3WODG

Rna polymerase-gp39 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
135
structure length
127
Chain Sequence
GFVEPYIRLFEAIPDAETELATFYDADLDTLPPRMFLPSGDLYTPPGPVRLEEIKRKRRVRLVKVSIYRFEHVGLGLAARPYAYAYAWQGDNGILHLYHAPVVLEDEVTYNESYVRLMRAMGHVDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
total genus 25
structure length 127
sequence length 135
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.550 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3wodG00
3WOEB 3WOFB 3WODG
chains in the Genus database with same CATH superfamily
2AAEA 1B2MA 3MG3A 5D81A 2F5WA 3IJEB 2CFLA 1X1YA 3WMDA 1RGGA 2Y73A 3PXMA 3FGYA 1TTOA 4HM1B 3GWRA 4NPBA 1JZOA 1X1UA 1RGAA 1LQGC 3RGAA 4BIRA 1KSIA 1JV2B 1TRQA 3DH2A 4XBXA 1ROAA 1B27A 2STDA 2W6JH 1JN5A 1RN4A 5CXOA 3H51A 3S29A 1DMNA 1D6UA 3VF1A 1N5HA 3LZAA 1IVWA 1OF5A 1AQZA 4FCZA 2WOHA 1QMAA 1LNIA 2XGLA 4O02B 5I97A 3LOYA 5M19A 1OH0A 3NBRA 4N6OB 1NU3A 2E2TA 2GEYA 5AIIA 1VZZA 1VQ93 3BNCA 3LXUX 2W56B 1BUJA 1ISKA 1D6YA 1RNBA 3T0UA 4ORLA 3WODG 1IQ8A 3EQQB 4K1UA 1Q9EA 4HVNA 1UI7A 1LRAA 2BNGA 1VQM3 2IY2A 3G16A 4IIAA 4LZIA 3SXXA 4ZM8A 1JJ22 3MSOA 2HMKB 1STDA 1BNIA 1FUSA 2CG0A 3A5EA 4K1VA 2CH9A 1RSNA 3STDA 3PGBA 3QRDA 1MGWA 1UUWB 1STFI 3S5CA 3NXJA 1GOUA 2OQEA 1SPUA 4FMDA 4HM0B 4K90B 1G0TA 4X2OA 1NO3A 1BNSA 4GL6A 1K41A 3DXOA 2P05A 5AYSC 1RCLA 4KFDA 5BU4A 3X41A 2A15A 3HK4A 5D83A 3NV0B 1Z1SA 5STDA 2YFIB 1X1WA 9RNTA 3LMLA 4BTYA 1W02A 3VSYA 1EUIC 3F14A 1B21A 3MYTA 1J2BA 2JQ5A 4G1MB 2QEX3 3CMA3 2W0QA 3LT8A 2FGTA 5IEPA 1GS3A 1WQLB 1YHQ3 2CFDA 4QWTA 3HX8A 1CQSA 2KF6A 2L1SA 3DM8A 4HM7B 3NHXA 2KRTA 3U97A 5IG4A 1NNVA 2W2CA 1IQYA 3BNDA 1JB2A 1LOXA 4HM6B 4FCJA 5G1LA 1GD4A 2V1LA 5JPUA 4EXRA 2BMRB 2D1WA 1UCLA 1UGHI 1OGXA 1PYLA 1W6YA 4GB5A 5DRVA 2QIYA 1MOLA 5BXQA 3EJVA 2H0HA 3SVAA 1FUWA 4K61A 1YVBI 1DETA 1RTUA 5IERA 1WMOA 1N8QA 3CME3 1YI23 1W2B2 1VQ83 4N6TA 1VQP3 4BTWA 5FW5A 1YIJ3 5IENA 3X3XA 1VQ63 1R4CA 2HMJB 4KZ1A 1DMMA 3Q1CA 3BNBA 1A2PA 4EYCA 1BIRA 1YJW3 3D4AA 1GOYA 2PNCA 1UCKA 3OXAA 1PU4A 1LNHA 1QVG2 1YJ93 1O7HB 1E3RA 1GMPA 1ZGXA 3ER7A 1JKGB 4L7KA 1ULIB 2GXFA 1JBRA 3JVCA 1A2KA 3KSPA 4XBTA 1VQ43 2Z77A 1T3BA 1WNHA 1IVVA 3ZG5A 1UUVB 6STDA 3N9HA 3FSDA 3FLJA 1Q40B 3AGNA 1GMQA 1RN7A 2QA43 2XGNA 1B3SA 1KWIA 1O7NB 1RGEA 2HMMB 2YFLB 2GBXB 5AYRB 4HJLB 1YJN3 2E2VA 1I3FA 1UDII 5HGRA 4WP5A 1VQN3 2OQEC 2OCTA 3NBBA 4XBYA 4LMIA 4CDLA 4FMAA 1BAOA 2UGIA 2W03A 4EV5A 3B8LA 1WMPA 3BNEA 4HYZA 1BRHA 1C7HA 3QK9A 1K734 2SBLA 3DGYA 4R1KA 2R41A 1OHPA 1LQMB 1BANA 2KCDA 3X3ZA 1KD14 1VQ53 3CPOA 2W9QA 2Z7AA 1C54A 3OWSA 4NREA 2P0MA 4WWUC 2XR8B 3AHSA 3CCJ3 1B2SA 4J8TA 3CCQ3 1I3IA 4JF8A 1MWTA 3F9SA 1BNJA 1GY6A 5IG3A 