4HM3B

Naphthalene 1,2-dioxygenase bound to ethylbenzene
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to ethylbenzene
rcsb
source organism Pseudomonas sp. c18
total genus 55
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm3B00
1JB4A 4FCJA 3MSOA 2Z76A 2I9WA 5IG4A 3G0KA 3HK4A 3K7CA 3KSPA 4U13A 1QJGA 2HMMB 1CQSA 5KP3A 2B1XB 1OUNA 2Z77A 3EJVA 3EBTA 2HMJB 3OWUA 1VZZA 4GB5A 3T8UA 5EVHA 2HMKB 3OXAA 4HZBB 5AI1A 3F8XA 3ECFA 4WYKB 5CK6A 1ULJB 2OWPA 1OHOA 4HM0B 3FZWA 2YFJB 5AIHA 4HM3B 1DMQA 5AIIA 2BNGA 2BMRB 4XBTA 3GRDA 1GY6A 1JB5A 4FCMA 1GY5A 4LMIA 4N3VA 5KP1A 2R4IA 1W00A 5CXOA 3F7SA 2HMOB 2Z7AA 5IG3A 1W6YA 3SOAA 6STDA 1HKXA 2K54A 3FF0A 5JPUA 2B24B 3FH1A 1OHSA 3G16A 4R9LA 1ASKA 5D83A 1W02A 3MKIA 2XSOB 3FLJA 5AEUB 3DMCA 2W2CA 8CHOA 3DUKA 4Q53A 1C7HA 3F14A 1SJWA 3RGAA 3FSDA 3HZPA 5IEOA 1STDA 3KKGA 1O7GB 4XDWA 4RZMA 2QGUA 5AIGA 3GZXB 2A15A 1NU3A 2YFLB 2INXA 2QIYA 1ZO2A 2BMOB 2F86B 4HZ9B 2GEXA 3NHXA 2F99A 1UUWB 5IG0A 2CKFB 3K0ZA 3CNMA 2XSHB 3D9RA 1O7MB 3T8NA 3OV4A 4HM5B 1U5OA 3M8CA 4HM8B 3EN8A 2HMNB 4HM4B 3EN1B 3KZTA 3E99A 4I4KA 4HM6B 1BUQA 3VGNA 1JN5A 3H3HA 4XB5A 1OGZA 1EG9B 1O7HB 4IIAA 3JUOA 1K41A 1EA2A 3VSYA 4OUQA 4HKVB 5CF2A 4K1VA 3GWRA 3NM2A 4X2OA 4HM1B 1S5AA 3SOYA 1OF5B 2GXFA 5CLKA 1GYBA 1Q40A 3I0YA 1OPYA 3KE7A 3CNXA 4ORLA 5STDA 1O7WB 1E3RA 2YFIB 3NUVA 1GY7A 4XDVA 3UJMA 1ZX2A 3MG1A 1JN5B 5IENA 3NXJA 1A2KA 3SEDA 3G8ZA 1TUHA 4WWUC 4XM4A 5IEPA 4HVNA 1OH0A 3EHCA 3LYGA 3GZRA 1OGXA 1NWWA 3MG3A 4HJLB 1DMNA 1E97A 1Q40B 4L7KA 3F9SA 4CDLA 5IG5A 1Q42A 4HM7B 5DRVA 3OWYA 1W01A 4PEJA 1OHPA 2F98A 4K1UA 3JUNA 2UX0A 4STDA 4X2HA 3CPOA 5AIFA 1AR0A 5DREA 4XBXA 3MG2A 3OX9A 2RGQA 2HMLB 3B4OA 5BVBA 5FW5A 4HM2B 4R1KA 5D82A 3EC9A 3NV0A 3JUMA 3FGYA 2IMJA 2RCDA 5JPPA 3IPTA 4MJDA 1GS3A 3MYTA 4H3UA 3BB9A 3HX8A 2GBWB 3FF2A 4J9AA 3CU3A 1O7NB 3JUQA 3EX9A 3B4PA 3ER7A 2PZVA 3EF8A 1JB2A 1JKGA 2BMQB 3Q90A 2XRXB 3FKAA 3NBRA 3DZLA 3OWSA 5IF6A 4LEHA 3WMDA 1ISKA 3NV0B 4KVHA 5AEWB 4LGQA 3GZYB 4WP5A 3ROBA 4XBYA 1TP6A 3H51A 3MHEA 1DMMA 2STDA 5KP4A 2RFRA 5D81A 3B8LA 5BXQA 3S5CA 5HGRA 1JKGB 4OVMA 3GZBA 4J8TA 3DM8A 1E3VA 3B7CA 1IDPA 1O7PB 3F7XA 5G2GA 3UNLA 3LZAA 1UUVB 1Z1SA 4L8PA 1WQLB 1ULIB 2GBXB 3F8HA 3STDA 5TGNA 2XR8B 2CHCA 1OCVA 3BLZA 4WYKA 3A76A 3EQQB 1NDOB 3EBYA 3DXOA 1QMAA 4R9KA 5CF1A 2JQ5A 7STDA 3F40A 1OF5A 2GEYA 3JUPA 5IERA 4L8OA 3RGRA
chains in the Genus database with same CATH superfamily
2UGIA 3AHWA 3DGMA 1JB4A 4FCJA 3SVAA 3V98A 3I553 1X1WA 1X1XA 1RN1A 3MSOA 2Y74A 4BIRA 3LTAA 2Z76A 2I9WA 1YVSA 5IG4A 1RDSA 3G0KA 3HK4A 2IY2A 3K7CA 1IQYA 4LSOA 3PCSA 1RJOA 1B21A 3KSPA 5JBSA 4U13A 1QJGA 1DVCA 1MGRA 1JZOA 2HMMB 1CQSA 2WGQA 5KP3A 2P0XA 1JV2B 2B1XB 1OUNA 2Z77A 4LYLB 3EJVA 2KXGA 3CC23 3EBTA 3VF1A 2HMJB 4KFFA 2CH9A 3OWUA 1VZZA 4GB5A 3T8UA 5EVHA 1YGEA 3CCR3 2HMKB 3JVCA 1D6YA 4KT3B 3OXAA 4HZBB 1VQM3 3X3XA 2MF7A 2ML6A 4EV2A 5ELJA 5AI1A 5I97A 2XFSA 1B2UA 2XF3A 3F8XA 4EV5A 1VQO3 2C11A 1NO3A 3ECFA 4WYKB 3LT8A 1UGHI 5CK6A 1ULJB 2OWPA 1OHOA 4HM0B 3FZWA 3Q1CA 2YFJB 4N6TA 4HYZA 4HM3B 5AIHA 1DMQA 1BRHA 1TFOA 1D6UA 2CWUA 3X42A 5AIIA 4HBRA 1WMPA 2BNGA 3D5GA 2BMRB 2XGLA 4XBTA 2OCTA 3GRDA 1GY6A 1JB5A 4FCMA 1LOWA 1STFI 1GY5A 4LMIA 4EC6A 8RNTA 3HIIA 1VQ43 1SARA 2CFGA 1HU9A 1RCKA 4N3VA 4N6NB 5KP1A 4J5KA 2R4IA 1W00A 5CXOA 2LQVA 2Z6BA 2W9QA 3KIIA 6RNTA 2V1LA 1N5PA 3ALAA 3F7SA 1K734 2HMOB 7GSPA 2Z7AA 5IG3A 1T3BA 1W6YA 3RDEA 1ROVA 3SOAA 6STDA 1BSBA 1JJ22 1HKXA 3DY5A 2K54A 2ZDJA 4ZM8A 3FF0A 2P09A 2L1SA 5JPUA 2B24B 3N9HA 3FG3A 1OACA 3BNCA 2ML5A 4LZIA 3FH1A 1T5YA 3GSPA 1OHSA 3G16A 1MOLA 1ASKA 4R9LA 5D83A 1JNQA 2KF6A 3SYUA 1W02A 1RKYA 2W04A 3MKIA 4KFDA 2XSOB 3I563 1GOUA 3FLJA 2FGTA 3J7Yd 5AEUB 1RGEA 3DGLA 3DMCA 3LT9A 3NQYA 2W2CA 1YJW3 4WHAA 8CHOA 1N9EA 1PYLA 1VQL3 3DUKA 2CK3H 3CC43 1BRGA 1L5GB 1VQN3 4Q53A 3K5TA 1C7HA 3BNEA 3F14A 1SJWA 1EEJA 1BANA 2WOHA 3FSDA 3RGAA 1I8VA 1GMRA 1EUIC 1MWTA 1G0TA 2F5MA 2D42A 2O3OA 3HZPA 5IW9A 3KFQC 5BIRA 1TIJA 1K8A4 5IEOA 1UCIA 1I2EA 1WMOA 1BNEA 2MC8A 3PZWA 2CFWA 4JF8A 4CJNA 1STDA 3AGOA 3KKGA 4RNTA 2W9PA 1DVDA 3MWZA 1IV9A 3GAXA 1O7GB 2OOVC 4XDWA 4RZMA 2QGUA 5AIGA 1BIRA 3GZXB 5G1LA 4WFOA 1LOYA 1TTOA 4DKIA 1BOXA 3FG1A 1KSIA 4KZ1A 1LNHA 2A15A 1IQXA 4N6V0 1YJN3 1NU3A 1LQGC 2PNCA 2UUGC 3KSED 1MWRA 2YFLB 2INXA 