5AYRB

The crystal structure of saugi/human udg complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
MTLELQLKHYITNLFNLPKDEKWECESIEEIADDILPDQYVRLGALSNKILQTYTYYSDTLHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-DNA glycosylase
publication title Using structural-based protein engineering to modulate the differential inhibition effects of SAUGI on human and HSV uracil DNA glycosylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 28
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ayrB00
2KCDA 3WDGB 5AYRB 5AYSC
chains in the Genus database with same CATH superfamily
1WMPA 3GZYB 1OHSA 4K1UA 1O7PB 1V58A 1VQ83 1GY5A 2BNGA 2UUGC 3FF0A 1RHLA 1YIJ3 2P0MA 1Q7HA 3NBJA 3K7CA 3K0ZA 4DKIA 2H0HA 3GAXA 1RNTA 1EG9B 3CNXA 3K9MC 7RNTA 4R80A 4L8OA 4OVMA 3G713 1BRHA 3NV0A 4MMYB 1BRNL 1JB5A 2P05A 2XFTA 1GY7A 5AIFA 3G6E3 5HGRA 1S5AA 1RGFA 3FG3A 3Q1CA 4BTWA 3CCV3 2CK3H 1N9JA 3LTDA 2OOVC 4EW5A 1B20A 3AGNA 3NUVA 4RNZA 1JBTA 2XH9A 1JJ22 2STDA 1QALA 4EC6A 1Q814 1LQGC 2W9QA 3E99A 1G0TA 1X1YA 1U8CB 4HAAA 4R9LA 2KF3A 4G1MB 1VQ73 1HZ1A 5HOHA 1UGIA 1UI8A 1S723 3B7CA 3G16A 3JUPA 4O2HA 2OOVA 1TU5A 2BU4A 4LSOA 1GY6A 2CWUA 3U97A 3UJMA 1MWRA 4R1KA 3FGYA 1OACA 4FCJA 2Z76A 4XM4A 1RN4A 4HM4B 4J8TA 4GL6A 3PGBA 1BIRA 3PCRA 4N6V0 2OQEA 1US1A 1EUIC 1JZDA 1OF5A 3KIIA 2IMJA 3SOYA 2XF3A 1UI7A 3KN4A 3G8ZA 4FMCA 4HOHA 5AEUB 3FLJA 3PYJA 1FGQA 4J5KA 4HJLB 1B2SA 3EQQB 3KE7A 3LMLA 2GU1A 4GHOA 2QA43 1W6CA 3WHOA 3PCSA 3K5TA 1GYBA 1R4YA 3DMCA 3CCR3 1FGMA 3JUOA 2Z7AA 1O7HB 5JPUA 4K1VA 2W04A 3D9RA 3SXXA 3EJVA 1I0VA 3AGOA 3NM2A 2HMJB 1GMRA 4ILFA 1UW1A 2ZA4A 3JUQA 1AR0A 3GZRA 2IUKA 3FCSB 1QVG2 1PYLA 3A5EA 2KCDA 1WNHA 3EF8A 1R4CA 1A2KA 1NB3I 2GXFA 3CCU3 1FGRA 1UUWB 2GBWB 2GSPA 2YFJB 3CU3A 4O3VA 3D5IA 3SVAA 4HZ9B 4LYLB 4WP5A 5STDA 1IT7A 3MSOA 4KFDA 3ZFZA 1N5HA 1QAFA 3F7XA 4X2HA 5BU4A 1X1WA 1C7HA 1JZOA 1I70A 4O8SA 4WWUC 4RZMA 3S29A 2YFIB 1LQMB 1DE3A 2CG1A 5KP4A 1N5PA 1MWSA 1W6YA 3SOAA 4JRFA 5LC7A 1ZX2A 1KC84 3KCHA 1O7WB 3KSPA 3JUMA 2JDIH 3MG1A 1ISKA 2AADA 3G0KA 6GSPA 1BNIA 2WO0A 3BIRA 2ZDJA 1RLSA 1SIIA 3DGLA 4XBXA 1RGAA 1OHPA 4EV2A 1NDOB 1DMNA 1BSEA 2F4YA 4HM0B 2C10A 1I2FA 1QAKA 5D81A 2D42A 4HM2B 4X2OA 1MOLA 3RDEA 1OGXA 3FKAA 2UX0A 4LEHA 1DMQA 1LVNA 5CLKA 3LT8A 2FXTA 3OXAA 1D6UA 1V57A 2Z6BA 4JF8A 3KFQC 2CC3A 3I553 2O3OA 1UCLA 3HZPA 5EEOA 5CXOA 1RKYA 1IQ8A 2BO9B 3SX1A 3DGNA 3CCE3 3LOYA 2OQEC 3S27A 5M19A 1Q824 3WOEB 2K3DA 1SPUA 2ZHXB 2HMMB 1A2VA 5A0OB 1IQYA 2HMNB 2IY2A 1U5OA 3STDA 2CG0A 1FUSA 1YVSA 3LZAA 1IV7A 3UB1A 2XEPA 1W7CA 2FGTA 4HVNA 1VQL3 2W56B 4N6NB 1BNEA 1STDA 5FW5A 3F8HA 4WYKA 2CFGA 1L5GB 3Q90A 3OWSA 1MWUA 1DVCA 8RNTA 3CD63 3EHCA 1Q9EA 2CW9A 3ER7A 3DGOA 2MC8A 1G96A 2I9WA 2B24B 2F99A 6RNTA 3UL6A 2R41A 4J5GA 5JPPA 1JB4A 3DY5A 1GOVA 1Z1SA 4O02B 4N3VA 3CPW2 1OUNA 1LOXA 4CPKA 2IUJA 2L1SA 1SQWA 4HZBB 3MYTA 1JBSA 4NPBA 1M9GA 5IEPA 1MNLA 1STFI 1NU3A 4FCZA 1YJN3 1GMQA 1E3VA 3K63A 1JKGA 2E2UA 3MPHA 4HM5B 3GZBA 3WA2X 3N8BA 2RFRA 2O9UX 3V99A 1RGHA 2BMOB 2F56A 5KP3A 2CFDA 1ZGXA 4XB5A 4WFOA 1FYSA 3MHEA 1Q40B 4KFFA 5KP1A 4STDA 3URPA 2Y73A 4KT3B 3WA3A 1CQSA 4N6LA 4FR9A 5CF2A 2W2CA 5AIHA 3GWRA 1BUJA 1QMAA 1BSBA 1RRLA 3F7SA 5G1KA 5AYSC 1JN5B 1B2UA 5BXQA 1LXEA 3NM7A 4BIRA 1VQ93 1GOYA 2C11A 5IF6A 5DRVA 1AQZA 2FNQA 2B1XB 3EBYA 3HI7A 2QEX3 1SARA 1I2EA 1BRKA 1Q7Y4 2GBXB 1BOXA 1LNIA 2CX0A 2XSOB 5CF1A 1I2GA 5AIGA 5IG5A 3CME3 1VQO3 1A67A 1I3IA 3AMOB 1RMSA 4IPBA 1UUGB 1KQS2 1HKXA 3DM8A 1TIJA 1UCJA 1HU9A 1DMMA 4Q53A 3IJEB 1GD3A 1AVLA 1Q42A 2P38A 3WMDA 3X3XA 4XDWA 2F98A 5DREA 3M8CA 3MKIA 3PS8A 4EXRA 4BU4A 3NBBA 4I4KA 3N9HA 1DETA 2F86B 1VQP3 4KVHA 3DZLA 3ZG5A 4WHAA 