1OUNA 4IPBA 3BIRA 1ZO2A 1B2XA 3WOFB 2CWUA 2FXTA 2XSOB 4J5GA 3V92A 1LOYA 2O9UX 1TIJA 3CCU3 3EN1B 4HM8B 2YX9A 3JUPA 3HIGA 1Q7HA 1MGRA 1GSPA 2RCDA 1X1XA 2RNTA 1D6ZA 1E97A 1EG9B 2HMOB 3KN4A 3UL6A 1BRNL 3RNTA 1PY3A 1BSEA 4ILFA 1BRKA 1TFKA 2F99A 2ML5A 2WO0A 1BSAA 4BTXA 1VQ73 3Q2PA 4EBGA 3WOEB 2XSHB 3FKAA 1O7GB 3Q3FA 2H0GA 1RHLA 1Y4KA 2BMQB 2AADA 1LXEA 1MWSA 4BL2A 1G02A 1AY7A 1AVKA 2I9WA 2OOVA 4XDWA 5TGNA 3G8ZA 3DGLA 3CXC2 2C11A 3A76A 3AMOA 4R80A 3SYUA 8RNTA 1V74A 7RNTA 3FG3A 2Z76A 1RGLA 3EB8A 1RGHA 1CYVA 1A2VA 3PCSA 1UUGB 3ALAA 4O3VA 2GU3A 3MG2A 4LGQA 3FH1A 3LH4A 1BSBA 4HBRA 3CCM3 3N8BA 2KF4A 2P0XA 1BRSA 1ZS7A 2HMLB 3GSPA 3K9MC 5AIFA 1LOWA 1RN1A 1RCKA 1B2ZA 3K0ZA 4XDVA 1RDSA 3X42A 3ECFA 3F7XA 1BNRA 5G1KA 5LC7A 2KXGA 3B7CA 1BNFA 2CFKA 1GY5A 2UUGC 2CC3A 1BRGA 5G2GA 2K0MA 5LC6A 4WFOA 1FYSA 1OACA 1YGEA 5JBSA 2CX1A 1K8A4 3FG1A 1TJDA 1NB5I 1W7CA 3NUVA 1HYFA 3NM7A 1O7MB 3EC9A 3SLUA 3HI7A 2INXA 1SARA 2Q07A 1SIIA 3UB1A 1B2UA 1W01A 2LQVA 3KZTA 3ZFZA 2F4YA 3CC43 1W00A 1T2IA 1W6CA 5IEOA 3CCR3 2FNQA 3RDEA 1M1K4 2RFRA 3AHWA 1QJGA 1DVCA 4OK0A 3UL5A 1K9M4 1EEJA 3LTAA 5CLKA 4N6LA 1S723 3S67A 1I0XA 5GSPA 2HMNB 3G6E3 1VQL3 5FGOA 1T5YA 3V98A 1Q864 2ZDJA 3KIIA 4RNYA 1JRQA 3S28A 2CKFB 4LSOA 1JNQA 4KVHA 3SX1A 1RGKA 2CK3H 5CF1A 2C10A 2R4IA 2B24B 1N9EA 3EBYA 3F8XA 1ASKA 3D5IA 1AVLA 1OHSA 3CNMA 3HZPA 4O8SA 3B4PA 4MMZB 1UW1A 3I563 4J9AA 2P38A 1OHOA 4WYKB 1IV7A 2OOVC 4HOHA 3NQYA 1M9GA 4IT7A 5IG0A 1MWRA 2CHCA 3WDGB 3DMCA 1IVUA 1DYUA 3KCHA 1QAFA 5EVHA 3WA2X 6RNTA 1K28A 1PFPA 3MKIA 2M7OA 4FR9A 2O3OA 3CCV3 4R9LA 4HM2B 1EQKA 1HU9A 3K5TA 4HKVB 2GU1A 2Z6BA 4RNZA 3FF0A 3GRDA 4HM3B 3PS8A 1IVXA 1JN5B 1F8NA 3MWZA 5DREA 3Q90A 2JDIH 3G0KA 4NHFA 5JPPA 3DZLA 1LOVA 1GD3A 4RNTA 3CC23 1RNTA 1I70A 1UCJA 1VQO3 3MG1A 1OF5B 5AEUB 4OVMA 3T8UA 4MMYB 2F56A 4HZ9B 2Y74A 1RGCA 2SARA 1U8CB 2XFSA 2YFJB 3BU4A 1N5PA 3ZG0A 4R4KA 4XB5A 4JRFA 3SOYA 2KAAA 3EF8A 4N6V0 3UJMA 2L4VA 2K54A 3ROBA 5ELJA 3AMOB 3NQZA 1CH0A 3J7Yd 2LYXA 2H0IA 3WR2A 3EBTA 3VGNA 2C4BA 4HZBB 4AKYA 3OWYA 3GZBA 1Q814 1GY7A 1W6GA 5BIRA 4I5QA 7STDA 1BSCA 1LVNA 1FZUA 3NM2A 3D3LA 4R9KA 3CC73 3CD63 1NB3I 3SEDA 2W9PA 2GSPA 7GSPA 1ULJB 3X3YA 4MEIA 4N6NB 4STDA 3LTBA 3KE7A 4N6MA 1I0VA 5CK6A 1UCIA 1AV4A 4HM5B 4GSPA 4MJDA 1TU5A 2BMOB 1US1A 2CX0A 2CW9A 4L8OA 1W2ZA 3BB9A 1IT8A 1MNLA 1GOVA 3CCE3 2PZVA 1KC84 5KP3A 2B1XB 1Q40A 3CNXA 1RRLA 2OTJ3 2CFGA 1O7PB 1MWUA 3IMAB 3EN8A 1IQXA 2WGOA 1BNGA 1OGZA 3FCSB 1BOXA 1EKMA 2HOHA 4FMBA 3S27A 2CWVA 2XH9A 5HOHA 3EHCA 3RGRA 1KQS2 1E3VA 4EW5A 2IA7A 3KSED 1R4YA 4KT3B 3X40A 1BNEA 3LTCA 4EC6A 3E99A 3U1WA 1IU7A 3FZWA 1JBTA 1AR0A 2F98A 2QGUA 4FCMA 4MMXB 1JBSA 2ZHXB 1SQWA 3CCL3 