1QVF2 3KN4A 1KQS2 1FW7A 1A2VA 2QIYA 1UCJA 1ZO2A 1RSNA 1M904 4N6LA 1IT7A 1IV7A 2BMOB 2F86B 4HZ9B 1G02A 1FGMA 2GEXA 4ILFA 2FXTA 3CXC2 3NQZA 2P05A 2OQEC 3NHXA 3G6E3 2ZHXB 2F99A 4FCZA 3Q2PA 1TRPA 3LOYA 4RBNA 1W2ZA 1BRJA 2F5WA 1VQ83 1UUWB 3V92A 5IG0A 4BTYA 2CKFB 3K0ZA 3CMA3 4I5QA 1SPUA 1V58A 3PS8A 4O2HA 1D6ZA 1IYYA 1GOYA 3NBBA 1YHQ3 5LC7A 3CNMA 1EKMA 1RGLA 2XSHB 3D9RA 3EB8A 5AYRB 1O7MB 1TFKA 2CG0A 1BNIA 1AV4A 3IMAB 3L0RA 3T8NA 3OV4A 3UL5A 1FUSA 2CC3A 1U5OA 1SIHA 2K0MA 3M8CA 4HM5B 4NREA 4O3VA 4HM8B 4J5GA 5GSPA 3EN8A 5RNTA 1A2PA 2HMNB 4HM4B 1MWSA 3EN1B 1B27A 2H0GA 3E99A 3KZTA 2L4VA 1C54A 2KAAA 4I4KA 4HM6B 1FGQA 1BUQA 3VGNA 1JN5A 4EBGA 2CG1A 4BL2A 3H3HA 4XB5A 1LXEA 1OGZA 3D4AA 1M9GA 1IK3A 1JBRA 4MEIA 1EG9B 1O7HB 1Q864 4IIAA 1RRHA 3JUOA 1K41A 1EA2A 3KCHA 3VSYA 4OUQA 1Q824 4HKVB 1WTHA 3CCU3 5CF2A 3WA3A 1BRIA 4K1VA 3U97A 4O8SA 3GWRA 1SQWA 3NM2A 1U8CB 1BSCA 1RNTA 3N8BA 1UI7A 4N6MA 4X2OA 4HM1B 1I2GA 3WDGB 1LVNA 3WOEB 1QVG2 1S5AA 2IUJA 3SOYA 4G1MB 1BNRA 1OF5B 1RGHA 2GXFA 1MNLA 3SXXA 5CLKA 3FCSB 4AKYA 1QAFA 1GYBA 1Q40A 2KF3A 4MMXB 3I0YA 4R80A 3S27A 1HYFA 3CME3 2FNQA 3FG4A 1GMPA 1OPYA 3KE7A 3CNXA 4ORLA 3ZFZA 5STDA 4KFEA 1KD14 1O7WB 1RMSA 1RLSA 3X3YA 1UCKA 4BTWA 1E3RA 2C10A 1S723 2YFIB 1DETA 2E2UA 4QWTA 3K63A 1N5HA 3BU4A 1HZ1A 3EE1A 3NUVA 4TX4A 3LMLA 1GY7A 1IQ8A 1CYVA 4XDVA 3RNTA 3UJMA 1IVUA 1ZX2A 2GSPA 2CX0A 2XGNA 1JRQA 1I3IA 3MG1A 3G4S3 1JN5B 5IENA 2Q07A 4BU4A 3NXJA 3X41A 5HOHA 1A2KA 3SEDA 3G8ZA 1TUHA 4WWUC 4XM4A 1R4YA 2OOVA 1PY3A 7RNTA 1UGIA 1AY7A 4FMBA 3D3LA 1IVXA 5IEPA 3CPW2 2HOHA 1OH0A 4HVNA 1WMNA 2OTL3 1LRAA 3HI7A 1MGWA 3EHCA 3LYGA 1CEWI 2BIRA 1BNSA 2J8XB 1IVWA 1FZUA 4N6OB 1YJ93 3S28A 4AEQA 3CCM3 1FUTA 1V57A 3CCS3 1V74A 1J2BA 3GZRA 1K9M4 3S29A 1OGXA 1NWWA 4FMCA 1VQ73 3MG3A 3MPHA 1VQQA 1VQ53 4HJLB 1DMNA 1YI23 2WOFA 2H0IA 1W5ZA 3PGBA 4CCVA 1BU4A 1E97A 1NB3I 1RGFA 4NHFA 1Q40B 4L7KA 2CWTA 3F9SA 2CX1A 1RGCA 3NM7A 4CDLA 1YIT3 3V99A 1BRSA 1GD4A 1W6CA 5IG5A 4BL3A 4EYCA 1Q42A 1BNGA 3K9MC 4HM7B 2JDIH 5DRVA 6GSPA 1W4NA 3PYJA 1YNVX 3LTCA 3OWYA 4GSPA 4EXRA 1W01A 1OHPA 3QK9A 4PEJA 2KRTA 2F98A 2AADA 1LNIA 3JUNA 4K1UA 2K3DA 2CFLA 2UX0A 4STDA 3D79A 4X2HA 1RNBA 1UW1A 3CPOA 5AIFA 1B2ZA 1AR0A 5DREA 4XBXA 1RN7A 3MG2A 4OK0A 2AAEA 3X40A 9RNTA 3CCV3 1B2SA 3OX9A 2RGQA 3LTDA 1I0XA 2HMLB 3B4OA 3U1WA 5BVBA 3N54B 2IUKA 5FW5A 3LH4A 2RNTA 1BGSA 4HM2B 1Q814 4R1KA 3DH2A 5D82A 3OW22 1A90A 4NPBA 5M18A 3PXMA 4HOHA 3EC9A 4EW5A 3NV0A 1UCLA 2W56A 3WOFB 3X3ZA 4IT7A 1YIJ3 3HOHA 1LQMB 3JUMA 1BNFA 3FGYA 3BNDA 2IMJA 1B2MA 2CIUA 1JBTA 2RCDA 3WA2X 1VQK3 1BSEA 5JPPA 3IPTA 4K90B 4MJDA 1A67A 1X1YA 1TRQA 1GS3A 1CYUA 2W03A 3DGNA 3MYTA 4H3UA 1YVBI 5EEOA 3HIGA 3G713 1LOXA 3BB9A 3HX8A 5M19A 2GBWB 2KF5A 1FYSA 1SIIA 1T2HA 3FF2A 1I0VA 3PCRA 4K61A 4J9AA 1ZS7A 3CU3A 1Y4KA 3NX0A 1BNJA 4FMDA 1O7NB 1GSPA 3JUQA 5AYSC 4AKZA 3BNBA 3ZG0A 3CCJ3 2BT3A 3B4PA 3EX9A 3ER7A 2CFKA 4MMZB 4O02B 2PZVA 1B20A 2SARA 3CCL3 1T2IA 3EF8A 1N8R4 1JB2A 1RRLA 2C4BA 3T0UA 3WHOA 1JKGA 3IJEB 1M1XB 3UB1A 2CWVA 1NB5I 1B3SA 2BMQB 2XFTA 1JZDA 3AHSA 1AQZA 3Q90A 2XRXB 3AMOA 5A0OB 1TU5A 3FKAA 1GOVA 3NBRA 2D1WA 3O8YA 1F8NA 3DZLA 2OTJ3 1KC84 1B2XA 2KF4A 1TJDA 3OWSA 1DE3A 5IF6A 4LEHA 1BVIA 1PFPA 3WMDA 2E2VA 4N6UA 1R4CA 2P0MA 3NV0B 1YGWA 2W56B 1N8QA 1ISKA 1FGTA 1RGAA 2SBLA 3AGNA 3NBJA 5LC6A 2QA43 2ZL8A 4KVHA 1PU4A 2CFDA 2RSXA 1G96A 3Q3FA 5AEWB 1BSDA 4BTXA 3CC73 1FA3A 4LGQA 4HAAA 1RGKA 1W7CA 1RN4A 2H0HA 3GZYB 4WP5A 3WODG 2WGOA 1BRKA 2IYJA 1KWIA 3ZG5A 1FUWA 2BU4A 4H61A 2Y73A 1W2B2 1Q9EA 3S67A 2F4YA 3ROBA 4IPBA 1TP6A 4XBYA 4RNZA 1FGRA 1RGGA 3H51A 3CCE3 1CH0A 3MHEA 1DMMA 2STDA 5BU4A 1Q7HA 5KP4A 5EQLA 1VQ63 2M7OA 2RFRA 1IVVA 1X1UA 4FR9A 1Q7Y4 5D81A 3B8LA 5BXQA 3BIRA 2ZA4A 1UDII 3LXUX 3S5CA 1EQKA 1AVLA 3A5EA 3DGOA 3URPA 2CW9A 5HGRA 2OQEA 3UL6A 1NNVA 2KCDA 1JKGB 1BSAA 2IA7A 2P38A 1VQ93 4OVMA 3GZBA 4J8TA 5G1KA 3DM8A 5FGOA 3AMOB 1E3VA 2QEX3 3B7CA 1IDPA 1US1A 1MWUA 1UI8A 1RTUA 1O7PB 2GU1A 3F7XA 5G2GA 3UNLA 3LZAA 1UUGB 1RHLA 4GL6A 2XEPA 3QRDA 1UUVB 1Z1SA 4L8PA 1WQLB 1VQP3 2LYXA 3SX1A 1ULIB 2GBXB 3F8HA 2YX9A 4FMAA 1BRNL 3DGYA 3CD63 3STDA 1N9JA 1GD3A 2GU3A 5TGNA 1BAOA 2WO0A 4GHOA 2BHMA 2XR8B 2CHCA 1LOVA 1OCVA 4R4KA 1I2FA 2R41A 3BLZA 2F56A 1I70A 2O9UX 4WYKA 3A76A 1IU7A 2W0QA 3EQQB 1NDOB 1GMQA 1QALA 3EBYA 1W6GA 4MMYB 5ELUA 3SLUA 2RBIA 3DXOA 2E2TA 1QAKA 1IT8A 1QMAA 2BO9B 2XH9A 5IERA 1AVKA 1BUJA 3WR2A 1DYUA 4R9KA 5CF1A 1WNHA 2JQ5A 7STDA 1I3FA 1M1K4 1K28A 3F40A 1OF5A 4CPKA 3D5IA 1NJI4 1RCLA 1ROAA 3TDGA 2GEYA 3CCQ3 1FGOA 1ZGXA 2W6JH 3JUPA 5M1AA 4L8OA 4RNYA 1JBSA 4JRFA 3RGRA 3LTBA