3QK9A 3MG3A 3MWZA 1B3SA 4XDVA 4I5QA 1BU4A 2W56A 3VSYA 1B27A 1VQ43 1BRGA 2HMLB 6STDA 2LYXA 3DGMA 1RCKA 3NBRA 2CH9A 3X3ZA 1T2HA 1KWIA 3BNEA 3D5GA 3ALAA 1YGEA 2Q07A 5FGOA 2SARA 3CC73 5AI1A 1RGCA 1E3RA 1B2ZA 3JVCA 3T8NA 1BNGA 3DXOA 2OTJ3 1RJOA 2CFKA 3BNDA 3LH4A 1JBRA 1IVXA 4AEQA 1YJ93 2CIUA 1DYUA 2Y74A 1EQKA 5LC6A 4AKZA 1BRJA 1NJI4 4NREA 8CHOA 3X42A 3NQZA 1NNVA 5BVBA 1PY3A 1VZZA 3G4S3 5D83A 4BL2A 1IT8A 2C4BA 2F5WA 1IVWA 2WOFA 1PU4A 1IQXA 1MWTA 3CPOA 3NHXA 4BL3A 1YVBI 1UUVB 1LRAA 1IVUA 4LMIA 1CYVA 4RNTA 1K9M4 1Q40A 3Q3FA 3FG4A 1WMOA 5IENA 3WOFB 3LYGA 4N6TA 1RRHA 2HOHA 1RGLA 4ZM8A 1ASKA 2BHMA 3Q2PA 1K28A 1WQLB 1ULIB 3CC23 1W6GA 2K0MA 3ZG0A 3VGNA 4KZ1A 3S28A 3EN1B 4MEIA 2KF5A 3SYUA 5IERA 4LZIA 3KKGA 2P0XA 4GB5A 1BNFA 1BRSA 1GSPA 2YX9A 4GSPA 5CK6A 5AIIA 5IG4A 4EBGA 4FCMA 2A15A 2BMQB 1FUWA 1K41A 3DUKA 4MJDA 2KRTA 3EX9A 3F40A 1AVKA 4XBTA 2UGIA 3BNCA 3FH1A 3OV4A 3O8YA 3UNLA 1O7NB 3IPTA 2W6JH 3ECFA 3NXJA 4IIAA 1K8A4 1FGTA 2RBIA 2RCDA 1F8NA 1T3BA 1X1XA 2K54A 4QWTA 1AY7A 2XR8B 3WR2A 3CCL3 1AV4A 1IU7A 4HKVB 2ML6A 1O7MB 1UGHI 3AMOA 1T2IA 1GD4A 4HM6B 2J8XB 5IG3A 3F9SA 1IDPA 1TFKA 3HIIA 2GU3A 3X41A 7GSPA 3HX8A 3B4PA 1RN7A 5EVHA 1IK3A 1BUQA 3LTAA 2CFWA 3GSPA 5AEWB 2OWPA 4K61A 2ZL8A 3EE1A 2H0IA 4N6MA 3LXUX 5IEOA 5I97A 1SJWA 3FF2A 1FA3A 2GEXA 3T0UA 3I0YA 1DVDA 1VQ63 5EQLA 3WDGB 1LOVA 3LTCA 2M7OA 3HOHA 2MF7A 1ZO2A 4RNYA 3J7Yd 3V98A 1TRQA 1LNHA 2HMKB 3V92A 1UCKA 4H61A 1NB5I 1W01A 1W2ZA 1FUTA 1BVIA 1FGOA 2SBLA 2INXA 4NHFA 3CCS3 1GOUA 2W9PA 3D3LA 4IT7A 5D82A 1OPYA 1T5YA 5TGNA 1BNSA 1BAOA 2WGOA 1LOYA 1RGGA 3AHSA 3B4OA 3F8XA 1N8R4 4HYZA 3FG1A 2CWTA 2QIYA 1VQK3 1B2MA 1RSNA 1TTOA 3HK4A 3EBTA 4R4KA 3T8UA 1W4NA 4H3UA 3VF1A 2WOHA 3EC9A 2W0QA 5G2GA 3DGYA 3TDGA 2KF6A 3IMAB 3KSED 4OUQA 1M904 4RBNA 3UL5A 7STDA 3D79A 3LT9A 1M1XB 3DH2A 3EB8A 1N8QA 1EA2A 1OH0A 1KSIA 2OCTA 3RGRA 1NWWA 1BGSA 2D1WA 1ULJB 2V1LA 1WMNA 3CC43 4L8PA 2W03A 5BIRA 1JNQA 1HYFA 1M1K4 2AAEA 4TX4A 3MG2A 2E2VA 4K90B 5IG0A 3I563 1I3FA 2F5MA 1BSCA 1RN1A 5G1LA 1W00A 1I8VA 2CHCA 1RTUA 4OK0A 2XSHB 4R9KA 2XGNA 1EKMA 2R4IA 3GZXB 4FMAA 1MGRA 1ZS7A 3GRDA 3CNMA 3CMA3 4ORLA 1BNJA 2BIRA 3CCQ3 5AYRB 1RCLA 2KXGA 1RGKA 1A90A 2HMOB 1QJGA 4MMXB 1IYYA 1EEJA 3JUNA 1BNRA 3EN8A 4WYKB 3S5CA 5M1AA 1YHQ3 5IW9A 1UCIA 4HM8B 2QGUA 1B21A 3FZWA 4EYCA 3F14A 3RNTA 3FSDA 2RSXA 4N6OB 1A2PA 1MGWA 4J9AA 3WODG 3NV0B 1QVF2 2OTL3 1W5ZA 2CFLA 4L7KA 4HM7B 1BSDA 1CH0A 2GEYA 1YJW3 1RNBA 1PFPA 1BANA 1G02A 4LGQA 4FMBA 3S67A 3H3HA 1RDSA 1JKGB 1ROAA 2L4VA 1YNVX 2BT3A 1JB2A 1IV9A 3A76A 3D4AA 1FZUA 1SIHA 1N9EA 4MMZB 3NQYA 1OGZA 1K734 1WTHA 3NX0A 4EV5A 5RNTA 4BTXA 1YIT3 1VQN3 4HM3B 3HIGA 1TUHA 4CDLA 1J2BA 1OHOA 4KFEA 5JBSA 2PZVA 1LOWA 3SEDA 1TFOA 1KD14 2Z77A 4PEJA 2H0GA 1JRQA 2RGQA 3QRDA 2XRXB 1D6ZA 2ML5A 5M18A 1V74A 1TRPA 3OX9A 2IA7A 2E2TA 1Y4KA 3B8LA 3H51A 1YGWA 2CWVA 3CCJ3 1CEWI 1JN5A 2WGQA 3X40A 1Q864 1VQQA 3SLUA 1RGEA 2PNCA 1GS3A 2KAAA 2XGLA 2YFLB 3RGAA 3X3YA 3OWYA 9RNTA 3OWUA 2RNTA 1OF5B 4BTYA 2KF4A 1E97A 1W02A 2JQ5A 3N54B 4CJNA 3BB9A 1YI23 3BU4A 1VQM3 2IYJA 1X1UA 3PXMA 3U1WA 3CXC2 2XFSA 2LQVA 4FMDA 5GSPA 3BNBA 2CX1A 1UDII 3PZWA 3OW22 1ROVA 4CCVA 1JV2B 3BLZA 1IVVA 1D6YA 3ROBA 4XBYA 1OCVA 1W2B2 4U13A 4AKYA 1I0XA 1C54A 2CKFB 1GMPA 1O7GB 1NO3A 3L0RA 2BMRB 5ELJA 1TJDA 3KZTA 3CCM3 3LTBA 3AHWA 4HBRA 1TP6A 5ELUA 1BSAA 1CYUA 4HM1B 4N6UA 1B2XA 1FW7A 1VQ53 2P09A 1BRIA
chains in the Genus database with same CATH topology
