5IG3A

Crystal structure of the human camkii-alpha hub
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
144
Chain Sequence
HHHSSGLEVLFQGPHMVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium/calmodulin-dependent protein kinase type II subunit
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 144
sequence length 144
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig3A00
1O7MB 4CDLA 4X2OA 1JKGB 1OHPA 1JB4A 5FW5A 3E99A 3KSPA 3DXOA 3DZLA 4U13A 4R9LA 4OVMA 3NUVA 1EA2A 4L7KA 1TP6A 3S5CA 1Q40A 3MKIA 1GY6A 3MHEA 5D81A 3GZYB 3DUKA 1O7PB 3CU3A 3I0YA 1EG9B 3F8HA 3F40A 3D9RA 3MSOA 2UX0A 3FLJA 5BXQA 3VGNA 2F86B 3ER7A 5IG3A 4HM0B 3EC9A 3H3HA 4MJDA 3DMCA 3GZRA 5KP4A 4K1UA 2INXA 3DM8A 1K41A 4J9AA 3HZPA 2HMJB 3EBTA 2STDA 3K0ZA 4PEJA 2Z7AA 3EHCA 3MG1A 1UUWB 3Q90A 3FZWA 1JB2A 3KE7A 1W00A 2RGQA 2R4IA 2YFLB 1GS3A 3H51A 2Z77A 3G16A 3LZAA 4LEHA 4WWUC 1W02A 2QIYA 1ULIB 4L8PA 1DMQA 2CKFB 3EQQB 7STDA 1C7HA 1HKXA 5IERA 6STDA 2IMJA 4XM4A 1DMNA 3HX8A 3UNLA 3EX9A 2BMQB 1Q40B 3KZTA 1NDOB 4HVNA 5CK6A 1Z1SA 4IIAA 3GZBA 2GXFA 3STDA 3SOYA 2BNGA 4GB5A 5JPUA 3CPOA 5AI1A 3VSYA 1U5OA 1OUNA 3F8XA 4XBYA 5AIHA 5G2GA 5AIFA 2K54A 3IPTA 1VZZA 5IG0A 1Q42A 2XRXB 1GY7A 4LMIA 4XBTA 8CHOA 5D82A 2YFJB 3B8LA 3MYTA 4OUQA 2XR8B 1O7HB 5AEWB 2XSHB 3JUOA 4XDVA 4HZ9B 3F7XA 4WYKA 2PZVA 4HM7B 4WP5A 5STDA 4L8OA 3OWYA 4XB5A 1JB5A 5EVHA 3RGAA 1QJGA 5KP3A 4LGQA 1CQSA 2HMMB 3B4PA 3EF8A 2JQ5A 4FCMA 1NU3A 3GRDA 3RGRA 1ASKA 3FGYA 3NHXA 3MG3A 3ECFA 5AIIA 4KVHA 3EJVA 2HMNB 3UJMA 3CNMA 4HZBB 1BUQA 1ZX2A 3GWRA 3G8ZA 4R1KA 4XDWA 5AEUB 5CF2A 3OXAA 4HM1B 2HMLB 1W6YA 1OF5A 2HMKB 2YFIB 1ULJB 3G0KA 2F99A 4HM2B 2Z76A 1DMMA 1JN5A 4HM6B 3F9SA 3CNXA 3F14A 3HK4A 5IG4A 5CXOA 2OWPA 3LYGA 3T8NA 4I4KA 3K7CA 3GZXB 3NM2A 5HGRA 2BMRB 3JUPA 4R9KA 5D83A 3NBRA 1ZO2A 5DREA 4HM8B 4FCJA 1ISKA 4WYKB 3WMDA 2CHCA 4STDA 3B7CA 5IG5A 3EN1B 2I9WA 5IENA 1E3VA 3F7SA 3FF0A 3SOAA 4XBXA 3NV0A 3KKGA 5CF1A 1GYBA 5TGNA 2A15A 5IEOA 4RZMA 1A2KA 5BVBA 4HM4B 4J8TA 1JKGA 3OWSA 1O7GB 1AR0A 3FH1A 5IF6A 3JUMA 5IEPA 4ORLA 2GBWB 4HM5B 5KP1A 2GEXA 2XSOB 3JUQA 4HM3B 1O7NB 1OGZA 3SEDA 4X2HA 1OF5B 1OHOA 3MG2A 4N3VA 1S5AA 2B1XB 1JN5B 1STDA 3FF2A 3B4OA 1TUHA 3FSDA 2W2CA 2F98A 3NXJA 3BB9A 4Q53A 5CLKA 4HJLB 3A76A 3OV4A 1IDPA 4K1VA 2BMOB 1OHSA 1OGXA 5AIGA 3EBYA 2B24B 1OPYA 1O7WB 2QGUA 1OH0A 5JPPA 3M8CA 1E3RA 2RCDA 1E97A 4HKVB 2RFRA 4H3UA 1W01A 3FKAA 3EN8A 1GY5A 3JUNA 3OX9A 1NWWA 2GBXB 3T8UA 1SJWA 3NV0B 3BLZA 2HMOB 3OWUA 5DRVA 1WQLB 1OCVA 3ROBA 1UUVB 1QMAA 2GEYA
chains in the Genus database with same CATH superfamily
1O7MB 3N8BA 4CDLA 1VQQA 3BNEA 4X2OA 4BU4A 1YJ93 1BIRA 1JKGB 3ALAA 1OHPA 1JB4A 4GL6A 1YGWA 1MWTA 5FW5A 2W0QA 1BNSA 3E99A 1MGWA 2W6JH 3DXOA 2Q07A 3DZLA 3KSPA 4U13A 1W2B2 4R9LA 4OVMA 3ZFZA 3NUVA 3HIIA 5ELJA 1EA2A 3AMOA 4L7KA 1BRJA 4JF8A 4GSPA 4HBRA 1TP6A 1UCLA 1RN4A 2WOHA 1AVLA 3IJEB 4H61A 3S5CA 2OQEC 3O8YA 4N6OB 1Q40A 1LOWA 1ROVA 5M18A 2CFGA 3PCRA 3WHOA 3LTCA 3MKIA 1GY6A 3MHEA 5D81A 4EC6A 3BNCA 3KFQC 1RGFA 1RGAA 3DUKA 3GZYB 1KC84 1K9M4 1VQ53 2ZA4A 1DE3A 1O7PB 5EEOA 3CU3A 3LTBA 1FUSA 3I0YA 4MMXB 1EG9B 3F8HA 3DY5A 1I2FA 2CG0A 3SXXA 3F40A 4BL2A 4EV2A 1I3FA 1RN7A 2IY2A 2UX0A 2V1LA 3D9RA 3FLJA 3MSOA 1A90A 3LXUX 5BXQA 1A2PA 1YGEA 1NB5I 3VGNA 2F86B 2GSPA 2RBIA 1JRQA 3CC73 3ER7A 5IG3A 4HM0B 3EC9A 3H3HA 4MJDA 1EKMA 1OACA 3CPW2 2QEX3 1IVWA 3DMCA 1IQ8A 4FMAA 4BTXA 2GU3A 2F56A 1JNQA 3GZRA 1YI23 5KP4A 1HZ1A 4K1UA 2INXA 1B2ZA 1FGMA 1RRHA 3G6E3 3DM8A 1K41A 3WA3A 4J9AA 3LT9A 2FNQA 1Y4KA 3HZPA 2HMJB 1YNVX 3DGOA 3EBTA 4ZM8A 4CCVA 1VQK3 5A0OB 1RRLA 1ZGXA 2STDA 3K0ZA 4PEJA 4LZIA 2W04A 1VQ63 2Z7AA 1UCKA 1UUGB 1I2EA 2PNCA 3EHCA 1QVG2 3MG1A 1UUWB 5G1LA 1BNJA 2WO0A 2CW9A 3Q90A 1IVXA 2FXTA 1JB2A 3FZWA 3SYUA 3KE7A 2YX9A 5I97A 1W00A 2BU4A 2RGQA 1IVVA 3EE1A 3X3ZA 1FUWA 4KT3B 1JZDA 1TJDA 1BNFA 2R4IA 2YFLB 4R4KA 2Z6BA 1M1XB 1K8A4 1GS3A 3PZWA 3H51A 2Z77A 3G16A 3LZAA 4LEHA 1RNBA 4WWUC 3WDGB 3PYJA 1UI7A 1YVBI 4NPBA 1NJI4 1UI8A 3AHSA 1CYUA 1W02A 1RGHA 3CCE3 4EBGA 4O3VA 3UL6A 2QIYA 1SIHA 1TTOA 4KFEA 3K5TA 1ULIB 2CFWA 1T2HA 1DMQA 3NX0A 4L8PA 2CKFB 1KWIA 3S28A 1BNIA 3EQQB 3V99A 7STDA 1YIJ3 1QAFA 1C7HA 1M904 1HKXA 1N9JA 1U8CB 3S67A 1I2GA 5IERA 6STDA 2IMJA 4XM4A 1DMNA 1FGOA 1FGQA 3HX8A 3UNLA 2H0HA 1B2SA 1B27A 3EX9A 5AYRB 1TIJA 