5IG3A

Crystal structure of the human camkii-alpha hub
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
144
Chain Sequence
HHHSSGLEVLFQGPHMVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Calcium/calmodulin-dependent protein kinase type II subunit
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 144
sequence length 144
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig3A00
3G0KA 1GY7A 3F14A 5IERA 3M8CA 4H3UA 3NUVA 4HM6B 4XB5A 1HKXA 2OWPA 4Q53A 2Z76A 3EX9A 3RGAA 3DUKA 4XBTA 3G8ZA 5AEWB 1Q40A 2BMQB 2CHCA 4PEJA 4R9LA 2YFLB 3OX9A 3MG1A 1OUNA 1OGXA 3F7XA 1GY5A 5IG5A 3VSYA 1A2KA 2F86B 3JUNA 5IEPA 1CQSA 2IMJA 1GY6A 5CLKA 5AI1A 2GEYA 2F98A 3B7CA 5DRVA 2BMRB 3UNLA 1JB5A 4X2OA 1DMNA 1SJWA 3B4OA 5CF1A 1Q42A 2YFJB 3JUMA 3H51A 1OF5B 5TGNA 3OWUA 3GWRA 5EVHA 7STDA 2HMMB 1NWWA 2RGQA 3KSPA 3H3HA 2W2CA 3FF2A 5STDA 3NV0A 5KP4A 2XR8B 3CNXA 2K54A 1EA2A 1NDOB 3MYTA 6STDA 4HZ9B 5D82A 5JPUA 3IPTA 2JQ5A 4XDWA 4RZMA 3F8HA 1K41A 3F8XA 1W01A 4LEHA 4HM3B 3T8NA 3ER7A 1OHOA 5CXOA 4HM1B 5KP1A 1UUVB 2QGUA 4L8OA 3JUPA 3FSDA 4HVNA 1JKGB 3BLZA 5G2GA 3EHCA 3DMCA 1IDPA 1E3RA 1WQLB 3NHXA 1S5AA 3GZRA 4HJLB 2YFIB 3KZTA 4R1KA 2GBXB 4XM4A 3GRDA 2Z77A 2HMLB 1VZZA 1ULJB 3CPOA 2HMKB 3FF0A 4HM7B 5AEUB 2B1XB 3GZBA 3SEDA 2B24B 3EN8A 3S5CA 1O7GB 4U13A 3BB9A 5CK6A 3MHEA 1UUWB 3EJVA 3JUOA 2RCDA 5IG0A 4N3VA 3I0YA 4OVMA 3ECFA 1ISKA 3FKAA 5IG4A 2GEXA 1OH0A 3MSOA 3A76A 1OF5A 3CNMA 4CDLA 3SOYA 3EBTA 4HM4B 3GZYB 1U5OA 5IG3A 4IIAA 2PZVA 1STDA 3Q90A 3CU3A 3OXAA 4XBYA 4I4KA 1Z1SA 3MKIA 3LZAA 1AR0A 2A15A 2GBWB 3EC9A 4L7KA 5CF2A 3F9SA 5D81A 1NU3A 2STDA 4OUQA 1ULIB 1ZO2A 5AIHA 4WP5A 4HM0B 2Z7AA 4GB5A 2BNGA 3VGNA 2INXA 4FCMA 4L8PA 3FLJA 2XRXB 2R4IA 4K1UA 3JUQA 1JN5B 3NXJA 1JKGA 2HMNB 4STDA 3EBYA 1W6YA 3MG3A 1O7PB 3EF8A 3KE7A 3EN1B 3LYGA 3D9RA 4R9KA 3HK4A 5KP3A 5IF6A 2CKFB 3B4PA 4K1VA 1O7MB 5IEOA 3STDA 2UX0A 2XSOB 3B8LA 5HGRA 4HM5B 1C7HA 3EQQB 4LGQA 1E3VA 4MJDA 1Q40B 4J8TA 3E99A 3FH1A 1DMQA 1OHPA 3G16A 5BVBA 3FZWA 1OCVA 1OGZA 1QJGA 4FCJA 2HMOB 1DMMA 4WYKB 4WYKA 3F40A 1TUHA 2BMOB 3KKGA 4ORLA 3ROBA 3UJMA 4X2HA 1QMAA 3GZXB 5AIIA 2I9WA 2QIYA 3HX8A 3MG2A 3WMDA 3F7SA 4XDVA 3FGYA 1ZX2A 1OHSA 4XBXA 5JPPA 4HZBB 3HZPA 4J9AA 1JB4A 5DREA 8CHOA 4LMIA 3SOAA 4WWUC 1GYBA 3OWSA 3OV4A 5AIGA 3RGRA 3DM8A 3K7CA 1BUQA 3NM2A 1O7NB 1JB2A 4KVHA 3NBRA 3NV0B 1OPYA 5BXQA 1O7HB 1ASKA 1EG9B 2XSHB 1O7WB 1E97A 5D83A 2GXFA 1JN5A 1W00A 2HMJB 3DXOA 2F99A 5IENA 1TP6A 3OWYA 5AIFA 4HKVB 3T8UA 2RFRA 4HM2B 5FW5A 1W02A 1GS3A 3K0ZA 4HM8B 3DZLA
chains in the Genus database with same CATH superfamily
2AAEA 3G0KA 3CCS3 1GY7A 3UL6A 1DVDA 3F14A 2O3OA 3EE1A 2CG0A 5IERA 3M8CA 4R80A 1LNHA 3V92A 2CWUA 4H3UA 5GSPA 3RNTA 3NUVA 2WOHA 4G1MB 3SYUA 1VQN3 3AGOA 4HM6B 2P38A 1LNIA 3D4AA 1BU4A 1RKYA 2KF6A 4XB5A 1HKXA 2OWPA 4N6MA 4Q53A 1RSNA 2Z76A 1BRNL 1MWTA 1LOWA 3EX9A 3RGAA 1BNIA 3DUKA 1S723 1K8A4 3OW22 5LC7A 1RLSA 2GU3A 4XBTA 1W6GA 2Y73A 3G8ZA 3SVAA 2BHMA 3CXC2 2F5MA 5AEWB 5M19A 1HU9A 1VQ73 1I2GA 3J7Yd 1YJ93 1Q7HA 1IVWA 1W2ZA 4KT3B 1QALA 2CC3A 1BRIA 1Q40A 2BMQB 2CHCA 2W6JH 1M9GA 4N6TA 4PEJA 2YFLB 4R9LA 3OX9A 3MG1A 3X40A 1OUNA 1OGXA 3KSED 3G713 3F7XA 1GY5A 5IG5A 3DGLA 3VSYA 1A2KA 1PYLA 4WHAA 2Z6BA 1FUWA 1I0VA 1N5PA 2F86B 3CCJ3 1WTHA 1B20A 2W04A 3JUNA 1UGIA 3G6E3 1SIHA 3I553 1VQK3 5IEPA 4EW5A 1CQSA 5I97A 2IMJA 1GY6A 5CLKA 1MWUA 5AI1A 1RJOA 2GEYA 2F98A 3PXMA 3ZFZA 3B7CA 1V74A 3PYJA 1KSIA 2SBLA 3X3YA 1AQZA 3CME3 3S29A 1K734 5DRVA 3NBJA 4J5GA 2BMRB 4EV2A 3G4S3 1CYUA 1Q814 1JBTA 1NO3A 1JB5A 3UNLA 4ZM8A 4X2OA 1SARA 1KQS2 2IUKA 4FMDA 1RMSA 2P05A 5AYSC 1F8NA 1FA3A 1CEWI 1RRHA 4FCZA 2P0XA 1RHLA 1DMNA 1SJWA 1TJDA 3B4OA 4BL2A 5CF1A 1KD14 1YJW3 1Q42A 1U8CB 3V99A 4EBGA 1QAKA 1T5YA 1ZS7A 2YFJB 4IT7A 3JUMA 3H51A 1WNHA 2D1WA 1VQM3 1RN1A 1OF5B 1STFI 1UCJA 4RNZA 3KIIA 5TGNA 3JVCA 1M1XB 3GSPA 3OWUA 3GWRA 3CMA3 4R4KA 5EVHA 3MPHA 3AGNA 1BRSA 4BU4A 1DETA 1BIRA 1I3IA 2Q07A 3WOFB 3K5TA 4FR9A 7STDA 2HMMB 5IW9A 1B27A 2GSPA 3CCE3 2LYXA 1JNQA 3HI7A 3VF1A 1T2HA 3BNDA 3ZG5A 1NWWA 2UGIA 3NM7A 2CFWA 2RGQA 1BSDA 4H61A 3KSPA 3H3HA 2W2CA 3FF2A 5EQLA 4N6LA 1KC84 5AYRB 5STDA 2H0IA 1VQQA 3NV0A 4NHFA 5KP4A 1YI23 3WOEB 2XR8B 3PZWA 4HOHA 2XFSA 1GMQA 1NB5I 1V57A 2K54A 3CNXA 1EA2A 2F4YA 3AMOB 1IVVA 3D5GA 3LTCA 3AHWA 3DY5A 1BNGA 2YX9A 1I2EA 