1WMPA 3GZYB 1OHSA 4K1UA 1O7PB 1VQ83 1GY5A 2BNGA 3FF0A 1YIJ3 2P0MA 3NBJA 3K7CA 3K0ZA 3GAXA 1EG9B 3CNXA 3K9MC 4R80A 4L8OA 4OVMA 3G713 3NV0A 4MMYB 1JB5A 2P05A 2XFTA 1GY7A 5AIFA 3G6E3 5HGRA 1S5AA 3FG3A 3Q1CA 4BTWA 3CCV3 2CK3H 1N9JA 3LTDA 2OOVC 3NUVA 4RNZA 2XH9A 1JJ22 2STDA 1QALA 4EC6A 1Q814 2W9QA 3E99A 1U8CB 4R9LA 4G1MB 1VQ73 1UI8A 1S723 3B7CA 3G16A 3JUPA 4O2HA 2OOVA 1TU5A 4LSOA 1GY6A 2CWUA 3U97A 3UJMA 4R1KA 3FGYA 1OACA 4FCJA 2Z76A 4XM4A 4HM4B 4J8TA 4GL6A 3PGBA 3PCRA 4N6V0 1US1A 1OF5A 3KIIA 3SOYA 2IMJA 2XF3A 1UI7A 3KN4A 3G8ZA 4FMCA 5AEUB 3FLJA 3PYJA 1FGQA 4HJLB 3EQQB 3KE7A 3LMLA 2GU1A 2QA43 1W6CA 3PCSA 3K5TA 1GYBA 3DMCA 3CCR3 1FGMA 3JUOA 2Z7AA 1O7HB 5JPUA 4K1VA 2W04A 3D9RA 3SXXA 3EJVA 3NM2A 2HMJB 1UW1A 3JUQA 1AR0A 3GZRA 2IUKA 3FCSB 1QVG2 2KCDA 1WNHA 3EF8A 1R4CA 1A2KA 1NB3I 2GXFA 3CCU3 1FGRA 1UUWB 2GBWB 3CU3A 2YFJB 4O3VA 3SVAA 4HZ9B 5STDA 4WP5A 1IT7A 3MSOA 4KFDA 1N5HA 1QAFA 3F7XA 4X2HA 1C7HA 4O8SA 4WWUC 4RZMA 3S29A 2YFIB 2CG1A 5KP4A 1N5PA 1W6YA 3SOAA 4JRFA 5LC7A 1ZX2A 1KC84 3KSPA 1O7WB 3JUMA 2JDIH 3MG1A 1ISKA 3G0KA 2WO0A 3DGLA 2ZDJA 4XBXA 1SIIA 1OHPA 4EV2A 1NDOB 1DMNA 4HM0B 2C10A 5D81A 1QAKA 2D42A 4HM2B 4X2OA 1MOLA 3RDEA 1OGXA 3FKAA 2UX0A 4LEHA 1DMQA 1LVNA 5CLKA 3LT8A 2FXTA 3OXAA 1D6UA 2Z6BA 4JF8A 3KFQC 2CC3A 3I553 2O3OA 3HZPA 5EEOA 5CXOA 1RKYA 1IQ8A 2BO9B 3SX1A 3DGNA 3CCE3 3LOYA 2OQEC 3S27A 1Q824 3WOEB 1SPUA 2HMMB 1A2VA 5A0OB 1IQYA 2HMNB 3STDA 1U5OA 2CG0A 3LZAA 1IV7A 3UB1A 2XEPA 1W7CA 2FGTA 4HVNA 1VQL3 2W56B 4N6NB 1STDA 5FW5A 3F8HA 4WYKA 2CFGA 1L5GB 3Q90A 3OWSA 1DVCA 3CD63 3EHCA 2CW9A 3ER7A 3DGOA 2MC8A 1G96A 2I9WA 2B24B 2F99A 3UL6A 5JPPA 1JB4A 3DY5A 1Z1SA 4O02B 3CPW2 4N3VA 1OUNA 1LOXA 2IUJA 1SQWA 4HZBB 3MYTA 1M9GA 5IEPA 1MNLA 1STFI 1NU3A 4FCZA 1YJN3 3K63A 1E3VA 3WA2X 1JKGA 2E2UA 3MPHA 4HM5B 3GZBA 3N8BA 2RFRA 2O9UX 3V99A 2BMOB 5KP3A 2CFDA 4XB5A 4WFOA 3MHEA 1Q40B 4KFFA 5KP1A 4STDA 2Y73A 3WA3A 1CQSA 4N6LA 4FR9A 5CF2A 2W2CA 5AIHA 3GWRA 1QMAA 1RRLA 3F7SA 5AYSC 1JN5B 5BXQA 1LXEA 3NM7A 1VQ93 2C11A 5IF6A 5DRVA 2FNQA 2B1XB 3EBYA 3HI7A 2QEX3 1Q7Y4 2GBXB 2XSOB 5CF1A 5AIGA 5IG5A 3CME3 1VQO3 1A67A 3AMOB 4IPBA 1KQS2 1HKXA 3DM8A 1TIJA 1HU9A 1DMMA 4Q53A 3IJEB 1GD3A 1AVLA 1Q42A 2P38A 3WMDA 3X3XA 4XDWA 2F98A 5DREA 3M8CA 3MKIA 3PS8A 4EXRA 3NBBA 4I4KA 3N9HA 2F86B 1VQP3 4KVHA 3DZLA 4WHAA 3QK9A 3MG3A 3MWZA 4XDVA 2W56A 3VSYA 1VQ43 2HMLB 6STDA 2LYXA 3DGMA 3NBRA 2CH9A 3X3ZA 3BNEA 1KWIA 3ALAA 1YGEA 2Q07A 5FGOA 3CC73 5AI1A 1E3RA 3JVCA 3T8NA 3DXOA 2OTJ3 1RJOA 2CFKA 3BNDA 3LH4A 1IVXA 4AEQA 1YJ93 2CIUA 1DYUA 2Y74A 1EQKA 5LC6A 4AKZA 1NJI4 4NREA 8CHOA 3X42A 3NQZA 5BVBA 1VZZA 3G4S3 5D83A 1IT8A 1PU4A 1IVWA 2WOFA 1IQXA 3CPOA 3NHXA 1YVBI 1UUVB 1IVUA 4LMIA 1CYVA 1K9M4 1Q40A 5IENA 3FG4A 1WMOA 3WOFB 3LYGA 4N6TA 1RRHA 4ZM8A 3CC23 1ASKA 2BHMA 3Q2PA 1K28A 1WQLB 1ULIB 1W6GA 2K0MA 3VGNA 4KZ1A 3S28A 3EN1B 4MEIA 5IERA 4LZIA 3KKGA 2P0XA 4GB5A 5AIIA 2YX9A 5IG4A 5CK6A 4EBGA 4FCMA 2A15A 2BMQB 1FUWA 1K41A 3DUKA 4MJDA 2KRTA 3EX9A 3F40A 1AVKA 4XBTA 3BNCA 3FH1A 3OV4A 3O8YA 3UNLA 1O7NB 3IPTA 2W6JH 3ECFA 3NXJA 4IIAA 1K8A4 1FGTA 2RCDA 1F8NA 4QWTA 2K54A 2XR8B 3CCL3 1AV4A 1IU7A 4HKVB 2ML6A 1O7MB 3AMOA 1GD4A 4HM6B 5IG3A 3F9SA 1IDPA 1TFKA 3HIIA 2GU3A 3X41A 3HX8A 3B4PA 1RN7A 5EVHA 1IK3A 1BUQA 3LTAA 2CFWA 5AEWB 2OWPA 4K61A 2ZL8A 3EE1A 4N6MA 3LXUX 5IEOA 5I97A 1SJWA 3FF2A 1FA3A 2GEXA 3T0UA 3I0YA 1DVDA 1VQ63 5EQLA 3WDGB 3LTCA 2M7OA 2MF7A 1ZO2A 4RNYA 3J7Yd 3V98A 2HMKB 1LNHA 3V92A 4H61A 1NB5I 1W01A 1W2ZA 1FGOA 2SBLA 2INXA 4NHFA 3CCS3 2W9PA 3D3LA 4IT7A 5D82A 1OPYA 1T5YA 5TGNA 2WGOA 3B4OA 3F8XA 1N8R4 4HYZA 3FG1A 2CWTA 2QIYA 1VQK3 3HK4A 3EBTA 4R4KA 3T8UA 1W4NA 4H3UA 3VF1A 2WOHA 3EC9A 2W0QA 5G2GA 3TDGA 3KSED 3IMAB 4OUQA 1M904 4RBNA 3UL5A 7STDA 3LT9A 1M1XB 3EB8A 1N8QA 1EA2A 1OH0A 1KSIA 2OCTA 3RGRA 1NWWA 2D1WA 1ULJB 2V1LA 1WMNA 3CC43 4L8PA 2W03A 1JNQA 1M1K4 4TX4A 3MG2A 2E2VA 4K90B 