1RN1A 1LOXA 1NB3I 1BNGA 1BANA 1CEWI 1LQMB 2J8XB 1SIIA 1TRPA 2ZDJA 1VQ43 2BMQB 1Q40B 3KZTA 1NDOB 4BL3A 4HVNA 4EYCA 5CK6A 1N5PA 2SARA 4WHAA 1Z1SA 1UDII 1I3IA 4FCZA 4IIAA 5LC6A 2OTL3 3GZBA 1FZUA 2GXFA 1I70A 2CIUA 3SOYA 3STDA 3I553 2WOFA 1QALA 2BNGA 1M1K4 4GB5A 5JPUA 3CPOA 5AI1A 3GAXA 2KXGA 1KD14 3VSYA 1U5OA 1OUNA 3F8XA 4XBYA 2RSXA 4QWTA 2CWUA 1D6YA 4IPBA 1UGHI 1UGIA 4N6V0 1G0TA 3URPA 4CJNA 5AIHA 5G2GA 5AIFA 2K3DA 1IT8A 1BUJA 2K54A 3IPTA 3WODG 1VZZA 1BVIA 1Q42A 2XRXB 5IG0A 2XGLA 1VQN3 1IV7A 4WFOA 1GY7A 2F4YA 4LMIA 4NREA 4XBTA 4MMYB 1AVKA 1US1A 8CHOA 4DKIA 1SQWA 3KSED 1QVF2 2CH9A 1GD4A 5D82A 5IW9A 2YFJB 3B8LA 3EB8A 3MYTA 4OUQA 2XR8B 1O7HB 1RJOA 5AEWB 2XSHB 3JUOA 2F5WA 4XDVA 1BSBA 4CPKA 1WMNA 3NM7A 1IVUA 1ROAA 4HZ9B 3F7XA 1SPUA 3Q2PA 4WYKA 2JDIH 1UW1A 2L4VA 2PZVA 4HM7B 3A5EA 3PCSA 4GHOA 3G713 1S723 3DGYA 1N8R4 4WP5A 3PGBA 1IQYA 5STDA 2IUJA 4OK0A 2XGNA 4RNYA 1LXEA 3J7Yd 4L8OA 3HI7A 3OWYA 4XB5A 1JB5A 5EVHA 4EXRA 3RGAA 1QJGA 5KP3A 4HAAA 4LGQA 1F8NA 1CQSA 2HMMB 3B4PA 1RDSA 2JQ5A 3EF8A 1VQL3 3VF1A 2OCTA 4LSOA 2CC3A 4FCMA 3X3YA 1BSAA 1NU3A 2ZHXB 3GRDA 1LNHA 3RGRA 1T5YA 3AGNA 1N8QA 2E2UA 1ASKA 2P05A 2W03A 1Q7HA 3FGYA 5FGOA 3SLUA 1K734 3QK9A 3X41A 3LOYA 1Q864 1G02A 3NHXA 3MG3A 1DYUA 1VQO3 3ECFA 2ML6A 1RSNA 1RCKA 1BRKA 2L1SA 1IU7A 4AKYA 1C54A 5AIIA 2C4BA 4KVHA 3EJVA 1M9GA 4N6UA 1STFI 1GMPA 4N6MA 2HMNB 3UJMA 1BNEA 1B2UA 2GU1A 4KFDA 2FGTA 3BNBA 3LTAA 1HYFA 3KIIA 3Q3FA 1I8VA 5M19A 3CNMA 3CCJ3 2XH9A 1A2VA 4HZBB 1B2MA 1BUQA 1TU5A 1ZX2A 3GWRA 3FG1A 3G8ZA 1RGEA 3JVCA 3OW22 2KF6A 4JRFA 4R1KA 2E2VA 2KRTA 3BU4A 4XDWA 2IYJA 5AEUB 1BSCA 3AGOA 2MF7A 1MWSA 1JJ22 1BRSA 2ZL8A 3HOHA 1EQKA 2D1WA 1R4CA 5CF2A 3OXAA 3G4S3 3NBJA 1BNRA 1YJN3 4HM1B 3TDGA 2HMLB 1W6YA 3QRDA 1GMRA 1WMPA 3ZG5A 1YHQ3 1KSIA 5BU4A 1OF5A 2HMKB 1LOVA 3HIGA 2YFIB 3I563 1ULJB 5RNTA 1G96A 1GOUA 2M7OA 3G0KA 2E2TA 2BO9B 4K90B 1X1WA 1B21A 5LC7A 2F99A 1X1YA 4O02B 2CFDA 1AY7A 1RMSA 1SARA 1DMMA 2Z76A 4HM2B 5BIRA 1CYVA 3CME3 1JN5A 4HM6B 1BSEA 3AMOB 6RNTA 1BOXA 3F9SA 3CNXA 3CC23 3MPHA 1FW7A 3F14A 9RNTA 1K28A 3HK4A 5IG4A 5CXOA 2CX0A 2OWPA 1RLSA 4K61A 3V98A 2KF3A 3LYGA 4RBNA 3RDEA 3T8NA 4I4KA 3FCSB 3K7CA 1QAKA 2CX1A 4LYLB 1D6UA 3KN4A 3GZXB 1UCIA 3L0RA 1B20A 2CWVA 1RGCA 3NM2A 3D4AA 3S27A 1W6GA 1YIT3 1W2ZA 2SBLA 2W56A 2WGQA 1RGGA 3FG4A 1GOVA 5HGRA 3UB1A 2XFTA 2BMRB 1DVCA 2LYXA 1NNVA 3JUPA 1TRQA 4R9KA 5D83A 3NBRA 1ZO2A 2XEPA 4HOHA 3MWZA 1LQGC 1BGSA 3LT8A 3Q1CA 5DREA 3CMA3 3BIRA 1W5ZA 4HM8B 4FCJA 5AYSC 4J5KA 3AHWA 4WYKB 3WMDA 1VQM3 1ISKA 1AQZA 4I5QA 4AEQA 1TFOA 3D5GA 2CHCA 1W7CA 3DGLA 4STDA 3B7CA 1RKYA 2OTJ3 1RTUA 5IG5A 2W9QA 1LRAA 2Y73A 4RNTA 3WA2X 1BRIA 1BSDA 1KQS2 1B3SA 3X42A 3EN1B 1BRNL 2I9WA 5IENA 4MMZB 4N6NB 3FG3A 1DVDA 1YVSA 5M1AA 1E3VA 7GSPA 1WTHA 2KF4A 2P09A 3F7SA 1X1XA 2CFKA 2R41A 1MOLA 2UGIA 1FGRA 3FF0A 3SOAA 2W9PA 2P0XA 1Q7Y4 4XBXA 3NV0A 1MNLA 2BIRA 4N6TA 3KKGA 3SVAA 5CF1A 1VQ93 1GYBA 2MC8A 5TGNA 1X1UA 2A15A 3NQZA 1JBSA 3LH4A 1IT7A 5IEOA 4J5GA 4RZMA 4MEIA 4O2HA 1JZOA 2IA7A 3UL5A 1A2KA 1W4NA 3GSPA 4HM4B 5BVBA 1FA3A 1NO3A 4J8TA 2Y74A 1JKGA 4FR9A 2WGOA 3OWSA 1IK3A 1O7GB 3CCL3 4TX4A 1AR0A 1EEJA 4RNZA 3RNTA 3FH1A 5HOHA 4BIRA 1Q9EA 3D5IA 1Q814 5IF6A 1JV2B 3JUMA 3K9MC 3WOFB 5IEPA 2HOHA 3T0UA 3CC43 4ORLA 2GBWB 3DH2A 4R80A 2XFSA 3N54B 2CK3H 4HM5B 2IUKA 5KP1A 3CCR3 2GEXA 5GSPA 3D3LA 3PXMA 2P38A 2XSOB 1PYLA 1N5HA 3JUQA 4HM3B 5ELUA 1O7NB 1OGZA 4IT7A 3DGNA 3PS8A 3SEDA 3SX1A 2XF3A 4EV5A 1V74A 1BRGA 4FMBA 4G1MB 4X2HA 1TFKA 1OF5B 1OHOA 1JBRA 2KCDA 3MG2A 3CD63 2O9UX 3N9HA 1RCLA 1J2BA 3CCM3 4EW5A 1HU9A 3CCQ3 1GMQA 4N3VA 1BRHA 1V58A 1EUIC 1S5AA 3CCS3 2B1XB 1N9EA 1R4YA 1W6CA 1LVNA 2H0GA 1JN5B 1STDA 1GD3A 3FF2A 4KFFA 3CXC2 2UUGC 1PY3A 3B4OA 1BAOA 1IQXA 1YJW3 3D79A 3WOEB 1TUHA 3FSDA 2LQVA 2W2CA 2F98A 5EQLA 3NXJA 1RNTA 2AADA 4FMCA 2CG1A 3BB9A 2KAAA 4Q53A 5CLKA 4HJLB 3K63A 4BTWA 1BU4A 3U1WA 1UCJA 2OOVA 3A76A 3ZG0A 3OV4A 1IDPA 1B2XA 1RGKA 2ML5A 3IMAB 4ILFA 2W56B 1DETA 3S29A 1V57A 1I0XA 8RNTA 4K1VA 1PU4A 2BMOB 1FUTA 4FMDA 1OHSA 1OGXA 2D42A 5AIGA 1JBTA 3EBYA 2BT3A 7RNTA 1FYSA 1T3BA 2C11A 1ZS7A 2B24B 1OPYA 3NBBA 3NQYA 1O7WB 4N6LA 2QGUA 1IV9A 1OH0A 2OQEA 5JPPA 4KZ1A 5JBSA 2C10A 2CWTA 3M8CA 4BTYA 1MWUA 1E3RA 1MWRA 4NHFA 2KF5A 2RCDA 6GSPA 1FGTA 3V92A 1E97A 1PFPA 4HKVB 1L5GB 3LTDA 2RFRA 1VQ73 5G1KA 3X40A 3DGMA 4H3UA 1WMOA 1W01A 3FKAA 3EN8A 1RGLA 3LMLA 4AKZA 1GY5A 2F5MA 1LNIA 3JUNA 3OX9A 3U97A 2QA43 1D6ZA 1T2IA 1NWWA 2BHMA 2GBXB 3T8UA 1AV4A 3CCV3 1SJWA 3CCU3 3NV0B 2RNTA 2AAEA 1MGRA 3BLZA 1GSPA 1WNHA 2HMOB 3X3XA 2K0MA 3BNDA 2O3OA 1Q824 1LOYA 1A67A 2P0MA 1I0VA 1RHLA 2CFLA 3OWUA 5DRVA 1VQP3 1WQLB 4HYZA 1IYYA 1OCVA 3KCHA 4O8SA 1CH0A 3ROBA 1VQ83 1UUVB 2OOVC 1QMAA 1GOYA 3WR2A 2H0IA 2GEYA