3TDGA 1BVIA 3V99A 3EE1A 1HZ1A 3GZRA 1FGOA 1RMSA 2WOFA 1BRIA 3OW22 2OWPA 1I2FA 3EX9A 4TX4A 1QALA 1IV9A 3KFQC 2GEXA 4OUQA 4U13A 5ELUA 1M904 4N6UA 5M1AA 2KF3A 5D82A 4CJNA 5EEOA 2MF7A 4DKIA 5M18A 3B4OA 5KP1A 3OX9A 1I2GA 3WHOA 3MPHA 1A90A 3GZXB 1IT7A 3UNLA 2D42A 4CCVA 1SIHA 3G713 3LTDA 4BL3A 3FF2A 5RNTA 3L0RA 3JUMA 1Q824 4AEQA 1UGIA 5KP4A 1DE3A 1RKYA 3F40A 1OPYA 3SOAA 2IYJA 1CEWI 4XM4A 4L8PA 4J5KA 3AGOA 3N54B 2BT3A 2GBWB 2RBIA 3CU3A 1W5ZA 1YVSA 3URPA 1FGTA 2KF5A 1V57A 3DY5A 3K7CA 4FMCA 5IW9A 4Q53A 5A0OB 5IF6A 1RGFA 1DMQA 1FUTA 2XRXB 1UI8A 1BGSA 1FGMA 1JB5A 1V58A 3JUNA 4RZMA 1U5OA 2XEPA 1CYUA 2E2UA 1BUQA 2WGQA 2W56A 1YGWA 4RBNA 2IUKA 3KKGA 2ZA4A 3K63A 3DUKA 3HOHA 4HAAA 4N3VA 1IYYA 3M8CA 3F7SA 3FG4A 4I4KA 3IPTA 4KFEA 6GSPA 2P09A 5IG5A 5AIGA 1EA2A 1S5AA 2MC8A 3I0YA 1JZDA 4GHOA 3PZWA 2ZL8A 3OWUA 4O2HA 1HKXA 3D5GA 3D9RA 3G4S3 3OV4A 5CF2A 1GMRA 4EV2A 3NBJA 1FGQA 1WMNA 1SJWA 3DGMA 2ML6A 4H3UA 5BVBA 8CHOA 4H61A 1FA3A 1QVF2 1RJOA 1QAKA 3T8NA 2IMJA 2W04A 1I8VA 1NJI4 1IDPA 3NV0A 1VQK3 4X2HA 2K3DA 1RRHA 2CIUA 4AKZA 1Q7Y4 3CCS3 3NX0A 1OCVA 3D79A 2BHMA 2XFTA 2BIRA 1WTHA 1G96A 2CWTA 3CPW2 1NDOB 3GAXA 3DGOA 3LT9A 2RSXA 2F86B 1N9JA 1TRPA 5EQLA 3JUQA 1NWWA 1Q42A 1RLSA 2RGQA 3HIIA 2XF3A 3PCRA 3F8HA 3JUOA 3H3HA 1FGRA 1VQQA 2F5MA 1YNVX 4HM4B 5AI1A 3I553 1FW7A 1BU4A 1IK3A 2OTL3 1M1XB 3MHEA 3BLZA 2IUJA 1YIT3 2BU4A 4LEHA 4BU4A 3DGNA 3LYGA 1ZX2A 1GYBA 4KFFA 5AIHA 1N8R4 2BO9B 1ROVA 1TFOA 1TUHA 1A67A 1DVDA 2UX0A 1BRJA 4PEJA 1T2HA 1TP6A 4WYKA 4WHAA 3O8YA 1O7WB 3GZYB 4CPKA 3PYJA 1JB4A 1W4NA 5AEWB 2J8XB 3WA3A 1BSDA 4LYLB 1I2EA 2CG1A 1L5GB 1JKGA 2CFWA 1B20A
chains in the Genus database with same CATH topology
3MG3A 5D81A 3IJEB 2CFLA 3WMDA 2Y73A 3PXMA 3FGYA 4HM1B 3GWRA 3RGAA 1KSIA 1JV2B 4XBXA 1ROAA 2STDA 2W6JH 1JN5A 5CXOA 3S29A 3H51A 3VF1A 1DMNA 1D6UA 1N5HA 3LZAA 1IVWA 1OF5A 4FCZA 2WOHA 1QMAA 2XGLA 4O02B 5I97A 3LOYA 1OH0A 3NBRA 4N6OB 1NU3A 2E2TA 2GEYA 5AIIA 1VZZA 1VQ93 3BNCA 3LXUX 2W56B 1ISKA 1D6YA 3T0UA 4ORLA 3WODG 1IQ8A 3EQQB 4K1UA 4HVNA 1UI7A 2BNGA 1VQM3 3G16A 4IIAA 4LZIA 3SXXA 4ZM8A 1JJ22 3MSOA 2HMKB 1STDA 2CG0A 4K1VA 2CH9A 3STDA 3PGBA 3QRDA 1UUWB 1STFI 3S5CA 3NXJA 2OQEA 1SPUA 4FMDA 4HM0B 4K90B 4X2OA 1NO3A 4GL6A 1K41A 3DXOA 2P05A 5AYSC 4KFDA 3X41A 2A15A 3HK4A 5D83A 3NV0B 1Z1SA 5STDA 2YFIB 3LMLA 4BTYA 1W02A 3VSYA 3F14A 3MYTA 1J2BA 2JQ5A 4G1MB 2QEX3 3CMA3 2W0QA 3LT8A 2FGTA 5IEPA 1GS3A 1WQLB 1YHQ3 2CFDA 4QWTA 3HX8A 1CQSA 3DM8A 4HM7B 3U97A 3NHXA 2KRTA 5IG4A 2W2CA 3BNDA 1IQYA 5JPUA 1JB2A 1LOXA 4HM6B 4FCJA 1GD4A 2V1LA 4EXRA 2BMRB 2D1WA 1W6YA 1OGXA 4GB5A 5DRVA 2QIYA 1MOLA 5BXQA 3EJVA 3SVAA 1FUWA 4K61A 1YVBI 5IERA 3CME3 1WMOA 1N8QA 1YI23 