5IG0A 3I563 1W00A 2CHCA 4OK0A 2XSHB 4R9KA 2XGNA 1EKMA 2R4IA 3GZXB 4FMAA 3GRDA 3CMA3 3CNMA 4ORLA 3CCQ3 5AYRB 2KXGA 1A90A 2HMOB 1QJGA 4MMXB 3JUNA 3EN8A 4WYKB 3S5CA 1YHQ3 5IW9A 4HM8B 2QGUA 3FZWA 4EYCA 3F14A 3FSDA 2RSXA 4N6OB 4J9AA 3WODG 3NV0B 1QVF2 2OTL3 1W5ZA 2CFLA 4L7KA 4HM7B 2GEYA 1YJW3 1PFPA 4LGQA 3S67A 4FMBA 3H3HA 3A76A 1JKGB 1ROAA 2L4VA 2BT3A 1JB2A 1IV9A 1SIHA 1N9EA 4MMZB 3NQYA 1OGZA 1K734 1WTHA 3NX0A 4EV5A 4BTXA 1YIT3 1VQN3 4HM3B 3HIGA 1TUHA 4CDLA 1J2BA 1OHOA 4KFEA 5JBSA 2PZVA 3SEDA 1KD14 1TFOA 2Z77A 4PEJA 1JRQA 2RGQA 3QRDA 2XRXB 1D6ZA 2ML5A 1V74A 3OX9A 2IA7A 2E2TA 1Y4KA 3B8LA 3H51A 3CCJ3 2CWVA 1CEWI 1JN5A 2WGQA 3X40A 1Q864 3SLUA 2PNCA 1GS3A 3X3YA 2XGLA 2YFLB 3RGAA 3OWYA 3OWUA 1OF5B 4BTYA 1E97A 1W02A 2JQ5A 3N54B 3BB9A 1YI23 1VQM3 3PXMA 3U1WA 3CXC2 2XFSA 2LQVA 4FMDA 3BNBA 3PZWA 3OW22 1ROVA 4CCVA 1JV2B 3BLZA 1IVVA 1D6YA 3ROBA 4XBYA 1OCVA 1W2B2 4U13A 4AKYA 2CKFB 1O7GB 1NO3A 3L0RA 2BMRB 5ELJA 3KZTA 3CCM3 3LTBA 4HBRA 1TP6A 5ELUA 1CYUA 4HM1B 4N6UA 2OQEA 1VQ53 2P09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCD A;  3WDG B;  5AYR B;  5AYS C; 
#chains in the Genus database with same CATH topology
 1WMP A;  3GZY B;  1OHS A;  4K1U A;  1O7P B;  1V58 A;  1VQ8 3;  1GY5 A;  2BNG A;  2UUG C;  3FF0 A;  1RHL A;  1YIJ 3;  2P0M A;  1Q7H A;  3NBJ A;  3K7C A;  3K0Z A;  4DKI A;  2H0H A;  3GAX A;  1RNT A;  1EG9 B;  3CNX A;  3K9M C;  7RNT A;  4R80 A;  4L8O A;  4OVM A;  3G71 3;  1BRH A;  3NV0 A;  4MMY B;  1BRN L;  1JB5 A;  2P05 A;  2XFT A;  1GY7 A;  5AIF A;  3G6E 3;  5HGR A;  1S5A A;  1RGF A;  3FG3 A;  3Q1C A;  4BTW A;  3CCV 3;  2CK3 H;  1N9J A;  3LTD A;  2OOV C;  4EW5 A;  1B20 A;  3AGN A;  3NUV A;  4RNZ A;  1JBT A;  2XH9 A;  1JJ2 2;  2STD A;  1QAL A;  4EC6 A;  1Q81 4;  1LQG C;  2W9Q A;  3E99 A;  1G0T A;  1X1Y A;  1U8C B;  4HAA A;  4R9L A;  2KF3 A;  4G1M B;  1VQ7 3;  1HZ1 A;  5HOH A;  1UGI A;  1UI8 A;  1S72 3;  3B7C A;  3G16 A;  3JUP A;  4O2H A;  2OOV A;  1TU5 A;  2BU4 A;  4LSO A;  1GY6 A;  2CWU A;  3U97 A;  3UJM A;  1MWR A;  4R1K A;  3FGY A;  1OAC A;  4FCJ A;  2Z76 A;  4XM4 A;  1RN4 A;  4HM4 B;  4J8T A;  4GL6 A;  3PGB A;  1BIR A;  3PCR A;  4N6V 0;  2OQE A;  1US1 A;  1EUI C;  1JZD A;  1OF5 A;  3KII A;  2IMJ A;  3SOY A;  2XF3 A;  1UI7 A;  3KN4 A;  3G8Z A;  4FMC A;  4HOH A;  5AEU B;  3FLJ A;  3PYJ A;  1FGQ A;  4J5K A;  4HJL B;  1B2S A;  3EQQ B;  3KE7 A;  3LML A;  2GU1 A;  4GHO A;  2QA4 3;  1W6C A;  3WHO A;  3PCS A;  3K5T A;  1GYB A;  1R4Y A;  3DMC A;  3CCR 3;  1FGM A;  3JUO A;  2Z7A A;  1O7H B;  5JPU A;  4K1V A;  2W04 A;  3D9R A;  3SXX A;  3EJV A;  1I0V A;  3AGO A;  3NM2 A;  2HMJ B;  1GMR A;  4ILF A;  1UW1 A;  2ZA4 A;  3JUQ A;  1AR0 A;  3GZR A;  2IUK A;  3FCS B;  1QVG 2;  1PYL A;  3A5E A;  2KCD A;  1WNH A;  3EF8 A;  1R4C A;  1A2K A;  1NB3 I;  2GXF A;  3CCU 3;  1FGR A;  1UUW B;  2GBW B;  2GSP A;  2YFJ B;  3CU3 A;  4O3V A;  3D5I A;  3SVA A;  4HZ9 B;  4LYL B;  4WP5 A;  5STD A;  1IT7 A;  3MSO A;  4KFD A;  3ZFZ A;  1N5H A;  1QAF A;  3F7X A;  4X2H A;  5BU4 A;  1X1W A;  1C7H A;  1JZO A;  1I70 A;  4O8S A;  4WWU C;  4RZM A;  3S29 A;  2YFI B;  1LQM B;  1DE3 A;  2CG1 A;  5KP4 A;  1N5P A;  1MWS A;  1W6Y A;  3SOA A;  4JRF A;  5LC7 A;  1ZX2 A;  1KC8 4;  3KCH A;  1O7W B;  3KSP A;  3JUM A;  2JDI H;  3MG1 A;  1ISK A;  2AAD A;  3G0K A;  6GSP A;  1BNI A;  2WO0 A;  3BIR A;  2ZDJ A;  1RLS A;  1SII A;  3DGL A;  4XBX A;  1RGA A;  1OHP A;  4EV2 A;  1NDO B;  1DMN A;  1BSE A;  2F4Y A;  4HM0 B;  2C10 A;  1I2F A;  1QAK A;  5D81 A;  2D42 A;  4HM2 B;  4X2O A;  1MOL A;  3RDE A;  1OGX A;  3FKA A;  2UX0 A;  4LEH A;  1DMQ A;  1LVN A;  5CLK A;  3LT8 