chains in the Genus database with same CATH topology
1O7MB 3N8BA 4CDLA 1JJ22 3BNEA 4X2OA 1YJ93 1KC84 1JKGB 2OTL3 3ALAA 1OHPA 1JB4A 4GL6A 5FW5A 2W0QA 3E99A 1W2B2 2W6JH 3DXOA 2Q07A 3DZLA 3KSPA 4U13A 4R9LA 4OVMA 3NUVA 3HIIA 5ELJA 1EA2A 3AMOA 4L7KA 4JF8A 4HBRA 1TP6A 2WOHA 1AVLA 3IJEB 4H61A 3S5CA 2OQEC 3O8YA 4N6OB 1Q40A 1ROVA 2CFGA 3PCRA 3LTCA 3MKIA 1GY6A 3MHEA 5D81A 4EC6A 3BNCA 3KFQC 3GZYB 3DUKA 1K9M4 1VQ53 1O7PB 5EEOA 3CU3A 3LTBA 4MMXB 3I0YA 1EG9B 3F8HA 3DY5A 2CG0A 3SXXA 3F40A 4EV2A 3D9RA 1RN7A 2UX0A 2V1LA 3MSOA 3FLJA 1A90A 3LXUX 5BXQA 1YGEA 1NB5I 3VGNA 2F86B 3CC73 1JRQA 3ER7A 5IG3A 4HM0B 3EC9A 3H3HA 4MJDA 1EKMA 1OACA 3CPW2 2QEX3 1IVWA 3DMCA 1IQ8A 4FMAA 2GU3A 1JNQA 3GZRA 1YI23 5KP4A 4K1UA 2INXA 1FGMA 1RRHA 3G6E3 3DM8A 1K41A 3WA3A 4J9AA 3LT9A 2FNQA 1Y4KA 3HZPA 2HMJB 3DGOA 3EBTA 4ZM8A 4CCVA 1VQK3 5A0OB 1RRLA 2STDA 3K0ZA 4PEJA 4LZIA 2W04A 1VQ63 2Z7AA 2PNCA 3EHCA 1QVG2 3MG1A 1UUWB 3Q90A 2WO0A 2CW9A 1IVXA 2FXTA 1JB2A 3FZWA 3KE7A 2YX9A 5I97A 1W00A 2RGQA 3EE1A 1IVVA 3X3ZA 1FUWA 2R4IA 2YFLB 4R4KA 2Z6BA 1M1XB 1K8A4 1GS3A 3PZWA 3H51A 2Z77A 3G16A 3LZAA 4LEHA 4WWUC 3WDGB 3PYJA 1UI7A 1YVBI 1NJI4 1UI8A 1CYUA 1W02A 3CCE3 4EBGA 4O3VA 3UL6A 2QIYA 1SIHA 4KFEA 3K5TA 1ULIB 2CFWA 4L8PA 1DMQA 3NX0A 2CKFB 1KWIA 3S28A 3EQQB 3V99A 7STDA 1YIJ3 1QAFA 1C7HA 1M904 1HKXA 1N9JA 1U8CB 3S67A 5IERA 6STDA 2IMJA 4XM4A 1DMNA 1FGOA 1FGQA 3HX8A 3UNLA 5AYRB 3EX9A 1TIJA 1LOXA 1NB3I 1CEWI 1SIIA 2ZDJA 1VQ43 2BMQB 1Q40B 3KZTA 1NDOB 4HVNA 4EYCA 5CK6A 1N5PA 4WHAA 1Z1SA 4IIAA 5LC6A 4FCZA 3GZBA 2GXFA 3SOYA 2CIUA 3STDA 3I553 2WOFA 1QALA 2BNGA 1M1K4 4GB5A 5JPUA 3CPOA 5AI1A 3GAXA 2KXGA 1KD14 3VSYA 1U5OA 1OUNA 3F8XA 4XBYA 2RSXA 4QWTA 2CWUA 1D6YA 4IPBA 4N6V0 5AIHA 5G2GA 5AIFA 1IT8A 2K54A 3IPTA 3WODG 1VZZA 5IG0A 1Q42A 2XRXB 2XGLA 1VQN3 1IV7A 4WFOA 1GY7A 4LMIA 4NREA 4XBTA 4MMYB 1AVKA 1US1A 8CHOA 1SQWA 3KSED 1QVF2 2CH9A 1GD4A 5D82A 5IW9A 2YFJB 3B8LA 3EB8A 3MYTA 4OUQA 2XR8B 1O7HB 1RJOA 5AEWB 2XSHB 3JUOA 4XDVA 1WMNA 3NM7A 1IVUA 1ROAA 4HZ9B 3F7XA 1SPUA 3Q2PA 4WYKA 2JDIH 1UW1A 2L4VA 2PZVA 4HM7B 1N8R4 3PCSA 3G713 1S723 4WP5A 3PGBA 1IQYA 5STDA 2IUJA 4OK0A 2XGNA 4RNYA 1LXEA 3J7Yd 4L8OA 3HI7A 3OWYA 4XB5A 1JB5A 5EVHA 4EXRA 3RGAA 1QJGA 5KP3A 4LGQA 1F8NA 1CQSA 3B4PA 2HMMB 3EF8A 2JQ5A 1VQL3 3VF1A 2OCTA 4LSOA 2CC3A 4FCMA 3X3YA 1NU3A 3GRDA 1LNHA 3RGRA 1T5YA 1N8QA 2E2UA 1ASKA 2P05A 2W03A 3FGYA 5FGOA 3SLUA 1K734 3QK9A 3X41A 3LOYA 1Q864 3NHXA 3MG3A 1DYUA 1VQO3 3ECFA 2ML6A 1IU7A 4AKYA 5AIIA 4KVHA 3EJVA 1M9GA 4N6UA 1STFI 4N6MA 2HMNB 3UJMA 2GU1A 4KFDA 2FGTA 3BNBA 3LTAA 3KIIA 3CNMA 3CCJ3 2XH9A 1A2VA 4HZBB 1BUQA 1TU5A 1ZX2A 3GWRA 3FG1A 3G8ZA 3JVCA 3OW22 4JRFA 4R1KA 2E2VA 2KRTA 4XDWA 5AEUB 2MF7A 2ZL8A 1EQKA 2D1WA 1R4CA 5CF2A 3OXAA 3G4S3 3NBJA 1YJN3 4HM1B 3TDGA 2HMLB 1W6YA 3QRDA 1WMPA 1YHQ3 1KSIA 1OF5A 2HMKB 3HIGA 2YFIB 3I563 1ULJB 1G96A 2M7OA 3G0KA 2E2TA 2BO9B 4K90B 5LC7A 2F99A 4O02B 2CFDA 4HM2B 2Z76A 1DMMA 3CME3 1CYVA 1JN5A 4HM6B 3AMOB 3F9SA 3CC23 3CNXA 3MPHA 3F14A 1K28A 3HK4A 5IG4A 5CXOA 2OWPA 4K61A 3V98A 3LYGA 4RBNA 3RDEA 3T8NA 4I4KA 3FCSB 3K7CA 1QAKA 1D6UA 3KN4A 3GZXB 3L0RA 2CWVA 3NM2A 3S27A 1YIT3 1W6GA 1W2ZA 2SBLA 2W56A 2WGQA 3FG4A 3UB1A 5HGRA 2XFTA 2BMRB 1DVCA 2LYXA 3JUPA 4R9KA 5D83A 3NBRA 1ZO2A 2XEPA 3MWZA 3LT8A 3Q1CA 5DREA 3CMA3 1W5ZA 4HM8B 4FCJA 5AYSC 4WYKB 1VQM3 3WMDA 1ISKA 4AEQA 1TFOA 2CHCA 1W7CA 3DGLA 4STDA 3B7CA 1RKYA 2OTJ3 5IG5A 2W9QA 2Y73A 3WA2X 1KQS2 3X42A 3EN1B 2I9WA 5IENA 4MMZB 4N6NB 3FG3A 1DVDA 1E3VA 1WTHA 2P09A 3F7SA 2CFKA 3FF0A 1MOLA 1FGRA 3SOAA 2W9PA 2P0XA 1Q7Y4 4XBXA 3NV0A 1MNLA 4N6TA 3KKGA 3SVAA 5CF1A 1VQ93 1GYBA 2MC8A 5TGNA 2A15A 3NQZA 3LH4A 1IT7A 5IEOA 4RZMA 4MEIA 4O2HA 2IA7A 3UL5A 1A2KA 1W4NA 4HM4B 5BVBA 1FA3A 1NO3A 4J8TA 2Y74A 1JKGA 4FR9A 2WGOA 3OWSA 1IK3A 1O7GB 3CCL3 4TX4A 1AR0A 4RNZA 3FH1A 1Q814 5IF6A 1JV2B 3JUMA 3K9MC 3WOFB 5IEPA 3CC43 3T0UA 4ORLA 2GBWB 