5AYRB

The crystal structure of saugi/human udg complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
MTLELQLKHYITNLFNLPKDEKWECESIEEIADDILPDQYVRLGALSNKILQTYTYYSDTLHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
publication title Using structural-based protein engineering to modulate the differential inhibition effects of SAUGI on human and HSV uracil DNA glycosylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ayrB00
2KCDA 5AYSC 3WDGB 5AYRB
chains in the Genus database with same CATH superfamily
4NHFA 1RGCA 2L4VA 1N8R4 4J8TA 3VGNA 1BSAA 1T2HA 2QIYA 2KF3A 3CCM3 1B2MA 3IJEB 5AI1A 3HIIA 1OHOA 3DM8A 5M19A 3OW22 2XEPA 3X41A 2KRTA 4KFDA 1W6CA 1RGKA 3KN4A 1GY7A 1DVDA 3AHSA 3D4AA 1LOVA 3MPHA 4L7KA 4ORLA 1TFOA 1I0VA 3LH4A 3S29A 3BLZA 4MMXB 1B2ZA 1OGZA 2V1LA 4J9AA 1D6YA 1JB2A 3PZWA 3CCE3 3CCJ3 1BSCA 3G4S3 3NXJA 1IVWA 1JRQA 2AAEA 2HMOB 1STDA 1B20A 1BNFA 2F4YA 2UGIA 3FCSB 5D83A 4CDLA 1Q864 1RGHA 1O7MB 1IT7A 3EF8A 3FSDA 2IMJA 4H61A 4FCZA 6STDA 1PYLA 3E99A 2ZHXB 1LOWA 4N6MA 5CF2A 1LRAA 1V74A 4CCVA 1K41A 1YNVX 3K9MC 1OHSA 1QAKA 3RNTA 3V98A 1BUQA 2GBWB 4HVNA 1JKGA 2Z77A 5AIHA 1ROAA 5EEOA 4BIRA 1FGMA 1TRPA 2ML5A 4I5QA 3JUNA 1EUIC 1FUWA 1N9JA 4BTYA 2CWVA 1YJW3 1M1K4 2XR8B 4BU4A 4R9KA 1JN5A 1N9EA 2GEYA 4HM0B 1W7CA 3BNBA 2CK3H 4K1UA 5KP4A 1KC84 2YX9A 1JBTA 3A76A 3SEDA 4XM4A 2WGQA 7STDA 1YVSA 2F99A 2UUGC 1HZ1A 3CCL3 3CC43 3ALAA 3BNEA 4LYLB 1YIJ3 4XB5A 2CWUA 2LQVA 1UCIA 1UUGB 1SARA 1LNIA 3NM2A 3CC73 1GY6A 2WOFA 3F7SA 1AV4A 1W6YA 1RDSA 1IYYA 2CFWA 5CLKA 1BIRA 1GMRA 1LOXA 4OUQA 2CH9A 5ELUA 1PU4A 3N9HA 4HM2B 3PGBA 5DRVA 4HZBB 1NB5I 1NU3A 1NDOB 3G16A 1YIT3 3WMDA 3UNLA 1RNTA 3SXXA 1DVCA 3EE1A 4EYCA 2P05A 2XFSA 1RHLA 3FGYA 2GXFA 2C10A 2E2TA 3X42A 4L8OA 3MSOA 4MMZB 3T8UA 3CC23 1O7PB 2H0IA 4X2OA 2KCDA 4LEHA 3K0ZA 3FH1A 3M8CA 1RGFA 4Q53A 3WOEB 5HOHA 1K28A 2P38A 4J5KA 1UGHI 1QALA 1IT8A 3MKIA 3URPA 2Z76A 1WTHA 5RNTA 3T8NA 4WYKB 2AADA 2W04A 3FZWA 4HYZA 1JBSA 3K7CA 4K90B 1VQM3 1AR0A 3B8LA 1A67A 4GSPA 4HBRA 3HK4A 1OF5B 3J7Yd 3HI7A 3PCSA 3WA2X 4AKZA 4BL3A 1Q814 1ZX2A 3U97A 1GD3A 1TRQA 1YI23 1BRSA 1BNSA 3RGRA 1YVBI 2JDIH 2SBLA 2GEXA 4OK0A 4TX4A 3D5IA 2OCTA 1UI7A 4GL6A 1BSBA 2D1WA 5AEUB 2RSXA 2SARA 3F7XA 3D5GA 5LC7A 1JZDA 4NPBA 1QVF2 5M1AA 3CCV3 1X1WA 1OH0A 2E2VA 1Y4KA 5A0OB 3CCQ3 1BRJA 1O7HB 3NQYA 1RRLA 1AY7A 1ASKA 3ECFA 1BSEA 1S723 1BNGA 1GOUA 3KCHA 3D79A 1FGTA 3LT9A 3RGAA 1LNHA 1NJI4 1BRKA 1OHPA 3DXOA 4HM7B 2P0XA 5FGOA 4O3VA 1K734 4RBNA 3EB8A 5BVBA 3SOAA 1B27A 1CYUA 1U8CB 3G0KA 1AQZA 1MWSA 1EG9B 3F9SA 1LQGC 2W03A 2CG1A 4CJNA 5IG3A 5IG4A 4N6LA 2QGUA 1RRHA 3OWYA 4O8SA 2QA43 4L8PA 2XGLA 4R1KA 4WFOA 1JB4A 3ZFZA 3CPW2 1UGIA 3FG4A 4J5GA 2YFIB 1TTOA 3FLJA 3NX0A 1OPYA 1HYFA 3F14A 4N6V0 3FG1A 3X3XA 2C11A 4FCJA 4KFEA 5DREA 3I563 3AHWA 1ZO2A 3EC9A 2I9WA 2RBIA 3HOHA 1RKYA 1YGEA 4HOHA 1VZZA 2BHMA 3SX1A 1MGWA 3K63A 3ZG5A 1B21A 1WNHA 3MWZA 3S28A 1SIHA 2YFLB 1BNIA 2Z6BA 3AMOB 3EHCA 1RGAA 1KWIA 3NUVA 4O2HA 4KVHA 3X40A 3CCU3 2XSHB 2FXTA 3V92A 2M7OA 2IYJA 1B2XA 3KSED 1RCLA 4H3UA 3PYJA 4N3VA 3VF1A 4HM8B 3DGYA 5G1LA 1M1XB 2BMRB 1LQMB 1ROVA 2FNQA 2BT3A 2XF3A 1DE3A 1Q9EA 1RGGA 4BTWA 3CXC2 2RFRA 3QK9A 1IV7A 2W9QA 3WDGB 4WHAA 3CME3 2KF6A 4O02B 1W2B2 2F5WA 1HKXA 4EC6A 1K9M4 4RNTA 1TJDA 4FMDA 4AEQA 3CMA3 3DGMA 4KT3B 1VQO3 1V58A 2WO0A 4WP5A 3EJVA 1RMSA 1SIIA 1YJ93 4AKYA 1W02A 5KP3A 1FUSA 3KIIA 5AIGA 1EA2A 1UCKA 1R4YA 2HMMB 5IEPA 3EN8A 1RTUA 3DZLA 1EKMA 2BO9B 4XDVA 4XDWA 4EBGA 1JV2B 1BNRA 2CIUA 1VQL3 2IA7A 5G1KA 1GMQA 3LOYA 1BAOA 3D3LA 3X3ZA 2L1SA 8RNTA 2CC3A 3KSPA 1VQ53 5CK6A 3N54B 2INXA 3GZBA 1DMQA 1I2FA 2CFLA 2KF5A 3U1WA 3CD63 2CX0A 2KF4A 