  2WO0 A;  3MPH A;  1JZD A;  2HMK B;  4GL6 A;  2KRT A;  3STD A;  3LT9 A;  1B2M A;  1M1K 4;  2B1X B;  1I2E A;  1RLS A;  1NNV A;  1ULJ B;  4L8O A;  4XBT A;  3IPT A;  4N6N B;  2KF3 A;  2MC8 A;  2KAA A;  4HYZ A;  3G8Z A;  3GWR A;  3D5I A;  3V99 A;  5M18 A;  1SAR A;  4BIR A;  5KP3 A;  1ROA A;  2HOH A;  2P0X A;  5STD A;  1HKX A;  1VQ5 3;  2CIU A;  3EJV A;  2CG1 A;  1IK3 A;  1DMM A;  4XB5 A;  3DGN A;  3B7C A;  3DXO A;  1NJI 4;  2FNQ A;  1QVG 2;  4AKZ A;  4KT3 B;  3EF8 A;  5FW5 A;  3S5C A;  4G1M B;  1BRG A;  3MG2 A;  1ZS7 A;  3HI7 A;  3CCM 3;  7STD A;  3RDE A;  2QA4 3;  1RCK A;  1FGO A;  1UCJ A;  2OCT A;  3N9H A;  5BU4 A;  1I70 A;  4LMI A;  3K0Z A;  3N8B A;  2UGI A;  1MGW A;  3U97 A;  3X3Y A;  1CYV A;  1BVI A;  1LNI A;  1O7P B;  3DUK A;  2R4I A;  1WNH A;  1BRJ A;  1FW7 A;  2ZL8 A;  3BU4 A;  2Z7A A;  1QJG A;  1F8N A;  5RNT A;  2OTJ 3;  4EBG A;  2O3O A;  1GD4 A;  1Z1S A;  3DGO A;  1CQS A;  1BSD A;  1JZO A;  1I2G A;  1OHO A;  5HOH A;  3JUM A;  2W56 A;  1SPU A;  5CXO A;  1GS3 A;  1W02 A;  3ER7 A;  1R4Y A;  4BTY A;  1JNQ A;  1NO3 A;  2GBW B;  5JBS A;  3T8N A;  3GZX B;  1RMS A;  1J2B A;  1RDS A;  3WA3 A;  3WDG B;  1AVL A;  2RFR A;  2CWU A;  3UNL A;  1JKG B;  3H51 A;  3N54 B;  3K5T A;  2P0M A;  4FMA A;  2C10 A;  1FUS A;  3G6E 3;  3URP A;  1IQ8 A;  5G2G A;  1BAN A;  1STD A;  2F56 A;  3L0R A;  1B21 A;  1UUW B;  4R9K A;  3VGN A;  1VQK 3;  1KQS 2;  3PGB A;  1E97 A;  3FG3 A;  1KD1 4;  1BNS A;  3GRD A;  1W6C A;  1UCK A;  1IQX A;  1GMP A;  1IU7 A;  1N9J A;  1UW1 A;  1ZO2 A;  2XRX B;  4I5Q A;  4NPB A;  4WFO A;  5D81 A;  1PYL A;  5G1K A;  5IG3 A;  3I55 3;  2O9U X;  4NRE A;  1RKY A;  1Y4K A;  2GEY A;  1UI8 A;  4GSP A;  1GY7 A;  4IIA A;  5IG0 A;  1U5O A;  3F8X A;  5CF2 A;  3EQQ B;  3DGY A;  4N6V 0;  1X1W A;  1YJ9 3;  1E3V A;  3S27 A;  3MG1 A;  4HBR A;  1IVW A;  3KSE D;  3TDG A;  2XSH B;  2YX9 A;  1BSA A;  4KFF A;  1RGF A;  1OF5 B;  1GMR A;  1WMO A;  1Q42 A;  1UGH I;  1O7W B;  1PU4 A;  3X3Z A;  1I3I A;  4R1K A;  2F4Y A;  1N5H A;  3T8U A;  3HZP A;  3B4O A;  3MWZ A;  1BIR A;  3LYG A;  2P05 A;  5ELU A;  2C4B A;  3NBR A;  1Q7H A;  5IG4 A;  5KP4 A;  3JUN A;  1TUH A;  3IJE B;  3OW2 2;  2PZV A; 
#chains in the Genus database with same CATH homology