4R80A 2XFSA 3N54B 2CK3H 4HM5B 2IUKA 5KP1A 3CCR3 2GEXA 3D3LA 3PXMA 2P38A 2XSOB 1N5HA 3JUQA 4HM3B 5ELUA 1O7NB 1OGZA 4IT7A 3DGNA 3PS8A 3SEDA 3SX1A 2XF3A 4EV5A 1V74A 4FMBA 4G1MB 4X2HA 1TFKA 1OF5B 1OHOA 2KCDA 3MG2A 3CD63 2O9UX 3N9HA 1J2BA 3CCM3 1HU9A 3CCQ3 4N3VA 1S5AA 3CCS3 1N9EA 2B1XB 1W6CA 1LVNA 1JN5B 1STDA 1GD3A 3FF2A 4KFFA 3CXC2 3B4OA 1IQXA 1YJW3 3WOEB 1TUHA 3FSDA 2LQVA 2W2CA 2F98A 5EQLA 3NXJA 2CG1A 4FMCA 3BB9A 4Q53A 5CLKA 4HJLB 3K63A 4BTWA 3U1WA 2OOVA 3A76A 3OV4A 1IDPA 2ML5A 3IMAB 2W56B 3S29A 4K1VA 1PU4A 2BMOB 4FMDA 1OHSA 1OGXA 2D42A 5AIGA 3EBYA 2BT3A 3NBBA 4BTXA 2C11A 2B24B 1OPYA 4N6LA 3NQYA 1O7WB 2OQEA 2QGUA 1IV9A 1OH0A 5JPPA 4KZ1A 5JBSA 2C10A 2CWTA 3M8CA 4BTYA 1E3RA 4NHFA 2RCDA 1FGTA 3V92A 1E97A 1PFPA 4HKVB 1L5GB 3LTDA 2RFRA 1VQ73 3X40A 3DGMA 4H3UA 1WMOA 1W01A 3FKAA 3EN8A 3LMLA 4AKZA 1GY5A 3JUNA 3OX9A 2QA43 3U97A 1D6ZA 2BHMA 1NWWA 2GBXB 3T8UA 3CCV3 1AV4A 1SJWA 3CCU3 3NV0B 3BLZA 1WNHA 2HMOB 3X3XA 2K0MA 3BNDA 2O3OA 1Q824 1A67A 2P0MA 2CFLA 3OWUA 5DRVA 1VQP3 1WQLB 4HYZA 1OCVA 4O8SA 3ROBA 1VQ83 1UUVB 2OOVC 1QMAA 2GEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7M B;  4CDL A;  4X2O A;  1JKG B;  1OHP A;  1JB4 A;  5FW5 A;  3E99 A;  3KSP A;  3DXO A;  3DZL A;  4U13 A;  4R9L A;  4OVM A;  3NUV A;  1EA2 A;  4L7K A;  1TP6 A;  3S5C A;  1Q40 A;  3MKI A;  1GY6 A;  3MHE A;  5D81 A;  3GZY B;  3DUK A;  1O7P B;  3CU3 A;  3I0Y A;  1EG9 B;  3F8H A;  3F40 A;  3D9R A;  3MSO A;  2UX0 A;  3FLJ A;  5BXQ A;  3VGN A;  2F86 B;  3ER7 A;  5IG3 A;  4HM0 B;  3EC9 A;  3H3H A;  4MJD A;  3DMC A;  3GZR A;  5KP4 A;  4K1U A;  2INX A;  3DM8 A;  1K41 A;  4J9A A;  3HZP A;  2HMJ B;  3EBT A;  2STD A;  3K0Z A;  4PEJ A;  2Z7A A;  3EHC A;  3MG1 A;  1UUW B;  3Q90 A;  3FZW A;  1JB2 A;  3KE7 A;  1W00 A;  2RGQ A;  2R4I A;  2YFL B;  1GS3 A;  3H51 A;  2Z77 A;  3G16 A;  3LZA A;  4LEH A;  4WWU C;  1W02 A;  2QIY A;  1ULI B;  4L8P A;  1DMQ A;  2CKF B;  3EQQ B;  7STD A;  1C7H A;  1HKX A;  5IER A;  6STD A;  2IMJ A;  4XM4 A;  1DMN A;  3HX8 A;  3UNL A;  3EX9 A;  2BMQ B;  1Q40 B;  3KZT A;  1NDO B;  4HVN A;  5CK6 A;  1Z1S A;  4IIA A;  3GZB A;  2GXF A;  3STD A;  3SOY A;  2BNG A;  4GB5 A;  5JPU A;  3CPO A;  5AI1 A;  3VSY A;  1U5O A;  1OUN A;  3F8X A;  4XBY A;  5AIH A;  5G2G A;  5AIF A;  2K54 A;  3IPT A;  1VZZ A;  5IG0 A;  1Q42 A;  2XRX B;  1GY7 A;  4LMI A;  4XBT A;  8CHO A;  5D82 A;  2YFJ B;  3B8L A;  3MYT A;  4OUQ A;  2XR8 B;  1O7H B;  5AEW B;  2XSH B;  3JUO A;  4XDV A;  4HZ9 B;  3F7X A;  4WYK A;  2PZV A;  4HM7 B;  4WP5 A;  5STD A;  4L8O A;  3OWY A;  4XB5 A;  1JB5 A;  5EVH A;  3RGA A;  1QJG A;  5KP3 A;  4LGQ A;  1CQS A;  2HMM B;  3B4P A;  3EF8 A;  2JQ5 A;  4FCM A;  1NU3 A;  3GRD A;  3RGR A;  1ASK A;  3FGY A;  3NHX A;  3MG3 A;  3ECF A;  5AII A;  4KVH A;  3EJV A;  2HMN B;  3UJM A;  3CNM A;  4HZB B;  1BUQ A;  1ZX2 A;  3GWR A;  3G8Z A;  4R1K A;  4XDW A;  5AEU B;  5CF2 A;  3OXA A;  4HM1 B;  2HML B;  1W6Y A;  1OF5 A;  2HMK B;  2YFI B;  1ULJ B;  3G0K A;  2F99 A;  4HM2 B;  2Z76 A;  1DMM A;  1JN5 A;  4HM6 B;  3F9S A;  3CNX A;  3F14 A;  3HK4 A;  5IG4 A;  5CXO A;  2OWP A;  3LYG A;  3T8N A;  4I4K A;  3K7C A;  3GZX B;  3NM2 A;  5HGR A;  2BMR B;  3JUP A;  4R9K A;  5D83 A;  3NBR A;  1ZO2 A;  5DRE A;  4HM8 B;  4FCJ A;  1ISK A;  4WYK B;  3WMD A;  2CHC A;  4STD A;  3B7C A;  5IG5 A;  3EN1 B;  2I9W A;  5IEN A;  1E3V A;  3F7S A;  3FF0 A;  3SOA A;  4XBX A;  3NV0 A;  3KKG A;  5CF1 A;  1GYB A;  5TGN A;  2A15 A;  5IEO A;  4RZM A;  1A2K A;  5BVB A;  4HM4 B;  4J8T A;  1JKG A;  3OWS A;  1O7G B;  1AR0 A;  3FH1 A;  5IF6 A;  3JUM A;  5IEP A;  4ORL A;  2GBW B;  4HM5 B;  5KP1 A;  2GEX A;  2XSO B;  3JUQ A;  4HM3 B;  1O7N B;  1OGZ A;  3SED A;  4X2H A;  1OF5 B;  1OHO A;  3MG2 A;  4N3V A;  1S5A A;  2B1X B;  1JN5 B;  1STD A;  3FF2 A;  3B4O A;  1TUH A;  3FSD A;  2W2C A;  2F98 A;  3NXJ A;  3BB9 A;  4Q53 A;  5CLK A;  4HJL B;  3A76 A;  3OV4 A;  1IDP A;  4K1V A;  2BMO B;  1OHS A;  1OGX A;  5AIG A;  3EBY A;  2B24 B;  1OPY A;  1O7W B;  2QGU A;  1OH0 A;  5JPP A;  3M8C A;  1E3R A;  2RCD A;  1E97 A;  4HKV B;  2RFR A;  4H3U A;  1W01 A;  3FKA A;  3EN8 A;  1GY5 A;  3JUN A;  3OX9 A;  1NWW A;  2GBX B;  3T8U A;  1SJW A;  3NV0 B;  3BLZ A;  2HMO B;  3OWU A;  5DRV A;  1WQL B;  1OCV A;  3ROB A;  1UUV B;  1QMA A;  2GEY A; 