3S5CA 2ZDJA 3ZG0A 1NO3A 1GOYA 3AGOA 1AVKA 3DGNA 1DETA 3MG1A 3OV4A 3Q2PA 3MG2A 2J8XB 2Q07A 3KZTA 3OX9A 1X1YA 1I0XA 5BIRA 3I553 1VQ93 3WHOA 2WGOA 2CHCA 3GZYB 4WYKA 2MF7A 2OOVA 2C4BA 1IK3A 1GOVA 1IV9A 3GWRA 4LZIA 1QAFA 1GD4A 3LXUX 1BUJA 1OF5A 1Q40B 4JF8A 1CYVA 2BMOB 1BRIA 1IQXA 1J2BA 2W9PA 3BNCA 4OVMA 1W01A 4FCMA 4FMAA 3NBJA 4RZMA 4MEIA 3MYTA 3GAXA 4QWTA 3S67A 4MMYB 1S5AA 1KSIA 5AIIA 4HJLB 4HM6B 3DMCA 5FW5A 5AYSC 3Q1CA 3EBYA 1AVLA 2XH9A 1C7HA 3L0RA 3SYUA 1YJN3 1BVIA 3KKGA 5M18A 1BANA 1OUNA 3NBRA 5IG5A 5HGRA 1JBRA 1B3SA 3UL6A 1MWUA 3NV0B 1NWWA 1TUHA 1UI8A 2MC8A 3NHXA 2W0QA 1VQ43 3K5TA 2R41A 4ILFA 1I3IA 3CU3A 2STDA 3JUPA 6GSPA 4RNZA 4X2HA 2HMJB 1VQN3 2YFJB 1I2GA 3NQZA 4ZM8A 1KQS2 3I0YA 1F8NA 3WOFB 4FMCA 1A2PA 3G6E3 1JJ22 1NNVA 1B2UA 1ULIB 1W00A 4IIAA 4K61A 4LSOA 1I70A 1ZS7A 1WMPA 2P09A 1OCVA 4IT7A 1RJOA 3EX9A 3SLUA 1DMMA 2UX0A 2OTJ3 4G1MB 5TGNA 5IW9A 2Y74A 2GU1A 2PZVA 1N8QA 3G713 3VSYA 2LYXA 2IY2A 4NREA 3OWUA 2F56A 3MHEA 1HU9A 3UB1A 7GSPA 1MWRA 2RGQA 1Q7Y4 3LT8A 2GBXB 3AMOA 1W6GA 1TFKA 2CKFB 2Y73A 1JB5A 5IEOA 4N6NB 5EQLA 1QMAA 1IQ8A 1IQYA 3S27A 4XBXA 3ROBA 1VQQA 3N8BA 1I8VA 1RNBA 1ISKA 1FGRA 3DGLA 2W56B 3DY5A 1O7NB 1FA3A 3DH2A 2K3DA 1OACA 1E3VA 2P0MA 2E2UA 3JUMA 3O8YA 4HM4B 2CFGA 4EW5A 1YGWA 2CW9A 3BU4A 4HAAA 1VQ63 2K54A 1QVG2 4HM1B 1STFI 1UUWB 3LTBA 2FGTA 5AEWB 5JPUA 1L5GB 5STDA 5I97A 1I3FA 1T5YA 2Z7AA 2XRXB 4N6UA 5AIFA 3T0UA 4KFFA 4HZ9B 1ULJB 3WR2A 2QEX3 2XSOB 1GYBA 3PCRA 1RN1A 3LYGA 2IUJA 2XGNA 1GY5A 3GZRA 2H0GA 5IG0A 5D82A 2KAAA 5D81A 4STDA 1Q7HA 3LTDA 4FMBA 1FUTA 3UL5A 1DYUA 3KFQC 1UW1A 2CFKA 1VQK3 1D6ZA 4GHOA 1E97A 2CFDA 3AGNA 3CCS3 1FGQA 1BNEA 4R80A 4R9LA 1O7WB 2HMLB 3JUOA 3CPOA 4EXRA 3EBTA 8CHOA 1GSPA 1BGSA 4BTXA 1G02A 1W2ZA 2KXGA 1SJWA 4R4KA 3BB9A 3FF2A 1C54A 2CWTA 2IUKA 1X1XA 1RGEA 5EVHA 1WQLB 2BIRA 3LTAA 3OXAA 4GB5A 3D9RA 1RSNA 1G0TA 1FW7A 3JVCA 3TDGA 4CPKA 4MJDA 1M9GA 1W4NA 2F98A 5LC6A 3GZXB 1BRNL 1UDII 1QJGA 6RNTA 1JKGB 1LVNA 1DMNA 3WA3A 1CEWI 1TIJA 5BU4A 1SQWA 3DUKA 1E3RA 3H51A 1A90A 1MNLA 2HOHA 1NB3I 1Q40A 2W2CA 1M904 1BRHA 3F40A 1R4CA 3PXMA 1JN5B 1U5OA 1BNJA 1T3BA 4N6OB 2D42A 1K8A4 1TU5A 1GMPA 1B2SA 2O9UX 3GRDA 3H3HA 5AYRB 1US1A 2B1XB 1LXEA 1A2KA 2ZA4A 1BSDA 3G8ZA 1BRGA 1CQSA 3HIGA 1N5HA 2OQEA 2F5MA 2OTL3 1MGRA 3CCR3 1IDPA 4HM3B 5ELJA 1O7GB 5CF1A 3LZAA 1V57A 1D6UA 2CG0A 2HMKB 1PY3A 1BOXA 2BU4A 3FG3A 3NV0A 1FZUA 4KZ1A 4LMIA 1T2IA 4DKIA 2H0HA 3EN1B 2WOHA 1Q42A 2RNTA 4XBYA 5G2GA 3SOYA 1G96A 2GU3A 5GSPA 1IVXA 3FF0A 5IF6A 2HMNB 1FYSA 1UUVB 2F86B 3B4OA 5BXQA 3SVAA 1KD14 1Z1SA 3CNMA 3CNXA 7RNTA 4EV2A 3HZPA 2OOVC 3Q3FA 4K1VA 1VQ83 1RCKA 1ZGXA 1UCLA 1MOLA 2R4IA 1TP6A 2OQEC 1JZOA 3BNDA 3WODG 3GSPA 1VQP3 3LMLA 3F8XA 4U13A 5CXOA 4LGQA 1IVUA 1I2EA 1RN4A 1FGOA 1RLSA 2ML6A 2ZL8A 1RGLA 3F8HA 4IPBA 1VQ73 9RNTA 5KP1A 5IENA 3KE7A 1IVVA 3B7CA 3MG3A 4XBTA 2BNGA 3EQQB 4WWUC 1BU4A 4JRFA 5JBSA 3NBBA 3Q90A 1N5PA 1PFPA 1UCJA 4N6TA 3JUQA 1IU7A 3UJMA 4HKVB 4HM5B 3OWSA 4RNYA 3RDEA 1SPUA 1JNQA 2O3OA 2RCDA 1A2VA 2A15A 3LTCA 1X1UA 4BL2A 1GS3A 2GSPA 1EQKA 1Q824 1OGXA 2B24B 1MWTA 1CH0A 3ER7A 4EV5A 2XFTA 2JQ5A 3V99A 2W6JH 3BIRA 3FKAA 4I4KA 3A5EA 1WMOA 3HX8A 2W56A 1YHQ3 3PS8A 2K0MA 2BMQB 1RN7A 1EEJA 3IMAB 3NM7A 3STDA 5IERA 3B4PA 4PEJA 1WMNA 1W5ZA 2CX1A 3QRDA 2PNCA 2OWPA 4FR9A 5JPPA 3X3YA 3DGOA 1LOYA 3IPTA
chains in the Genus database with same CATH topology