A;  2FXT A;  3OXA A;  1D6U A;  1V57 A;  2Z6B A;  4JF8 A;  3KFQ C;  2CC3 A;  3I55 3;  2O3O A;  1UCL A;  3HZP A;  5EEO A;  5CXO A;  1RKY A;  1IQ8 A;  2BO9 B;  3SX1 A;  3DGN A;  3CCE 3;  3LOY A;  2OQE C;  3S27 A;  5M19 A;  1Q82 4;  3WOE B;  2K3D A;  1SPU A;  2ZHX B;  2HMM B;  1A2V A;  5A0O B;  1IQY A;  2HMN B;  2IY2 A;  1U5O A;  3STD A;  2CG0 A;  1FUS A;  1YVS A;  3LZA A;  1IV7 A;  3UB1 A;  2XEP A;  1W7C A;  2FGT A;  4HVN A;  1VQL 3;  2W56 B;  4N6N B;  1BNE A;  1STD A;  5FW5 A;  3F8H A;  4WYK A;  2CFG A;  1L5G B;  3Q90 A;  3OWS A;  1MWU A;  1DVC A;  8RNT A;  3CD6 3;  3EHC A;  1Q9E A;  2CW9 A;  3ER7 A;  3DGO A;  2MC8 A;  1G96 A;  2I9W A;  2B24 B;  2F99 A;  6RNT A;  3UL6 A;  2R41 A;  4J5G A;  5JPP A;  1JB4 A;  3DY5 A;  1GOV A;  1Z1S A;  4O02 B;  4N3V A;  3CPW 2;  1OUN A;  1LOX A;  4CPK A;  2IUJ A;  2L1S A;  1SQW A;  4HZB B;  3MYT A;  1JBS A;  4NPB A;  1M9G A;  5IEP A;  1MNL A;  1STF I;  1NU3 A;  4FCZ A;  1YJN 3;  1GMQ A;  1E3V A;  3K63 A;  1JKG A;  2E2U A;  3MPH A;  4HM5 B;  3GZB A;  3WA2 X;  3N8B A;  2RFR A;  2O9U X;  3V99 A;  1RGH A;  2BMO B;  2F56 A;  5KP3 A;  2CFD A;  1ZGX A;  4XB5 A;  4WFO A;  1FYS A;  3MHE A;  1Q40 B;  4KFF A;  5KP1 A;  4STD A;  3URP A;  2Y73 A;  4KT3 B;  3WA3 A;  1CQS A;  4N6L A;  4FR9 A;  5CF2 A;  2W2C A;  5AIH A;  3GWR A;  1BUJ A;  1QMA A;  1BSB A;  1RRL A;  3F7S A;  5G1K A;  5AYS C;  1JN5 B;  1B2U A;  5BXQ A;  1LXE A;  3NM7 A;  4BIR A;  1VQ9 3;  1GOY A;  2C11 A;  5IF6 A;  5DRV A;  1AQZ A;  2FNQ A;  2B1X B;  3EBY A;  3HI7 A;  2QEX 3;  1SAR A;  1I2E A;  1BRK A;  1Q7Y 4;  2GBX B;  1BOX A;  1LNI A;  2CX0 A;  2XSO B;  5CF1 A;  1I2G A;  5AIG A;  5IG5 A;  3CME 3;  1VQO 3;  1A67 A;  1I3I A;  3AMO B;  1RMS A;  4IPB A;  1UUG B;  1KQS 2;  1HKX A;  3DM8 A;  1TIJ A;  1UCJ A;  1HU9 A;  1DMM A;  4Q53 A;  3IJE B;  1GD3 A;  1AVL A;  1Q42 A;  2P38 A;  3WMD A;  3X3X A;  4XDW A;  2F98 A;  5DRE A;  3M8C A;  3MKI A;  3PS8 A;  4EXR A;  4BU4 A;  3NBB A;  4I4K A;  3N9H A;  1DET A;  2F86 B;  1VQP 3;  4KVH A;  3DZL A;  3ZG5 A;  4WHA A;  3QK9 A;  3MG3 A;  3MWZ A;  1B3S A;  4XDV A;  4I5Q A;  1BU4 A;  2W56 A;  3VSY A;  1B27 A;  1VQ4 3;  1BRG A;  2HML B;  6STD A;  2LYX A;  3DGM A;  1RCK A;  3NBR A;  2CH9 A;  3X3Z A;  1T2H A;  1KWI A;  3BNE A;  3D5G A;  3ALA A;  1YGE A;  2Q07 A;  5FGO A;  2SAR A;  3CC7 3;  5AI1 A;  1RGC A;  1E3R A;  1B2Z A;  3JVC A;  3T8N A;  1BNG A;  3DXO A;  2OTJ 3;  1RJO A;  2CFK A;  3BND A;  3LH4 A;  1JBR A;  1IVX A;  4AEQ A;  1YJ9 3;  2CIU A;  1DYU A;  2Y74 A;  1EQK A;  5LC6 A;  4AKZ A;  1BRJ A;  1NJI 4;  4NRE A;  8CHO A;  3X42 A;  3NQZ A;  1NNV A;  5BVB A;  1PY3 A;  1VZZ A;  3G4S 3;  5D83 A;  4BL2 A;  1IT8 A;  2C4B A;  2F5W A;  1IVW A;  2WOF A;  1PU4 A;  1IQX A;  1MWT A;  3CPO A;  3NHX A;  4BL3 A;  1YVB I;  1UUV B;  1LRA A;  1IVU A;  4LMI A;  1CYV A;  4RNT A;  1K9M 4;  1Q40 A;  3Q3F A;  3FG4 A;  1WMO A;  5IEN A;  3WOF B;  3LYG A;  4N6T A;  1RRH A;  2HOH A;  1RGL A;  4ZM8 A;  1ASK A;  2BHM A;  3Q2P A;  1K28 A;  1WQL B;  1ULI B;  3CC2 3;  1W6G A;  2K0M A;  3ZG0 A;  3VGN A;  4KZ1 A;  3S28 A;  3EN1 B;  4MEI A;  2KF5 A;  3SYU A;  5IER A;  4LZI A;  3KKG A;  2P0X A;  4GB5 A;  1BNF A;  1BRS A;  1GSP A;  2YX9 A;  4GSP A;  5CK6 A;  5AII A;  5IG4 A;  4EBG A;  4FCM A;  2A15 A;  2BMQ B;  1FUW A;  1K41 A;  3DUK A;  4MJD A;  2KRT A;  3EX9 A;  3F40 A;  1AVK A;  4XBT A;  2UGI A;  3BNC A;  3FH1 A;  3OV4 A;  3O8Y A;  3UNL A;  1O7N B;  3IPT A;  2W6J H;  3ECF A;  3NXJ A;  4IIA A;  1K8A 4;  1FGT A;  2RBI A;  2RCD A;  1F8N A;  1T3B A;  1X1X A;  2K54 A;  4QWT A;  1AY7 A;  2XR8 B;  3WR2 A;  3CCL 3;  1AV4 A;  