#chains in the Genus database with same CATH topology
 1O7M B;  3N8B A;  4CDL A;  1VQQ A;  3BNE A;  4X2O A;  4BU4 A;  1YJ9 3;  1BIR A;  1JKG B;  3ALA A;  1OHP A;  1JB4 A;  4GL6 A;  1YGW A;  1MWT A;  5FW5 A;  2W0Q A;  1BNS A;  3E99 A;  1MGW A;  2W6J H;  3DXO A;  2Q07 A;  3DZL A;  3KSP A;  4U13 A;  1W2B 2;  4R9L A;  4OVM A;  3ZFZ A;  3NUV A;  3HII A;  5ELJ A;  1EA2 A;  3AMO A;  4L7K A;  1BRJ A;  4JF8 A;  4GSP A;  4HBR A;  1TP6 A;  1UCL A;  1RN4 A;  2WOH A;  1AVL A;  3IJE B;  4H61 A;  3S5C A;  2OQE C;  3O8Y A;  4N6O B;  1Q40 A;  1LOW A;  1ROV A;  5M18 A;  2CFG A;  3PCR A;  3WHO A;  3LTC A;  3MKI A;  1GY6 A;  3MHE A;  5D81 A;  4EC6 A;  3BNC A;  3KFQ C;  1RGF A;  1RGA A;  3DUK A;  3GZY B;  1KC8 4;  1K9M 4;  1VQ5 3;  2ZA4 A;  1DE3 A;  1O7P B;  5EEO A;  3CU3 A;  3LTB A;  1FUS A;  3I0Y A;  4MMX B;  1EG9 B;  3F8H A;  3DY5 A;  1I2F A;  2CG0 A;  3SXX A;  3F40 A;  4BL2 A;  4EV2 A;  1I3F A;  1RN7 A;  2IY2 A;  2UX0 A;  2V1L A;  3D9R A;  3FLJ A;  3MSO A;  1A90 A;  3LXU X;  5BXQ A;  1A2P A;  1YGE A;  1NB5 I;  3VGN A;  2F86 B;  2GSP A;  2RBI A;  1JRQ A;  3CC7 3;  3ER7 A;  5IG3 A;  4HM0 B;  3EC9 A;  3H3H A;  4MJD A;  1EKM A;  1OAC A;  3CPW 2;  2QEX 3;  1IVW A;  3DMC A;  1IQ8 A;  4FMA A;  4BTX A;  2GU3 A;  2F56 A;  1JNQ A;  3GZR A;  1YI2 3;  5KP4 A;  1HZ1 A;  4K1U A;  2INX A;  1B2Z A;  1FGM A;  1RRH A;  3G6E 3;  3DM8 A;  1K41 A;  3WA3 A;  4J9A A;  3LT9 A;  2FNQ A;  1Y4K A;  3HZP A;  2HMJ B;  1YNV X;  3DGO A;  3EBT A;  4ZM8 A;  4CCV A;  1VQK 3;  5A0O B;  1RRL A;  1ZGX A;  2STD A;  3K0Z A;  4PEJ A;  4LZI A;  2W04 A;  1VQ6 3;  2Z7A A;  1UCK A;  1UUG B;  1I2E A;  2PNC A;  3EHC A;  1QVG 2;  3MG1 A;  1UUW B;  5G1L A;  1BNJ A;  2WO0 A;  2CW9 A;  3Q90 A;  1IVX A;  2FXT A;  1JB2 A;  3FZW A;  3SYU A;  3KE7 A;  2YX9 A;  5I97 A;  1W00 A;  2BU4 A;  2RGQ A;  1IVV A;  3EE1 A;  3X3Z A;  1FUW A;  4KT3 B;  1JZD A;  1TJD A;  1BNF A;  2R4I A;  2YFL B;  4R4K A;  2Z6B A;  1M1X B;  1K8A 4;  1GS3 A;  3PZW A;  3H51 A;  2Z77 A;  3G16 A;  3LZA A;  4LEH A;  1RNB A;  4WWU C;  3WDG B;  3PYJ A;  1UI7 A;  1YVB I;  4NPB A;  1NJI 4;  1UI8 A;  3AHS A;  1CYU A;  1W02 A;  1RGH A;  3CCE 3;  4EBG A;  4O3V A;  3UL6 A;  2QIY A;  1SIH A;  1TTO A;  4KFE A;  3K5T A;  1ULI B;  2CFW A;  1T2H A;  1DMQ A;  3NX0 A;  4L8P A;  2CKF B;  1KWI A;  3S28 A;  1BNI A;  3EQQ B;  3V99 A;  7STD A;  1YIJ 3;  1QAF A;  1C7H A;  1M90 4;  1HKX A;  1N9J A;  1U8C B;  3S67 A;  1I2G A;  5IER A;  6STD A;  2IMJ A;  4XM4 A;  1DMN A;  1FGO A;  1FGQ A;  3HX8 A;  3UNL A;  2H0H A;  1B2S A;  1B27 A;  3EX9 A;  5AYR B;  1TIJ A;  1RN1 A;  1LOX A;  1NB3 I;  1BNG A;  1BAN A;  1CEW I;  1LQM B;  2J8X B;  1SII A;  1TRP A;  2ZDJ A;  1VQ4 3;  2BMQ B;  1Q40 B;  3KZT A;  1NDO B;  4BL3 A;  4HVN A;  4EYC A;  5CK6 A;  1N5P A;  2SAR A;  4WHA A;  1Z1S A;  1UDI I;  1I3I A;  4FCZ A;  4IIA A;  5LC6 A;  2OTL 3;  3GZB A;  1FZU A;  2GXF A;  1I70 A;  2CIU A;  3SOY A;  3STD A;  3I55 3;  2WOF A;  1QAL A;  2BNG A;  1M1K 4;  4GB5 A;  5JPU A;  3CPO A;  5AI1 A;  3GAX A;  2KXG A;  1KD1 4;  3VSY A;  1U5O A;  1OUN A;  3F8X A;  4XBY A;  2RSX A;  4QWT A;  2CWU A;  1D6Y A;  4IPB A;  1UGH I;  1UGI A;  4N6V 0;  1G0T A;  3URP A;  4CJN A;  5AIH A;  5G2G A;  5AIF A;  2K3D A;  1IT8 A;  1BUJ A;  2K54 A;  3IPT A;  3WOD G;  1VZZ A;  1BVI A;  1Q42 A;  2XRX B;  5IG0 A;  2XGL A;  1VQN 3;  1IV7 A;  4WFO A;  1GY7 A;  2F4Y A;  4LMI A;  4NRE A;  4XBT A;  4MMY B;  1AVK A;  1US1 A;  8CHO A;  4DKI A;  1SQW A;  3KSE D;  1QVF 2;  2CH9 A;  1GD4 A;  5D82 A;  5IW9 A;  2YFJ B;  3B8L A;  3EB8 A;  3MYT A;  4OUQ A;  2XR8 B;  1O7H B;  1RJO A;  5AEW B;  2XSH B;  3JUO A;  2F5W A;  4XDV A;  1BSB A;  4CPK A;  1WMN A;  3NM7 A;  1IVU A;  1ROA A;  4HZ9 B;  3F7X A;  1SPU A;  3Q2P A;  4WYK A;  2JDI H;  1UW1 A;  2L4V A;  2PZV A;  4HM7 B;  3A5E A;  3PCS A;  4GHO A;  3G71 3;  1S72 3;  3DGY A;  1N8R 4;  4WP5 A;  3PGB A;  1IQY A;  5STD A;  2IUJ A;  4OK0 A;  2XGN A;  4RNY A;  1LXE A;  3J7Y d;  4L8O A;  3HI7 A;  3OWY A;  4XB5 A;  1JB5 A;  5EVH A;  4EXR A;  3RGA A;  1QJG A;  5KP3 A;  4HAA A;  4LGQ A;  1F8N A;  1CQS A;  2HMM B;  3B4P A;  1RDS A;  2JQ5 A;  3EF8 A;  1VQL 3;  3VF1 A;  2OCT A;  4LSO A;  2CC3 A;  4FCM A;  3X3Y A;  1BSA A;  1NU3 A;  2ZHX B;  