4NHFA 2L4VA 1N8R4 4J8TA 3VGNA 2QIYA 3CCM3 3IJEB 5AI1A 3HIIA 1OHOA 3DM8A 3OW22 2XEPA 3X41A 2KRTA 4KFDA 1W6CA 3KN4A 1GY7A 1DVDA 3MPHA 4L7KA 4ORLA 1TFOA 3LH4A 3S29A 3BLZA 4MMXB 1OGZA 2V1LA 4J9AA 1D6YA 1JB2A 3PZWA 3CCE3 3CCJ3 3G4S3 3NXJA 1IVWA 1JRQA 2HMOB 1STDA 3FCSB 4CDLA 1Q864 5D83A 6STDA 1O7MB 1IT7A 3EF8A 3FSDA 2IMJA 4H61A 4FCZA 3E99A 5CF2A 4N6MA 1V74A 4CCVA 1K41A 1BUQA 3K9MC 1OHSA 1QAKA 3V98A 2GBWB 4HVNA 1JKGA 2Z77A 5AIHA 1ROAA 5EEOA 1FGMA 2ML5A 3JUNA 1FUWA 1N9JA 4BTYA 2CWVA 1YJW3 1M1K4 2XR8B 4R9KA 1JN5A 1N9EA 2GEYA 4HM0B 1W7CA 3BNBA 2CK3H 4K1UA 5KP4A 1KC84 2YX9A 3A76A 3SEDA 4XM4A 2WGQA 7STDA 2F99A 3CCL3 3CC43 3ALAA 3BNEA 1YIJ3 4XB5A 2CWUA 2LQVA 3NM2A 3CC73 1GY6A 2WOFA 3F7SA 1AV4A 1W6YA 2CFWA 5CLKA 1LOXA 5ELUA 4OUQA 2CH9A 1PU4A 3N9HA 4HM2B 3PGBA 5DRVA 4HZBB 1NB5I 1NU3A 1NDOB 3G16A 1YIT3 3WMDA 3UNLA 3SXXA 1DVCA 3EE1A 4EYCA 2P05A 2XFSA 3FGYA 2GXFA 2C10A 2E2TA 3X42A 4L8OA 3MSOA 4MMZB 3T8UA 3CC23 1O7PB 4X2OA 2KCDA 4LEHA 3K0ZA 3FH1A 3M8CA 4Q53A 3WOEB 1K28A 2P38A 1QALA 1IT8A 3MKIA 2Z76A 1WTHA 3T8NA 4WYKB 2W04A 3FZWA 4HYZA 3K7CA 4K90B 1AR0A 3B8LA 4HBRA 3HK4A 1OF5B 3J7Yd 3HI7A 3PCSA 3WA2X 4AKZA 1Q814 1ZX2A 3U97A 1GD3A 1YI23 3RGRA 1YVBI 2JDIH 2SBLA 2GEXA 4OK0A 4TX4A 2OCTA 1UI7A 4GL6A 2D1WA 5AEUB 2RSXA 3F7XA 5LC7A 1QVF2 3CCV3 5A0OB 1OH0A 2E2VA 1Y4KA 3CCQ3 1O7HB 3NQYA 1RRLA 1ASKA 3ECFA 1S723 1FGTA 3LT9A 3RGAA 1LNHA 1NJI4 1OHPA 3DXOA 4HM7B 5FGOA 2P0XA 4O3VA 1K734 4RBNA 3EB8A 5BVBA 1CYUA 1U8CB 3G0KA 1EG9B 3F9SA 2W03A 2CG1A 5IG3A 5IG4A 4N6LA 2QGUA 1RRHA 3OWYA 4O8SA 2QA43 4L8PA 2XGLA 4R1KA 4WFOA 1JB4A 3CPW2 3FG4A 2YFIB 3FLJA 3NX0A 1OPYA 3F14A 4N6V0 3FG1A 3X3XA 2C11A 4FCJA 4KFEA 5DREA 3I563 1ZO2A 3EC9A 2I9WA 1RKYA 3WA3A 1YGEA 1VZZA 2BHMA 3SX1A 3K63A 1WNHA 3MWZA 3S28A 1SIHA 2YFLB 2Z6BA 3AMOB 3EHCA 3NUVA 4O2HA 1KWIA 3SOAA 3CCU3 4KVHA 3X40A 2XSHB 2FXTA 3V92A 2M7OA 3KSED 4H3UA 3PYJA 4N3VA 3VF1A 4HM8B 1M1XB 2BMRB 1ROVA 2FNQA 2BT3A 2XF3A 4BTWA 3CXC2 2RFRA 3QK9A 1IV7A 2W9QA 3WDGB 4WHAA 3CME3 4O02B 1W2B2 1K9M4 4EC6A 1HKXA 4FMDA 4AEQA 3CMA3 3DGMA 1VQO3 2WO0A 4WP5A 3EJVA 1SIIA 1YJ93 4AKYA 1W02A 5KP3A 3KIIA 5AIGA 1EA2A 5IEPA 2HMMB 3EN8A 3DZLA 1EKMA 2BO9B 4XDVA 4XDWA 4EBGA 1JV2B 2CIUA 1VQL3 2IA7A 3LOYA 3D3LA 3X3ZA 2CC3A 3KSPA 1VQ53 5CK6A 3N54B 2INXA 3GZBA 1DMQA 3U1WA 2CFLA 3CD63 3S5CA 2ZDJA 1NO3A 3DGNA 1AVKA 3MG1A 3OV4A 3Q2PA 3MG2A 2Q07A 3KZTA 3OX9A 3I553 1VQ93 2WGOA 2CHCA 3GZYB 4WYKA 2MF7A 2OOVA 1IK3A 1IV9A 3GWRA 4LZIA 1QAFA 1GD4A 3LXUX 1OF5A 1Q40B 4JF8A 1CYVA 2BMOB 1IQXA 1J2BA 2W9PA 3BNCA 4OVMA 1W01A 4FCMA 4FMAA 3NBJA 4RZMA 4MEIA 3MYTA 3GAXA 4QWTA 3S67A 4MMYB 1S5AA 1KSIA 5AIIA 4HJLB 4HM6B 3DMCA 5FW5A 5AYSC 3Q1CA 3EBYA 1AVLA 2XH9A 1C7HA 3L0RA 1YJN3 3KKGA 1OUNA 3NBRA 5IG5A 5HGRA 3UL6A 3NV0B 1NWWA 1TUHA 1UI8A 2MC8A 3NHXA 2W0QA 1VQ43 3K5TA 3CU3A 2STDA 3JUPA 4RNZA 4X2HA 2HMJB 1VQN3 2YFJB 4ZM8A 3NQZA 1KQS2 3I0YA 1F8NA 3WOFB 4FMCA 3G6E3 1JJ22 1ULIB 1W00A 4IIAA 4K61A 4LSOA 1WMPA 2P09A 1OCVA 4IT7A 1RJOA 3EX9A 3SLUA 1DMMA 2UX0A 2OTJ3 4G1MB 5TGNA 5IW9A 2Y74A 2GU1A 2PZVA 1N8QA 3G713 3VSYA 2LYXA 4NREA 3OWUA 3MHEA 3UB1A 1HU9A 1Q7Y4 2RGQA 3LT8A 2GBXB 3AMOA 1W6GA 1TFKA 2CKFB 2Y73A 1JB5A 5IEOA 4N6NB 5EQLA 1QMAA 1IQ8A 1IQYA 3S27A 4XBXA 3ROBA 3N8BA 1ISKA 1FGRA 3DGLA 2W56B 3DY5A 1O7NB 1FA3A 3JUMA 1OACA 1E3VA 2P0MA 2E2UA 3O8YA 4HM4B 1VQM3 2CFGA 2CW9A 1VQ63 2K54A 1QVG2 4HM1B 1STFI 1UUWB 3LTBA 2FGTA 5AEWB 5JPUA 1L5GB 5STDA 5I97A 1T5YA 4N6UA 2Z7AA 2XRXB 5AIFA 3T0UA 4KFFA 4HZ9B 1ULJB 2QEX3 2XSOB 1GYBA 3PCRA 3LYGA 2IUJA 2XGNA 1GY5A 3GZRA 5IG0A 5D82A 5D81A 4STDA 3LTDA 4FMBA 3UL5A 1DYUA 3KFQC 1UW1A 2CFKA 1VQK3 1D6ZA 1E97A 2CFDA 3CCS3 1FGQA 4R80A 4R9LA 1O7WB 2HMLB 3JUOA 3CPOA 4EXRA 3EBTA 8CHOA 4BTXA 1W2ZA 2KXGA 1SJWA 4R4KA 3BB9A 3FF2A 2CWTA 2IUKA 5EVHA 1WQLB 3LTAA 3OXAA 4GB5A 3D9RA 3JVCA 3TDGA 4MJDA 1M9GA 1W4NA 2F98A 5LC6A 3GZXB 1QJGA 1JKGB 1LVNA 1DMNA 1CEWI 1TIJA 1SQWA 3DUKA 1E3RA 3H51A 1A90A 1MNLA 