1IU7 A;  4HKV B;  2ML6 A;  1O7M B;  1UGH I;  3AMO A;  1T2I A;  1GD4 A;  4HM6 B;  2J8X B;  5IG3 A;  3F9S A;  1IDP A;  1TFK A;  3HII A;  2GU3 A;  3X41 A;  7GSP A;  3HX8 A;  3B4P A;  1RN7 A;  5EVH A;  1IK3 A;  1BUQ A;  3LTA A;  2CFW A;  3GSP A;  5AEW B;  2OWP A;  4K61 A;  2ZL8 A;  3EE1 A;  2H0I A;  4N6M A;  3LXU X;  5IEO A;  5I97 A;  1SJW A;  3FF2 A;  1FA3 A;  2GEX A;  3T0U A;  3I0Y A;  1DVD A;  1VQ6 3;  5EQL A;  3WDG B;  1LOV A;  3LTC A;  2M7O A;  3HOH A;  2MF7 A;  1ZO2 A;  4RNY A;  3J7Y d;  3V98 A;  1TRQ A;  1LNH A;  2HMK B;  3V92 A;  1UCK A;  4H61 A;  1NB5 I;  1W01 A;  1W2Z A;  1FUT A;  1BVI A;  1FGO A;  2SBL A;  2INX A;  4NHF A;  3CCS 3;  1GOU A;  2W9P A;  3D3L A;  4IT7 A;  5D82 A;  1OPY A;  1T5Y A;  5TGN A;  1BNS A;  1BAO A;  2WGO A;  1LOY A;  1RGG A;  3AHS A;  3B4O A;  3F8X A;  1N8R 4;  4HYZ A;  3FG1 A;  2CWT A;  2QIY A;  1VQK 3;  1B2M A;  1RSN A;  1TTO A;  3HK4 A;  3EBT A;  4R4K A;  3T8U A;  1W4N A;  4H3U A;  3VF1 A;  2WOH A;  3EC9 A;  2W0Q A;  5G2G A;  3DGY A;  3TDG A;  2KF6 A;  3IMA B;  3KSE D;  4OUQ A;  1M90 4;  4RBN A;  3UL5 A;  7STD A;  3D79 A;  3LT9 A;  1M1X B;  3DH2 A;  3EB8 A;  1N8Q A;  1EA2 A;  1OH0 A;  1KSI A;  2OCT A;  3RGR A;  1NWW A;  1BGS A;  2D1W A;  1ULJ B;  2V1L A;  1WMN A;  3CC4 3;  4L8P A;  2W03 A;  5BIR A;  1JNQ A;  1HYF A;  1M1K 4;  2AAE A;  4TX4 A;  3MG2 A;  2E2V A;  4K90 B;  5IG0 A;  3I56 3;  1I3F A;  2F5M A;  1BSC A;  1RN1 A;  5G1L A;  1W00 A;  1I8V A;  2CHC A;  1RTU A;  4OK0 A;  2XSH B;  4R9K A;  2XGN A;  1EKM A;  2R4I A;  3GZX B;  4FMA A;  1MGR A;  1ZS7 A;  3GRD A;  3CNM A;  3CMA 3;  4ORL A;  1BNJ A;  2BIR A;  3CCQ 3;  5AYR B;  1RCL A;  2KXG A;  1RGK A;  1A90 A;  2HMO B;  1QJG A;  4MMX B;  1IYY A;  1EEJ A;  3JUN A;  1BNR A;  3EN8 A;  4WYK B;  3S5C A;  5M1A A;  1YHQ 3;  5IW9 A;  1UCI A;  4HM8 B;  2QGU A;  1B21 A;  3FZW A;  4EYC A;  3F14 A;  3RNT A;  3FSD A;  2RSX A;  4N6O B;  1A2P A;  1MGW A;  4J9A A;  3WOD G;  3NV0 B;  1QVF 2;  2OTL 3;  1W5Z A;  2CFL A;  4L7K A;  4HM7 B;  1BSD A;  1CH0 A;  2GEY A;  1YJW 3;  1RNB A;  1PFP A;  1BAN A;  1G02 A;  4LGQ A;  4FMB A;  3S67 A;  3H3H A;  1RDS A;  1JKG B;  1ROA A;  2L4V A;  1YNV X;  2BT3 A;  1JB2 A;  1IV9 A;  3A76 A;  3D4A A;  1FZU A;  1SIH A;  1N9E A;  4MMZ B;  3NQY A;  1OGZ A;  1K73 4;  1WTH A;  3NX0 A;  4EV5 A;  5RNT A;  4BTX A;  1YIT 3;  1VQN 3;  4HM3 B;  3HIG A;  1TUH A;  4CDL A;  1J2B A;  1OHO A;  4KFE A;  5JBS A;  2PZV A;  1LOW A;  3SED A;  1TFO A;  1KD1 4;  2Z77 A;  4PEJ A;  2H0G A;  1JRQ A;  2RGQ A;  3QRD A;  2XRX B;  1D6Z A;  2ML5 A;  5M18 A;  1V74 A;  1TRP A;  3OX9 A;  2IA7 A;  2E2T A;  1Y4K A;  3B8L A;  3H51 A;  1YGW A;  2CWV A;  3CCJ 3;  1CEW I;  1JN5 A;  2WGQ A;  3X40 A;  1Q86 4;  1VQQ A;  3SLU A;  1RGE A;  2PNC A;  1GS3 A;  2KAA A;  2XGL A;  2YFL B;  3RGA A;  3X3Y A;  3OWY A;  9RNT A;  3OWU A;  2RNT A;  1OF5 B;  4BTY A;  2KF4 A;  1E97 A;  1W02 A;  2JQ5 A;  3N54 B;  4CJN A;  3BB9 A;  1YI2 3;  3BU4 A;  1VQM 3;  2IYJ A;  1X1U A;  3PXM A;  3U1W A;  3CXC 2;  2XFS A;  2LQV A;  4FMD A;  5GSP A;  3BNB A;  2CX1 A;  1UDI I;  3PZW A;  3OW2 2;  1ROV A;  4CCV A;  1JV2 B;  3BLZ A;  1IVV A;  1D6Y A;  3ROB A;  4XBY A;  1OCV A;  1W2B 2;  4U13 A;  4AKY A;  1I0X A;  1C54 A;  2CKF B;  1GMP A;  1O7G B;  1NO3 A;  3L0R A;  2BMR B;  5ELJ A;  1TJD A;  3KZT A;  3CCM 3;  3LTB A;  3AHW A;  4HBR A;  1TP6 A;  5ELU A;  1BSA A;  1CYU A;  4HM1 B;  4N6U A;  1B2X A;  1FW7 A;  1VQ5 3;  2P09 A;  1BRI A; 
#chains in the Genus database with same CATH homology