1W5ZA 1NDOB 3CC43 2H0GA 3MYTA 4O02B 4FMBA 3S67A 6STDA 2MC8A 4HZ9B 1M1K4 5D82A 5JPUA 1NJI4 2CWTA 3IPTA 2JQ5A 3MWZA 3O8YA 3Q3FA 4XDWA 1JBSA 2W9PA 3BNBA 3F8HA 1K41A 3KCHA 4HYZA 4RZMA 1YIJ3 1B21A 1RGEA 3F8XA 1W01A 4LEHA 1I3FA 4HM3B 3ER7A 1HYFA 3T8NA 1OHOA 1X1XA 1IYYA 4NREA 5CXOA 4HM1B 5KP1A 1UUVB 1FZUA 2QGUA 4I5QA 3D3LA 2CFGA 4L8OA 1VQL3 3K9MC 1HZ1A 3JUPA 4KFFA 5ELUA 7GSPA 3FSDA 1RGCA 4JF8A 2LQVA 1DE3A 1CH0A 2E2UA 4HVNA 1QVF2 2RSXA 1AV4A 2ZHXB 1JKGB 2KXGA 4J5KA 2KRTA 8RNTA 3BLZA 2FGTA 3LXUX 5G2GA 3A5EA 1BRGA 3EHCA 3LTDA 3DMCA 1IDPA 4CJNA 1GD3A 4CCVA 3FG3A 3BNEA 3CPW2 2BIRA 1E3RA 3GAXA 1WQLB 4MMYB 3NHXA 3NQYA 1S5AA 1UI8A 2IA7A 4HAAA 5RNTA 3GZRA 2ML6A 3NBBA 1NNVA 4HJLB 2YFIB 3KZTA 3BU4A 4R1KA 4EV5A 2C4BA 2GBXB 2CIUA 4XM4A 1IVUA 2JDIH 3WA2X 2CFDA 1W7CA 3U97A 4AEQA 3GRDA 2L1SA 2Z77A 4LYLB 1B2ZA 5LC6A 1Q7Y4 1SPUA 1RGKA 2HMLB 1VZZA 3I563 1ULJB 1LVNA 1RGLA 3CPOA 2W9QA 2HMKB 1MWRA 4MEIA 1TU5A 1N9EA 2WGQA 3HOHA 3FF0A 1BRJA 4HM7B 6RNTA 5AEUB 2B1XB 1RN4A 1VQP3 3GZBA 3ZG0A 2QEX3 2RBIA 2KCDA 3SEDA 2F5WA 2B24B 3D79A 3EN8A 1VQ53 1GOVA 1A90A 3S5CA 1O7GB 4U13A 1IU7A 3BB9A 4CPKA 5BIRA 5CK6A 1D6ZA 1JRQA 3MHEA 3CCV3 1UUWB 3EJVA 2CW9A 1PFPA 3JUOA 2CWVA 4K90B 1KWIA 1LRAA 2RCDA 1UDII 1RGGA 3CCQ3 5IG0A 4N3VA 2M7OA 1BSAA 1G0TA 3I0YA 1EEJA 3UB1A 2Y74A 4BL3A 2P0MA 4OVMA 1Q9EA 3WODG 1VQ83 5HOHA 5EEOA 3LT9A 3PCSA 1BSCA 3LH4A 3ECFA 1BNEA 3FKAA 5IG4A 1T3BA 1ISKA 4O2HA 1NB3I 1RGFA 2CK3H 1A2VA 2GEXA 2R41A 1OH0A 3MSOA 3SLUA 2E2TA 1TFKA 1JZOA 3A76A 3UL5A 1YVSA 1OF5A 3CNMA 2CG1A 3SX1A 1I0XA 3SOYA 4CDLA 3AHSA 2BT3A 1YVBI 3EBTA 3GZYB 4HM4B 2QA43 1U5OA 1PY3A 5IG3A 1LOXA 4IIAA 2K3DA 2PZVA 3CD63 1BNSA 1FUTA 1STDA 1QVG2 1JJ22 2CX0A 2ZA4A 3X3XA 1MNLA 3DH2A 3Q90A 1UCKA 3CU3A 1Q824 1FW7A 4EC6A 1BSEA 3OXAA 4AKYA 1GSPA 2CX1A 4XBYA 4I4KA 3X42A 1TFOA 1Z1SA 1T2IA 1IQXA 1UGHI 3MKIA 2WOFA 1RGHA 3LZAA 1VQ63 1AR0A 1A2PA 2A15A 2GBWB 2O9UX 1RCKA 1UCLA 2OOVC 3EC9A 3HIIA 3IJEB 4L7KA 3F9SA 2FNQA 3NX0A 5D81A 2WO0A 1N5HA 2RNTA 3NQZA 1NU3A 3EB8A 4RNYA 2STDA 4OUQA 1ULIB 2E2VA 2PNCA 1AVKA 1YHQ3 3LTAA 1ZO2A 3CC23 1YIT3 3AMOA 2AADA 1GD4A 2BU4A 3V98A 1MGWA 4ILFA 4O3VA 5AIHA 4WP5A 2KF5A 1DVCA 1R4CA 4HM0B 1BRHA 1BANA 2Z7AA 4GB5A 5M1AA 5A0OB 3CCL3 2BNGA 1B2SA 3VGNA 2H0HA 1IV9A 2IY2A 1YGWA 4GL6A 1X1UA 2INXA 1EQKA 1RTUA 9RNTA 4FCMA 2W56B 4MMZB 4TX4A 4K61A 1W4NA 3D5IA 1UI7A 4L8PA 3FLJA 3IMAB 1BAOA 2XRXB 2C10A 3WA3A 1WMOA 1MGRA 2V1LA 2IUJA 1BOXA 2CFKA 2R4IA 3DGOA 1QAFA 5G1KA 4K1UA 4BIRA 5ELJA 1UW1A 1VQO3 3S27A 2UUGC 1X1YA 2K0MA 3JUQA 1JN5B 2KF4A 3NXJA 2L4VA 1BNJA 1FGRA 3CCR3 1GOYA 1IV7A 1DYUA 1JKGA 2HMNB 4STDA 4AKZA 3EBYA 1W6YA 2XH9A 4BTWA 3MG3A 2OQEA 3K63A 2OCTA 1O7PB 1RCLA 3EF8A 6GSPA 1MOLA 2ZL8A 3WR2A 1BNRA 2W03A 3KE7A 1D6YA 3KFQC 4KZ1A 3EN1B 2F56A 4DKIA 3LYGA 1IK3A 2ZDJA 1YJN3 2KF3A 1W2B2 3D9RA 4R9KA 3BNCA 3HK4A 1SIIA 5KP3A 1N8QA 3BIRA 5IF6A 2CKFB 4IPBA 3LTBA 3B4PA 1N8R4 3HIGA 4LSOA 4K1VA 1O7MB 5IEOA 1X1WA 1UCIA 1LQMB 2CFLA 3PGBA 2UX0A 1IQYA 4GSPA 3STDA 1Y4KA 2XSOB 3B8LA 1EKMA 1K28A 1GMRA 5HGRA 4GHOA 1I70A 2HOHA 2D42A 3LMLA 4HM5B 1FUSA 2XF3A 1AY7A 3PS8A 3X41A 1C7HA 5BU4A 2W0QA 3N54B 3EQQB 2MF7A 4O8SA 4LGQA 1E3VA 4MJDA 3RDEA 5M18A 1Q40B 4EYCA 4HBRA 4J8TA 4FMCA 3E99A 3U1WA 3FH1A 1B2XA 3Q1CA 4N6V0 1DMQA 1OHPA 3G16A 5BVBA 3FZWA 1OCVA 3DGNA 1OGZA 1BGSA 2GU1A 2ML5A 1QJGA 1AVLA 4FCJA 2HMOB 1DMMA 1JZDA 4MMXB 4KFDA 3DGMA 4WYKB 3F40A 4WYKA 1TUHA 2BMOB 1BVIA 3KKGA 4ORLA 4BTXA 1M904 3ROBA 1IVXA 3Q2PA 1VQ43 1MWSA 1ROAA 3UJMA 1BSBA 1WMPA 3L0RA 4X2HA 1QMAA 2FXTA 3GZXB 1RDSA 2I9WA 1W6CA 1ZGXA 2QIYA 4LZIA 5AIIA 2XEPA 3N8BA 1LOYA 3S28A 1RNBA 3HX8A 3MG2A 1BRKA 5FGOA 3WMDA 3F7SA 1VQ93 1J2BA 1TTOA 3ALAA 1V58A 4XDVA 1B2MA 3PCRA 1GOUA 2XGNA 3CCU3 2OTJ3 3FGYA 1N9JA 2P09A 1B2UA 3KN4A 1ZX2A 4NPBA 1I2FA 3WHOA 4WFOA 1OHSA 1TIJA 2IYJA 4XBXA 5JPPA 4HZBB 1B3SA 1UUGB 2BO9B 3HZPA 4BTYA 1BNFA 3N9HA 1FGMA 1FGQA 4QWTA 3FG4A 3CCM3 1TRPA 4J9AA 1Q864 1RNTA 3CC73 1IT8A 4JRFA 1C54A 1JB4A 5DREA 1OACA 1RN7A 2J8XB 1EUIC 8CHOA 4LMIA 3SOAA 1RRLA 1LOVA 1LQGC 3QK9A 2C11A 3X3ZA 1RGAA 4KFEA 4WWUC 1GYBA 3OWSA 3OV4A 5AIGA 3RGRA 5JBSA 1SQWA 3DM8A 3LOYA 3K7CA 1US1A 1BUQA 3QRDA 2XGLA 1R4YA 3T0UA 4EXRA 1K9M4 3NM2A 2SARA 1O7NB 1JB2A 4KVHA 3NBRA 3NV0B 1FGTA 4RBNA 1GMPA 1OPYA 7RNTA 1G02A 5BXQA 5CF2A 1G96A 4FMAA 4OK0A 2W56A 2OOVA 1CYVA 1O7HB 1ASKA 3FCSB 1D6UA 4RNTA 1JBRA 1EG9B 1I8VA 1LXEA 2WGOA 3FG1A 3TDGA 1PU4A 1JV2B 2XSHB 1O7WB 1E97A 2XFTA 5D83A 4N6NB 3URPA 2GXFA 1YGEA 1JN5A 1W00A 2HMJB 2OQEC 3DXOA 2F99A 5IENA 1TP6A 3OWYA 3SXXA 5AIFA 4HKVB 1A67A 1FGOA 2KAAA 3T8UA 1BUJA 2RFRA 4N6UA 4HM2B 3WDGB 3LT8A 1TRQA 4N6OB 1W02A 5FW5A 2CH9A 1GS3A 5G1LA 1WMNA 1FYSA 3K0ZA 4HM8B 1L5GB 2OTL3 1IT7A 3DZLA 3DGYA 1ROVA 1YNVX 1IQ8A