chains in the Genus database with same CATH topology
3SVAA 3DGMA 1JB4A 4FCJA 3V98A 3I553 3MSOA 2Y74A 3LTAA 2Z76A 2I9WA 5IG4A 3G0KA 3HK4A 3K7CA 1IQYA 4LSOA 3PCSA 1RJOA 3KSPA 5JBSA 4U13A 1QJGA 1DVCA 2HMMB 1CQSA 2WGQA 5KP3A 2P0XA 1JV2B 2B1XB 1OUNA 2Z77A 3EJVA 2KXGA 3CC23 3EBTA 3VF1A 2HMJB 4KFFA 2CH9A 3OWUA 1VZZA 4GB5A 3T8UA 5EVHA 1YGEA 3CCR3 2HMKB 3JVCA 1D6YA 3OXAA 4HZBB 1VQM3 3X3XA 2MF7A 2ML6A 4EV2A 5ELJA 5AI1A 5I97A 2XFSA 2XF3A 3F8XA 4EV5A 1VQO3 2C11A 1NO3A 3ECFA 4WYKB 3LT8A 5CK6A 1ULJB 2OWPA 1OHOA 4HM0B 3FZWA 3Q1CA 2YFJB 4N6TA 4HYZA 4HM3B 5AIHA 1DMQA 1TFOA 1D6UA 2CWUA 3X42A 5AIIA 4HBRA 1WMPA 2BNGA 2BMRB 2XGLA 4XBTA 2OCTA 3GRDA 1GY6A 1JB5A 4FCMA 1STFI 1GY5A 4LMIA 4EC6A 1VQ43 3HIIA 2CFGA 1HU9A 4N3VA 4N6NB 5KP1A 2R4IA 1W00A 5CXOA 2LQVA 2Z6BA 2W9QA 3KIIA 2V1LA 1N5PA 3ALAA 3F7SA 1K734 2HMOB 2Z7AA 5IG3A 1W6YA 3RDEA 1ROVA 3SOAA 6STDA 1JJ22 1HKXA 3DY5A 2K54A 2ZDJA 4ZM8A 3FF0A 2P09A 5JPUA 2B24B 3N9HA 3FG3A 1OACA 3BNCA 2ML5A 4LZIA 3FH1A 1T5YA 1OHSA 3G16A 1MOLA 1ASKA 4R9LA 5D83A 1JNQA 1RKYA 1W02A 2W04A 3MKIA 4KFDA 2XSOB 3I563 3FLJA 2FGTA 3J7Yd 5AEUB 3DGLA 3DMCA 3LT9A 3NQYA 2W2CA 1YJW3 4WHAA 8CHOA 1N9EA 1VQL3 3DUKA 2CK3H 3CC43 1L5GB 1VQN3 4Q53A 3K5TA 1C7HA 3BNEA 3F14A 1SJWA 2WOHA 3FSDA 3RGAA 2O3OA 3HZPA 2D42A 5IW9A 3KFQC 1TIJA 1K8A4 5IEOA 1WMOA 2MC8A 3PZWA 2CFWA 4JF8A 1STDA 3KKGA 2W9PA 1DVDA 3MWZA 1IV9A 3GAXA 1O7GB 2OOVC 4XDWA 4RZMA 2QGUA 5AIGA 3GZXB 4WFOA 3FG1A 1KSIA 4KZ1A 1LNHA 2A15A 1IQXA 4N6V0 1YJN3 1NU3A 2PNCA 3KSED 2YFLB 2INXA 1QVF2 3KN4A 1KQS2 1A2VA 2QIYA 1ZO2A 1M904 4N6LA 1IT7A 1IV7A 2BMOB 2F86B 4HZ9B 1FGMA 2GEXA 2FXTA 3CXC2 3NQZA 2P05A 2OQEC 3NHXA 3G6E3 2F99A 4FCZA 3Q2PA 3LOYA 4RBNA 1W2ZA 1VQ83 1UUWB 3V92A 5IG0A 4BTYA 2CKFB 3K0ZA 3CMA3 1SPUA 3PS8A 4O2HA 1D6ZA 3NBBA 1YHQ3 5LC7A 3CNMA 1EKMA 3EB8A 2XSHB 3D9RA 5AYRB 1O7MB 1TFKA 2CG0A 3IMAB 1AV4A 3L0RA 3T8NA 3UL5A 3OV4A 2CC3A 1U5OA 1SIHA 2K0MA 3M8CA 4HM5B 4NREA 4O3VA 4HM8B 3EN8A 2HMNB 4HM4B 3EN1B 3KZTA 3E99A 2L4VA 4I4KA 4HM6B 1FGQA 1BUQA 3VGNA 1JN5A 4EBGA 2CG1A 3H3HA 4XB5A 1LXEA 1OGZA 1M9GA 1IK3A 4MEIA 1EG9B 1O7HB 1Q864 4IIAA 1RRHA 3JUOA 1K41A 1EA2A 3VSYA 4OUQA 1Q824 4HKVB 1WTHA 3CCU3 5CF2A 3WA3A 4K1VA 3U97A 4O8SA 3GWRA 1SQWA 3NM2A 1U8CB 3N8BA 1UI7A 4N6MA 4X2OA 4HM1B 3WDGB 3WOEB 1LVNA 1QVG2 1S5AA 2IUJA 3SOYA 4G1MB 1OF5B 2GXFA 1MNLA 3SXXA 5CLKA 3FCSB 4AKYA 1QAFA 1GYBA 1Q40A 4MMXB 3I0YA 4R80A 3S27A 3CME3 2FNQA 3FG4A 1OPYA 3KE7A 3CNXA 4ORLA 5STDA 4KFEA 1KD14 1O7WB 4BTWA 3X3YA 1E3RA 2C10A 1S723 2YFIB 2E2UA 4QWTA 3K63A 1N5HA 3EE1A 3NUVA 4TX4A 3LMLA 1GY7A 1IQ8A 1CYVA 4XDVA 3UJMA 1IVUA 1ZX2A 2XGNA 1JRQA 3MG1A 3G4S3 1JN5B 5IENA 2Q07A 3NXJA 3X41A 1A2KA 3SEDA 3G8ZA 1TUHA 4WWUC 4XM4A 2OOVA 4FMBA 3D3LA 1IVXA 5IEPA 3CPW2 4HVNA 1OH0A 1WMNA 2OTL3 3HI7A 3EHCA 3LYGA 1CEWI 1IVWA 4N6OB 1YJ93 3S28A 4AEQA 3CCM3 3CCS3 1V74A 1J2BA 3GZRA 1K9M4 3S29A 1OGXA 1NWWA 4FMCA 1VQ73 3MG3A 3MPHA 1VQ53 4HJLB 1DMNA 1YI23 2WOFA 1W5ZA 3PGBA 4CCVA 1E97A 1NB3I 4NHFA 1Q40B 4L7KA 2CWTA 3F9SA 4CDLA 3NM7A 1YIT3 3V99A 1GD4A 1W6CA 5IG5A 4EYCA 1Q42A 3K9MC 4HM7B 2JDIH 5DRVA 1W4NA 3PYJA 3LTCA 3OWYA 4EXRA 1W01A 1OHPA 3QK9A 4PEJA 2KRTA 2F98A 4K1UA 3JUNA 2CFLA 2UX0A 4STDA 4X2HA 1UW1A 3CPOA 5AIFA 1AR0A 5DREA 4XBXA 1RN7A 3MG2A 4OK0A 3X40A 3CCV3 3OX9A 2RGQA 3LTDA 2HMLB 3B4OA 3U1WA 5BVBA 3N54B 2IUKA 5FW5A 3LH4A 4HM2B 1Q814 4R1KA 1A90A 5D82A 3OW22 3PXMA 3EC9A 3NV0A 2W56A 3WOFB 3X3ZA 4IT7A 1YIJ3 3JUMA 3FGYA 3BNDA 2IMJA 2CIUA 2RCDA 3WA2X 1VQK3 5JPPA 3IPTA 4K90B 4MJDA 1A67A 1GS3A 1CYUA 2W03A 3DGNA 3MYTA 4H3UA 1YVBI 5EEOA 3HIGA 3G713 1LOXA 3BB9A 3HX8A 2GBWB 1SIIA 3FF2A 3PCRA 4K61A 4J9AA 3CU3A 1Y4KA 3NX0A 4FMDA 1O7NB 3JUQA 5AYSC 4AKZA 3BNBA 3CCJ3 2BT3A 3B4PA 3EX9A 3ER7A 2CFKA 4MMZB 4O02B 2PZVA 3CCL3 3EF8A 1N8R4 1JB2A 1RRLA 3T0UA 1JKGA 3IJEB 1M1XB 3UB1A 2CWVA 1NB5I 2BMQB 2XFTA 3Q90A 2XRXB 3AMOA 5A0OB 1TU5A 3FKAA 3NBRA 2D1WA 3O8YA 1F8NA 3DZLA 2OTJ3 1KC84 3OWSA 5IF6A 4LEHA 1PFPA 3WMDA 2E2VA 4N6UA 2P0MA 1R4CA 3NV0B 1ISKA 