1W2B2 1VQ83 4N6TA 1VQP3 4BTWA 5FW5A 1YIJ3 5IENA 3X3XA 1VQ63 1R4CA 2HMJB 4KZ1A 1DMMA 3Q1CA 3BNBA 4EYCA 1YJW3 2PNCA 3OXAA 1PU4A 1LNHA 1QVG2 1YJ93 1O7HB 1E3RA 3ER7A 1JKGB 4L7KA 1ULIB 2GXFA 3JVCA 1A2KA 3KSPA 4XBTA 1VQ43 2Z77A 1WNHA 1IVVA 1UUVB 6STDA 3N9HA 3FSDA 3FLJA 1Q40B 1RN7A 2QA43 2XGNA 1KWIA 1O7NB 2HMMB 2YFLB 2GBXB 5AYRB 4HJLB 1YJN3 2E2VA 5HGRA 4WP5A 1VQN3 2OQEC 2OCTA 3NBBA 4XBYA 4LMIA 4CDLA 4FMAA 2W03A 4EV5A 3B8LA 1WMPA 3BNEA 4HYZA 1C7HA 3QK9A 2SBLA 4R1KA 1OHPA 3X3ZA 2KCDA 1KD14 1VQ53 3CPOA 2W9QA 2Z7AA 3OWSA 4NREA 2P0MA 4WWUC 2XR8B 3CCJ3 4J8TA 3CCQ3 4JF8A 3F9SA 1GY6A 5IG3A 1OUNA 4IPBA 1ZO2A 3WOFB 2CWUA 2FXTA 2XSOB 3V92A 2O9UX 1TIJA 3CCU3 3EN1B 4HM8B 2YX9A 3JUPA 3HIGA 2RCDA 1D6ZA 1E97A 1EG9B 2HMOB 3KN4A 3UL6A 4BTXA 1TFKA 2F99A 2ML5A 2WO0A 1VQ73 3Q2PA 4EBGA 3WOEB 2XSHB 3FKAA 1O7GB 1Y4KA 2BMQB 1LXEA 1AVKA 2I9WA 2OOVA 4XDWA 5TGNA 3G8ZA 3DGLA 3CXC2 2C11A 3A76A 3AMOA 4R80A 1V74A 3FG3A 2Z76A 3EB8A 1CYVA 1A2VA 3PCSA 3ALAA 4O3VA 2GU3A 3MG2A 4LGQA 3FH1A 3LH4A 4HBRA 3CCM3 3N8BA 2P0XA 2HMLB 3K9MC 5AIFA 3K0ZA 4XDVA 3X42A 3ECFA 3F7XA 5LC7A 2KXGA 3B7CA 2CFKA 1GY5A 2CC3A 5G2GA 2K0MA 5LC6A 4WFOA 1OACA 1YGEA 5JBSA 1K8A4 3FG1A 1NB5I 1W7CA 3NUVA 3NM7A 1O7MB 3EC9A 3SLUA 3HI7A 2INXA 2Q07A 1SIIA 3UB1A 2LQVA 1W01A 3KZTA 3CC43 1W00A 5IEOA 1W6CA 1M1K4 3CCR3 2FNQA 3RDEA 2RFRA 4OK0A 1QJGA 1DVCA 3UL5A 1K9M4 3LTAA 5CLKA 4N6LA 1S723 3S67A 2HMNB 3G6E3 1VQL3 5FGOA 1T5YA 3V98A 1Q864 2ZDJA 3KIIA 4RNYA 1JRQA 3S28A 2CKFB 4LSOA 1JNQA 4KVHA 3SX1A 5CF1A 2CK3H 2C10A 2R4IA 2B24B 1N9EA 3EBYA 3F8XA 1ASKA 1AVLA 1OHSA 3CNMA 3HZPA 4O8SA 3B4PA 4MMZB 1UW1A 3I563 4J9AA 2P38A 1OHOA 4WYKB 1IV7A 2OOVC 3NQYA 1M9GA 4IT7A 5IG0A 2CHCA 3WDGB 3DMCA 1IVUA 1DYUA 1QAFA 5EVHA 3WA2X 1K28A 1PFPA 3MKIA 2M7OA 4FR9A 2O3OA 3CCV3 4R9LA 4HM2B 1EQKA 1HU9A 3K5TA 4HKVB 2GU1A 2Z6BA 4RNZA 3FF0A 3GRDA 4HM3B 3PS8A 1IVXA 1JN5B 1F8NA 3MWZA 5DREA 3Q90A 2JDIH 3G0KA 4NHFA 5JPPA 3DZLA 1K734 1GD3A 3CC23 1VQO3 3MG1A 1OF5B 5AEUB 4OVMA 3T8UA 4MMYB 4HZ9B 2Y74A 1U8CB 2XFSA 2YFJB 1N5PA 4R4KA 4XB5A 4JRFA 3SOYA 3EF8A 4N6V0 3UJMA 2L4VA 2K54A 3ROBA 5ELJA 3AMOB 3NQZA 3J7Yd 2LYXA 3EBTA 3VGNA 4HZBB 4AKYA 3OWYA 3GZBA 1Q814 1GY7A 1W6GA 7STDA 1LVNA 3NM2A 3D3LA 4R9KA 3CC73 3CD63 1NB3I 3SEDA 2W9PA 1ULJB 3X3YA 4MEIA 4N6NB 4STDA 3LTBA 3KE7A 4N6MA 5CK6A 1AV4A 4HM5B 4MJDA 1TU5A 2BMOB 1US1A 2CW9A 4L8OA 1W2ZA 3BB9A 1IT8A 1MNLA 3CCE3 2PZVA 1KC84 5KP3A 2B1XB 1Q40A 3CNXA 1RRLA 2OTJ3 2CFGA 1O7PB 3IMAB 3EN8A 1IQXA 2WGOA 1OGZA 3FCSB 4FMBA 1EKMA 3S27A 2CWVA 2XH9A 3EHCA 3RGRA 1KQS2 1E3VA 2IA7A 3KSED 3X40A 3LTCA 4EC6A 3E99A 3U1WA 1IU7A 3FZWA 1AR0A 2F98A 2QGUA 4FCMA 4MMXB 1SQWA 3CCL3 3TDGA 3V99A 3EE1A 3GZRA 