1NB3I 1Q40A 2W2CA 1M904 3F40A 1R4CA 3PXMA 1JN5B 1U5OA 4N6OB 2D42A 1K8A4 1TU5A 3GRDA 3H3HA 2O9UX 5AYRB 1US1A 2B1XB 1LXEA 1A2KA 3G8ZA 1CQSA 3HIGA 1N5HA 2OQEA 2OTL3 3CCR3 1IDPA 4HM3B 5ELJA 1O7GB 5CF1A 3LZAA 1D6UA 2CG0A 2HMKB 3FG3A 3NV0A 4KZ1A 4LMIA 3EN1B 2WOHA 1Q42A 4XBYA 5G2GA 3SOYA 1G96A 2GU3A 1IVXA 3FF0A 5IF6A 2HMNB 1UUVB 2F86B 3B4OA 5BXQA 3SVAA 1KD14 1Z1SA 3CNMA 3CNXA 4EV2A 3HZPA 2OOVC 4K1VA 1VQ83 2R4IA 1MOLA 1TP6A 2OQEC 3BNDA 3WODG 1VQP3 3LMLA 3F8XA 4U13A 5CXOA 4LGQA 1IVUA 2ZL8A 3F8HA 1FGOA 1VQ73 2ML6A 4IPBA 5KP1A 5IENA 3KE7A 1IVVA 3B7CA 3MG3A 4XBTA 2BNGA 3EQQB 4WWUC 5JBSA 4JRFA 3NBBA 3Q90A 1N5PA 1PFPA 4N6TA 3JUQA 1IU7A 3UJMA 4HKVB 4HM5B 3OWSA 4RNYA 3RDEA 1SPUA 1JNQA 2O3OA 2RCDA 1A2VA 2A15A 3LTCA 1GS3A 1EQKA 1Q824 1OGXA 2B24B 3ER7A 4EV5A 2XFTA 2JQ5A 3V99A 2W6JH 3FKAA 4I4KA 1WMOA 3HX8A 2W56A 1YHQ3 3PS8A 2K0MA 2BMQB 1RN7A 3IMAB 3NM7A 3STDA 5IERA 3B4PA 4PEJA 1WMNA 1W5ZA 3QRDA 1A67A 2PNCA 2OWPA 4FR9A 5JPPA 3X3YA 3DGOA 3IPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCD A;  5AYS C;  3WDG B;  5AYR B; 
#chains in the Genus database with same CATH topology
 4NHF A;  1RGC A;  2L4V A;  1N8R 4;  4J8T A;  3VGN A;  1BSA A;  1T2H A;  2QIY A;  2KF3 A;  3CCM 3;  1B2M A;  3IJE B;  5AI1 A;  3HII A;  1OHO A;  3DM8 A;  5M19 A;  3OW2 2;  2XEP A;  3X41 A;  2KRT A;  4KFD A;  1W6C A;  1RGK A;  3KN4 A;  1GY7 A;  1DVD A;  3AHS A;  3D4A A;  1LOV A;  3MPH A;  4L7K A;  4ORL A;  1TFO A;  1I0V A;  3LH4 A;  3S29 A;  3BLZ A;  4MMX B;  1B2Z A;  1OGZ A;  2V1L A;  4J9A A;  1D6Y A;  1JB2 A;  3PZW A;  3CCE 3;  3CCJ 3;  1BSC A;  3G4S 3;  3NXJ A;  1IVW A;  1JRQ A;  2AAE A;  2HMO B;  1STD A;  1B20 A;  1BNF A;  2F4Y A;  2UGI A;  3FCS B;  5D83 A;  4CDL A;  1Q86 4;  1RGH A;  1O7M B;  1IT7 A;  3EF8 A;  3FSD A;  2IMJ A;  4H61 A;  4FCZ A;  6STD A;  1PYL A;  3E99 A;  2ZHX B;  1LOW A;  4N6M A;  5CF2 A;  1LRA A;  1V74 A;  4CCV A;  1K41 A;  1YNV X;  3K9M C;  1OHS A;  1QAK A;  3RNT A;  3V98 A;  1BUQ A;  2GBW B;  4HVN A;  1JKG A;  2Z77 A;  5AIH A;  1ROA A;  5EEO A;  4BIR A;  1FGM A;  1TRP A;  2ML5 A;  4I5Q A;  3JUN A;  1EUI C;  1FUW A;  1N9J A;  4BTY A;  2CWV A;  1YJW 3;  1M1K 4;  2XR8 B;  4BU4 A;  4R9K A;  1JN5 A;  1N9E A;  2GEY A;  4HM0 B;  1W7C A;  3BNB A;  2CK3 H;  4K1U A;  5KP4 A;  1KC8 4;  2YX9 A;  1JBT A;  3A76 A;  3SED A;  4XM4 A;  2WGQ A;  7STD A;  1YVS A;  2F99 A;  2UUG C;  1HZ1 A;  3CCL 3;  3CC4 3;  3ALA A;  3BNE A;  4LYL B;  1YIJ 3;  4XB5 A;  2CWU A;  2LQV A;  1UCI A;  1UUG B;  1SAR A;  1LNI A;  3NM2 A;  3CC7 3;  1GY6 A;  2WOF A;  3F7S A;  1AV4 A;  1W6Y A;  1RDS A;  1IYY A;  2CFW A;  5CLK A;  1BIR A;  1GMR A;  1LOX A;  4OUQ A;  2CH9 A;  5ELU A;  1PU4 A;  3N9H A;  4HM2 B;  3PGB A;  5DRV A;  4HZB B;  1NB5 I;  1NU3 A;  1NDO B;  3G16 A;  1YIT 3;  3WMD A;  3UNL A;  1RNT A;  3SXX A;  1DVC A;  3EE1 A;  4EYC A;  2P05 A;  2XFS A;  1RHL A;  3FGY A;  2GXF A;  2C10 A;  2E2T A;  3X42 A;  4L8O A;  3MSO A;  4MMZ B;  3T8U A;  3CC2 3;  1O7P B;  2H0I A;  4X2O A;  2KCD A;  4LEH A;  3K0Z A;  3FH1 A;  3M8C A;  1RGF A;  4Q53 A;  3WOE B;  5HOH A;  1K28 A;  2P38 A;  4J5K A;  1UGH I;  1QAL A;  1IT8 A;  3MKI A;  3URP A;  2Z76 A;  1WTH A;  5RNT A;  3T8N A;  4WYK B;  2AAD A;  2W04 A;  3FZW A;  4HYZ A;  1JBS A;  3K7C A;  4K90 B;  1VQM 3;  1AR0 A;  3B8L A;  1A67 A;  4GSP A;  4HBR A;  3HK4 A;  1OF5 B;  3J7Y d;  3HI7 A;  3PCS A;  3WA2 X;  4AKZ A;  4BL3 A;  1Q81 4;  1ZX2 A;  3U97 A;  1GD3 A;  1TRQ A;  1YI2 3;  1BRS A;  1BNS A;  3RGR A;  1YVB I;  2JDI H;  2SBL A;  2GEX A;  4OK0 A;  4TX4 A;  3D5I A;  2OCT A;  1UI7 A;  4GL6 A;  1BSB A;  2D1W A;  5AEU B;  2RSX