2W56B 1N8QA 1FGTA 5LC6A 2SBLA 2QA43 3NBJA 2ZL8A 4KVHA 1PU4A 2CFDA 2RSXA 1G96A 5AEWB 4BTXA 3CC73 1FA3A 4LGQA 1W7CA 3GZYB 4WP5A 3WODG 2WGOA 1KWIA 1FUWA 4H61A 2Y73A 1W2B2 3S67A 3ROBA 4IPBA 1TP6A 4XBYA 4RNZA 1FGRA 3H51A 3CCE3 3MHEA 1DMMA 2STDA 5KP4A 5EQLA 1VQ63 2M7OA 2RFRA 1IVVA 4FR9A 1Q7Y4 5D81A 3B8LA 5BXQA 3LXUX 3S5CA 1EQKA 1AVLA 3DGOA 2CW9A 5HGRA 2OQEA 3UL6A 2KCDA 1JKGB 2IA7A 2P38A 1VQ93 4OVMA 3GZBA 4J8TA 3DM8A 5FGOA 3AMOB 1E3VA 2QEX3 3B7CA 1IDPA 1US1A 1UI8A 1O7PB 2GU1A 3F7XA 5G2GA 3UNLA 3LZAA 4GL6A 2XEPA 1UUVB 1Z1SA 4L8PA 1WQLB 1VQP3 2LYXA 3SX1A 1ULIB 2GBXB 3F8HA 2YX9A 4FMAA 3CD63 3STDA 1N9JA 1GD3A 2GU3A 5TGNA 2WO0A 2BHMA 2XR8B 2CHCA 1OCVA 4R4KA 3BLZA 2O9UX 4WYKA 3A76A 1IU7A 2W0QA 3EQQB 1NDOB 1QALA 3EBYA 4MMYB 1W6GA 5ELUA 3SLUA 3DXOA 2E2TA 1QAKA 1IT8A 1QMAA 2BO9B 2XH9A 5IERA 1AVKA 1DYUA 4R9KA 5CF1A 1WNHA 2JQ5A 7STDA 1M1K4 1K28A 3F40A 1OF5A 1NJI4 1ROAA 3TDGA 2GEYA 3CCQ3 1FGOA 2W6JH 3JUPA 3QRDA 4L8OA 4RNYA 4JRFA 3RGRA 3LTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB4 A;  4FCJ A;  3MSO A;  2Z76 A;  2I9W A;  5IG4 A;  3G0K A;  3HK4 A;  3K7C A;  3KSP A;  4U13 A;  1QJG A;  2HMM B;  1CQS A;  5KP3 A;  2B1X B;  1OUN A;  2Z77 A;  3EJV A;  3EBT A;  2HMJ B;  3OWU A;  1VZZ A;  4GB5 A;  3T8U A;  5EVH A;  2HMK B;  3OXA A;  4HZB B;  5AI1 A;  3F8X A;  3ECF A;  4WYK B;  5CK6 A;  1ULJ B;  2OWP A;  1OHO A;  4HM0 B;  3FZW A;  2YFJ B;  5AIH A;  4HM3 B;  1DMQ A;  5AII A;  2BNG A;  2BMR B;  4XBT A;  3GRD A;  1GY6 A;  1JB5 A;  4FCM A;  1GY5 A;  4LMI A;  4N3V A;  5KP1 A;  2R4I A;  1W00 A;  5CXO A;  3F7S A;  2HMO B;  2Z7A A;  5IG3 A;  1W6Y A;  3SOA A;  6STD A;  1HKX A;  2K54 A;  3FF0 A;  5JPU A;  2B24 B;  3FH1 A;  1OHS A;  3G16 A;  4R9L A;  1ASK A;  5D83 A;  1W02 A;  3MKI A;  2XSO B;  3FLJ A;  5AEU B;  3DMC A;  2W2C A;  8CHO A;  3DUK A;  4Q53 A;  1C7H A;  3F14 A;  1SJW A;  3RGA A;  3FSD A;  3HZP A;  5IEO A;  1STD A;  3KKG A;  1O7G B;  4XDW A;  4RZM A;  2QGU A;  5AIG A;  3GZX B;  2A15 A;  1NU3 A;  2YFL B;  2INX A;  2QIY A;  1ZO2 A;  2BMO B;  2F86 B;  4HZ9 B;  2GEX A;  3NHX A;  2F99 A;  1UUW B;  5IG0 A;  2CKF B;  3K0Z A;  3CNM A;  2XSH B;  3D9R A;  1O7M B;  3T8N A;  3OV4 A;  4HM5 B;  1U5O A;  3M8C A;  4HM8 B;  3EN8 A;  2HMN B;  4HM4 B;  3EN1 B;  3KZT A;  3E99 A;  4I4K A;  4HM6 B;  1BUQ A;  3VGN A;  1JN5 A;  3H3H A;  4XB5 A;  1OGZ A;  1EG9 B;  1O7H B;  4IIA A;  3JUO A;  1K41 A;  1EA2 A;  3VSY A;  4OUQ A;  4HKV B;  5CF2 A;  4K1V A;  3GWR A;  3NM2 A;  4X2O A;  4HM1 B;  1S5A A;  3SOY A;  1OF5 B;  2GXF A;  5CLK A;  1GYB A;  1Q40 A;  3I0Y A;  1OPY A;  3KE7 A;  3CNX A;  4ORL A;  5STD A;  1O7W B;  1E3R A;  2YFI B;  3NUV A;  1GY7 A;  4XDV A;  3UJM A;  1ZX2 A;  3MG1 A;  1JN5 B;  5IEN A;  3NXJ A;  1A2K A;  3SED A;  3G8Z A;  1TUH A;  4WWU C;  4XM4 A;  5IEP A;  4HVN A;  1OH0 A;  3EHC A;  3LYG A;  3GZR A;  1OGX A;  1NWW A;  3MG3 A;  4HJL B;  1DMN A;  1E97 A;  1Q40 B;  4L7K A;  3F9S A;  4CDL A;  5IG5 A;  1Q42 A;  4HM7 B;  5DRV A;  3OWY A;  1W01 A;  4PEJ A;  1OHP A;  2F98 A;  4K1U A;  3JUN A;  2UX0 A;  4STD A;  4X2H A;  3CPO A;  5AIF A;  1AR0 A;  5DRE A;  4XBX A;  3MG2 A;  3OX9 A;  2RGQ A;  2HML B;  3B4O A;  5BVB A;  5FW5 A;  4HM2 B;  4R1K A;  5D82 A;  3EC9 A;  3NV0 A;  3JUM A;  3FGY A;  2IMJ A;  2RCD A;  5JPP A;  3IPT A;  4MJD A;  1GS3 A;  3MYT A;  4H3U A;  3BB9 A;  3HX8 A;  2GBW B;  3FF2 A;  4J9A A;  3CU3 A;  1O7N B;  3JUQ A;  3EX9 A;  3B4P A;  3ER7 A;  2PZV A;  3EF8 A;  1JB2 A;  1JKG A;  2BMQ B;  3Q90 A;  2XRX B;  3FKA A;  3NBR A;  3DZL A;  3OWS A;  5IF6 A;  4LEH A;  3WMD A;  1ISK A;  3NV0 B;  4KVH A;  5AEW B;  4LGQ A;  3GZY B;  4WP5 A;  3ROB A;  4XBY A;  1TP6 A;  3H51 A;  3MHE A;  1DMM A;  2STD A;  5KP4 A;  2RFR A;  5D81 A;  3B8L A;  5BXQ A;  3S5C A;  5HGR A;  1JKG B;  4OVM A;  3GZB A;  4J8T A;  3DM8 A;  1E3V A;  3B7C A;  1IDP A;  1O7P B;  3F7X A;  5G2G A;  3UNL A;  3LZA A;  1UUV B;  1Z1S A;  4L8P A;  1WQL B;  1ULI B;  2GBX B;  3F8H A;  3STD A;  5TGN A;  2XR8 B;  2CHC A;  1OCV A;  3BLZ A;  4WYK A;  3A76 A;  3EQQ B;  1NDO B;  3EBY A;  3DXO A;  1QMA A;  4R9K A;  5CF1 A;  2JQ5 A;  7STD A;  3F40 A;  1OF5 A;  2GEY A;  3JUP A;  5IER A;  4L8O A;  3RGR A; 
#chains in the Genus database with same CATH topology