 2JQ5 A;  1LXE A;  5TGN A;  4N6O B;  1Q7Y 4;  3BLZ A;  3BNE A;  4WYK B;  1JN5 B;  1TFO A;  5CF1 A;  1S72 3;  1DVC A;  4KZ1 A;  1Q40 A;  1W2Z A;  1L5G B;  3LXU X;  1LNH A;  1DYU A;  4FCZ A;  4HM4 B;  5DRV A;  3UL5 A;  2W2C A;  1OGX A;  1AV4 A;  3PXM A;  2RSX A;  3PCR A;  3EN1 B;  3WOE B;  2KCD A;  2RCD A;  3CCQ 3;  3MG3 A;  3KZT A;  2CG0 A;  1QMA A;  2HMN B;  4R80 A;  3EN8 A;  4HM2 B;  1PFP A;  2A15 A;  1W01 A;  4HM0 B;  5EVH A;  3UB1 A;  3ECF A;  4FR9 A;  4HZ9 B;  1IV9 A;  2CWV A;  3FLJ A;  3JUO A;  3KKG A;  3LTB A;  3PYJ A;  3X42 A;  5IEN A;  1IQY A;  4N3V A;  4PEJ A;  1KWI A;  3CCE 3;  2P38 A;  1YVB I;  2SBL A;  4O2H A;  4R4K A;  4LEH A;  2K54 A;  3ALA A;  3FSD A;  1QVF 2;  1RJO A;  2YFL B;  3A76 A;  3JUP A;  3UJM A;  1W4N A;  2CK3 H;  1MNL A;  1RN7 A;  2BMQ B;  5IG5 A;  3EHC A;  1JB4 A;  2Y73 A;  4KFE A;  3NV0 B;  3CME 3;  1K28 A;  1LVN A;  2YFI B;  2QEX 3;  3CPO A;  4LGQ A;  4EYC A;  3KN4 A;  3DZL A;  5AI1 A;  4ZM8 A;  1QAK A;  1N8Q A;  5I97 A;  4TX4 A;  3Q2P A;  3S28 A;  3GZB A;  3NHX A;  1M90 4;  1DMN A;  1VZZ A;  3CD6 3;  2QIY A;  2OTL 3;  3OXA A;  5D82 A;  2ML5 A;  8CHO A;  3SLU A;  1GYB A;  3BNC A;  4OUQ A;  3FH1 A;  3SXX A;  1W00 A;  3JVC A;  3CXC 2;  1OCV A;  3D9R A;  5KP1 A;  4X2H A;  5IEO A;  3VSY A;  2B24 B;  4K61 A;  2CC3 A;  4WWU C;  5AIH A;  5AYS C;  1HU9 A;  4FMC A;  5D83 A;  2CFD A;  5IER A;  2F98 A;  4NHF A;  4HM3 B;  2BHM A;  2FGT A;  4FCJ A;  1ULI B;  4K90 B;  3EC9 A;  3LOY A;  2D42 A;  1FGQ A;  1OUN A;  4H61 A;  4I4K A;  1DVD A;  5IF6 A;  4MMX B;  1SJW A;  2BNG A;  1U8C B;  3F7X A;  2HMJ B;  1JRQ A;  3WA2 X;  1W6Y A;  3F40 A;  3PS8 A;  3FCS B;  3B4P A;  4XDV A;  1UI7 A;  4HZB B;  3MKI A;  4L8P A;  2GU3 A;  3NQZ A;  3EX9 A;  2E2U A;  4MJD A;  3OX9 A;  3CCL 3;  4OK0 A;  1IDP A;  1ZX2 A;  1US1 A;  1FUW A;  4HM7 B;  5ELJ A;  1TU5 A;  1Q40 B;  4JF8 A;  4HJL B;  3BB9 A;  3DGM A;  5A0O B;  1EA2 A;  3O8Y A;  1SQW A;  1IT7 A;  2M7O A;  3AMO B;  3LML A;  3NBB A;  1TFK A;  2CFW A;  1O7M B;  4H3U A;  3EB8 A;  4OVM A;  1O7G B;  3WOF B;  1NB5 I;  2LYX A;  3CC2 3;  1R4C A;  2C11 A;  4EV2 A;  3KII A;  1QAF A;  1T5Y A;  3BNB A;  5FGO A;  2IA7 A;  2F99 A;  4LZI A;  2KXG A;  1NB3 I;  3HIG A;  2K0M A;  1O7N B;  2W03 A;  6STD A;  3NX0 A;  1EQK A;  1JKG A;  4WP5 A;  3FGY A;  4XBY A;  3FZW A;  3G4S 3;  3S29 A;  1FGT A;  4N6M A;  4HKV B;  4BTX A;  1SII A;  1OHP A;  2Z76 A;  4EC6 A;  1A90 A;  5BVB A;  1TIJ A;  1JB2 A;  5LC7 A;  1VQ7 3;  1YJN 3;  1OH0 A;  2IUJ A;  4HVN A;  4O8S A;  1VQ6 3;  5AYR