 1WMP A;  3GZY B;  1OHS A;  4K1U A;  1O7P B;  1VQ8 3;  1GY5 A;  2BNG A;  3FF0 A;  1YIJ 3;  2P0M A;  3NBJ A;  3K7C A;  3K0Z A;  3GAX A;  1EG9 B;  3CNX A;  3K9M C;  4R80 A;  4L8O A;  4OVM A;  3G71 3;  3NV0 A;  4MMY B;  1JB5 A;  2P05 A;  2XFT A;  1GY7 A;  5AIF A;  3G6E 3;  5HGR A;  1S5A A;  3FG3 A;  3Q1C A;  4BTW A;  3CCV 3;  2CK3 H;  1N9J A;  3LTD A;  2OOV C;  3NUV A;  4RNZ A;  2XH9 A;  1JJ2 2;  2STD A;  1QAL A;  4EC6 A;  1Q81 4;  2W9Q A;  3E99 A;  1U8C B;  4R9L A;  4G1M B;  1VQ7 3;  1UI8 A;  1S72 3;  3B7C A;  3G16 A;  3JUP A;  4O2H A;  2OOV A;  1TU5 A;  4LSO A;  1GY6 A;  2CWU A;  3U97 A;  3UJM A;  4R1K A;  3FGY A;  1OAC A;  4FCJ A;  2Z76 A;  4XM4 A;  4HM4 B;  4J8T A;  4GL6 A;  3PGB A;  3PCR A;  4N6V 0;  1US1 A;  1OF5 A;  3KII A;  3SOY A;  2IMJ A;  2XF3 A;  1UI7 A;  3KN4 A;  3G8Z A;  4FMC A;  5AEU B;  3FLJ A;  3PYJ A;  1FGQ A;  4HJL B;  3EQQ B;  3KE7 A;  3LML A;  2GU1 A;  2QA4 3;  1W6C A;  3PCS A;  3K5T A;  1GYB A;  3DMC A;  3CCR 3;  1FGM A;  3JUO A;  2Z7A A;  1O7H B;  5JPU A;  4K1V A;  2W04 A;  3D9R A;  3SXX A;  3EJV A;  3NM2 A;  2HMJ B;  1UW1 A;  3JUQ A;  1AR0 A;  3GZR A;  2IUK A;  3FCS B;  1QVG 2;  2KCD A;  1WNH A;  3EF8 A;  1R4C A;  1A2K A;  1NB3 I;  2GXF A;  3CCU 3;  1FGR A;  1UUW B;  2GBW B;  3CU3 A;  2YFJ B;  4O3V A;  3SVA A;  4HZ9 B;  5STD A;  4WP5 A;  1IT7 A;  3MSO A;  4KFD A;  1N5H A;  1QAF A;  3F7X A;  4X2H A;  1C7H A;  4O8S A;  4WWU C;  4RZM A;  3S29 A;  2YFI B;  2CG1 A;  5KP4 A;  1N5P A;  1W6Y A;  3SOA A;  4JRF A;  5LC7 A;  1ZX2 A;  1KC8 4;  3KSP A;  1O7W B;  3JUM A;  2JDI H;  3MG1 A;  1ISK A;  3G0K A;  2WO0 A;  3DGL A;  2ZDJ A;  4XBX A;  1SII A;  1OHP A;  4EV2 A;  1NDO B;  1DMN A;  4HM0 B;  2C10 A;  5D81 A;  1QAK A;  2D42 A;  4HM2 B;  4X2O A;  1MOL A;  3RDE A;  1OGX A;  3FKA A;  2UX0 A;  4LEH A;  1DMQ A;  1LVN A;  5CLK A;  3LT8 A;  2FXT A;  3OXA A;  1D6U A;  2Z6B A;  4JF8 A;  3KFQ C;  2CC3 A;  3I55 3;  2O3O A;  3HZP A;  5EEO A;  5CXO A;  1RKY A;  1IQ8 A;  2BO9 B;  3SX1 A;  3DGN A;  3CCE 3;  3LOY A;  2OQE C;  3S27 A;  1Q82 4;  3WOE B;  1SPU A;  2HMM B;  1A2V A;  5A0O B;  1IQY A;  2HMN B;  3STD A;  1U5O A;  2CG0 A;  3LZA A;  1IV7 A;  3UB1 A;  2XEP A;  1W7C A;  2FGT A;  4HVN A;  1VQL 3;  2W56 B;  4N6N B;  1STD A;  5FW5 A;  3F8H A;  4WYK A;  2CFG A;  1L5G B;  3Q90 A;  3OWS A;  1DVC A;  3CD6 3;  3EHC A;  2CW9 A;  3ER7 A;  3DGO A;  2MC8 A;  1G96 A;  2I9W A;  2B24 B;  2F99 A;  3UL6 A;  5JPP A;  1JB4 A;  3DY5 A;  1Z1S A;  4O02 B;  3CPW 2;  4N3V A;  1OUN A;  1LOX A;  2IUJ A;  1SQW A;  4HZB B;  3MYT A;  1M9G A;  5IEP A;  1MNL A;  1STF I;  1NU3 A;  4FCZ A;  1YJN 3;  3K63 A;  1E3V A;  3WA2 X;  1JKG A;  2E2U A;  3MPH A;  4HM5 B;  3GZB A;  3N8B A;  2RFR A;  2O9U X;  3V99 A;  2BMO B;  5KP3 A;  2CFD A;  4XB5 A;  4WFO A;  3MHE A;  1Q40 B;  4KFF A;  5KP1 A;  4STD A;  2Y73 A;  3WA3 A;  1CQS A;  4N6L A;  4FR9 A;  5CF2 A;  2W2C A;  5AIH A;  3GWR A;  1QMA A;  1RRL A;  3F7S A;  5AYS C;  1JN5 B;  5BXQ A;  1LXE A;  3NM7 A;  1VQ9 3;  2C11 A;  5IF6 A;  5DRV A;  2FNQ A;  2B1X B;  3EBY A;  3HI7 A;  2QEX 3;  1Q7Y 4;  2GBX B;  2XSO B;  5CF1 A;  5AIG A;  5IG5 A;  3CME 3;  1VQO 3;  1A67 A;  3AMO B;  4IPB A;  1KQS 2;  1HKX A;  3DM8 A;  1TIJ A;  1HU9 A;  1DMM A;  4Q53 A;  3IJE B;  1GD3 A;  1AVL A;  1Q42 A;  2P38 A;  3WMD A;  3X3X A;  4XDW A;  2F98 A;  5DRE A;  3M8C A;  3MKI A;  3PS8 A;  4EXR A;  3NBB A;  4I4K A;  3N9H A;  2F86 B;  1VQP 3;  4KVH A;  3DZL A;  4WHA A;  3QK9 A;  3MG3 A;  3MWZ A;  4XDV A;  2W56 A;  3VSY A;  1VQ4 3;  2HML B;  6STD A;  2LYX A;  3DGM A;  3NBR A;  2CH9 A;  3X3Z A;  3BNE A;  1KWI A;  3ALA A;  1YGE A;  2Q07 A;  5FGO A;  3CC7 3;  5AI1 A;  1E3R A;  3JVC A;  3T8N A;  3DXO A;  2OTJ 3;  1RJO A;  2CFK A;  