 2UGI A;  3AHW A;  3DGM A;  1JB4 A;  4FCJ A;  3SVA A;  3V98 A;  3I55 3;  1X1W A;  1X1X A;  1RN1 A;  3MSO A;  2Y74 A;  4BIR A;  3LTA A;  2Z76 A;  2I9W A;  1YVS A;  5IG4 A;  1RDS A;  3G0K A;  3HK4 A;  2IY2 A;  3K7C A;  1IQY A;  4LSO A;  3PCS A;  1RJO A;  1B21 A;  3KSP A;  5JBS A;  4U13 A;  1QJG A;  1DVC A;  1MGR A;  1JZO A;  2HMM B;  1CQS A;  2WGQ A;  5KP3 A;  2P0X A;  1JV2 B;  2B1X B;  1OUN A;  2Z77 A;  4LYL B;  3EJV A;  2KXG A;  3CC2 3;  3EBT A;  3VF1 A;  2HMJ B;  4KFF A;  2CH9 A;  3OWU A;  1VZZ A;  4GB5 A;  3T8U A;  5EVH A;  1YGE A;  3CCR 3;  2HMK B;  3JVC A;  1D6Y A;  4KT3 B;  3OXA A;  4HZB B;  1VQM 3;  3X3X A;  2MF7 A;  2ML6 A;  4EV2 A;  5ELJ A;  5AI1 A;  5I97 A;  2XFS A;  1B2U A;  2XF3 A;  3F8X A;  4EV5 A;  1VQO 3;  2C11 A;  1NO3 A;  3ECF A;  4WYK B;  3LT8 A;  1UGH I;  5CK6 A;  1ULJ B;  2OWP A;  1OHO A;  4HM0 B;  3FZW A;  3Q1C A;  2YFJ B;  4N6T A;  4HYZ A;  4HM3 B;  5AIH A;  1DMQ A;  1BRH A;  1TFO A;  1D6U A;  2CWU A;  3X42 A;  5AII A;  4HBR A;  1WMP A;  2BNG A;  3D5G A;  2BMR B;  2XGL A;  4XBT A;  2OCT A;  3GRD A;  1GY6 A;  1JB5 A;  4FCM A;  1LOW A;  1STF I;  1GY5 A;  4LMI A;  4EC6 A;  8RNT A;  3HII A;  1VQ4 3;  1SAR A;  2CFG A;  1HU9 A;  1RCK A;  4N3V A;  4N6N B;  5KP1 A;  4J5K A;  2R4I A;  1W00 A;  5CXO A;  2LQV A;  2Z6B A;  2W9Q A;  3KII A;  6RNT A;  2V1L A;  1N5P A;  3ALA A;  3F7S A;  1K73 4;  2HMO B;  7GSP A;  2Z7A A;  5IG3 A;  1T3B A;  1W6Y A;  3RDE A;  1ROV A;  3SOA A;  6STD A;  1BSB A;  1JJ2 2;  1HKX A;  3DY5 A;  2K54 A;  2ZDJ A;  4ZM8 A;  3FF0 A;  2P09 A;  2L1S A;  5JPU A;  2B24 B;  3N9H A;  3FG3 A;  1OAC A;  3BNC A;  2ML5 A;  4LZI A;  3FH1 A;  1T5Y A;  3GSP A;  1OHS A;  3G16 A;  1MOL A;  1ASK A;  4R9L A;  5D83 A;  1JNQ A;  2KF6 A;  3SYU A;  1W02 A;  1RKY A;  2W04 A;  3MKI A;  4KFD A;  2XSO B;  3I56 3;  1GOU A;  3FLJ A;  2FGT A;  3J7Y d;  5AEU B;  1RGE A;  3DGL A;  3DMC A;  3LT9 A;  3NQY A;  2W2C A;  1YJW 3;  4WHA A;  8CHO A;  1N9E A;  1PYL A;  1VQL 3;  3DUK A;  2CK3 H;  3CC4 3;  1BRG A;  1L5G B;  1VQN 3;  4Q53 A;  3K5T A;  1C7H A;  3BNE A;  3F14 A;  1SJW A;  1EEJ A;  1BAN A;  2WOH A;  3FSD A;  3RGA A;  1I8V A;  1GMR A;  1EUI C;  1MWT A;  1G0T A;  2F5M A;  2D42 A;  2O3O A;  3HZP A;  5IW9 A;  3KFQ C;  5BIR A;  1TIJ A;  1K8A 4;  5IEO A;  1UCI A;  1I2E A;  1WMO A;  1BNE A;  2MC8 A;  3PZW A;  2CFW A;  4JF8 A;  4CJN A;  1STD A;  3AGO A;  3KKG A;  4RNT A;  2W9P A;  1DVD A;  3MWZ A;  1IV9 A;  3GAX A;  1O7G B;  2OOV C;  4XDW A;  4RZM A;  2QGU A;  5AIG A;  1BIR A;  3GZX B;  5G1L A;  4WFO A;  1LOY A;  1TTO A;  4DKI A;  1BOX A;  3FG1 A;  1KSI A;  4KZ1 A;  1LNH A;  2A15 A;  1IQX A;  4N6V 0;  1YJN 3;  1NU3 A;  1LQG C;  2PNC A;  2UUG C;  3KSE D;  1MWR A;  2YFL B;  2INX A;  1QVF 2;  3KN4 A;  1KQS 2;  1FW7 A;  1A2V A;  2QIY A;  1UCJ A;  1ZO2 A;  1RSN A;  1M90 4;  4N6L A;  1IT7 A;  1IV7 A;  2BMO B;  2F86 B;  4HZ9 B;  1G02 A;  1FGM A;  2GEX A;  4ILF A;  2FXT A;  3CXC 2;  3NQZ A;  2P05 A;  2OQE C;  3NHX A;  3G6E 3;  2ZHX B;  2F99 A;  4FCZ A;  3Q2P A;  1TRP A;  3LOY A;  4RBN A;  1W2Z A;  1BRJ A;  2F5W A;  1VQ8 3;  1UUW B;  3V92 A;  5IG0 A;  4BTY A;  2CKF B;  3K0Z A;  3CMA 3;  4I5Q A;  1SPU A;  1V58 A;  3PS8 A;  4O2H A;  1D6Z A;  1IYY A;  1GOY A;  3NBB A;  1YHQ 3;  5LC7 A;  3CNM A;  1EKM A;  1RGL A;  2XSH B;  3D9R A;  3EB8 A;  5AYR B;  1O7M B;  1TFK A;  2CG0 A;  1BNI A;  1AV4 A;  3IMA B;  3L0R A;  3T8N A;  3OV4 A;  3UL5 A;  1FUS A;  2CC3 A;  1U5O A;  1SIH A;  2K0M A;  3M8C A;  4HM5 B;  4NRE A;  4O3V A;  4HM8 B;  4J5G A;  5GSP A;  3EN8 A;  5RNT A;  1A2P A;  2HMN B;  4HM4 B;  1MWS A;  3EN1 B;  1B27 A;  2H0G A;  3E99 A;  3KZT A;  2L4V A;  1C54 A;  2KAA A;  4I4K A;  4HM6 B;  1FGQ A;  1BUQ A;  3VGN A;  1JN5 A;  4EBG A;  2CG1 A;  4BL2 A;  3H3H A;  4XB5 A;  1LXE A;  1OGZ A;  3D4A A;  1M9G A;  1IK3 A;  1JBR A;  4MEI A;  1EG9 B;  1O7H B;  1Q86 4;  4IIA A;  1RRH A;  3JUO A;  1K41 A;  1EA2 A;  3KCH A;  3VSY A;  4OUQ A;  1Q82 4;  4HKV B;  1WTH A;  3CCU 3;  5CF2 A;  3WA3 A;  1BRI A;  4K1V A;  3U97 A;  4O8S A;  3GWR A;  1SQW A;  3NM2 A;  1U8C B;  1BSC A;  1RNT A;  3N8B A;  1UI7 A;  4N6M A;  4X2O A;  4HM1 B;  1I2G A;  3WDG B;  1LVN A;  3WOE B;  1QVG 2;  1S5A A;  2IUJ A;  3SOY A;  4G1M B;  1BNR A;  