1FGOA 2WOFA 3OW22 2OWPA 3EX9A 4TX4A 1QALA 1IV9A 3KFQC 2GEXA 4OUQA 4U13A 5ELUA 1M904 4N6UA 5D82A 5EEOA 2MF7A 3B4OA 5KP1A 3OX9A 3MPHA 1A90A 3GZXB 1IT7A 3UNLA 2D42A 4CCVA 1SIHA 3G713 3LTDA 3FF2A 3L0RA 3JUMA 1Q824 4AEQA 5KP4A 1RKYA 3F40A 1OPYA 3SOAA 1CEWI 4XM4A 4L8PA 3N54B 2BT3A 2GBWB 3CU3A 1W5ZA 5IW9A 1FGTA 3K7CA 3DY5A 4FMCA 4Q53A 5A0OB 5IF6A 1DMQA 2XRXB 1UI8A 1FGMA 1JB5A 4RZMA 3JUNA 1U5OA 2XEPA 1CYUA 2E2UA 1BUQA 2WGQA 2W56A 4RBNA 2IUKA 3KKGA 3K63A 3DUKA 4N3VA 3M8CA 3F7SA 3FG4A 4I4KA 3IPTA 4KFEA 2P09A 5IG5A 5AIGA 1EA2A 1S5AA 2MC8A 3I0YA 3PZWA 2ZL8A 3OWUA 4O2HA 1HKXA 3G4S3 3D9RA 3OV4A 5CF2A 4EV2A 3NBJA 1FGQA 1WMNA 1SJWA 3DGMA 2ML6A 4H3UA 5BVBA 8CHOA 4H61A 1FA3A 1QVF2 1RJOA 1QAKA 3T8NA 2IMJA 2W04A 1NJI4 1IDPA 3NV0A 1VQK3 4X2HA 1RRHA 2CIUA 4AKZA 1Q7Y4 3CCS3 3NX0A 1OCVA 2BHMA 2XFTA 1WTHA 1G96A 2CWTA 3CPW2 1NDOB 3GAXA 3DGOA 3LT9A 2RSXA 2F86B 1N9JA 5EQLA 3JUQA 1NWWA 1Q42A 2RGQA 3HIIA 2XF3A 3PCRA 3F8HA 3JUOA 3H3HA 1FGRA 4HM4B 5AI1A 3I553 1IK3A 2OTL3 1M1XB 3MHEA 3BLZA 2IUJA 1YIT3 4LEHA 3DGNA 3LYGA 1ZX2A 1GYBA 4KFFA 5AIHA 1N8R4 2BO9B 1ROVA 1TFOA 1TUHA 1A67A 1DVDA 2UX0A 4PEJA 1TP6A 4WYKA 4WHAA 3O8YA 1O7WB 3GZYB 3PYJA 1JB4A 1W4NA 5AEWB 3WA3A 2CG1A 1L5GB 1JKGA 2CFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOE B;  3WOF B;  3WOD G; 
#chains in the Genus database with same CATH topology
 2AAE A;  1B2M A;  3MG3 A;  5D81 A;  2F5W A;  3IJE B;  2CFL A;  1X1Y A;  3WMD A;  1RGG A;  2Y73 A;  3PXM A;  3FGY A;  1TTO A;  4HM1 B;  3GWR A;  4NPB A;  1JZO A;  1X1U A;  1RGA A;  1LQG C;  3RGA A;  4BIR A;  1KSI A;  1JV2 B;  1TRQ A;  3DH2 A;  4XBX A;  1ROA A;  1B27 A;  2STD A;  2W6J H;  1JN5 A;  1RN4 A;  5CXO A;  3H51 A;  3S29 A;  1DMN A;  1D6U A;  3VF1 A;  1N5H A;  3LZA A;  1IVW A;  1OF5 A;  1AQZ A;  4FCZ A;  2WOH A;  1QMA A;  1LNI A;  2XGL A;  4O02 B;  5I97 A;  3LOY A;  5M19 A;  1OH0 A;  3NBR A;  4N6O B;  1NU3 A;  2E2T A;  2GEY A;  5AII A;  1VZZ A;  1VQ9 3;  3BNC A;  3LXU X;  2W56 B;  1BUJ A;  1ISK A;  1D6Y A;  1RNB A;  3T0U A;  4ORL A;  3WOD G;  1IQ8 A;  3EQQ B;  4K1U A;  1Q9E A;  4HVN A;  1UI7 A;  1LRA A;  2BNG A;  1VQM 3;  2IY2 A;  3G16 A;  4IIA A;  4LZI A;  3SXX A;  4ZM8 A;  1JJ2 2;  3MSO A;  2HMK B;  1STD A;  1BNI A;  1FUS A;  2CG0 A;  3A5E A;  4K1V A;  2CH9 A;  1RSN A;  3STD A;  3PGB A;  3QRD A;  1MGW A;  1UUW B;  1STF I;  3S5C A;  3NXJ A;  1GOU A;  2OQE A;  1SPU A;  4FMD A;  4HM0 B;  4K90 B;  1G0T A;  4X2O A;  1NO3 A;  1BNS A;  4GL6 A;  1K41 A;  3DXO A;  2P05 A;  5AYS C;  1RCL A;  4KFD A;  5BU4 A;  3X41 A;  2A15 A;  3HK4 A;  5D83 A;  3NV0 B;  1Z1S A;  5STD A;  2YFI B;  1X1W A;  9RNT A;  3LML A;  4BTY A;  1W02 A;  