3BND A;  3LH4 A;  1IVX A;  4AEQ A;  1YJ9 3;  2CIU A;  1DYU A;  2Y74 A;  1EQK A;  5LC6 A;  4AKZ A;  1NJI 4;  4NRE A;  8CHO A;  3X42 A;  3NQZ A;  5BVB A;  1VZZ A;  3G4S 3;  5D83 A;  1IT8 A;  1PU4 A;  1IVW A;  2WOF A;  1IQX A;  3CPO A;  3NHX A;  1YVB I;  1UUV B;  1IVU A;  4LMI A;  1CYV A;  1K9M 4;  1Q40 A;  5IEN A;  3FG4 A;  1WMO A;  3WOF B;  3LYG A;  4N6T A;  1RRH A;  4ZM8 A;  3CC2 3;  1ASK A;  2BHM A;  3Q2P A;  1K28 A;  1WQL B;  1ULI B;  1W6G A;  2K0M A;  3VGN A;  4KZ1 A;  3S28 A;  3EN1 B;  4MEI A;  5IER A;  4LZI A;  3KKG A;  2P0X A;  4GB5 A;  5AII A;  2YX9 A;  5IG4 A;  5CK6 A;  4EBG A;  4FCM A;  2A15 A;  2BMQ B;  1FUW A;  1K41 A;  3DUK A;  4MJD A;  2KRT A;  3EX9 A;  3F40 A;  1AVK A;  4XBT A;  3BNC A;  3FH1 A;  3OV4 A;  3O8Y A;  3UNL A;  1O7N B;  3IPT A;  2W6J H;  3ECF A;  3NXJ A;  4IIA A;  1K8A 4;  1FGT A;  2RCD A;  1F8N A;  4QWT A;  2K54 A;  2XR8 B;  3CCL 3;  1AV4 A;  1IU7 A;  4HKV B;  2ML6 A;  1O7M B;  3AMO A;  1GD4 A;  4HM6 B;  5IG3 A;  3F9S A;  1IDP A;  1TFK A;  3HII A;  2GU3 A;  3X41 A;  3HX8 A;  3B4P A;  1RN7 A;  5EVH A;  1IK3 A;  1BUQ A;  3LTA A;  2CFW A;  5AEW B;  2OWP A;  4K61 A;  2ZL8 A;  3EE1 A;  4N6M A;  3LXU X;  5IEO A;  5I97 A;  1SJW A;  3FF2 A;  1FA3 A;  2GEX A;  3T0U A;  3I0Y A;  1DVD A;  1VQ6 3;  5EQL A;  3WDG B;  3LTC A;  2M7O A;  2MF7 A;  1ZO2 A;  4RNY A;  3J7Y d;  3V98 A;  2HMK B;  1LNH A;  3V92 A;  4H61 A;  1NB5 I;  1W01 A;  1W2Z A;  1FGO A;  2SBL A;  2INX A;  4NHF A;  3CCS 3;  2W9P A;  3D3L A;  4IT7 A;  5D82 A;  1OPY A;  1T5Y A;  5TGN A;  2WGO A;  3B4O A;  3F8X A;  1N8R 4;  4HYZ A;  3FG1 A;  2CWT A;  2QIY A;  1VQK 3;  3HK4 A;  3EBT A;  4R4K A;  3T8U A;  1W4N A;  4H3U A;  3VF1 A;  2WOH A;  3EC9 A;  2W0Q A;  5G2G A;  3TDG A;  3KSE D;  3IMA B;  4OUQ A;  1M90 4;  4RBN A;  3UL5 A;  7STD A;  3LT9 A;  1M1X B;  3EB8 A;  1N8Q A;  1EA2 A;  1OH0 A;  1KSI A;  2OCT A;  3RGR A;  1NWW A;  2D1W A;  1ULJ B;  2V1L A;  1WMN A;  3CC4 3;  4L8P A;  2W03 A;  1JNQ A;  1M1K 4;  4TX4 A;  3MG2 A;  2E2V A;  4K90 B;  5IG0 A;  3I56 3;  1W00 A;  2CHC A;  4OK0 A;  2XSH B;  4R9K A;  2XGN A;  1EKM A;  2R4I A;  3GZX B;  4FMA A;  3GRD A;  3CMA 3;  3CNM A;  4ORL A;  3CCQ 3;  5AYR B;  2KXG A;  1A90 A;  2HMO B;  1QJG A;  4MMX B;  3JUN A;  3EN8 A;  4WYK B;  3S5C A;  1YHQ 3;  5IW9 A;  4HM8 B;  2QGU A;  3FZW A;  4EYC A;  3F14 A;  3FSD A;  2RSX A;  4N6O B;  4J9A A;  3WOD G;  3NV0 B;  1QVF 2;  2OTL 3;  1W5Z A;  2CFL A;  4L7K A;  4HM7 B;  2GEY A;  1YJW 3;  1PFP A;  4LGQ A;  3S67 A;  4FMB A;  3H3H A;  3A76 A;  1JKG B;  1ROA A;  2L4V A;  2BT3 A;  1JB2 A;  1IV9 A;  1SIH A;  1N9E A;  4MMZ B;  3NQY A;  1OGZ A;  1K73 4;  1WTH A;  3NX0 A;  4EV5 A;  4BTX A;  1YIT 3;  1VQN 3;  4HM3 B;  3HIG A;  1TUH A;  4CDL A;  1J2B A;  1OHO A;  4KFE A;  5JBS A;  2PZV A;  3SED A;  1KD1 4;  1TFO A;  2Z77 A;  4PEJ A;  1JRQ A;  2RGQ A;  3QRD A;  2XRX B;  1D6Z A;  2ML5 A;  1V74 A;  3OX9 A;  2IA7 A;  2E2T A;  1Y4K A;  3B8L A;  3H51 A;  3CCJ 3;  2CWV A;  1CEW I;  1JN5 A;  2WGQ A;  3X40 A;  1Q86 4;  3SLU A;  2PNC A;  1GS3 A;  3X3Y A;  2XGL A;  2YFL B;  3RGA A;  3OWY A;  3OWU A;  1OF5 B;  4BTY A;  1E97 A;  1W02 A;  2JQ5 A;  3N54 B;  3BB9 A;  1YI2 3;  1VQM 3;  3PXM A;  3U1W A;  3CXC 2;  2XFS A;  2LQV A;  4FMD A;  3BNB A;  3PZW A;  3OW2 2;  1ROV A;  4CCV A;  1JV2 B;  3BLZ A;  1IVV A;  1D6Y A;  3ROB A;  4XBY A;  1OCV A;  1W2B 2;  4U13 A;  4AKY A;  2CKF B;  1O7G B;  1NO3 A;  3L0R A;  2BMR B;  5ELJ A;  3KZT A;  3CCM 3;  3LTB A;  4HBR A;  1TP6 A;  5ELU A;  1CYU A;  4HM1 B;  4N6U A;  2OQE A;  1VQ5 3;  2P09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...