3GRD A;  1LNH A;  3RGR A;  1T5Y A;  3AGN A;  1N8Q A;  2E2U A;  1ASK A;  2P05 A;  2W03 A;  1Q7H A;  3FGY A;  5FGO A;  3SLU A;  1K73 4;  3QK9 A;  3X41 A;  3LOY A;  1Q86 4;  1G02 A;  3NHX A;  3MG3 A;  1DYU A;  1VQO 3;  3ECF A;  2ML6 A;  1RSN A;  1RCK A;  1BRK A;  2L1S A;  1IU7 A;  4AKY A;  1C54 A;  5AII A;  2C4B A;  4KVH A;  3EJV A;  1M9G A;  4N6U A;  1STF I;  1GMP A;  4N6M A;  2HMN B;  3UJM A;  1BNE A;  1B2U A;  2GU1 A;  4KFD A;  2FGT A;  3BNB A;  3LTA A;  1HYF A;  3KII A;  3Q3F A;  1I8V A;  5M19 A;  3CNM A;  3CCJ 3;  2XH9 A;  1A2V A;  4HZB B;  1B2M A;  1BUQ A;  1TU5 A;  1ZX2 A;  3GWR A;  3FG1 A;  3G8Z A;  1RGE A;  3JVC A;  3OW2 2;  2KF6 A;  4JRF A;  4R1K A;  2E2V A;  2KRT A;  3BU4 A;  4XDW A;  2IYJ A;  5AEU B;  1BSC A;  3AGO A;  2MF7 A;  1MWS A;  1JJ2 2;  1BRS A;  2ZL8 A;  3HOH A;  1EQK A;  2D1W A;  1R4C A;  5CF2 A;  3OXA A;  3G4S 3;  3NBJ A;  1BNR A;  1YJN 3;  4HM1 B;  3TDG A;  2HML B;  1W6Y A;  3QRD A;  1GMR A;  1WMP A;  3ZG5 A;  1YHQ 3;  1KSI A;  5BU4 A;  1OF5 A;  2HMK B;  1LOV A;  3HIG A;  2YFI B;  3I56 3;  1ULJ B;  5RNT A;  1G96 A;  1GOU A;  2M7O A;  3G0K A;  2E2T A;  2BO9 B;  4K90 B;  1X1W A;  1B21 A;  5LC7 A;  2F99 A;  1X1Y A;  4O02 B;  2CFD A;  1AY7 A;  1RMS A;  1SAR A;  1DMM A;  2Z76 A;  4HM2 B;  5BIR A;  1CYV A;  3CME 3;  1JN5 A;  4HM6 B;  1BSE A;  3AMO B;  6RNT A;  1BOX A;  3F9S A;  3CNX A;  3CC2 3;  3MPH A;  1FW7 A;  3F14 A;  9RNT A;  1K28 A;  3HK4 A;  5IG4 A;  5CXO A;  2CX0 A;  2OWP A;  1RLS A;  4K61 A;  3V98 A;  2KF3 A;  3LYG A;  4RBN A;  3RDE A;  3T8N A;  4I4K A;  3FCS B;  3K7C A;  1QAK A;  2CX1 A;  4LYL B;  1D6U A;  3KN4 A;  3GZX B;  1UCI A;  3L0R A;  1B20 A;  2CWV A;  1RGC A;  3NM2 A;  3D4A A;  3S27 A;  1W6G A;  1YIT 3;  1W2Z A;  2SBL A;  2W56 A;  2WGQ A;  1RGG A;  3FG4 A;  1GOV A;  5HGR A;  3UB1 A;  2XFT A;  2BMR B;  1DVC A;  2LYX A;  1NNV A;  3JUP A;  1TRQ A;  4R9K A;  5D83 A;  3NBR A;  1ZO2 A;  2XEP A;  4HOH A;  3MWZ A;  1LQG C;  1BGS A;  3LT8 A;  3Q1C A;  5DRE A;  3CMA 3;  3BIR A;  1W5Z A;  4HM8 B;  4FCJ A;  5AYS C;  4J5K A;  3AHW A;  4WYK B;  3WMD A;  1VQM 3;  1ISK A;  1AQZ A;  4I5Q A;  4AEQ A;  1TFO A;  3D5G A;  2CHC A;  1W7C A;  3DGL A;  4STD A;  3B7C A;  1RKY A;  2OTJ 3;  1RTU A;  5IG5 A;  2W9Q A;  1LRA A;  2Y73 A;  4RNT A;  3WA2 X;  1BRI A;  1BSD A;  1KQS 2;  1B3S A;  3X42 A;  3EN1 B;  1BRN L;  2I9W A;  5IEN A;  4MMZ B;  4N6N B;  3FG3 A;  1DVD A;  1YVS A;  5M1A A;  1E3V A;  7GSP A;  1WTH A;  2KF4 A;  2P09 A;  3F7S A;  1X1X A;  2CFK A;  2R41 A;  1MOL A;  2UGI A;  1FGR A;  3FF0 A;  3SOA A;  2W9P A;  2P0X A;  1Q7Y 4;  4XBX A;  3NV0 A;  1MNL A;  2BIR A;  4N6T A;  3KKG A;  3SVA A;  5CF1 A;  1VQ9 3;  1GYB A;  2MC8 A;  5TGN A;  1X1U A;  2A15 A;  3NQZ A;  1JBS A;  3LH4 A;  1IT7 A;  5IEO A;  4J5G A;  4RZM A;  4MEI A;  4O2H A;  1JZO A;  2IA7 A;  3UL5 A;  1A2K A;  1W4N A;  3GSP A;  4HM4 B;  5BVB A;  1FA3 A;  1NO3 A;  4J8T A;  2Y74 A;  1JKG A;  4FR9 A;  2WGO A;  3OWS A;  1IK3 A;  1O7G B;  3CCL 3;  4TX4 A;  1AR0 A;  1EEJ A;  4RNZ A;  3RNT A;  3FH1 A;  5HOH A;  4BIR A;  1Q9E A;  3D5I A;  1Q81 4;  5IF6 A;  1JV2 B;  3JUM A;  3K9M C;  3WOF B;  5IEP A;  2HOH A;  3T0U A;  3CC4 3;  4ORL A;  2GBW B;  3DH2 A;  4R80 A;  2XFS A;  3N54 B;  2CK3 H;  4HM5 B;  2IUK A;  5KP1 A;  3CCR 3;  2GEX A;  5GSP A;  3D3L A;  3PXM A;  2P38 A;  2XSO B;  1PYL A;  1N5H A;  3JUQ A;  4HM3 B;  5ELU A;  1O7N B;  1OGZ A;  4IT7 A;  3DGN A;  3PS8 A;  3SED A;  3SX1 A;  2XF3 A;  4EV5 A;  1V74 A;  1BRG A;  4FMB A;  4G1M B;  4X2H A;  1TFK A;  1OF5 B;  1OHO A;  1JBR A;  2KCD A;  3MG2 A;  3CD6 3;  2O9U X;  3N9H A;  1RCL A;  1J2B A;  3CCM 3;  4EW5 A;  1HU9 A;  3CCQ 3;  1GMQ A;  4N3V A;  1BRH A;  1V58 A;  1EUI C;  1S5A A;  3CCS 3;  2B1X B;  1N9E A;  1R4Y A;  1W6C A;  1LVN A;  2H0G A;  1JN5 B;  1STD A;  1GD3 A;  3FF2 A;  4KFF A;  3CXC 2;  2UUG C;  1PY3 A;  3B4O A;  1BAO A;  1IQX A;  1YJW 3;  3D79 A;  3WOE B;  1TUH A;  3FSD A;  2LQV A;  2W2C A;  2F98 A;  5EQL A;  3NXJ A;  1RNT A;  2AAD A;  4FMC A;  2CG1 A;  3BB9 A;  2KAA A;  4Q53 A;  5CLK A;  4HJL B;  3K63 A;  4BTW A;  1BU4 A;  3U1W A;  1UCJ A;  2OOV A;  3A76 A;  3ZG0 A;  3OV4 A;  1IDP A;  1B2X A;  1RGK A;  2ML5 A;  3IMA B;  4ILF A;  2W56 B;  1DET A;  3S29 A;  1V57 A;  1I0X A;  