3VSY A;  1EUI C;  3F14 A;  1B21 A;  3MYT A;  1J2B A;  2JQ5 A;  4G1M B;  2QEX 3;  3CMA 3;  2W0Q A;  3LT8 A;  2FGT A;  5IEP A;  1GS3 A;  1WQL B;  1YHQ 3;  2CFD A;  4QWT A;  3HX8 A;  1CQS A;  2KF6 A;  2L1S A;  3DM8 A;  4HM7 B;  3NHX A;  2KRT A;  3U97 A;  5IG4 A;  1NNV A;  2W2C A;  1IQY A;  3BND A;  1JB2 A;  1LOX A;  4HM6 B;  4FCJ A;  5G1L A;  1GD4 A;  2V1L A;  5JPU A;  4EXR A;  2BMR B;  2D1W A;  1UCL A;  1UGH I;  1OGX A;  1PYL A;  1W6Y A;  4GB5 A;  5DRV A;  2QIY A;  1MOL A;  5BXQ A;  3EJV A;  2H0H A;  3SVA A;  1FUW A;  4K61 A;  1YVB I;  1DET A;  1RTU A;  5IER A;  1WMO A;  1N8Q A;  3CME 3;  1YI2 3;  1W2B 2;  1VQ8 3;  4N6T A;  1VQP 3;  4BTW A;  5FW5 A;  1YIJ 3;  5IEN A;  3X3X A;  1VQ6 3;  1R4C A;  2HMJ B;  4KZ1 A;  1DMM A;  3Q1C A;  3BNB A;  1A2P A;  4EYC A;  1BIR A;  1YJW 3;  3D4A A;  1GOY A;  2PNC A;  1UCK A;  3OXA A;  1PU4 A;  1LNH A;  1QVG 2;  1YJ9 3;  1O7H B;  1E3R A;  1GMP A;  1ZGX A;  3ER7 A;  1JKG B;  4L7K A;  1ULI B;  2GXF A;  1JBR A;  3JVC A;  1A2K A;  3KSP A;  4XBT A;  1VQ4 3;  2Z77 A;  1T3B A;  1WNH A;  1IVV A;  3ZG5 A;  1UUV B;  6STD A;  3N9H A;  3FSD A;  3FLJ A;  1Q40 B;  3AGN A;  1GMQ A;  1RN7 A;  2QA4 3;  2XGN A;  1B3S A;  1KWI A;  1O7N B;  1RGE A;  2HMM B;  2YFL B;  2GBX B;  5AYR B;  4HJL B;  1YJN 3;  2E2V A;  1I3F A;  1UDI I;  5HGR A;  4WP5 A;  1VQN 3;  2OQE C;  2OCT A;  3NBB A;  4XBY A;  4LMI A;  4CDL A;  4FMA A;  1BAO A;  2UGI A;  2W03 A;  4EV5 A;  3B8L A;  1WMP A;  3BNE A;  4HYZ A;  1BRH A;  1C7H A;  3QK9 A;  1K73 4;  2SBL A;  3DGY A;  4R1K A;  2R41 A;  1OHP A;  1LQM B;  1BAN A;  2KCD A;  3X3Z A;  1KD1 4;  1VQ5 3;  3CPO A;  2W9Q A;  2Z7A A;  1C54 A;  3OWS A;  4NRE A;  2P0M A;  4WWU C;  2XR8 B;  3AHS A;  3CCJ 3;  1B2S A;  4J8T A;  3CCQ 3;  1I3I A;  4JF8 A;  1MWT A;  3F9S A;  1BNJ A;  1GY6 A;  5IG3 A;  1OUN A;  4IPB A;  3BIR A;  1ZO2 A;  1B2X A;  3WOF B;  2CWU A;  2FXT A;  2XSO B;  4J5G A;  3V92 A;  1LOY A;  2O9U X;  1TIJ A;  3CCU 3;  3EN1 B;  4HM8 B;  2YX9 A;  3JUP A;  3HIG A;  1Q7H A;  1MGR A;  1GSP A;  2RCD A;  1X1X A;  2RNT A;  1D6Z A;  1E97 A;  1EG9 B;  2HMO B;  3KN4 A;  3UL6 A;  1BRN L;  3RNT A;  1PY3 A;  1BSE A;  4ILF A;  1BRK A;  1TFK A;  2F99 A;  2ML5 A;  2WO0 A;  1BSA A;  4BTX A;  1VQ7 3;  3Q2P A;  4EBG A;  3WOE B;  2XSH B;  3FKA A;  1O7G B;  3Q3F A;  2H0G A;  1RHL A;  1Y4K A;  2BMQ B;  2AAD A;  1LXE A;  1MWS A;  4BL2 A;  1G02 A;  1AY7 A;  1AVK A;  2I9W A;  2OOV A;  4XDW A;  5TGN A;  3G8Z A;  3DGL A;  3CXC 2;  2C11 A;  3A76 A;  3AMO A;  4R80 A;  3SYU A;  8RNT A;  1V74 A;  7RNT A;  3FG3 A;  2Z76 A;  1RGL A;  3EB8 A;  1RGH A;  1CYV A;  1A2V A;  3PCS A;  1UUG B;  3ALA A;  4O3V