B;  1ASK A;  1E3R A;  3CCU 3;  3FF0 A;  3FG4 A;  3OV4 A;  4N6L A;  3T0U A;  3CCJ 3;  3CMA 3;  1W7C A;  1WTH A;  3DY5 A;  1D6Z A;  1AR0 A;  3H3H A;  4RBN A;  1TP6 A;  3NQY A;  3QRD A;  1N8R 4;  1K8A 4;  5AII A;  1MOL A;  4AEQ A;  2Z77 A;  3Q90 A;  1W6G A;  5BXQ A;  2BO9 B;  5JPU A;  4K1V A;  1S5A A;  3ROB A;  4IPB A;  4XM4 A;  1GY5 A;  2LQV A;  3WOD G;  4EV5 A;  1A2V A;  3J7Y d;  1IT8 A;  1OF5 A;  4RNY A;  1NDO B;  3NUV A;  3UL6 A;  1OPY A;  1STF I;  1M9G A;  3LH4 A;  2BMR B;  4L7K A;  3I56 3;  4HM6 B;  5EQL A;  2XGL A;  1YHQ 3;  2Q07 A;  2CKF B;  3CNX A;  2CH9 A;  4RZM A;  3PCS A;  2W56 B;  1LOX A;  2E2V A;  3FG1 A;  4WYK A;  2HMM B;  4GB5 A;  4MMY B;  1JN5 A;  4KFD A;  2W6J H;  3F8H A;  1Q81 4;  4N6U A;  3M8C A;  1IVV A;  1KC8 4;  5AEU B;  2CFG A;  3KE7 A;  1IV7 A;  4N6T A;  4K1U A;  2OQE C;  1JV2 B;  3IMA B;  2P09 A;  2FXT A;  2JDI H;  4O02 B;  4O3V A;  4XBX A;  2ML6 A;  2QGU A;  3KFQ C;  4X2O A;  3MSO A;  5EEO A;  3X3X A;  3CC7 3;  1A67 A;  4HM8 B;  4IT7 A;  3K7C A;  1D6U A;  3SX1 A;  1VQ9 3;  4HM5 B;  3GAX A;  2ZDJ A;  1FGM A;  3SED A;  3NM2 A;  3CPW 2;  4HM1 B;  2F86 B;  1EKM A;  2XR8 B;  3MHE A;  1YIT 3;  3LTA A;  1RRH A;  4J8T A;  2XFS A;  3EBY A;  1IVU A;  2MF7 A;  2WGO A;  2XFT A;  1WMP A;  1Q86 4;  3B8L A;  4BTW A;  3CU3 A;  2D1W A;  1D6Y A;  2GEX A;  1N5P A;  1VQM 3;  1VQN 3;  1GD3 A;  3NV0 A;  3SVA A;  2V1L A;  2XGN A;  1VQO 3;  1BUQ A;  3F7S A;  3SOA A;  1OHS A;  2OQE A;  3LTC A;  2WOF A;  4CDL A;  4R9L A;  3DMC A;  5CK6 A;  3NBJ A;  1OAC A;  2Z6B A;  3G0K A;  1UUV B;  4QWT A;  4LSO A;  4J9A A;  2BT3 A;  5DRE A;  3GZR A;  1GY6 A;  1DMQ A;  3LTD A;  3OWS A;  3HX8 A;  4FMD A;  5HGR A;  1C7H A;  1JB5 A;  4ORL A;  3G16 A;  1VQL 3;  3V92 A;  1QAL A;  2HML B;  2CW9 A;  3S67 A;  2WOH A;  3HK4 A;  3GZY B;  3NM7 A;  1NU3 A;  1OGZ A;  4FCM A;  3X41 A;  3VF1 A;  4Q53 A;  3DGL A;  3Q1C A;  2GBX B;  3K9M C;  1IVX A;  1NWW A;  1YJW 3;  3NXJ A;  3X40 A;  1ROV A;  3WMD A;  4AKY A;  4WHA A;  4CCV A;  3KSP A;  3SOY A;  3EBT A;  3LT8 A;  5JPP A;  1YI2 3;  1Q82 4;  3PZW A;  2HMO B;  5CLK A;  2STD A;  5AEW B;  2INX A;  2WGQ A;  5AIG A;  4MEI A;  2OWP A;  1YGE A;  3CCV 3;  2IMJ A;  3EE1 A;  3RGA A;  1A2K A;  1VQ4 3;  3CCS 3;  3K63 A;  3U1W A;  2OOV C;  2CFL A;  4FMB A;  1AVK A;  2XEP A;  1SIH A;  4EXR A;  2RGQ A;  3E99 A;  1WQL B;  5IW9 A;  2YFJ B;  1W2B 2;  1RRL