chains in the Genus database with same CATH topology
3G0KA 3CCS3 1GY7A 3UL6A 1DVDA 3F14A 2O3OA 3EE1A 2CG0A 5IERA 3M8CA 4R80A 1LNHA 3V92A 2CWUA 4H3UA 3NUVA 2WOHA 4G1MB 1VQN3 4HM6B 2P38A 1RKYA 4XB5A 1HKXA 2OWPA 4N6MA 4Q53A 2Z76A 2OTJ3 1S723 3EX9A 3RGAA 3DUKA 1K8A4 3OW22 5LC7A 2GU3A 4XBTA 1W6GA 2Y73A 3G8ZA 3SVAA 2BHMA 3CXC2 5AEWB 1HU9A 1VQ73 3J7Yd 1YJ93 1IVWA 1W2ZA 1QALA 2CC3A 2W6JH 1Q40A 2BMQB 2CHCA 4PEJA 1M9GA 4N6TA 4R9LA 2YFLB 3X40A 3OX9A 3MG1A 1OUNA 1OGXA 3KSED 3G713 3F7XA 1GY5A 5IG5A 3DGLA 3VSYA 1A2KA 4WHAA 2Z6BA 1FUWA 1N5PA 2F86B 3CCJ3 1WTHA 3JUNA 2W04A 3G6E3 1SIHA 3I553 1VQK3 5IEPA 1CQSA 5I97A 2IMJA 1GY6A 5CLKA 5AI1A 1RJOA 2GEYA 2F98A 3PXMA 3B7CA 1V74A 3PYJA 1KSIA 2SBLA 3X3YA 3CME3 3S29A 1K734 5DRVA 3NBJA 4EV2A 2BMRB 1CYUA 3G4S3 1Q814 1NO3A 1JB5A 3UNLA 4ZM8A 4X2OA 1KQS2 2IUKA 4FMDA 2P05A 5AYSC 1F8NA 1FA3A 1CEWI 1RRHA 4FCZA 2P0XA 1KD14 1DMNA 1SJWA 3B4OA 5CF1A 1YJW3 1Q42A 1U8CB 3V99A 4EBGA 1QAKA 1T5YA 2YFJB 4IT7A 3JUMA 3H51A 1WNHA 2D1WA 1VQM3 1STFI 1OF5B 4RNZA 3KIIA 5TGNA 3JVCA 1M1XB 3OWUA 3GWRA 3CMA3 4R4KA 5EVHA 3MPHA 3WOFB 2Q07A 3K5TA 4FR9A 7STDA 2HMMB 5IW9A 3CCE3 2LYXA 1JNQA 3HI7A 3VF1A 3BNDA 1NWWA 3NM7A 2CFWA 2RGQA 4H61A 3KSPA 3H3HA 2W2CA 3FF2A 5EQLA 4N6LA 1KC84 5AYRB 5STDA 3NV0A 4NHFA 5KP4A 1YI23 3WOEB 2XR8B 3PZWA 2XFSA 1NB5I 3CNXA 2K54A 1EA2A 3AMOB 1IVVA 3LTCA 3DY5A 2YX9A 1W5ZA 3CC43 1NDOB 3MYTA 4O02B 4FMBA 3S67A 6STDA 2MC8A 4HZ9B 1M1K4 5D82A 5JPUA 1NJI4 2CWTA 3IPTA 2JQ5A 3MWZA 3O8YA 4XDWA 2W9PA 3BNBA 3F8HA 1K41A 4HYZA 4RZMA 1YIJ3 3F8XA 1W01A 4LEHA 4HM3B 3T8NA 3ER7A 1OHOA 4NREA 5CXOA 4HM1B 5KP1A 1UUVB 2QGUA 3D3LA 2CFGA 4L8OA 1VQL3 3K9MC 3JUPA 4KFFA 5ELUA 3FSDA 4JF8A 2LQVA 2E2UA 4HVNA 1QVF2 2RSXA 1AV4A 1JKGB 2KXGA 2KRTA 3BLZA 2FGTA 3LXUX 5G2GA 3LTDA 3EHCA 3DMCA 1IDPA 1GD3A 4CCVA 3FG3A 3BNEA 3CPW2 1E3RA 3GAXA 1WQLB 4MMYB 3NHXA 3NQYA 1S5AA 1UI8A 2IA7A 3GZRA 2ML6A 3NBBA 4HJLB 2YFIB 3KZTA 4R1KA 4EV5A 2GBXB 4XM4A 2CIUA 1IVUA 2JDIH 3WA2X 2CFDA 1W7CA 3U97A 4AEQA 3GRDA 2Z77A 5LC6A 1Q7Y4 1SPUA 2HMLB 1VZZA 3I563 1ULJB 1LVNA 3CPOA 2W9QA 2HMKB 4MEIA 1TU5A 1N9EA 2WGQA 3FF0A 4HM7B 5AEUB 2B1XB 1VQP3 3GZBA 2QEX3 2KCDA 3SEDA 1A90A 2B24B 3EN8A 1VQ53 3S5CA 1O7GB 4U13A 1IU7A 3BB9A 5CK6A 1D6ZA 1JRQA 3MHEA 1UUWB 3EJVA 2CW9A 1PFPA 3JUOA 2CWVA 4K90B 1KWIA 2RCDA 3CCQ3 5IG0A 4N3VA 2M7OA 3UB1A 3I0YA 2Y74A 2P0MA 4OVMA 3WODG 1VQ83 5EEOA 3LT9A 3PCSA 3LH4A 3ECFA 1ISKA 3FKAA 5IG4A 4O2HA 1NB3I 2CK3H 1A2VA 2GEXA 1OH0A 3MSOA 3SLUA 2E2TA 1TFKA 3A76A 3UL5A 1OF5A 3CNMA 2CG1A 4CDLA 3SX1A 3SOYA 3EBTA 2BT3A 1YVBI 3GZYB 4HM4B 2QA43 1U5OA 5IG3A 1LOXA 4IIAA 2PZVA 3CD63 1STDA 1JJ22 3X3XA 1MNLA 1Q824 3Q90A 3CU3A 4EC6A 3OXAA 4AKYA 4XBYA 4I4KA 3X42A 1TFOA 1Z1SA 1IQXA 3MKIA 2WOFA 3LZAA 1VQ63 1AR0A 2A15A 2GBWB 3EC9A 2O9UX 3HIIA 2OOVC 4L7KA 5CF2A 3IJEB 3F9SA 2FNQA 3NX0A 5D81A 2WO0A 1N5HA 3NQZA 1NU3A 3EB8A 4RNYA 2STDA 4OUQA 1ULIB 2E2VA 2PNCA 1AVKA 1YHQ3 3LTAA 1ZO2A 3CC23 3AMOA 1GD4A 3V98A 4O3VA 5AIHA 4WP5A 1DVCA 1R4CA 4HM0B 2Z7AA 4GB5A 5A0OB 3CCL3 2BNGA 3VGNA 1IV9A 4GL6A 2INXA 1EQKA 4FCMA 2W56B 4MMZB 4TX4A 4K61A 1W4NA 1UI7A 4L8PA 3FLJA 3IMAB 2XRXB 2C10A 3WA3A 1WMOA 2V1LA 2IUJA 3CCV3 2R4IA 2CFKA 1YIT3 3DGOA 1QAFA 1QVG2 4K1UA 5ELJA 1UW1A 1VQO3 3S27A 2K0MA 3JUQA 1JN5B 3NXJA 2L4VA 1FGRA 3CCR3 1IV7A 1DYUA 1JKGA 2HMNB 4STDA 4AKZA 3EBYA 1W6YA 2XH9A 4BTWA 3MG3A 2OQEA 3K63A 2OCTA 1O7PB 3EF8A 1MOLA 2ZL8A 2W03A 3KE7A 1D6YA 3KFQC 4KZ1A 3EN1B 3LYGA 1IK3A 2ZDJA 1YJN3 1W2B2 3D9RA 4R9KA 3BNCA 3HK4A 1SIIA 5KP3A 1N8QA 5IF6A 2CKFB 4IPBA 3LTBA 3B4PA 1N8R4 3HIGA 4LSOA 4K1VA 1O7MB 5IEOA 2CFLA 3PGBA 2UX0A 1IQYA 3STDA 1Y4KA 2XSOB 3B8LA 1EKMA 1K28A 5HGRA 2D42A 3LMLA 4HM5B 2XF3A 3PS8A 3X41A 1C7HA 2W0QA 3N54B 3EQQB 2MF7A 4O8SA 4LGQA 1E3VA 4MJDA 3RDEA 1Q40B 4EYCA 4HBRA 4J8TA 4FMCA 3E99A 3U1WA 3FH1A 3Q1CA 4N6V0 1DMQA 1OHPA 3G16A 5BVBA 3FZWA 1OCVA 3DGNA 1OGZA 2GU1A 2ML5A 1QJGA 