A;  2SAR A;  3F7X A;  3D5G A;  5LC7 A;  1JZD A;  4NPB A;  1QVF 2;  5M1A A;  3CCV 3;  1X1W A;  1OH0 A;  2E2V A;  1Y4K A;  5A0O B;  3CCQ 3;  1BRJ A;  1O7H B;  3NQY A;  1RRL A;  1AY7 A;  1ASK A;  3ECF A;  1BSE A;  1S72 3;  1BNG A;  1GOU A;  3KCH A;  3D79 A;  1FGT A;  3LT9 A;  3RGA A;  1LNH A;  1NJI 4;  1BRK A;  1OHP A;  3DXO A;  4HM7 B;  2P0X A;  5FGO A;  4O3V A;  1K73 4;  4RBN A;  3EB8 A;  5BVB A;  3SOA A;  1B27 A;  1CYU A;  1U8C B;  3G0K A;  1AQZ A;  1MWS A;  1EG9 B;  3F9S A;  1LQG C;  2W03 A;  2CG1 A;  4CJN A;  5IG3 A;  5IG4 A;  4N6L A;  2QGU A;  1RRH A;  3OWY A;  4O8S A;  2QA4 3;  4L8P A;  2XGL A;  4R1K A;  4WFO A;  1JB4 A;  3ZFZ A;  3CPW 2;  1UGI A;  3FG4 A;  4J5G A;  2YFI B;  1TTO A;  3FLJ A;  3NX0 A;  1OPY A;  1HYF A;  3F14 A;  4N6V 0;  3FG1 A;  3X3X A;  2C11 A;  4FCJ A;  4KFE A;  5DRE A;  3I56 3;  3AHW A;  1ZO2 A;  3EC9 A;  2I9W A;  2RBI A;  3HOH A;  1RKY A;  1YGE A;  4HOH A;  1VZZ A;  2BHM A;  3SX1 A;  1MGW A;  3K63 A;  3ZG5 A;  1B21 A;  1WNH A;  3MWZ A;  3S28 A;  1SIH A;  2YFL B;  1BNI A;  2Z6B A;  3AMO B;  3EHC A;  1RGA A;  1KWI A;  3NUV A;  4O2H A;  4KVH A;  3X40 A;  3CCU 3;  2XSH B;  2FXT A;  3V92 A;  2M7O A;  2IYJ A;  1B2X A;  3KSE D;  1RCL A;  4H3U A;  3PYJ A;  4N3V A;  3VF1 A;  4HM8 B;  3DGY A;  5G1L A;  1M1X B;  2BMR B;  1LQM B;  1ROV A;  2FNQ A;  2BT3 A;  2XF3 A;  1DE3 A;  1Q9E A;  1RGG A;  4BTW A;  3CXC 2;  2RFR A;  3QK9 A;  1IV7 A;  2W9Q A;  3WDG B;  4WHA A;  3CME 3;  2KF6 A;  4O02 B;  1W2B 2;  2F5W A;  1HKX A;  4EC6 A;  1K9M 4;  4RNT A;  1TJD A;  4FMD A;  4AEQ A;  3CMA 3;  3DGM A;  4KT3 B;  1VQO 3;  1V58 A;  2WO0 A;  4WP5 A;  3EJV A;  1RMS A;  1SII A;  1YJ9 3;  4AKY A;  1W02 A;  5KP3 A;  1FUS A;  3KII A;  5AIG A;  1EA2 A;  1UCK A;  1R4Y A;  2HMM B;  5IEP A;  3EN8 A;  1RTU A;  3DZL A;  1EKM A;  2BO9 B;  4XDV A;  4XDW A;  4EBG A;  1JV2 B;  1BNR A;  2CIU A;  1VQL 3;  2IA7 A;  5G1K A;  1GMQ A;  3LOY A;  1BAO A;  3D3L A;  3X3Z A;  2L1S A;  8RNT A;  2CC3 A;  3KSP A;  1VQ5 3;  5CK6 A;  3N54 B;  2INX A;  3GZB A;  1DMQ A;  1I2F A;  2CFL A;  2KF5 A;  3U1W A;  3CD6 3;  2CX0 A;  2KF4 A;  3S5C A;  2ZDJ A;  3ZG0 A;  1NO3 A;  1GOY A;  3AGO A;  1AVK A;  3DGN A;  1DET A;  3MG1 A;  3OV4 A;  3Q2P A;  3MG2 A;  2J8X B;  2Q07 A;  3KZT A;  3OX9 A;  1X1Y A;  1I0X A;  5BIR A;  3I55 3;  1VQ9 3;  3WHO A;  2WGO A;  2CHC A;  3GZY B;  4WYK A;  2MF7 A;  2OOV A;  2C4B A;  1IK3 A;  1GOV A;  1IV9 A;  3GWR A;  4LZI A;  1QAF A;  1GD4 A;  3LXU X;  1BUJ A;  1OF5 A;  1Q40 B;  4JF8 A;  1CYV A;  2BMO B;  1BRI A;  1IQX A;  1J2B A;  2W9P A;  3BNC A;  4OVM A;  1W01 A;  4FCM A;  4FMA A;  3NBJ A;  4RZM A;  4MEI A;  3MYT A;  3GAX A;  4QWT A;  3S67 A;  4MMY B;  1S5A A;  1KSI A;  5AII A;  4HJL B;  4HM6 B;  3DMC A;  5FW5 A;  5AYS C;  3Q1C A;  3EBY A;  1AVL A;  2XH9 A;  1C7H A;  3L0R A;  3SYU A;  1YJN 3;  1BVI A;  3KKG A;  5M18 A;  1BAN A;  1OUN A;  3NBR A;  5IG5 A;  5HGR A;  1JBR A;  1B3S A;  3UL6 A;  1MWU A;  3NV0 B;  1NWW A;  1TUH A;  1UI8 A;  2MC8 A;  3NHX A;  2W0Q A;  1VQ4 3;  3K5T A;  2R41 A;  4ILF A;  1I3I A;  3CU3 A;  2STD A;  3JUP A;  6GSP A;  4RNZ A;  4X2H A;  2HMJ B;  1VQN 3;  2YFJ B;  1I2G A;  3NQZ A;  4ZM8 A;  1KQS 2;  3I0Y A;  1F8N A;  3WOF B;  4FMC A;  1A2P A;  3G6E 3;  1JJ2 2;  1NNV A;  1B2U A;  1ULI B;  1W00 A;  4IIA A;  4K61 A;  4LSO A;  1I70 A;  1ZS7 A;  1WMP A;  2P09 A;  1OCV A;  4IT7 A;  1RJO A;  3EX9 A;  3SLU A;  1DMM A;  2UX0 A;  2OTJ 3;  4G1M B;  5TGN A;  5IW9 A;  2Y74 A;  2GU1 A;  2PZV A;  1N8Q A;  3G71 3;  3VSY A;  2LYX A;  2IY2 A;  4NRE A;  3OWU A;  2F56 A;  3MHE A;  1HU9 A;  3UB1 A;  7GSP A;  