A;  2GU3 A;  3MG2 A;  4LGQ A;  3FH1 A;  3LH4 A;  1BSB A;  4HBR A;  3CCM 3;  3N8B A;  2KF4 A;  2P0X A;  1BRS A;  1ZS7 A;  2HML B;  3GSP A;  3K9M C;  5AIF A;  1LOW A;  1RN1 A;  1RCK A;  1B2Z A;  3K0Z A;  4XDV A;  1RDS A;  3X42 A;  3ECF A;  3F7X A;  1BNR A;  5G1K A;  5LC7 A;  2KXG A;  3B7C A;  1BNF A;  2CFK A;  1GY5 A;  2UUG C;  2CC3 A;  1BRG A;  5G2G A;  2K0M A;  5LC6 A;  4WFO A;  1FYS A;  1OAC A;  1YGE A;  5JBS A;  2CX1 A;  1K8A 4;  3FG1 A;  1TJD A;  1NB5 I;  1W7C A;  3NUV A;  1HYF A;  3NM7 A;  1O7M B;  3EC9 A;  3SLU A;  3HI7 A;  2INX A;  1SAR A;  2Q07 A;  1SII A;  3UB1 A;  1B2U A;  1W01 A;  2LQV A;  3KZT A;  3ZFZ A;  2F4Y A;  3CC4 3;  1W00 A;  1T2I A;  1W6C A;  5IEO A;  3CCR 3;  2FNQ A;  3RDE A;  1M1K 4;  2RFR A;  3AHW A;  1QJG A;  1DVC A;  4OK0 A;  3UL5 A;  1K9M 4;  1EEJ A;  3LTA A;  5CLK A;  4N6L A;  1S72 3;  3S67 A;  1I0X A;  5GSP A;  2HMN B;  3G6E 3;  1VQL 3;  5FGO A;  1T5Y A;  3V98 A;  1Q86 4;  2ZDJ A;  3KII A;  4RNY A;  1JRQ A;  3S28 A;  2CKF B;  4LSO A;  1JNQ A;  4KVH A;  3SX1 A;  1RGK A;  2CK3 H;  5CF1 A;  2C10 A;  2R4I A;  2B24 B;  1N9E A;  3EBY A;  3F8X A;  1ASK A;  3D5I A;  1AVL A;  1OHS A;  3CNM A;  3HZP A;  4O8S A;  3B4P A;  4MMZ B;  1UW1 A;  3I56 3;  4J9A A;  2P38 A;  1OHO A;  4WYK B;  1IV7 A;  2OOV C;  4HOH A;  3NQY A;  1M9G A;  4IT7 A;  5IG0 A;  1MWR A;  2CHC A;  3WDG B;  3DMC A;  1IVU A;  1DYU A;  3KCH A;  1QAF A;  5EVH A;  3WA2 X;  6RNT A;  1K28 A;  1PFP A;  3MKI A;  2M7O A;  4FR9 A;  2O3O A;  3CCV 3;  4R9L A;  4HM2 B;  1EQK A;  1HU9 A;  3K5T A;  4HKV B;  2GU1 A;  2Z6B A;  4RNZ A;  3FF0 A;  3GRD A;  4HM3 B;  3PS8 A;  1IVX A;  1JN5 B;  1F8N A;  3MWZ A;  5DRE A;  3Q90 A;  2JDI H;  3G0K A;  4NHF A;  5JPP A;  3DZL A;  1LOV A;  1GD3 A;  4RNT A;  3CC2 3;  1RNT A;  1I70 A;  1UCJ A;  1VQO 3;  3MG1 A;  1OF5 B;  5AEU B;  4OVM A;  3T8U A;  4MMY B;  2F56 A;  4HZ9 B;  2Y74 A;  1RGC A;  2SAR A;  1U8C B;  2XFS A;  2YFJ B;  3BU4 A;  1N5P A;  3ZG0 A;  4R4K A;  4XB5 A;  4JRF A;  3SOY A;  2KAA A;  3EF8 A;  4N6V 0;  3UJM A;  2L4V A;  2K54 A;  3ROB A;  5ELJ A;  3AMO B;  3NQZ A;  1CH0 A;  3J7Y d;  2LYX A;  2H0I A;  3WR2 A;  3EBT A;  3VGN A;  2C4B A;  4HZB B;  4AKY A;  3OWY A;  3GZB A;  1Q81 4;  1GY7 A;  1W6G A;  5BIR A;  4I5Q A;  7STD A;  1BSC A;  1LVN A;  1FZU A;  3NM2 A;  3D3L A;  4R9K A;  3CC7 3;  3CD6 3;  1NB3 I;  3SED A;  2W9P A;  2GSP A;  7GSP A;  1ULJ B;  3X3Y A;  4MEI A;  4N6N B;  4STD A;  3LTB A;  3KE7 A;  4N6M A;  1I0V A;  5CK6 A;  1UCI A;  1AV4 A;  4HM5 B;  4GSP A;  4MJD A;  1TU5 A;  2BMO B;  1US1 A;  2CX0 A;  2CW9 A;  4L8O A;  1W2Z A;  3BB9 A;  1IT8 A;  1MNL A;  1GOV A;  3CCE 3;  2PZV A;  