1AVLA 4FCJA 2HMOB 1DMMA 4MMXB 4WYKB 4KFDA 3DGMA 4WYKA 3F40A 1TUHA 2BMOB 3KKGA 4ORLA 4BTXA 1M904 3ROBA 1IVXA 3Q2PA 1VQ43 1ROAA 3UJMA 1WMPA 3L0RA 4X2HA 1QMAA 2FXTA 3GZXB 4LZIA 2I9WA 1W6CA 2QIYA 5AIIA 2XEPA 3N8BA 3S28A 3HX8A 3MG2A 5FGOA 3WMDA 3F7SA 1VQ93 1J2BA 3ALAA 4XDVA 3PCRA 2XGNA 3CCU3 3FGYA 1N9JA 2P09A 3KN4A 1ZX2A 4WFOA 1OHSA 1TIJA 4XBXA 5JPPA 4HZBB 2BO9B 3HZPA 4BTYA 3N9HA 1FGMA 1FGQA 4QWTA 3FG4A 3CCM3 4J9AA 1Q864 3CC73 1IT8A 4JRFA 1JB4A 5DREA 1OACA 1RN7A 8CHOA 4LMIA 3SOAA 1RRLA 3QK9A 2C11A 3X3ZA 4KFEA 4WWUC 1GYBA 3OWSA 3OV4A 5AIGA 3RGRA 5JBSA 1SQWA 3DM8A 3LOYA 3K7CA 1US1A 1BUQA 3QRDA 2XGLA 3T0UA 4EXRA 1K9M4 3NM2A 1O7NB 1JB2A 4KVHA 3NBRA 3NV0B 1FGTA 4RBNA 1OPYA 5BXQA 1G96A 4FMAA 4OK0A 2W56A 2OOVA 1CYVA 1O7HB 1ASKA 3FCSB 1D6UA 1EG9B 1LXEA 2WGOA 3FG1A 3TDGA 1PU4A 1JV2B 2XSHB 1O7WB 1E97A 2XFTA 5D83A 4N6NB 2GXFA 1YGEA 1JN5A 1W00A 2HMJB 2OQEC 3DXOA 2F99A 5IENA 1TP6A 3OWYA 3SXXA 5AIFA 4HKVB 1A67A 1FGOA 3T8UA 2RFRA 4N6UA 4HM2B 3WDGB 3LT8A 4N6OB 1W02A 5FW5A 2CH9A 1GS3A 1WMNA 3K0ZA 4HM8B 1L5GB 2OTL3 1IT7A 3DZLA 1ROVA 1IQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0K A;  1GY7 A;  3F14 A;  5IER A;  3M8C A;  4H3U A;  3NUV A;  4HM6 B;  4XB5 A;  1HKX A;  2OWP A;  4Q53 A;  2Z76 A;  3EX9 A;  3RGA A;  3DUK A;  4XBT A;  3G8Z A;  5AEW B;  1Q40 A;  2BMQ B;  2CHC A;  4PEJ A;  4R9L A;  2YFL B;  3OX9 A;  3MG1 A;  1OUN A;  1OGX A;  3F7X A;  1GY5 A;  5IG5 A;  3VSY A;  1A2K A;  2F86 B;  3JUN A;  5IEP A;  1CQS A;  2IMJ A;  1GY6 A;  5CLK A;  5AI1 A;  2GEY A;  2F98 A;  3B7C A;  5DRV A;  2BMR B;  3UNL A;  1JB5 A;  4X2O A;  1DMN A;  1SJW A;  3B4O A;  5CF1 A;  1Q42 A;  2YFJ B;  3JUM A;  3H51 A;  1OF5 B;  5TGN A;  3OWU A;  3GWR A;  5EVH A;  7STD A;  2HMM B;  1NWW A;  2RGQ A;  3KSP A;  3H3H A;  2W2C A;  3FF2 A;  5STD A;  3NV0 A;  5KP4 A;  2XR8 B;  3CNX A;  2K54 A;  1EA2 A;  1NDO B;  3MYT A;  6STD A;  4HZ9 B;  5D82 A;  5JPU A;  3IPT A;  2JQ5 A;  4XDW A;  4RZM A;  3F8H A;  1K41 A;  3F8X A;  1W01 A;  4LEH A;  4HM3 B;  3T8N A;  3ER7 A;  1OHO A;  5CXO A;  4HM1 B;  5KP1 A;  1UUV B;  2QGU A;  4L8O A;  3JUP A;  3FSD A;  4HVN A;  1JKG B;  3BLZ A;  5G2G A;  3EHC A;  3DMC A;  1IDP A;  1E3R A;  1WQL B;  3NHX A;  1S5A A;  3GZR A;  4HJL B;  2YFI B;  3KZT A;  4R1K A;  2GBX B;  4XM4 A;  3GRD A;  2Z77 A;  2HML B;  1VZZ A;  1ULJ B;  3CPO A;  2HMK B;  3FF0 A;  4HM7 B;  5AEU B;  2B1X B;  3GZB A;  3SED A;  2B24 B;  3EN8 A;  3S5C A;  1O7G B;  4U13 A;  3BB9 A;  5CK6 A;  3MHE A;  1UUW B;  3EJV A;  3JUO A;  2RCD A;  5IG0 A;  4N3V A;  3I0Y A;  4OVM A;  3ECF A;  1ISK A;  3FKA A;  5IG4 A;  2GEX A;  1OH0 A;  3MSO A;  3A76 A;  1OF5 A;  3CNM A;  4CDL A;  3SOY A;  3EBT A;  4HM4 B;  3GZY B;  1U5O A;  5IG3 A;  4IIA A;  2PZV A;  1STD A;  3Q90 A;  3CU3 A;  3OXA A;  4XBY A;  4I4K A;  1Z1S A;  3MKI A;  3LZA A;  1AR0 A;  2A15 A;  2GBW B;  3EC9 A;  4L7K A;  5CF2 A;  3F9S A;  5D81 A;  1NU3 A;  2STD A;  4OUQ A;  1ULI B;  1ZO2 A;  5AIH A;  4WP5 A;  4HM0 B;  2Z7A A;  4GB5 A;  2BNG A;  3VGN A;  2INX A;  4FCM A;  4L8P A;  3FLJ A;  2XRX B;  2R4I A;  4K1U A;  3JUQ A;  1JN5 B;  3NXJ A;  1JKG A;  2HMN B;  4STD A;  3EBY A;  1W6Y A;  3MG3 A;  1O7P B;  3EF8 A;  3KE7 A;  3EN1 B;  3LYG A;  3D9R A;  4R9K A;  3HK4 A;  5KP3 A;  5IF6 A;  2CKF B;  3B4P A;  4K1V A;  1O7M B;  5IEO A;  3STD A;  2UX0 A;  2XSO B;  3B8L A;  5HGR A;  4HM5 B;  1C7H A;  3EQQ B;  4LGQ A;  1E3V A;  4MJD A;  1Q40 B;  4J8T A;  3E99 A;  3FH1 A;  1DMQ A;  1OHP A;  3G16 A;  5BVB A;  3FZW A;  1OCV A;  1OGZ A;  1QJG A;  4FCJ A;  2HMO B;  1DMM A;  4WYK B;  4WYK A;  3F40 A;  1TUH A;  2BMO B;  3KKG A;  4ORL A;  3ROB A;  3UJM A;  4X2H A;  1QMA A;  3GZX B;  5AII A;  2I9W A;  2QIY A;  3HX8 A;  3MG2 A;  3WMD A;  3F7S A;  4XDV A;  3FGY A;  1ZX2 A;  1OHS A;  4XBX A;  5JPP A;  4HZB B;  3HZP A;  4J9A A;  1JB4 A;  5DRE A;  8CHO A;  4LMI A;  3SOA A;  4WWU C;  1GYB A;  3OWS A;  3OV4 A;  5AIG A;  3RGR A;  3DM8 A;  3K7C A;  1BUQ A;  3NM2 A;  1O7N B;  1JB2 A;  4KVH A;  3NBR A;  3NV0 B;  1OPY A;  5BXQ A;  1O7H B;  1ASK A;  1EG9 B;  2XSH B;  1O7W B;  1E97 A;  5D83 A;  2GXF A;  1JN5 A;  1W00 A;  2HMJ B;  3DXO A;  2F99 A;  5IEN A;  1TP6 A;  3OWY A;  5AIF A;  4HKV B;  3T8U A;  2RFR A;  4HM2 B;  5FW5 A;  1W02 A;  1GS3 A;  3K0Z A;  4HM8 B;  3DZL A; 