1OF5 B;  1RGH A;  2GXF A;  1MNL A;  3SXX A;  5CLK A;  3FCS B;  4AKY A;  1QAF A;  1GYB A;  1Q40 A;  2KF3 A;  4MMX B;  3I0Y A;  4R80 A;  3S27 A;  1HYF A;  3CME 3;  2FNQ A;  3FG4 A;  1GMP A;  1OPY A;  3KE7 A;  3CNX A;  4ORL A;  3ZFZ A;  5STD A;  4KFE A;  1KD1 4;  1O7W B;  1RMS A;  1RLS A;  3X3Y A;  1UCK A;  4BTW A;  1E3R A;  2C10 A;  1S72 3;  2YFI B;  1DET A;  2E2U A;  4QWT A;  3K63 A;  1N5H A;  3BU4 A;  1HZ1 A;  3EE1 A;  3NUV A;  4TX4 A;  3LML A;  1GY7 A;  1IQ8 A;  1CYV A;  4XDV A;  3RNT A;  3UJM A;  1IVU A;  1ZX2 A;  2GSP A;  2CX0 A;  2XGN A;  1JRQ A;  1I3I A;  3MG1 A;  3G4S 3;  1JN5 B;  5IEN A;  2Q07 A;  4BU4 A;  3NXJ A;  3X41 A;  5HOH A;  1A2K A;  3SED A;  3G8Z A;  1TUH A;  4WWU C;  4XM4 A;  1R4Y A;  2OOV A;  1PY3 A;  7RNT A;  1UGI A;  1AY7 A;  4FMB A;  3D3L A;  1IVX A;  5IEP A;  3CPW 2;  2HOH A;  1OH0 A;  4HVN A;  1WMN A;  2OTL 3;  1LRA A;  3HI7 A;  1MGW A;  3EHC A;  3LYG A;  1CEW I;  2BIR A;  1BNS A;  2J8X B;  1IVW A;  1FZU A;  4N6O B;  1YJ9 3;  3S28 A;  4AEQ A;  3CCM 3;  1FUT A;  1V57 A;  3CCS 3;  1V74 A;  1J2B A;  3GZR A;  1K9M 4;  3S29 A;  1OGX A;  1NWW A;  4FMC A;  1VQ7 3;  3MG3 A;  3MPH A;  1VQQ A;  1VQ5 3;  4HJL B;  1DMN A;  1YI2 3;  2WOF A;  2H0I A;  1W5Z A;  3PGB A;  4CCV A;  1BU4 A;  1E97 A;  1NB3 I;  1RGF A;  4NHF A;  1Q40 B;  4L7K A;  2CWT A;  3F9S A;  2CX1 A;  1RGC A;  3NM7 A;  4CDL A;  1YIT 3;  3V99 A;  1BRS A;  1GD4 A;  1W6C A;  5IG5 A;  4BL3 A;  4EYC A;  1Q42 A;  1BNG A;  3K9M C;  4HM7 B;  2JDI H;  5DRV A;  6GSP A;  1W4N A;  3PYJ A;  1YNV X;  3LTC A;  3OWY A;  4GSP A;  4EXR A;  1W01 A;  1OHP A;  3QK9 A;  4PEJ A;  2KRT A;  2F98 A;  2AAD A;  1LNI A;  3JUN A;  4K1U A;  2K3D A;  2CFL A;  2UX0 A;  4STD A;  3D79 A;  4X2H A;  1RNB A;  1UW1 A;  3CPO A;  5AIF A;  1B2Z A;  1AR0 A;  5DRE A;  4XBX A;  1RN7 A;  3MG2 A;  4OK0 A;  2AAE A;  3X40 A;  9RNT A;  3CCV 3;  1B2S A;  3OX9 A;  2RGQ A;  3LTD A;  1I0X A;  2HML B;  3B4O A;  3U1W A;  5BVB A;  3N54 B;  2IUK A;  5FW5 A;  3LH4 A;  2RNT A;  1BGS A;  4HM2 B;  1Q81 4;  4R1K A;  3DH2 A;  5D82 A;  3OW2 2;  1A90 A;  4NPB A;  5M18 A;  3PXM A;  4HOH A;  3EC9 A;  4EW5 A;  3NV0 A;  1UCL A;  2W56 A;  3WOF B;  3X3Z A;  4IT7 A;  1YIJ 3;  3HOH A;  1LQM B;  3JUM A;  1BNF A;  3FGY A;  3BND A;  2IMJ A;  1B2M A;  2CIU A;  1JBT A;  2RCD A;  3WA2 X;  1VQK 3;  1BSE A;  5JPP A;  3IPT A;  4K90 B;  4MJD A;  1A67 A;  1X1Y A;  1TRQ A;  1GS3 A;  1CYU A;  2W03 A;  3DGN A;  3MYT A;  4H3U A;  1YVB I;  5EEO A;  3HIG A;  3G71 3;  1LOX A;  3BB9 A;  3HX8 A;  5M19 A;  2GBW B;  2KF5 A;  1FYS A;  1SII A;  1T2H A;  3FF2 A;  1I0V A;  3PCR A;  4K61 A;  4J9A A;  1ZS7 A;  3CU3 A;  1Y4K A;  3NX0 A;  1BNJ A;  4FMD A;  1O7N B;  1GSP A;  3JUQ A;  5AYS C;  4AKZ A;  3BNB A;  3ZG0 A;  3CCJ 3;  2BT3 A;  3B4P A;  3EX9 A;  3ER7 A;  2CFK A;  4MMZ B;  4O02 B;  2PZV A;  1B20 A;  2SAR A;  3CCL 3;  1T2I A;  3EF8 A;  1N8R 4;  1JB2 A;  1RRL A;  2C4B A;  3T0U A;  3WHO A;  1JKG A;  3IJE B;  1M1X B;  3UB1 A;  2CWV A;  1NB5 I;  1B3S A;  2BMQ B;  2XFT A;  1JZD A;  3AHS A;  1AQZ A;  3Q90 A;  2XRX B;  3AMO A;  5A0O B;  1TU5 A;  3FKA A;  1GOV A;  3NBR A;  2D1W A;  3O8Y A;  1F8N A;  3DZL A;  2OTJ 3;  1KC8 4;  1B2X A;  2KF4 A;  1TJD A;  3OWS A;  1DE3 A;  5IF6 A;  4LEH A;  1BVI A;  1PFP A;  3WMD A;  2E2V A;  4N6U A;  1R4C A;  2P0M A;  3NV0 B;  1YGW A;  2W56 B;  1N8Q A;  1ISK A;  1FGT A;  1RGA A;  2SBL A;  3AGN A;  3NBJ A;  5LC6 A;  2QA4 3;  2ZL8 A;  4KVH A;  1PU4 A;  2CFD A;  2RSX A;  1G96 A;  3Q3F A;  5AEW B;  1BSD A;  4BTX A;  3CC7 3;  1FA3 A;  4LGQ A;  4HAA A;  1RGK A;  1W7C A;  1RN4 A;  2H0H A;  3GZY B;  4WP5 A;  3WOD G;  2WGO A;  1BRK A;  2IYJ A;  1KWI A;  3ZG5 A;  1FUW A;  2BU4 A;  4H61 A;  2Y73 A;  1W2B 2;  1Q9E A;  3S67 A;  2F4Y A;  3ROB A;  4IPB A;  1TP6 A;  4XBY A;  4RNZ A;  1FGR A;  1RGG A;  3H51 A;  3CCE 3;  1CH0 A;  3MHE A;  1DMM A;  2STD A;  5BU4 A;  1Q7H A;  5KP4 A;  5EQL A;  1VQ6 3;  2M7O A;  2RFR A;  1IVV A;  1X1U A;  4FR9 A;  1Q7Y 4;  5D81 A;  3B8L A;  5BXQ A;  3BIR A;  2ZA4 A;  1UDI I;  3LXU X;  3S5C A;  1EQK A;  1AVL A;  3A5E A;  3DGO A;  3URP A;  2CW9 A;  5HGR A;  2OQE A;  3UL6 A;  1NNV A;  2KCD A;  1JKG B;  1BSA A;  2IA7 A;  2P38 A;  1VQ9 3;  4OVM A;  3GZB A;  4J8T A;  