8RNT A;  4K1V A;  1PU4 A;  2BMO B;  1FUT A;  4FMD A;  1OHS A;  1OGX A;  2D42 A;  5AIG A;  1JBT A;  3EBY A;  2BT3 A;  7RNT A;  1FYS A;  1T3B A;  2C11 A;  1ZS7 A;  2B24 B;  1OPY A;  3NBB A;  3NQY A;  1O7W B;  4N6L A;  2QGU A;  1IV9 A;  1OH0 A;  2OQE A;  5JPP A;  4KZ1 A;  5JBS A;  2C10 A;  2CWT A;  3M8C A;  4BTY A;  1MWU A;  1E3R A;  1MWR A;  4NHF A;  2KF5 A;  2RCD A;  6GSP A;  1FGT A;  3V92 A;  1E97 A;  1PFP A;  4HKV B;  1L5G B;  3LTD A;  2RFR A;  1VQ7 3;  5G1K A;  3X40 A;  3DGM A;  4H3U A;  1WMO A;  1W01 A;  3FKA A;  3EN8 A;  1RGL A;  3LML A;  4AKZ A;  1GY5 A;  2F5M A;  1LNI A;  3JUN A;  3OX9 A;  3U97 A;  2QA4 3;  1D6Z A;  1T2I A;  1NWW A;  2BHM A;  2GBX B;  3T8U A;  1AV4 A;  3CCV 3;  1SJW A;  3CCU 3;  3NV0 B;  2RNT A;  2AAE A;  1MGR A;  3BLZ A;  1GSP A;  1WNH A;  2HMO B;  3X3X A;  2K0M A;  3BND A;  2O3O A;  1Q82 4;  1LOY A;  1A67 A;  2P0M A;  1I0V A;  1RHL A;  2CFL A;  3OWU A;  5DRV A;  1VQP 3;  1WQL B;  4HYZ A;  1IYY A;  1OCV A;  3KCH A;  4O8S A;  1CH0 A;  3ROB A;  1VQ8 3;  1UUV B;  2OOV C;  1QMA A;  1GOY A;  3WR2 A;  2H0I A;  2GEY A; 
#chains in the Genus database with same CATH homology
 1O7M B;  3N8B A;  4CDL A;  1JJ2 2;  3BNE A;  4X2O A;  1YJ9 3;  1KC8 4;  1JKG B;  2OTL 3;  3ALA A;  1OHP A;  1JB4 A;  4GL6 A;  5FW5 A;  2W0Q A;  3E99 A;  1W2B 2;  2W6J H;  3DXO A;  2Q07 A;  3DZL A;  3KSP A;  4U13 A;  4R9L A;  4OVM A;  3NUV A;  3HII A;  5ELJ A;  1EA2 A;  3AMO A;  4L7K A;  4JF8 A;  4HBR A;  1TP6 A;  2WOH A;  1AVL A;  3IJE B;  4H61 A;  3S5C A;  2OQE C;  3O8Y A;  4N6O B;  1Q40 A;  1ROV A;  2CFG A;  3PCR A;  3LTC A;  3MKI A;  1GY6 A;  3MHE A;  5D81 A;  4EC6 A;  3BNC A;  3KFQ C;  3GZY B;  3DUK A;  1K9M 4;  1VQ5 3;  1O7P B;  5EEO A;  3CU3 A;  3LTB A;  4MMX B;  3I0Y A;  1EG9 B;  3F8H A;  3DY5 A;  2CG0 A;  3SXX A;  3F40 A;  4EV2 A;  3D9R A;  1RN7 A;  2UX0 A;  2V1L A;  3MSO A;  3FLJ A;  1A90 A;  3LXU X;  5BXQ A;  1YGE A;  1NB5 I;  3VGN A;  2F86 B;  3CC7 3;  1JRQ A;  3ER7 A;  5IG3 A;  4HM0 B;  3EC9 A;  3H3H A;  4MJD A;  1EKM A;  1OAC A;  3CPW 2;  2QEX 3;  1IVW A;  3DMC A;  1IQ8 A;  4FMA A;  2GU3 A;  1JNQ A;  3GZR A;  1YI2 3;  5KP4 A;  4K1U A;  2INX A;  1FGM A;  1RRH A;  3G6E 3;  3DM8 A;  1K41 A;  3WA3 A;  4J9A A;  3LT9 A;  2FNQ A;  1Y4K A;  3HZP A;  2HMJ B;  3DGO A;  3EBT A;  4ZM8 A;  4CCV A;  1VQK 3;  5A0O B;  1RRL A;  2STD A;  3K0Z A;  4PEJ A;  4LZI A;  2W04 A;  1VQ6 3;  2Z7A A;  2PNC A;  3EHC A;  1QVG 2;  3MG1 A;  1UUW B;  3Q90 A;  2WO0 A;  2CW9 A;  1IVX A;  2FXT A;  1JB2 A;  3FZW A;  3KE7 A;  2YX9 A;  5I97 A;  1W00 A;  2RGQ A;  3EE1 A;  1IVV A;  3X3Z A;  1FUW A;  2R4I A;  2YFL B;  4R4K A;  2Z6B A;  1M1X B;  1K8A 4;  1GS3 A;  3PZW A;  3H51 A;  2Z77 A;  3G16 A;  3LZA A;  4LEH A;  4WWU C;  3WDG B;  3PYJ A;  1UI7 A;  1YVB I;  1NJI 4;  1UI8 A;  1CYU A;  1W02 A;  3CCE 3;  4EBG A;  4O3V A;  3UL6 A;  2QIY A;  1SIH A;  4KFE A;  3K5T A;  1ULI B;  2CFW A;  4L8P A;  1DMQ A;  3NX0 A;  2CKF B;  1KWI A;  3S28 A;  3EQQ B;  3V99 A;  7STD A;  1YIJ 3;  1QAF A;  1C7H A;  1M90 4;  1HKX A;  1N9J A;  1U8C B;  3S67 A;  5IER A;  6STD A;  2IMJ A;  4XM4 A;  1DMN A;  1FGO A;  1FGQ A;  3HX8 A;  3UNL A;  5AYR B;  3EX9 A;  1TIJ A;  1LOX A;  1NB3 I;  1CEW I;  1SII A;  2ZDJ A;  1VQ4 3;  2BMQ B;  1Q40 B;  3KZT A;  1NDO B;  4HVN A;  4EYC A;  5CK6 A;  1N5P A;  4WHA A;  1Z1S A;  4IIA A;  5LC6 A;  4FCZ A;  3GZB A;  2GXF A;  3SOY A;  2CIU A;  3STD A;  3I55 3;  2WOF A;  1QAL A;  2BNG A;  1M1K 4;  4GB5 A;  5JPU A;  3CPO A;  5AI1 A;  3GAX A;  2KXG A;  1KD1 4;  3VSY A;  1U5O A;  1OUN A;  3F8X A;  4XBY A;  2RSX A;  4QWT A;  2CWU A;  1D6Y A;  4IPB A;  4N6V 0;  5AIH A;  5G2G A;  5AIF A;  1IT8 A;  2K54 A;  3IPT A;  3WOD G;  1VZZ A;  5IG0 A;  1Q42 A;  2XRX B;  2XGL A;  1VQN 3;  1IV7 A;  4WFO A;  1GY7 A;  4LMI A;  4NRE A;  4XBT A;  4MMY B;  1AVK A;  1US1 A;  8CHO A;  1SQW A;  3KSE D;  1QVF 2;  2CH9 A;  1GD4 A;  5D82 A;  5IW9 A;  2YFJ B;  3B8L A;  3EB8 A;  3MYT A;  4OUQ A;  2XR8 B;  1O7H B;  1RJO A;  5AEW B;  2XSH B;  3JUO A;  4XDV A;  1WMN A;  3NM7 A;  1IVU A;  1ROA A;  4HZ9 B;  3F7X A;  1SPU A;  3Q2P A;  4WYK A;  2JDI H;  1UW1 A;  2L4V A;  2PZV A;  4HM7 B;  1N8R 4;  3PCS A;  3G71 3;  1S72 3;  4WP5 A;  3PGB A;  1IQY A;  5STD A;  2IUJ A;  4OK0 