#chains in the Genus database with same CATH topology
 2AAE A;  3G0K A;  3CCS 3;  1GY7 A;  3UL6 A;  1DVD A;  3F14 A;  2O3O A;  3EE1 A;  2CG0 A;  5IER A;  3M8C A;  4R80 A;  1LNH A;  3V92 A;  2CWU A;  4H3U A;  5GSP A;  3RNT A;  3NUV A;  2WOH A;  4G1M B;  3SYU A;  1VQN 3;  3AGO A;  4HM6 B;  2P38 A;  1LNI A;  3D4A A;  1BU4 A;  1RKY A;  2KF6 A;  4XB5 A;  1HKX A;  2OWP A;  4N6M A;  4Q53 A;  1RSN A;  2Z76 A;  1BRN L;  1MWT A;  1LOW A;  3EX9 A;  3RGA A;  1BNI A;  3DUK A;  1S72 3;  1K8A 4;  3OW2 2;  5LC7 A;  1RLS A;  2GU3 A;  4XBT A;  1W6G A;  2Y73 A;  3G8Z A;  3SVA A;  2BHM A;  3CXC 2;  2F5M A;  5AEW B;  5M19 A;  1HU9 A;  1VQ7 3;  1I2G A;  3J7Y d;  1YJ9 3;  1Q7H A;  1IVW A;  1W2Z A;  4KT3 B;  1QAL A;  2CC3 A;  1BRI A;  1Q40 A;  2BMQ B;  2CHC A;  2W6J H;  1M9G A;  4N6T A;  4PEJ A;  2YFL B;  4R9L A;  3OX9 A;  3MG1 A;  3X40 A;  1OUN A;  1OGX A;  3KSE D;  3G71 3;  3F7X A;  1GY5 A;  5IG5 A;  3DGL A;  3VSY A;  1A2K A;  1PYL A;  4WHA A;  2Z6B A;  1FUW A;  1I0V A;  1N5P A;  2F86 B;  3CCJ 3;  1WTH A;  1B20 A;  2W04 A;  3JUN A;  1UGI A;  3G6E 3;  1SIH A;  3I55 3;  1VQK 3;  5IEP A;  4EW5 A;  1CQS A;  5I97 A;  2IMJ A;  1GY6 A;  5CLK A;  1MWU A;  5AI1 A;  1RJO A;  2GEY A;  2F98 A;  3PXM A;  3ZFZ A;  3B7C A;  1V74 A;  3PYJ A;  1KSI A;  2SBL A;  3X3Y A;  1AQZ A;  3CME 3;  3S29 A;  1K73 4;  5DRV A;  3NBJ A;  4J5G A;  2BMR B;  4EV2 A;  3G4S 3;  1CYU A;  1Q81 4;  1JBT A;  1NO3 A;  1JB5 A;  3UNL A;  4ZM8 A;  4X2O A;  1SAR A;  1KQS 2;  2IUK A;  4FMD A;  1RMS A;  2P05 A;  5AYS C;  1F8N A;  1FA3 A;  1CEW I;  1RRH A;  4FCZ A;  2P0X A;  1RHL A;  1DMN A;  1SJW A;  1TJD A;  3B4O A;  4BL2 A;  5CF1 A;  1KD1 4;  1YJW 3;  1Q42 A;  1U8C B;  3V99 A;  4EBG A;  1QAK A;  1T5Y A;  1ZS7 A;  2YFJ B;  4IT7 A;  3JUM A;  3H51 A;  1WNH A;  2D1W A;  1VQM 3;  1RN1 A;  1OF5 B;  1STF I;  1UCJ A;  4RNZ A;  3KII A;  5TGN A;  3JVC A;  1M1X B;  3GSP A;  3OWU A;  3GWR A;  3CMA 3;  4R4K A;  5EVH A;  3MPH A;  3AGN A;  1BRS A;  4BU4 A;  1DET A;  1BIR A;  1I3I A;  2Q07 A;  3WOF B;  3K5T A;  4FR9 A;  7STD A;  2HMM B;  5IW9 A;  1B27 A;  2GSP A;  3CCE 3;  2LYX A;  1JNQ A;  3HI7 A;  3VF1 A;  1T2H A;  3BND A;  3ZG5 A;  1NWW A;  2UGI A;  3NM7 A;  2CFW A;  2RGQ A;  1BSD A;  4H61 A;  3KSP A;  3H3H A;  2W2C A;  3FF2 A;  5EQL A;  4N6L A;  1KC8 4;  5AYR B;  5STD A;  2H0I A;  1VQQ A;  3NV0 A;  4NHF A;  5KP4 A;  1YI2 3;  3WOE B;  2XR8 B;  3PZW A;  4HOH A;  2XFS A;  1GMQ A;  1NB5 I;  1V57 A;  2K54 A;  3CNX A;  1EA2 A;  2F4Y A;  3AMO B;  1IVV A;  3D5G A;  3LTC A;  3AHW A;  3DY5 A;  1BNG A;  2YX9 A;  1I2E A;  1W5Z A;  1NDO B;  3CC4 3;  2H0G A;  3MYT A;  4O02 B;  4FMB A;  3S67 A;  6STD A;  2MC8 A;  4HZ9 B;  1M1K 4;  5D82 A;  5JPU A;  1NJI 4;  2CWT A;  3IPT A;  2JQ5 A;  3MWZ A;  3O8Y A;  3Q3F A;  4XDW A;  1JBS A;  2W9P A;  3BNB A;  3F8H A;  1K41 A;  3KCH A;  4HYZ A;  4RZM A;  1YIJ 3;  1B21 A;  1RGE A;  3F8X A;  1W01 A;  4LEH A;  1I3F A;  4HM3 B;  3ER7 A;  1HYF A;  3T8N A;  1OHO A;  1X1X A;  1IYY A;  4NRE A;  5CXO A;  4HM1 B;  5KP1 A;  1UUV B;  1FZU A;  2QGU A;  4I5Q A;  3D3L A;  2CFG A;  4L8O A;  1VQL 3;  3K9M C;  1HZ1 A;  3JUP A;  4KFF A;  5ELU A;  7GSP A;  3FSD A;  1RGC A;  4JF8 A;  2LQV A;  1DE3 A;  1CH0 A;  2E2U A;  4HVN A;  1QVF 2;  2RSX A;  1AV4 A;  2ZHX B;  1JKG B;  2KXG A;  4J5K A;  2KRT A;  8RNT A;  3BLZ A;  2FGT A;  3LXU X;  5G2G A;  3A5E A;  1BRG A;  3EHC A;  3LTD A;  3DMC A;  1IDP A;  4CJN A;  1GD3 A;  4CCV A;  3FG3 A;  3BNE A;  3CPW 2;  2BIR A;  1E3R A;  3GAX A;  1WQL B;  4MMY B;  3NHX A;  3NQY A;  1S5A A;  1UI8 A;  2IA7 A;  4HAA A;  5RNT A;  3GZR A;  2ML6 A;  3NBB A;  1NNV A;  4HJL B;  2YFI B;  3KZT A;  3BU4 A;  4R1K A;  4EV5 A;  2C4B A;  2GBX B;  2CIU A;  4XM4 A;  1IVU A;  2JDI H;  3WA2 X;  2CFD A;  1W7C A;  3U97 A;  4AEQ A;  3GRD A;  2L1S A;  2Z77 A;  4LYL B;  1B2Z A;  5LC6 A;  1Q7Y 4;  1SPU A;  1RGK A;  2HML B;  1VZZ A;  3I56 3;  1ULJ B;  1LVN A;  1RGL A;  3CPO A;  2W9Q A;  2HMK B;  1MWR A;  4MEI A;  1TU5 A;  1N9E A;  2WGQ A;  3HOH A;  3FF0 A;  1BRJ A;  4HM7 B;  6RNT A;  5AEU B;  2B1X B;  1RN4 A;  1VQP 3;  3GZB A;  3ZG0 A;  2QEX 3;  2RBI A;  2KCD A;  3SED A;  2F5W A;  2B24 B;  3D79 A;  3EN8 A;  1VQ5 3;  1GOV A;  1A90 A;  3S5C A;  1O7G