A;  2XSO B;  2CHC A;  2PNC A;  1KSI A;  3HII A;  2UX0 A;  3D3L A;  3RGR A;  1JJ2 2;  4KVH A;  4MMZ B;  5LC6 A;  4RNZ A;  1CEW I;  3FKA A;  1ISK A;  2I9W A;  4JRF A;  1WMN A;  1G96 A;  3JUQ A;  2XH9 A;  1K73 4;  2W9Q A;  3DM8 A;  1FA3 A;  1M1X B;  2W9P A;  3F14 A;  1N9E A;  2L4V A;  3AMO A;  1VQP 3;  3OWY A;  1EG9 B;  3V98 A;  4U13 A;  4STD A;  3CCR 3;  3I0Y A;  3BND A;  4XDW A;  2OOV A;  1O7H B;  1V74 A;  1VQ8 3;  3CNM A;  2XF3 A;  3MYT A;  2BMO B;  3G71 3;  2E2T A;  2W0Q A;  2Y74 A;  5AIF A;  2GXF A;  1K9M 4;  3LZA A;  1FGR A;  1K41 A;  3OWU A;  5IEP A;  1CYU A;  2W04 A;  2CFK A;  3FF2 A;  2IUK A;  3QK9 A;  2GU1 A;  3F9S A;  1W5Z A;  2CWT A;  1YIJ 3;  2WO0 A;  3MPH A;  2HMK B;  4GL6 A;  2KRT A;  3STD A;  3LT9 A;  1M1K 4;  2B1X B;  1ULJ B;  4L8O A;  4XBT A;  3IPT A;  4N6N B;  2MC8 A;  4HYZ A;  3G8Z A;  3GWR A;  3V99 A;  5KP3 A;  1ROA A;  2P0X A;  5STD A;  1HKX A;  1VQ5 3;  2CIU A;  3EJV A;  2CG1 A;  1IK3 A;  1DMM A;  4XB5 A;  3DGN A;  3B7C A;  3DXO A;  1NJI 4;  2FNQ A;  1QVG 2;  4AKZ A;  3EF8 A;  5FW5 A;  3S5C A;  4G1M B;  3MG2 A;  3HI7 A;  3CCM 3;  7STD A;  3RDE A;  2QA4 3;  1FGO A;  2OCT A;  3N9H A;  4LMI A;  3K0Z A;  3N8B A;  3U97 A;  3X3Y A;  1CYV A;  1O7P B;  3DUK A;  2R4I A;  1WNH A;  2ZL8 A;  2Z7A A;  1QJG A;  1F8N A;  2OTJ 3;  4EBG A;  2O3O A;  1GD4 A;  1Z1S A;  3DGO A;  1CQS A;  1OHO A;  3JUM A;  2W56 A;  1SPU A;  5CXO A;  1GS3 A;  1W02 A;  3ER7 A;  4BTY A;  1JNQ A;  1NO3 A;  2GBW B;  5JBS A;  3T8N A;  3GZX B;  1J2B A;  3WA3 A;  3WDG B;  1AVL A;  2RFR A;  2CWU A;  3UNL A;  1JKG B;  3H51 A;  3N54 B;  3K5T A;  2P0M A;  4FMA A;  2C10 A;  3G6E 3;  1IQ8 A;  5G2G A;  1STD A;  3L0R A;  4R9K A;  1UUW B;  3VGN A;  1VQK 3;  1KQS 2;  3PGB A;  1E97 A;  3FG3 A;  1KD1 4;  3GRD A;  1W6C A;  1IQX A;  1N9J A;  1IU7 A;  1UW1 A;  2XRX B;  1ZO2 A;  4WFO A;  3CC4 3;  5D81 A;  5IG3 A;  3I55 3;  2O9U X;  4NRE A;  1RKY A;  1Y4K A;  2GEY A;  1UI8 A;  1GY7 A;  4IIA A;  5IG0 A;  1U5O A;  3F8X A;  5CF2 A;  3EQQ B;  4N6V 0;  1YJ9 3;  1E3V A;  3S27 A;  3MG1 A;  4HBR A;  1IVW A;  3KSE D;  3TDG A;  2XSH B;  2YX9 A;  4KFF A;  1OF5 B;  1WMO A;  1Q42 A;  1O7W B;  1PU4 A;  3X3Z A;  4R1K A;  1N5H A;  3T8U A;  3HZP A;  3B4O A;  3MWZ A;  3LYG A;  2P05 A;  5ELU A;  3NBR A;  5IG4 A;  5KP4 A;  3JUN A;  1TUH A;  3IJE B;  3OW2 2;  2PZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...