1MWR A;  2RGQ A;  1Q7Y 4;  3LT8 A;  2GBX B;  3AMO A;  1W6G A;  1TFK A;  2CKF B;  2Y73 A;  1JB5 A;  5IEO A;  4N6N B;  5EQL A;  1QMA A;  1IQ8 A;  1IQY A;  3S27 A;  4XBX A;  3ROB A;  1VQQ A;  3N8B A;  1I8V A;  1RNB A;  1ISK A;  1FGR A;  3DGL A;  2W56 B;  3DY5 A;  1O7N B;  1FA3 A;  3DH2 A;  2K3D A;  1OAC A;  1E3V A;  2P0M A;  2E2U A;  3JUM A;  3O8Y A;  4HM4 B;  2CFG A;  4EW5 A;  1YGW A;  2CW9 A;  3BU4 A;  4HAA A;  1VQ6 3;  2K54 A;  1QVG 2;  4HM1 B;  1STF I;  1UUW B;  3LTB A;  2FGT A;  5AEW B;  5JPU A;  1L5G B;  5STD A;  5I97 A;  1I3F A;  1T5Y A;  2Z7A A;  2XRX B;  4N6U A;  5AIF A;  3T0U A;  4KFF A;  4HZ9 B;  1ULJ B;  3WR2 A;  2QEX 3;  2XSO B;  1GYB A;  3PCR A;  1RN1 A;  3LYG A;  2IUJ A;  2XGN A;  1GY5 A;  3GZR A;  2H0G A;  5IG0 A;  5D82 A;  2KAA A;  5D81 A;  4STD A;  1Q7H A;  3LTD A;  4FMB A;  1FUT A;  3UL5 A;  1DYU A;  3KFQ C;  1UW1 A;  2CFK A;  1VQK 3;  1D6Z A;  4GHO A;  1E97 A;  2CFD A;  3AGN A;  3CCS 3;  1FGQ A;  1BNE A;  4R80 A;  4R9L A;  1O7W B;  2HML B;  3JUO A;  3CPO A;  4EXR A;  3EBT A;  8CHO A;  1GSP A;  1BGS A;  4BTX A;  1G02 A;  1W2Z A;  2KXG A;  1SJW A;  4R4K A;  3BB9 A;  3FF2 A;  1C54 A;  2CWT A;  2IUK A;  1X1X A;  1RGE A;  5EVH A;  1WQL B;  2BIR A;  3LTA A;  3OXA A;  4GB5 A;  3D9R A;  1RSN A;  1G0T A;  1FW7 A;  3JVC A;  3TDG A;  4CPK A;  4MJD A;  1M9G A;  1W4N A;  2F98 A;  5LC6 A;  3GZX B;  1BRN L;  1UDI I;  1QJG A;  6RNT A;  1JKG B;  1LVN A;  1DMN A;  3WA3 A;  1CEW I;  1TIJ A;  5BU4 A;  1SQW A;  3DUK A;  1E3R A;  3H51 A;  1A90 A;  1MNL A;  2HOH A;  1NB3 I;  1Q40 A;  2W2C A;  1M90 4;  1BRH A;  3F40 A;  1R4C A;  3PXM A;  1JN5 B;  1U5O A;  1BNJ A;  1T3B A;  4N6O B;  2D42 A;  1K8A 4;  1TU5 A;  1GMP A;  1B2S A;  2O9U X;  3GRD A;  3H3H A;  5AYR B;  1US1 A;  2B1X B;  1LXE A;  1A2K A;  2ZA4 A;  1BSD A;  3G8Z A;  1BRG A;  1CQS A;  3HIG A;  1N5H A;  2OQE A;  2F5M A;  2OTL 3;  1MGR A;  3CCR 3;  1IDP A;  4HM3 B;  5ELJ A;  1O7G B;  5CF1 A;  3LZA A;  1V57 A;  1D6U A;  2CG0 A;  2HMK B;  1PY3 A;  1BOX A;  2BU4 A;  3FG3 A;  3NV0 A;  1FZU A;  4KZ1 A;  4LMI A;  1T2I A;  4DKI A;  2H0H A;  3EN1 B;  2WOH A;  1Q42 A;  2RNT A;  4XBY A;  5G2G A;  3SOY A;  1G96 A;  2GU3 A;  5GSP A;  1IVX A;  3FF0 A;  5IF6 A;  2HMN B;  1FYS A;  1UUV B;  2F86 B;  3B4O A;  5BXQ A;  3SVA A;  1KD1 4;  1Z1S A;  3CNM A;  3CNX A;  7RNT A;  4EV2 A;  3HZP A;  2OOV C;  3Q3F A;  4K1V A;  1VQ8 3;  1RCK A;  1ZGX A;  1UCL A;  1MOL A;  2R4I A;  1TP6 A;  2OQE C;  1JZO A;  3BND A;  3WOD G;  3GSP A;  1VQP 3;  3LML A;  3F8X A;  4U13 A;  5CXO A;  4LGQ A;  1IVU A;  1I2E A;  1RN4 A;  1FGO A;  1RLS A;  2ML6 A;  2ZL8 A;  1RGL A;  3F8H A;  4IPB A;  1VQ7 3;  9RNT A;  5KP1 A;  5IEN A;  3KE7 A;  1IVV A;  3B7C A;  3MG3 A;  4XBT A;  2BNG A;  3EQQ B;  4WWU C;  1BU4 A;  4JRF A;  5JBS A;  3NBB A;  3Q90 A;  1N5P A;  1PFP A;  1UCJ A;  4N6T A;  3JUQ A;  1IU7 A;  3UJM A;  4HKV B;  4HM5 B;  3OWS A;  4RNY A;  3RDE A;  1SPU A;  1JNQ A;  2O3O A;  2RCD A;  1A2V A;  2A15 A;  3LTC A;  1X1U A;  4BL2 A;  1GS3 A;  2GSP A;  1EQK A;  1Q82 4;  1OGX A;  2B24 B;  1MWT A;  1CH0 A;  3ER7 A;  4EV5 A;  2XFT A;  2JQ5 A;  3V99 A;  2W6J H;  3BIR A;  3FKA A;  4I4K A;  3A5E A;  1WMO A;  3HX8 A;  2W56 A;  1YHQ 3;  3PS8 A;  2K0M A;  2BMQ B;  1RN7 A;  1EEJ A;  3IMA B;  3NM7 A;  3STD A;  5IER A;  3B4P A;  4PEJ A;  1WMN A;  1W5Z A;  2CX1 A;  3QRD A;  2PNC A;  2OWP A;  4FR9 A;  5JPP A;  3X3Y A;  3DGO A;  1LOY A;  3IPT A; 
#chains in the Genus database with same CATH homology
 4NHF A;  2L4V A;  1N8R 4;  4J8T A;  3VGN A;  2QIY A;  3CCM 3;  3IJE B;  5AI1 A;  3HII A;  1OHO A;  3DM8 A;  3OW2 2;  2XEP A;  3X41 A;  2KRT A;  4KFD A;  1W6C A;  3KN4 A;  1GY7 A;  1DVD A;  3MPH A;  4L7K A;  4ORL A;  1TFO A;  3LH4 A;  3S29 A;  3BLZ A;  4MMX B;  1OGZ A;  2V1L A;  4J9A A;  1D6Y A;  1JB2 A;  3PZW A;  3CCE 3;  3CCJ 3;  3G4S 3;  3NXJ A;  1IVW A;  1JRQ A;  2HMO B;  1STD A;  3FCS B;  4CDL A;  1Q86 4;  5D83 A;  6STD A;  1O7M B;  1IT7 A;  3EF8 A;  3FSD A;  2IMJ A;  4H61 A;  4FCZ A;  3E99 A;  5CF2 A;  4N6M A;  1V74 A;  4CCV A;  1K41 A;  1BUQ A;  3K9M C;  1OHS A;  1QAK A;  3V98 A;  2GBW B;  4HVN A;  1JKG A;  2Z77 A;  5AIH A;  1ROA A;  5EEO A;  1FGM A;  2ML5 A;  3JUN A;  1FUW A;  1N9J A;  4BTY A;  2CWV A;  1YJW 3;  1M1K 4;  2XR8 B;  4R9K A;  1JN5 A;  1N9E A;  2GEY A;  4HM0 B;  1W7C A;  3BNB A;  2CK3 H;  4K1U A;  5KP4 A;  1KC8 4;  2YX9 A;  3A76 A;  3SED A;  4XM4 A;  2WGQ A;  7STD A;  2F99 A;  3CCL 3;  3CC4 3;  3ALA A;  3BNE A;  1YIJ 3;  4XB5 A;  2CWU A;  2LQV A;  3NM2 A;  3CC7 3;  1GY6 A;  2WOF A;  3F7S A;  1AV4 A;  1W6Y A;  2CFW A;  5CLK A;  1LOX A;  5ELU A;  4OUQ A;  2CH9 A;  1PU4 A;  3N9H A;  4HM2 B;  3PGB A;  5DRV A;  4HZB B;  1NB5 I;  1NU3 A;  1NDO B;  3G16 A;  1YIT 3;  3WMD A;  3UNL A;  3SXX A;  1DVC A;  3EE1 A;  4EYC A;  2P05 A;  2XFS A;  3FGY A;  2GXF A;  2C10 A;  2E2T A;  3X42 A;  4L8O A;  3MSO A;  4MMZ B;  3T8U A;  3CC2 3;  1O7P B;  4X2O A;  2KCD A;  4LEH A;  3K0Z A;  3FH1 A;  3M8C A;  4Q53 A;  3WOE B;  1K28 A;  2P38 A;  1QAL A;  1IT8 A;  3MKI A;  2Z76 A;  1WTH A;  3T8N A;  4WYK B;  2W04 A;  3FZW A;  4HYZ A;  3K7C A;  4K90 B;  1AR0 A;  3B8L A;  4HBR A;  3HK4 A;  1OF5 B;  3J7Y d;  3HI7 A;  3PCS A;  3WA2 X;  4AKZ A;  1Q81 4;  1ZX2 A;  3U97 A;  1GD3 A;  1YI2 3;  3RGR A;  1YVB I;  2JDI H;  2SBL A;  2GEX A;  4OK0 A;  4TX4 A;  2OCT A;  1UI7 A;  4GL6 A;  2D1W A;  5AEU B;  2RSX A;  3F7X A;  5LC7 A;  1QVF 2;  3CCV 3;  5A0O B;  1OH0 A;  2E2V A;  1Y4K A;  3CCQ 3;  1O7H B;  3NQY A;  1RRL A;  1ASK A;  3ECF A;  1S72 3;  1FGT A;  3LT9 A;  3RGA A;  1LNH A;  1NJI 4;  1OHP A;  3DXO A;  4HM7 B;  5FGO A;  2P0X A;  4O3V A;  1K73 4;  4RBN A;  3EB8 A;  5BVB A;  1CYU A;  1U8C B;  3G0K A;  1EG9 B;  3F9S A;  2W03 A;  2CG1 A;  5IG3 A;  5IG4 A;  4N6L A;  2QGU A;  1RRH A;  3OWY A;  4O8S A;  2QA4 3;  4L8P A;  2XGL A;  4R1K A;  4WFO A;  1JB4 A;  3CPW 2;  3FG4 A;  2YFI B;  3FLJ A;  3NX0 A;  1OPY A;  3F14 A;  4N6V 0;  3FG1 A;  3X3X A;  2C11 A;  4FCJ A;  4KFE A;  5DRE A;  3I56 3;  1ZO2 A;  3EC9 A;  2I9W A;  1RKY A;  3WA3 A;  1YGE A;  1VZZ A;  2BHM A;  3SX1 A;  3K63 A;  1WNH A;  3MWZ A;  3S28 A;  1SIH A;  2YFL B;  2Z6B A;  3AMO B;  3EHC A;  3NUV A;  4O2H A;  1KWI A;  3SOA A;  3CCU 3;  4KVH A;  3X40 A;  2XSH B;  2FXT A;  3V92 A;  2M7O A;  3KSE D;  4H3U A;  3PYJ A;  4N3V A;  3VF1 A;  4HM8 B;  1M1X B;  2BMR B;  1ROV A;  2FNQ A;  2BT3 A;  2XF3 A;  4BTW A;  3CXC 2;  2RFR A;  3QK9 A;  1IV7 A;  2W9Q A;  3WDG B;  4WHA A;  3CME 3;  4O02 B;  1W2B 2;  1K9M 4;  4EC6 A;  1HKX A;  4FMD A;  4AEQ A;  3CMA 3;  3DGM A;  1VQO 3;  2WO0 A;  4WP5 A;  3EJV A;  1SII A;  1YJ9 3;  4AKY A;  1W02 A;  5KP3 A;  3KII A;  5AIG A;  1EA2 A;  5IEP A;  2HMM B;  3EN8 A;  3DZL A;  1EKM A;  2BO9 B;  4XDV A;  4XDW A;  4EBG A;  1JV2 B;  2CIU A;  1VQL 3;  2IA7 A;  3LOY A;  3D3L A;  3X3Z A;  2CC3 A;  3KSP A;  1VQ5 3;  5CK6 A;  3N54 B;  2INX A;  3GZB A;  1DMQ A;  3U1W A;  2CFL A;  3CD6 3;  3S5C A;  2ZDJ A;  1NO3 A;  3DGN A;  1AVK A;  3MG1 A;  3OV4 A;  3Q2P A;  3MG2 A;  2Q07 A;  3KZT A;  3OX9 A;  3I55 3;  1VQ9 3;  2WGO A;  2CHC A;  3GZY B;  4WYK A;  2MF7 A;  2OOV A;  1IK3 A;  1IV9 A;  3GWR A;  4LZI A;  1QAF A;  1GD4 A;  3LXU X;  1OF5 A;  1Q40 B;  4JF8 A;  1CYV A;  2BMO