B;  4U13 A;  1IU7 A;  3BB9 A;  4CPK A;  5BIR A;  5CK6 A;  1D6Z A;  1JRQ A;  3MHE A;  3CCV 3;  1UUW B;  3EJV A;  2CW9 A;  1PFP A;  3JUO A;  2CWV A;  4K90 B;  1KWI A;  1LRA A;  2RCD A;  1UDI I;  1RGG A;  3CCQ 3;  5IG0 A;  4N3V A;  2M7O A;  1BSA A;  1G0T A;  3I0Y A;  1EEJ A;  3UB1 A;  2Y74 A;  4BL3 A;  2P0M A;  4OVM A;  1Q9E A;  3WOD G;  1VQ8 3;  5HOH A;  5EEO A;  3LT9 A;  3PCS A;  1BSC A;  3LH4 A;  3ECF A;  1BNE A;  3FKA A;  5IG4 A;  1T3B A;  1ISK A;  4O2H A;  1NB3 I;  1RGF A;  2CK3 H;  1A2V A;  2GEX A;  2R41 A;  1OH0 A;  3MSO A;  3SLU A;  2E2T A;  1TFK A;  1JZO A;  3A76 A;  3UL5 A;  1YVS A;  1OF5 A;  3CNM A;  2CG1 A;  3SX1 A;  1I0X A;  3SOY A;  4CDL A;  3AHS A;  2BT3 A;  1YVB I;  3EBT A;  3GZY B;  4HM4 B;  2QA4 3;  1U5O A;  1PY3 A;  5IG3 A;  1LOX A;  4IIA A;  2K3D A;  2PZV A;  3CD6 3;  1BNS A;  1FUT A;  1STD A;  1QVG 2;  1JJ2 2;  2CX0 A;  2ZA4 A;  3X3X A;  1MNL A;  3DH2 A;  3Q90 A;  1UCK A;  3CU3 A;  1Q82 4;  1FW7 A;  4EC6 A;  1BSE A;  3OXA A;  4AKY A;  1GSP A;  2CX1 A;  4XBY A;  4I4K A;  3X42 A;  1TFO A;  1Z1S A;  1T2I A;  1IQX A;  1UGH I;  3MKI A;  2WOF A;  1RGH A;  3LZA A;  1VQ6 3;  1AR0 A;  1A2P A;  2A15 A;  2GBW B;  2O9U X;  1RCK A;  1UCL A;  2OOV C;  3EC9 A;  3HII A;  3IJE B;  4L7K A;  3F9S A;  2FNQ A;  3NX0 A;  5D81 A;  2WO0 A;  1N5H A;  2RNT A;  3NQZ A;  1NU3 A;  3EB8 A;  4RNY A;  2STD A;  4OUQ A;  1ULI B;  2E2V A;  2PNC A;  1AVK A;  1YHQ 3;  3LTA A;  1ZO2 A;  3CC2 3;  1YIT 3;  3AMO A;  2AAD A;  1GD4 A;  2BU4 A;  3V98 A;  1MGW A;  4ILF A;  4O3V A;  5AIH A;  4WP5 A;  2KF5 A;  1DVC A;  1R4C A;  4HM0 B;  1BRH A;  1BAN A;  2Z7A A;  4GB5 A;  5M1A A;  5A0O B;  3CCL 3;  2BNG A;  1B2S A;  3VGN A;  2H0H A;  1IV9 A;  2IY2 A;  1YGW A;  4GL6 A;  1X1U A;  2INX A;  1EQK A;  1RTU A;  9RNT A;  4FCM A;  2W56 B;  4MMZ B;  4TX4 A;  4K61 A;  1W4N A;  3D5I A;  1UI7 A;  4L8P A;  3FLJ A;  3IMA B;  1BAO A;  2XRX B;  2C10 A;  3WA3 A;  1WMO A;  1MGR A;  2V1L A;  2IUJ A;  1BOX A;  2CFK A;  2R4I A;  3DGO A;  1QAF A;  5G1K A;  4K1U A;  4BIR A;  5ELJ A;  1UW1 A;  1VQO 3;  3S27 A;  2UUG C;  1X1Y A;  2K0M A;  3JUQ A;  1JN5 B;  2KF4 A;  3NXJ A;  2L4V A;  1BNJ A;  1FGR A;  3CCR 3;  1GOY A;  1IV7 A;  1DYU A;  1JKG A;  2HMN B;  4STD A;  4AKZ A;  3EBY A;  1W6Y A;  2XH9 A;  4BTW A;  3MG3 A;  2OQE A;  3K63 A;  2OCT A;  1O7P B;  1RCL A;  3EF8 A;  6GSP A;  1MOL A;  2ZL8 A;  3WR2 A;  1BNR A;  2W03 A;  3KE7 A;  1D6Y A;  3KFQ C;  4KZ1 A;  3EN1 B;  2F56 A;  4DKI A;  3LYG A;  1IK3 A;  2ZDJ A;  1YJN 3;  2KF3 A;  1W2B 2;  3D9R A;  4R9K A;  3BNC A;  3HK4 A;  1SII A;  5KP3 A;  1N8Q A;  3BIR A;  5IF6 A;  2CKF B;  4IPB A;  3LTB A;  3B4P A;  1N8R 4;  3HIG A;  4LSO A;  4K1V A;  1O7M B;  5IEO A;  1X1W A;  1UCI A;  1LQM B;  2CFL A;  3PGB A;  2UX0 A;  1IQY A;  4GSP A;  3STD A;  1Y4K A;  2XSO B;  3B8L A;  1EKM A;  1K28 A;  1GMR A;  5HGR A;  4GHO A;  1I70 A;  2HOH A;  2D42 A;  3LML A;  4HM5 B;  1FUS A;  2XF3 A;  1AY7 A;  3PS8 A;  3X41 A;  1C7H A;  5BU4 A;  2W0Q A;  3N54 B;  3EQQ B;  2MF7 A;  4O8S A;  4LGQ A;  1E3V A;  4MJD A;  3RDE A;  5M18 A;  1Q40 B;  4EYC A;  4HBR A;  4J8T A;  4FMC A;  3E99 A;  3U1W A;  3FH1 A;  1B2X A;  3Q1C A;  4N6V 0;  1DMQ A;  1OHP A;  3G16 A;  5BVB A;  3FZW A;  1OCV A;  3DGN A;  1OGZ A;  1BGS A;  2GU1 A;  2ML5 A;  1QJG A;  1AVL A;  4FCJ A;  2HMO B;  1DMM A;  1JZD A;  4MMX B;  4KFD A;  3DGM A;  4WYK B;  3F40 A;  4WYK A;  1TUH A;  2BMO B;  1BVI A;  3KKG A;  4ORL A;  4BTX A;  1M90 4;  3ROB A;  1IVX A;  3Q2P A;  1VQ4 3;  1MWS A;  1ROA A;  3UJM A;  1BSB A;  1WMP A;  3L0R A;  4X2H A;  1QMA A;  2FXT A;  3GZX B;  1RDS A;  2I9W A;  1W6C A;  1ZGX A;  2QIY A;  4LZI A;  5AII A;  2XEP A;  3N8B A;  1LOY A;  3S28 A;  1RNB A;  3HX8 A;  3MG2 A;  1BRK A;  5FGO A;  3WMD A;  3F7S A;  1VQ9 3;  1J2B A;  1TTO A;  3ALA A;  1V58 A;  4XDV A;  1B2M A;  3PCR A;  1GOU A;  2XGN A;  3CCU 3;  2OTJ 3;  3FGY A;  1N9J A;  2P09 A;  1B2U A;  3KN4 A;  1ZX2 A;  4NPB A;  1I2F A;  3WHO A;  4WFO A;  1OHS A;  1TIJ A;  2IYJ A;  4XBX A;  5JPP A;  4HZB B;  1B3S A;  1UUG B;  2BO9 B;  3HZP A;  4BTY A;  1BNF A;  3N9H A;  1FGM A;  1FGQ A;  4QWT A;  3FG4 A;  3CCM 3;  1TRP A;  4J9A A;  1Q86 4;  1RNT A;  3CC7 3;  1IT8 A;  4JRF A;  1C54 A;  1JB4 A;  5DRE A;  1OAC A;  1RN7 