5G1K A;  3DM8 A;  5FGO A;  3AMO B;  1E3V A;  2QEX 3;  3B7C A;  1IDP A;  1US1 A;  1MWU A;  1UI8 A;  1RTU A;  1O7P B;  2GU1 A;  3F7X A;  5G2G A;  3UNL A;  3LZA A;  1UUG B;  1RHL A;  4GL6 A;  2XEP A;  3QRD A;  1UUV B;  1Z1S A;  4L8P A;  1WQL B;  1VQP 3;  2LYX A;  3SX1 A;  1ULI B;  2GBX B;  3F8H A;  2YX9 A;  4FMA A;  1BRN L;  3DGY A;  3CD6 3;  3STD A;  1N9J A;  1GD3 A;  2GU3 A;  5TGN A;  1BAO A;  2WO0 A;  4GHO A;  2BHM A;  2XR8 B;  2CHC A;  1LOV A;  1OCV A;  4R4K A;  1I2F A;  2R41 A;  3BLZ A;  2F56 A;  1I70 A;  2O9U X;  4WYK A;  3A76 A;  1IU7 A;  2W0Q A;  3EQQ B;  1NDO B;  1GMQ A;  1QAL A;  3EBY A;  1W6G A;  4MMY B;  5ELU A;  3SLU A;  2RBI A;  3DXO A;  2E2T A;  1QAK A;  1IT8 A;  1QMA A;  2BO9 B;  2XH9 A;  5IER A;  1AVK A;  1BUJ A;  3WR2 A;  1DYU A;  4R9K A;  5CF1 A;  1WNH A;  2JQ5 A;  7STD A;  1I3F A;  1M1K 4;  1K28 A;  3F40 A;  1OF5 A;  4CPK A;  3D5I A;  1NJI 4;  1RCL A;  1ROA A;  3TDG A;  2GEY A;  3CCQ 3;  1FGO A;  1ZGX A;  2W6J H;  3JUP A;  5M1A A;  4L8O A;  4RNY A;  1JBS A;  4JRF A;  3RGR A;  3LTB A; 
#chains in the Genus database with same CATH homology
 3SVA A;  3DGM A;  1JB4 A;  4FCJ A;  3V98 A;  3I55 3;  3MSO A;  2Y74 A;  3LTA A;  2Z76 A;  2I9W A;  5IG4 A;  3G0K A;  3HK4 A;  3K7C A;  1IQY A;  4LSO A;  3PCS A;  1RJO A;  3KSP A;  5JBS A;  4U13 A;  1QJG A;  1DVC A;  2HMM B;  1CQS A;  2WGQ A;  5KP3 A;  2P0X A;  1JV2 B;  2B1X B;  1OUN A;  2Z77 A;  3EJV A;  2KXG A;  3CC2 3;  3EBT A;  3VF1 A;  2HMJ B;  4KFF A;  2CH9 A;  3OWU A;  1VZZ A;  4GB5 A;  3T8U A;  5EVH A;  1YGE A;  3CCR 3;  2HMK B;  3JVC A;  1D6Y A;  3OXA A;  4HZB B;  1VQM 3;  3X3X A;  2MF7 A;  2ML6 A;  4EV2 A;  5ELJ A;  5AI1 A;  5I97 A;  2XFS A;  2XF3 A;  3F8X A;  4EV5 A;  1VQO 3;  2C11 A;  1NO3 A;  3ECF A;  4WYK B;  3LT8 A;  5CK6 A;  1ULJ B;  2OWP A;  1OHO A;  4HM0 B;  3FZW A;  3Q1C A;  2YFJ B;  4N6T A;  4HYZ A;  4HM3 B;  5AIH A;  1DMQ A;  1TFO A;  1D6U A;  2CWU A;  3X42 A;  5AII A;  4HBR A;  1WMP A;  2BNG A;  2BMR B;  2XGL A;  4XBT A;  2OCT A;  3GRD A;  1GY6 A;  1JB5 A;  4FCM A;  1STF I;  1GY5 A;  4LMI A;  4EC6 A;  1VQ4 3;  3HII A;  2CFG A;  1HU9 A;  4N3V A;  4N6N B;  5KP1 A;  2R4I A;  1W00 A;  5CXO A;  2LQV A;  2Z6B A;  2W9Q A;  3KII A;  2V1L A;  1N5P A;  3ALA A;  3F7S A;  1K73 4;  2HMO B;  2Z7A A;  5IG3 A;  1W6Y A;  3RDE A;  1ROV A;  3SOA A;  6STD A;  1JJ2 2;  1HKX A;  3DY5 A;  2K54 A;  2ZDJ A;  4ZM8 A;  3FF0 A;  2P09 A;  5JPU A;  2B24 B;  3N9H A;  3FG3 A;  1OAC A;  3BNC A;  2ML5 A;  4LZI A;  3FH1 A;  1T5Y A;  1OHS A;  3G16 A;  1MOL A;  1ASK A;  4R9L A;  5D83 A;  1JNQ A;  1RKY A;  1W02 A;  2W04 A;  3MKI A;  4KFD A;  2XSO B;  3I56 3;  3FLJ A;  2FGT A;  3J7Y d;  5AEU B;  3DGL A;  3DMC A;  3LT9 A;  3NQY A;  2W2C A;  1YJW 3;  4WHA A;  8CHO A;  1N9E A;  1VQL 3;  3DUK A;  2CK3 H;  3CC4 3;  1L5G B;  1VQN 3;  4Q53 A;  3K5T A;  1C7H A;  3BNE A;  3F14 A;  1SJW A;  2WOH A;  3FSD A;  3RGA A;  2O3O A;  3HZP A;  2D42 A;  5IW9 A;  3KFQ C;  1TIJ A;  1K8A 4;  5IEO A;  1WMO A;  2MC8 A;  3PZW A;  2CFW A;  4JF8 A;  1STD A;  3KKG A;  2W9P A;  1DVD A;  3MWZ A;  1IV9 A;  3GAX A;  1O7G B;  2OOV C;  4XDW A;  4RZM A;  2QGU A;  5AIG A;  3GZX B;  4WFO A;  3FG1 A;  1KSI A;  4KZ1 A;  1LNH A;  2A15 A;  1IQX A;  4N6V 0;  1YJN 3;  1NU3 A;  2PNC A;  3KSE D;  2YFL B;  2INX A;  1QVF 2;  3KN4 A;  1KQS 2;  1A2V A;  2QIY A;  1ZO2 A;  1M90 4;  4N6L A;  1IT7 A;  1IV7 A;  2BMO B;  2F86 B;  4HZ9 B;  1FGM A;  2GEX A;  2FXT A;  3CXC 2;  3NQZ A;  2P05 A;  2OQE C;  3NHX A;  3G6E 3;  2F99 A;  4FCZ A;  3Q2P A;  3LOY A;  4RBN A;  1W2Z A;  1VQ8 3;  1UUW B;  3V92 A;  5IG0 A;  4BTY A;  2CKF B;  3K0Z A;  3CMA 3;  1SPU A;  3PS8 A;  4O2H A;  1D6Z A;  3NBB A;  1YHQ 3;  5LC7 A;  3CNM A;  1EKM A;  3EB8 A;  2XSH B;  3D9R A;  5AYR B;  1O7M B;  1TFK A;  2CG0 A;  3IMA B;  1AV4 A;  3L0R A;  3T8N A;  3UL5 A;  3OV4 A;  2CC3 A;  1U5O A;  1SIH A;  2K0M A;  3M8C A;  4HM5 B;  4NRE A;  4O3V A;  4HM8 B;  3EN8 A;  2HMN B;  4HM4 B;  3EN1 B;  3KZT A;  3E99 A;  2L4V A;  4I4K A;  4HM6 B;  1FGQ A;  1BUQ A;  3VGN A;  1JN5 A;  4EBG A;  2CG1 A;  3H3H A;  4XB5 A;  1LXE A;  1OGZ A;  1M9G A;  1IK3 A;  4MEI A;  1EG9 B;  1O7H B;  1Q86 4;  4IIA A;  1RRH A;  3JUO A;  1K41 A;  1EA2 A;  3VSY A;  4OUQ A;  1Q82 4;  4HKV B;  1WTH A;  3CCU 3;  5CF2 A;  3WA3 A;  4K1V A;  3U97 A;  4O8S A;  3GWR A;  1SQW A;  3NM2 A;  1U8C B;  3N8B A;  1UI7 A;  4N6M A;  4X2O A;  4HM1 B;  3WDG B;  3WOE B;  1LVN A;  1QVG 2;  1S5A A;  2IUJ A;  3SOY A;  4G1M B;  1OF5 B;  2GXF A;  1MNL A;  3SXX A;  5CLK A;  3FCS B;  4AKY A;  1QAF A;  1GYB A;  1Q40 A;  4MMX B;  3I0Y A;  4R80 A;  3S27 A;  3CME 3;  2FNQ A;  3FG4 A;  1OPY A;  3KE7 A;  3CNX A;  4ORL A;  5STD A;  4KFE A;  1KD1 4;  1O7W B;  4BTW A;  3X3Y A;  1E3R A;  2C10 A;  1S72 3;  2YFI B;  2E2U A;  4QWT A;  3K63 A;  1N5H A;  3EE1 A;  3NUV A;  4TX4 A;  3LML A;  1GY7 A;  1IQ8 A;  1CYV A;  4XDV A;  3UJM A;  1IVU A;  1ZX2 A;  2XGN A;  1JRQ A;  3MG1 A;  3G4S 3;  1JN5 B;  5IEN A;  2Q07 A;  3NXJ A;  3X41 A;  1A2K A;  3SED A;  3G8Z A;  1TUH A;  4WWU C;  4XM4 A;  2OOV A;  4FMB A;  3D3L A;  1IVX A;  5IEP A;  3CPW 2;  4HVN A;  1OH0 A;  1WMN A;  2OTL 3;  3HI7 A;  3EHC A;  3LYG A;  1CEW I;  1IVW A;  4N6O B;  1YJ9 3;  3S28 A;  4AEQ A;  3CCM 3;  3CCS 3;  1V74 A;  1J2B A;  3GZR A;  1K9M 4;  3S29 A;  1OGX A;  1NWW A;  4FMC A;  1VQ7 3;  3MG3 A;  3MPH A;  1VQ5 3;  4HJL B;  1DMN A;  1YI2 3;  2WOF A;  1W5Z A;  3PGB A;  4CCV A;  1E97 A;  1NB3 I;  4NHF A;  1Q40 B;  4L7K A;  2CWT A;  3F9S A;  4CDL A;  3NM7 A;  1YIT 3;  3V99 A;  1GD4 A;  1W6C A;  5IG5 A;  4EYC A;  1Q42 A;  3K9M C;  4HM7 B;  2JDI H;  5DRV A;  1W4N A;  3PYJ A;  3LTC A;  3OWY A;  4EXR A;  1W01 A;  1OHP A;  3QK9 A;  4PEJ A;  2KRT A;  2F98 A;  4K1U A;  3JUN A;  2CFL A;  2UX0 A;  4STD A;  4X2H A;  1UW1 A;  3CPO A;  5AIF A;  1AR0 A;  5DRE A;  4XBX A;  1RN7 A;  3MG2 A;  4OK0 A;  3X40 A;  3CCV 3;  3OX9 A;  2RGQ A;  3LTD A;  2HML B;  3B4O A;  3U1W A;  5BVB A;  3N54 B;  2IUK A;  5FW5 A;  3LH4 A;  4HM2 B;  1Q81 4;  4R1K A;  1A90 A;  5D82 A;  3OW2 2;  3PXM A;  3EC9 A;  3NV0 A;  2W56 A;  3WOF B;  3X3Z A;  4IT7 A;  1YIJ 3;  3JUM A;  3FGY A;  3BND A;  2IMJ A;  2CIU A;  2RCD A;  3WA2 X;  1VQK 3;  5JPP A;  3IPT A;  4K90 B;  4MJD A;  1A67 A;  1GS3 A;  1CYU A;  2W03 A;  3DGN A;  3MYT A;  4H3U A;  1YVB I;  5EEO A;  3HIG A;  3G71 3;  1LOX A;  3BB9 A;  3HX8 A;  2GBW B;  1SII A;  3FF2 A;  3PCR A;  4K61 A;  4J9A A;  3CU3 A;  1Y4K A;  3NX0 A;  4FMD A;  1O7N B;  3JUQ A;  5AYS C;  4AKZ A;  3BNB A;  3CCJ 3;  2BT3 A;  3B4P A;  3EX9 A;  3ER7 A;  2CFK A;  4MMZ B;  4O02 B;  2PZV A;  3CCL 3;  3EF8 A;  1N8R 4;  1JB2 A;  1RRL A;  3T0U A;  1JKG A;  3IJE B;  1M1X B;  3UB1 A;  2CWV A;  1NB5 I;  2BMQ B;  2XFT A;  3Q90 A;  2XRX B;  3AMO A;  5A0O B;  1TU5 A;  3FKA A;  3NBR A;  2D1W A;  3O8Y A;  1F8N A;  3DZL A;  2OTJ 3;  1KC8 4;  3OWS A;  5IF6 A;  4LEH A;  1PFP A;  3WMD A;  2E2V A;  4N6U A;  2P0M A;  1R4C A;  3NV0 B;  1ISK A;  2W56 B;  1N8Q A;  1FGT A;  5LC6 A;  2SBL A;  2QA4 3;  3NBJ A;  2ZL8 A;  4KVH A;  1PU4 A;  2CFD A;  2RSX A;  1G96 A;  5AEW B;  4BTX A;  3CC7 3;  1FA3 A;  4LGQ A;  1W7C A;  3GZY B;  4WP5 A;  3WOD G;  2WGO A;  1KWI A;  1FUW A;  4H61 A;  2Y73 A;  1W2B 2;  3S67 A;  3ROB A;  4IPB A;  1TP6 A;  4XBY A;  4RNZ A;  1FGR A;  3H51 A;  3CCE 3;  3MHE A;  1DMM A;  2STD A;  5KP4 A;  5EQL A;  1VQ6 3;  2M7O A;  2RFR A;  1IVV A;  4FR9 A;  1Q7Y 4;  5D81 A;  3B8L A;  5BXQ A;  3LXU X;  3S5C A;  1EQK A;  1AVL A;  3DGO A;  2CW9 A;  5HGR A;  2OQE A;  3UL6 A;  2KCD A;  1JKG B;  2IA7 A;  2P38 A;  1VQ9 3;  4OVM A;  3GZB A;  4J8T A;  3DM8 A;  5FGO A;  3AMO B;  1E3V A;  2QEX 3;  3B7C A;  1IDP A;  1US1 A;  1UI8 A;  1O7P B;  2GU1 A;  3F7X A;  5G2G A;  3UNL A;  3LZA A;  4GL6 A;  2XEP A;  1UUV B;  1Z1S A;  4L8P A;  1WQL B;  1VQP 3;  2LYX A;  3SX1 A;  1ULI B;  2GBX B;  3F8H A;  2YX9 A;  4FMA A;  3CD6 3;  3STD A;  1N9J A;  1GD3 A;  2GU3 A;  5TGN A;  2WO0 A;  2BHM A;  2XR8 B;  2CHC A;  1OCV A;  4R4K A;  3BLZ A;  2O9U X;  4WYK A;  3A76 A;  1IU7 A;  2W0Q A;  3EQQ B;  1NDO B;  1QAL A;  3EBY A;  4MMY B;  1W6G A;  5ELU A;  3SLU A;  3DXO A;  2E2T A;  1QAK A;  1IT8 A;  1QMA A;  2BO9 B;  2XH9 A;  5IER A;  1AVK A;  1DYU A;  4R9K A;  5CF1 A;  1WNH A;  2JQ5 A;  7STD A;  1M1K 4;  1K28 A;  3F40 A;  1OF5 A;  1NJI 4;  1ROA A;  3TDG A;  2GEY A;  3CCQ 3;  1FGO A;  2W6J H;  3JUP A;  3QRD A;  4L8O A;  4RNY A;  4JRF A;  3RGR A;  3LTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...