B;  1IQX A;  1J2B A;  2W9P A;  3BNC A;  4OVM A;  1W01 A;  4FCM A;  4FMA A;  3NBJ A;  4RZM A;  4MEI A;  3MYT A;  3GAX A;  4QWT A;  3S67 A;  4MMY B;  1S5A A;  1KSI A;  5AII A;  4HJL B;  4HM6 B;  3DMC A;  5FW5 A;  5AYS C;  3Q1C A;  3EBY A;  1AVL A;  2XH9 A;  1C7H A;  3L0R A;  1YJN 3;  3KKG A;  1OUN A;  3NBR A;  5IG5 A;  5HGR A;  3UL6 A;  3NV0 B;  1NWW A;  1TUH A;  1UI8 A;  2MC8 A;  3NHX A;  2W0Q A;  1VQ4 3;  3K5T A;  3CU3 A;  2STD A;  3JUP A;  4RNZ A;  4X2H A;  2HMJ B;  1VQN 3;  2YFJ B;  4ZM8 A;  3NQZ A;  1KQS 2;  3I0Y A;  1F8N A;  3WOF B;  4FMC A;  3G6E 3;  1JJ2 2;  1ULI B;  1W00 A;  4IIA A;  4K61 A;  4LSO A;  1WMP A;  2P09 A;  1OCV A;  4IT7 A;  1RJO A;  3EX9 A;  3SLU A;  1DMM A;  2UX0 A;  2OTJ 3;  4G1M B;  5TGN A;  5IW9 A;  2Y74 A;  2GU1 A;  2PZV A;  1N8Q A;  3G71 3;  3VSY A;  2LYX A;  4NRE A;  3OWU A;  3MHE A;  3UB1 A;  1HU9 A;  1Q7Y 4;  2RGQ A;  3LT8 A;  2GBX B;  3AMO A;  1W6G A;  1TFK A;  2CKF B;  2Y73 A;  1JB5 A;  5IEO A;  4N6N B;  5EQL A;  1QMA A;  1IQ8 A;  1IQY A;  3S27 A;  4XBX A;  3ROB A;  3N8B A;  1ISK A;  1FGR A;  3DGL A;  2W56 B;  3DY5 A;  1O7N B;  1FA3 A;  3JUM A;  1OAC A;  1E3V A;  2P0M A;  2E2U A;  3O8Y A;  4HM4 B;  1VQM 3;  2CFG A;  2CW9 A;  1VQ6 3;  2K54 A;  1QVG 2;  4HM1 B;  1STF I;  1UUW B;  3LTB A;  2FGT A;  5AEW B;  5JPU A;  1L5G B;  5STD A;  5I97 A;  1T5Y A;  4N6U A;  2Z7A A;  2XRX B;  5AIF A;  3T0U A;  4KFF A;  4HZ9 B;  1ULJ B;  2QEX 3;  2XSO B;  1GYB A;  3PCR A;  3LYG A;  2IUJ A;  2XGN A;  1GY5 A;  3GZR A;  5IG0 A;  5D82 A;  5D81 A;  4STD A;  3LTD A;  4FMB A;  3UL5 A;  1DYU A;  3KFQ C;  1UW1 A;  2CFK A;  1VQK 3;  1D6Z A;  1E97 A;  2CFD A;  3CCS 3;  1FGQ A;  4R80 A;  4R9L A;  1O7W B;  2HML B;  3JUO A;  3CPO A;  4EXR A;  3EBT A;  8CHO A;  4BTX A;  1W2Z A;  2KXG A;  1SJW A;  4R4K A;  3BB9 A;  3FF2 A;  2CWT A;  2IUK A;  5EVH A;  1WQL B;  3LTA A;  3OXA A;  4GB5 A;  3D9R A;  3JVC A;  3TDG A;  4MJD A;  1M9G A;  1W4N A;  2F98 A;  5LC6 A;  3GZX B;  1QJG A;  1JKG B;  1LVN A;  1DMN A;  1CEW I;  1TIJ A;  1SQW A;  3DUK A;  1E3R A;  3H51 A;  1A90 A;  1MNL A;  1NB3 I;  1Q40 A;  2W2C A;  1M90 4;  3F40 A;  1R4C A;  3PXM A;  1JN5 B;  1U5O A;  4N6O B;  2D42 A;  1K8A 4;  1TU5 A;  3GRD A;  3H3H A;  2O9U X;  5AYR B;  1US1 A;  2B1X B;  1LXE A;  1A2K A;  3G8Z A;  1CQS A;  3HIG A;  1N5H A;  2OQE A;  2OTL 3;  3CCR 3;  1IDP A;  4HM3 B;  5ELJ A;  1O7G B;  5CF1 A;  3LZA A;  1D6U A;  2CG0 A;  2HMK B;  3FG3 A;  3NV0 A;  4KZ1 A;  4LMI A;  3EN1 B;  2WOH A;  1Q42 A;  4XBY A;  5G2G A;  3SOY A;  1G96 A;  2GU3 A;  1IVX A;  3FF0 A;  5IF6 A;  2HMN B;  1UUV B;  2F86 B;  3B4O A;  5BXQ A;  3SVA A;  1KD1 4;  1Z1S A;  3CNM A;  3CNX A;  4EV2 A;  3HZP A;  2OOV C;  4K1V A;  1VQ8 3;  2R4I A;  1MOL A;  1TP6 A;  2OQE C;  3BND A;  3WOD G;  1VQP 3;  3LML A;  3F8X A;  4U13 A;  5CXO A;  4LGQ A;  1IVU A;  2ZL8 A;  3F8H A;  1FGO A;  1VQ7 3;  2ML6 A;  4IPB A;  5KP1 A;  5IEN A;  3KE7 A;  1IVV A;  3B7C A;  3MG3 A;  4XBT A;  2BNG A;  3EQQ B;  4WWU C;  5JBS A;  4JRF A;  3NBB A;  3Q90 A;  1N5P A;  1PFP A;  4N6T A;  3JUQ A;  1IU7 A;  3UJM A;  4HKV B;  4HM5 B;  3OWS A;  4RNY A;  3RDE A;  1SPU A;  1JNQ A;  2O3O A;  2RCD A;  1A2V A;  2A15 A;  3LTC A;  1GS3 A;  1EQK A;  1Q82 4;  1OGX A;  2B24 B;  3ER7 A;  4EV5 A;  2XFT A;  2JQ5 A;  3V99 A;  2W6J H;  3FKA A;  4I4K A;  1WMO A;  3HX8 A;  2W56 A;  1YHQ 3;  3PS8 A;  2K0M A;  2BMQ B;  1RN7 A;  3IMA B;  3NM7 A;  3STD A;  5IER A;  3B4P A;  4PEJ A;  1WMN A;  1W5Z A;  3QRD A;  1A67 A;  2PNC A;  2OWP A;  4FR9 A;  5JPP A;  3X3Y A;  3DGO A;  3IPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...