A;  2J8X B;  1EUI C;  8CHO A;  4LMI A;  3SOA A;  1RRL A;  1LOV A;  1LQG C;  3QK9 A;  2C11 A;  3X3Z A;  1RGA A;  4KFE A;  4WWU C;  1GYB A;  3OWS A;  3OV4 A;  5AIG A;  3RGR A;  5JBS A;  1SQW A;  3DM8 A;  3LOY A;  3K7C A;  1US1 A;  1BUQ A;  3QRD A;  2XGL A;  1R4Y A;  3T0U A;  4EXR A;  1K9M 4;  3NM2 A;  2SAR A;  1O7N B;  1JB2 A;  4KVH A;  3NBR A;  3NV0 B;  1FGT A;  4RBN A;  1GMP A;  1OPY A;  7RNT A;  1G02 A;  5BXQ A;  5CF2 A;  1G96 A;  4FMA A;  4OK0 A;  2W56 A;  2OOV A;  1CYV A;  1O7H B;  1ASK A;  3FCS B;  1D6U A;  4RNT A;  1JBR A;  1EG9 B;  1I8V A;  1LXE A;  2WGO A;  3FG1 A;  3TDG A;  1PU4 A;  1JV2 B;  2XSH B;  1O7W B;  1E97 A;  2XFT A;  5D83 A;  4N6N B;  3URP A;  2GXF A;  1YGE A;  1JN5 A;  1W00 A;  2HMJ B;  2OQE C;  3DXO A;  2F99 A;  5IEN A;  1TP6 A;  3OWY A;  3SXX A;  5AIF A;  4HKV B;  1A67 A;  1FGO A;  2KAA A;  3T8U A;  1BUJ A;  2RFR A;  4N6U A;  4HM2 B;  3WDG B;  3LT8 A;  1TRQ A;  4N6O B;  1W02 A;  5FW5 A;  2CH9 A;  1GS3 A;  5G1L A;  1WMN A;  1FYS A;  3K0Z A;  4HM8 B;  1L5G B;  2OTL 3;  1IT7 A;  3DZL A;  3DGY A;  1ROV A;  1YNV X;  1IQ8 A; 
#chains in the Genus database with same CATH homology
 3G0K A;  3CCS 3;  1GY7 A;  3UL6 A;  1DVD A;  3F14 A;  2O3O A;  3EE1 A;  2CG0 A;  5IER A;  3M8C A;  4R80 A;  1LNH A;  3V92 A;  2CWU A;  4H3U A;  3NUV A;  2WOH A;  4G1M B;  1VQN 3;  4HM6 B;  2P38 A;  1RKY A;  4XB5 A;  1HKX A;  2OWP A;  4N6M A;  4Q53 A;  2Z76 A;  2OTJ 3;  1S72 3;  3EX9 A;  3RGA A;  3DUK A;  1K8A 4;  3OW2 2;  5LC7 A;  2GU3 A;  4XBT A;  1W6G A;  2Y73 A;  3G8Z A;  3SVA A;  2BHM A;  3CXC 2;  5AEW B;  1HU9 A;  1VQ7 3;  3J7Y d;  1YJ9 3;  1IVW A;  1W2Z A;  1QAL A;  2CC3 A;  2W6J H;  1Q40 A;  2BMQ B;  2CHC A;  4PEJ A;  1M9G A;  4N6T A;  4R9L A;  2YFL B;  3X40 A;  3OX9 A;  3MG1 A;  1OUN A;  1OGX A;  3KSE D;  3G71 3;  3F7X A;  1GY5 A;  5IG5 A;  3DGL A;  3VSY A;  1A2K A;  4WHA A;  2Z6B A;  1FUW A;  1N5P A;  2F86 B;  3CCJ 3;  1WTH A;  3JUN A;  2W04 A;  3G6E 3;  1SIH A;  3I55 3;  1VQK 3;  5IEP A;  1CQS A;  5I97 A;  2IMJ A;  1GY6 A;  5CLK A;  5AI1 A;  1RJO A;  2GEY A;  2F98 A;  3PXM A;  3B7C A;  1V74 A;  3PYJ A;  1KSI A;  2SBL A;  3X3Y A;  3CME 3;  3S29 A;  1K73 4;  5DRV A;  3NBJ A;  4EV2 A;  2BMR B;  1CYU A;  3G4S 3;  1Q81 4;  1NO3 A;  1JB5 A;  3UNL A;  4ZM8 A;  4X2O A;  1KQS 2;  2IUK A;  4FMD A;  2P05 A;  5AYS C;  1F8N A;  1FA3 A;  1CEW I;  1RRH A;  4FCZ A;  2P0X A;  1KD1 4;  1DMN A;  1SJW A;  3B4O A;  5CF1 A;  1YJW 3;  1Q42 A;  1U8C B;  3V99 A;  4EBG A;  1QAK A;  1T5Y A;  2YFJ B;  4IT7 A;  3JUM A;  3H51 A;  1WNH A;  2D1W A;  1VQM 3;  1STF I;  1OF5 B;  4RNZ A;  3KII A;  5TGN A;  3JVC A;  1M1X B;  3OWU A;  3GWR A;  3CMA 3;  4R4K A;  5EVH A;  3MPH A;  3WOF B;  2Q07 A;  3K5T A;  4FR9 A;  7STD A;  2HMM B;  5IW9 A;  3CCE 3;  2LYX A;  1JNQ A;  3HI7 A;  3VF1 A;  3BND A;  1NWW A;  3NM7 A;  2CFW A;  2RGQ A;  4H61 A;  3KSP A;  3H3H A;  2W2C A;  3FF2 A;  5EQL A;  4N6L A;  1KC8 4;  5AYR B;  5STD A;  3NV0 A;  4NHF A;  5KP4 A;  1YI2 3;  3WOE B;  2XR8 B;  3PZW A;  2XFS A;  1NB5 I;  3CNX A;  2K54 A;  1EA2 A;  3AMO B;  1IVV A;  3LTC A;  3DY5 A;  2YX9 A;  1W5Z A;  3CC4 3;  1NDO B;  3MYT A;  4O02 B;  4FMB A;  3S67 A;  6STD A;  2MC8 A;  4HZ9 B;  1M1K 4;  5D82 A;  5JPU A;  1NJI 4;  2CWT A;  3IPT A;  2JQ5 A;  3MWZ A;  3O8Y A;  4XDW A;  2W9P A;  3BNB A;  3F8H A;  1K41 A;  4HYZ A;  4RZM A;  1YIJ 3;  3F8X A;  1W01 A;  4LEH A;  4HM3 B;  3T8N A;  3ER7 A;  1OHO A;  4NRE A;  5CXO A;  4HM1 B;  5KP1 A;  1UUV B;  2QGU A;  3D3L A;  2CFG A;  4L8O A;  1VQL 3;  3K9M C;  3JUP A;  4KFF A;  5ELU A;  3FSD A;  4JF8 A;  2LQV A;  2E2U A;  4HVN A;  1QVF 2;  2RSX A;  1AV4 A;  1JKG B;  2KXG A;  2KRT A;  3BLZ A;  2FGT A;  3LXU X;  5G2G A;  3LTD A;  3EHC A;  3DMC A;  1IDP A;  1GD3 A;  4CCV A;  3FG3 A;  3BNE A;  3CPW 2;  1E3R A;  3GAX A;  1WQL B;  4MMY B;  3NHX A;  3NQY A;  1S5A A;  1UI8 A;  2IA7 A;  3GZR A;  2ML6 A;  3NBB A;  4HJL B;  2YFI B;  3KZT A;  4R1K A;  4EV5 A;  2GBX B;  4XM4 A;  2CIU A;  1IVU A;  2JDI H;  3WA2 X;  2CFD A;  1W7C A;  3U97 A;  4AEQ A;  3GRD A;  2Z77 A;  5LC6 A;  1Q7Y 4;  1SPU A;  2HML B;  1VZZ A;  3I56 3;  1ULJ B;  1LVN A;  3CPO A;  2W9Q A;  2HMK B;  4MEI A;  1TU5 A;  1N9E A;  2WGQ A;  3FF0 A;  4HM7 B;  5AEU B;  2B1X B;  1VQP 