A;  2XGN A;  4RNY A;  1LXE A;  3J7Y d;  4L8O A;  3HI7 A;  3OWY A;  4XB5 A;  1JB5 A;  5EVH A;  4EXR A;  3RGA A;  1QJG A;  5KP3 A;  4LGQ A;  1F8N A;  1CQS A;  3B4P A;  2HMM B;  3EF8 A;  2JQ5 A;  1VQL 3;  3VF1 A;  2OCT A;  4LSO A;  2CC3 A;  4FCM A;  3X3Y A;  1NU3 A;  3GRD A;  1LNH A;  3RGR A;  1T5Y A;  1N8Q A;  2E2U A;  1ASK A;  2P05 A;  2W03 A;  3FGY A;  5FGO A;  3SLU A;  1K73 4;  3QK9 A;  3X41 A;  3LOY A;  1Q86 4;  3NHX A;  3MG3 A;  1DYU A;  1VQO 3;  3ECF A;  2ML6 A;  1IU7 A;  4AKY A;  5AII A;  4KVH A;  3EJV A;  1M9G A;  4N6U A;  1STF I;  4N6M A;  2HMN B;  3UJM A;  2GU1 A;  4KFD A;  2FGT A;  3BNB A;  3LTA A;  3KII A;  3CNM A;  3CCJ 3;  2XH9 A;  1A2V A;  4HZB B;  1BUQ A;  1TU5 A;  1ZX2 A;  3GWR A;  3FG1 A;  3G8Z A;  3JVC A;  3OW2 2;  4JRF A;  4R1K A;  2E2V A;  2KRT A;  4XDW A;  5AEU B;  2MF7 A;  2ZL8 A;  1EQK A;  2D1W A;  1R4C A;  5CF2 A;  3OXA A;  3G4S 3;  3NBJ A;  1YJN 3;  4HM1 B;  3TDG A;  2HML B;  1W6Y A;  3QRD A;  1WMP A;  1YHQ 3;  1KSI A;  1OF5 A;  2HMK B;  3HIG A;  2YFI B;  3I56 3;  1ULJ B;  1G96 A;  2M7O A;  3G0K A;  2E2T A;  2BO9 B;  4K90 B;  5LC7 A;  2F99 A;  4O02 B;  2CFD A;  4HM2 B;  2Z76 A;  1DMM A;  3CME 3;  1CYV A;  1JN5 A;  4HM6 B;  3AMO B;  3F9S A;  3CC2 3;  3CNX A;  3MPH A;  3F14 A;  1K28 A;  3HK4 A;  5IG4 A;  5CXO A;  2OWP A;  4K61 A;  3V98 A;  3LYG A;  4RBN A;  3RDE A;  3T8N A;  4I4K A;  3FCS B;  3K7C A;  1QAK A;  1D6U A;  3KN4 A;  3GZX B;  3L0R A;  2CWV A;  3NM2 A;  3S27 A;  1YIT 3;  1W6G A;  1W2Z A;  2SBL A;  2W56 A;  2WGQ A;  3FG4 A;  3UB1 A;  5HGR A;  2XFT A;  2BMR B;  1DVC A;  2LYX A;  3JUP A;  4R9K A;  5D83 A;  3NBR A;  1ZO2 A;  2XEP A;  3MWZ A;  3LT8 A;  3Q1C A;  5DRE A;  3CMA 3;  1W5Z A;  4HM8 B;  4FCJ A;  5AYS C;  4WYK B;  1VQM 3;  3WMD A;  1ISK A;  4AEQ A;  1TFO A;  2CHC A;  1W7C A;  3DGL A;  4STD A;  3B7C A;  1RKY A;  2OTJ 3;  5IG5 A;  2W9Q A;  2Y73 A;  3WA2 X;  1KQS 2;  3X42 A;  3EN1 B;  2I9W A;  5IEN A;  4MMZ B;  4N6N B;  3FG3 A;  1DVD A;  1E3V A;  1WTH A;  2P09 A;  3F7S A;  2CFK A;  3FF0 A;  1MOL A;  1FGR A;  3SOA A;  2W9P A;  2P0X A;  1Q7Y 4;  4XBX A;  3NV0 A;  1MNL A;  4N6T A;  3KKG A;  3SVA A;  5CF1 A;  1VQ9 3;  1GYB A;  2MC8 A;  5TGN A;  2A15 A;  3NQZ A;  3LH4 A;  1IT7 A;  5IEO A;  4RZM A;  4MEI A;  4O2H A;  2IA7 A;  3UL5 A;  1A2K A;  1W4N A;  4HM4 B;  5BVB A;  1FA3 A;  1NO3 A;  4J8T A;  2Y74 A;  1JKG A;  4FR9 A;  2WGO A;  3OWS A;  1IK3 A;  1O7G B;  3CCL 3;  4TX4 A;  1AR0 A;  4RNZ A;  3FH1 A;  1Q81 4;  5IF6 A;  1JV2 B;  3JUM A;  3K9M C;  3WOF B;  5IEP A;  3CC4 3;  3T0U A;  4ORL A;  2GBW B;  4R80 A;  2XFS A;  3N54 B;  2CK3 H;  4HM5 B;  2IUK A;  5KP1 A;  3CCR 3;  2GEX A;  3D3L A;  3PXM A;  2P38 A;  2XSO B;  1N5H A;  3JUQ A;  4HM3 B;  5ELU A;  1O7N B;  1OGZ A;  4IT7 A;  3DGN A;  3PS8 A;  3SED A;  3SX1 A;  2XF3 A;  4EV5 A;  1V74 A;  4FMB A;  4G1M B;  4X2H A;  1TFK A;  1OF5 B;  1OHO A;  2KCD A;  3MG2 A;  3CD6 3;  2O9U X;  3N9H A;  1J2B A;  3CCM 3;  1HU9 A;  3CCQ 3;  4N3V A;  1S5A A;  3CCS 3;  1N9E A;  2B1X B;  1W6C A;  1LVN A;  1JN5 B;  1STD A;  1GD3 A;  3FF2 A;  4KFF A;  3CXC 2;  3B4O A;  1IQX A;  1YJW 3;  3WOE B;  1TUH A;  3FSD A;  2LQV A;  2W2C A;  2F98 A;  5EQL A;  3NXJ A;  2CG1 A;  4FMC A;  3BB9 A;  4Q53 A;  5CLK A;  4HJL B;  3K63 A;  4BTW A;  3U1W A;  2OOV A;  3A76 A;  3OV4 A;  1IDP A;  2ML5 A;  3IMA B;  2W56 B;  3S29 A;  4K1V A;  1PU4 A;  2BMO B;  4FMD A;  1OHS A;  1OGX A;  2D42 A;  5AIG A;  3EBY A;  2BT3 A;  3NBB A;  4BTX A;  2C11 A;  2B24 B;  1OPY A;  4N6L A;  3NQY A;  1O7W B;  2OQE A;  2QGU A;  1IV9 A;  1OH0 A;  5JPP A;  4KZ1 A;  5JBS A;  2C10 A;  2CWT A;  3M8C A;  4BTY A;  1E3R A;  4NHF A;  2RCD A;  1FGT A;  3V92 A;  1E97 A;  1PFP A;  4HKV B;  1L5G B;  3LTD A;  2RFR A;  1VQ7 3;  3X40 A;  3DGM A;  4H3U A;  1WMO A;  1W01 A;  3FKA A;  3EN8 A;  3LML A;  4AKZ A;  1GY5 A;  3JUN A;  3OX9 A;  2QA4 3;  3U97 A;  1D6Z A;  2BHM A;  1NWW A;  2GBX B;  3T8U A;  3CCV 3;  1AV4 A;  1SJW A;  3CCU 3;  3NV0 B;  3BLZ A;  1WNH A;  2HMO B;  3X3X A;  2K0M A;  3BND A;  2O3O A;  1Q82 4;  1A67 A;  2P0M A;  2CFL A;  3OWU A;  5DRV A;  1VQP 3;  1WQL B;  4HYZ A;  1OCV A;  4O8S A;  3ROB A;  1VQ8 3;  1UUV B;  2OOV C;  1QMA A;  2GEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...