3;  3GZB A;  2QEX 3;  2KCD A;  3SED A;  1A90 A;  2B24 B;  3EN8 A;  1VQ5 3;  3S5C A;  1O7G B;  4U13 A;  1IU7 A;  3BB9 A;  5CK6 A;  1D6Z A;  1JRQ A;  3MHE A;  1UUW B;  3EJV A;  2CW9 A;  1PFP A;  3JUO A;  2CWV A;  4K90 B;  1KWI A;  2RCD A;  3CCQ 3;  5IG0 A;  4N3V A;  2M7O A;  3UB1 A;  3I0Y A;  2Y74 A;  2P0M A;  4OVM A;  3WOD G;  1VQ8 3;  5EEO A;  3LT9 A;  3PCS A;  3LH4 A;  3ECF A;  1ISK A;  3FKA A;  5IG4 A;  4O2H A;  1NB3 I;  2CK3 H;  1A2V A;  2GEX A;  1OH0 A;  3MSO A;  3SLU A;  2E2T A;  1TFK A;  3A76 A;  3UL5 A;  1OF5 A;  3CNM A;  2CG1 A;  4CDL A;  3SX1 A;  3SOY A;  3EBT A;  2BT3 A;  1YVB I;  3GZY B;  4HM4 B;  2QA4 3;  1U5O A;  5IG3 A;  1LOX A;  4IIA A;  2PZV A;  3CD6 3;  1STD A;  1JJ2 2;  3X3X A;  1MNL A;  1Q82 4;  3Q90 A;  3CU3 A;  4EC6 A;  3OXA A;  4AKY A;  4XBY A;  4I4K A;  3X42 A;  1TFO A;  1Z1S A;  1IQX A;  3MKI A;  2WOF A;  3LZA A;  1VQ6 3;  1AR0 A;  2A15 A;  2GBW B;  3EC9 A;  2O9U X;  3HII A;  2OOV C;  4L7K A;  5CF2 A;  3IJE B;  3F9S A;  2FNQ A;  3NX0 A;  5D81 A;  2WO0 A;  1N5H A;  3NQZ A;  1NU3 A;  3EB8 A;  4RNY A;  2STD A;  4OUQ A;  1ULI B;  2E2V A;  2PNC A;  1AVK A;  1YHQ 3;  3LTA A;  1ZO2 A;  3CC2 3;  3AMO A;  1GD4 A;  3V98 A;  4O3V A;  5AIH A;  4WP5 A;  1DVC A;  1R4C A;  4HM0 B;  2Z7A A;  4GB5 A;  5A0O B;  3CCL 3;  2BNG A;  3VGN A;  1IV9 A;  4GL6 A;  2INX A;  1EQK A;  4FCM A;  2W56 B;  4MMZ B;  4TX4 A;  4K61 A;  1W4N A;  1UI7 A;  4L8P A;  3FLJ A;  3IMA B;  2XRX B;  2C10 A;  3WA3 A;  1WMO A;  2V1L A;  2IUJ A;  3CCV 3;  2R4I A;  2CFK A;  1YIT 3;  3DGO A;  1QAF A;  1QVG 2;  4K1U A;  5ELJ A;  1UW1 A;  1VQO 3;  3S27 A;  2K0M A;  3JUQ A;  1JN5 B;  3NXJ A;  2L4V A;  1FGR A;  3CCR 3;  1IV7 A;  1DYU A;  1JKG A;  2HMN B;  4STD A;  4AKZ A;  3EBY A;  1W6Y A;  2XH9 A;  4BTW A;  3MG3 A;  2OQE A;  3K63 A;  2OCT A;  1O7P B;  3EF8 A;  1MOL A;  2ZL8 A;  2W03 A;  3KE7 A;  1D6Y A;  3KFQ C;  4KZ1 A;  3EN1 B;  3LYG A;  1IK3 A;  2ZDJ A;  1YJN 3;  1W2B 2;  3D9R A;  4R9K A;  3BNC A;  3HK4 A;  1SII A;  5KP3 A;  1N8Q A;  5IF6 A;  2CKF B;  4IPB A;  3LTB A;  3B4P A;  1N8R 4;  3HIG A;  4LSO A;  4K1V A;  1O7M B;  5IEO A;  2CFL A;  3PGB A;  2UX0 A;  1IQY A;  3STD A;  1Y4K A;  2XSO B;  3B8L A;  1EKM A;  1K28 A;  5HGR A;  2D42 A;  3LML A;  4HM5 B;  2XF3 A;  3PS8 A;  3X41 A;  1C7H A;  2W0Q A;  3N54 B;  3EQQ B;  2MF7 A;  4O8S A;  4LGQ A;  1E3V A;  4MJD A;  3RDE A;  1Q40 B;  4EYC A;  4HBR A;  4J8T A;  4FMC A;  3E99 A;  3U1W A;  3FH1 A;  3Q1C A;  4N6V 0;  1DMQ A;  1OHP A;  3G16 A;  5BVB A;  3FZW A;  1OCV A;  3DGN A;  1OGZ A;  2GU1 A;  2ML5 A;  1QJG A;  1AVL A;  4FCJ A;  2HMO B;  1DMM A;  4MMX B;  4WYK B;  4KFD A;  3DGM A;  4WYK A;  3F40 A;  1TUH A;  2BMO B;  3KKG A;  4ORL A;  4BTX A;  1M90 4;  3ROB A;  1IVX A;  3Q2P A;  1VQ4 3;  1ROA A;  3UJM A;  1WMP A;  3L0R A;  4X2H A;  1QMA A;  2FXT A;  3GZX B;  4LZI A;  2I9W A;  1W6C A;  2QIY A;  5AII A;  2XEP A;  3N8B A;  3S28 A;  3HX8 A;  3MG2 A;  5FGO A;  3WMD A;  3F7S A;  1VQ9 3;  1J2B A;  3ALA A;  4XDV A;  3PCR A;  2XGN A;  3CCU 3;  3FGY A;  1N9J A;  2P09 A;  3KN4 A;  1ZX2 A;  4WFO A;  1OHS A;  1TIJ A;  4XBX A;  5JPP A;  4HZB B;  2BO9 B;  3HZP A;  4BTY A;  3N9H A;  1FGM A;  1FGQ A;  4QWT A;  3FG4 A;  3CCM 3;  4J9A A;  1Q86 4;  3CC7 3;  1IT8 A;  4JRF A;  1JB4 A;  5DRE A;  1OAC A;  1RN7 A;  8CHO A;  4LMI A;  3SOA A;  1RRL A;  3QK9 A;  2C11 A;  3X3Z A;  4KFE A;  4WWU C;  1GYB A;  3OWS A;  3OV4 A;  5AIG A;  3RGR A;  5JBS A;  1SQW A;  3DM8 A;  3LOY A;  3K7C A;  1US1 A;  1BUQ A;  3QRD A;  2XGL A;  3T0U A;  4EXR A;  1K9M 4;  3NM2 A;  1O7N B;  1JB2 A;  4KVH A;  3NBR A;  3NV0 B;  1FGT A;  4RBN A;  1OPY A;  5BXQ A;  1G96 A;  4FMA A;  4OK0 A;  2W56 A;  2OOV A;  1CYV A;  1O7H B;  1ASK A;  3FCS B;  1D6U A;  1EG9 B;  1LXE A;  2WGO A;  3FG1 A;  3TDG A;  1PU4 A;  1JV2 B;  2XSH B;  1O7W B;  1E97 A;  2XFT A;  5D83 A;  4N6N B;  2GXF A;  1YGE A;  1JN5 A;  1W00 A;  2HMJ B;  2OQE C;  3DXO A;  2F99 A;  5IEN A;  1TP6 A;  3OWY A;  3SXX A;  5AIF A;  4HKV B;  1A67 A;  1FGO A;  3T8U A;  2RFR A;  4N6U A;  4HM2 B;  3WDG B;  3LT8 A;  4N6O B;  1W02 A;  5FW5 A;  2CH9 A;  1GS3 A;  1WMN A;  3K0Z A;  4HM8 B;  1L5G B;  2OTL 3;  1IT7 A;  3DZL A;  1ROV A;  1IQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...