1KC8 4;  5KP3 A;  2B1X B;  1Q40 A;  3CNX A;  1RRL A;  2OTJ 3;  2CFG A;  1O7P B;  1MWU A;  3IMA B;  3EN8 A;  1IQX A;  2WGO A;  1BNG A;  1OGZ A;  3FCS B;  1BOX A;  1EKM A;  2HOH A;  4FMB A;  3S27 A;  2CWV A;  2XH9 A;  5HOH A;  3EHC A;  3RGR A;  1KQS 2;  1E3V A;  4EW5 A;  2IA7 A;  3KSE D;  1R4Y A;  4KT3 B;  3X40 A;  1BNE A;  3LTC A;  4EC6 A;  3E99 A;  3U1W A;  1IU7 A;  3FZW A;  1JBT A;  1AR0 A;  2F98 A;  2QGU A;  4FCM A;  4MMX B;  1JBS A;  2ZHX B;  1SQW A;  3CCL 3;  3TDG A;  1BVI A;  3V99 A;  3EE1 A;  1HZ1 A;  3GZR A;  1FGO A;  1RMS A;  2WOF A;  1BRI A;  3OW2 2;  2OWP A;  1I2F A;  3EX9 A;  4TX4 A;  1QAL A;  1IV9 A;  3KFQ C;  2GEX A;  4OUQ A;  4U13 A;  5ELU A;  1M90 4;  4N6U A;  5M1A A;  2KF3 A;  5D82 A;  4CJN A;  5EEO A;  2MF7 A;  4DKI A;  5M18 A;  3B4O A;  5KP1 A;  3OX9 A;  1I2G A;  3WHO A;  3MPH A;  1A90 A;  3GZX B;  1IT7 A;  3UNL A;  2D42 A;  4CCV A;  1SIH A;  3G71 3;  3LTD A;  4BL3 A;  3FF2 A;  5RNT A;  3L0R A;  3JUM A;  1Q82 4;  4AEQ A;  1UGI A;  5KP4 A;  1DE3 A;  1RKY A;  3F40 A;  1OPY A;  3SOA A;  2IYJ A;  1CEW I;  4XM4 A;  4L8P A;  4J5K A;  3AGO A;  3N54 B;  2BT3 A;  2GBW B;  2RBI A;  3CU3 A;  1W5Z A;  1YVS A;  3URP A;  1FGT A;  2KF5 A;  1V57 A;  3DY5 A;  3K7C A;  4FMC A;  5IW9 A;  4Q53 A;  5A0O B;  5IF6 A;  1RGF A;  1DMQ A;  1FUT A;  2XRX B;  1UI8 A;  1BGS A;  1FGM A;  1JB5 A;  1V58 A;  3JUN A;  4RZM A;  1U5O A;  2XEP A;  1CYU A;  2E2U A;  1BUQ A;  2WGQ A;  2W56 A;  1YGW A;  4RBN A;  2IUK A;  3KKG A;  2ZA4 A;  3K63 A;  3DUK A;  3HOH A;  4HAA A;  4N3V A;  1IYY A;  3M8C A;  3F7S A;  3FG4 A;  4I4K A;  3IPT A;  4KFE A;  6GSP A;  2P09 A;  5IG5 A;  5AIG A;  1EA2 A;  1S5A A;  2MC8 A;  3I0Y A;  1JZD A;  4GHO A;  3PZW A;  2ZL8 A;  3OWU A;  4O2H A;  1HKX A;  3D5G A;  3D9R A;  3G4S 3;  3OV4 A;  5CF2 A;  1GMR A;  4EV2 A;  3NBJ A;  1FGQ A;  1WMN A;  1SJW A;  3DGM A;  2ML6 A;  4H3U A;  5BVB A;  8CHO A;  4H61 A;  1FA3 A;  1QVF 2;  1RJO A;  1QAK A;  3T8N A;  2IMJ A;  2W04 A;  1I8V A;  1NJI 4;  1IDP A;  3NV0 A;  1VQK 3;  4X2H A;  2K3D A;  1RRH A;  2CIU A;  4AKZ A;  1Q7Y 4;  3CCS 3;  3NX0 A;  1OCV A;  3D79 A;  2BHM A;  2XFT A;  2BIR A;  1WTH A;  1G96 A;  2CWT A;  3CPW 2;  1NDO B;  3GAX A;  3DGO A;  3LT9 A;  2RSX A;  2F86 B;  1N9J A;  1TRP A;  5EQL A;  3JUQ A;  1NWW A;  1Q42 A;  1RLS A;  2RGQ A;  3HII A;  2XF3 A;  3PCR A;  3F8H A;  3JUO A;  3H3H A;  1FGR A;  1VQQ A;  2F5M A;  1YNV X;  4HM4 B;  5AI1 A;  3I55 3;  1FW7 A;  1BU4 A;  1IK3 A;  2OTL 3;  1M1X B;  3MHE A;  3BLZ A;  2IUJ A;  1YIT 3;  2BU4 A;  4LEH A;  4BU4 A;  3DGN A;  3LYG A;  1ZX2 A;  1GYB A;  4KFF A;  5AIH A;  1N8R 4;  2BO9 B;  1ROV A;  1TFO A;  1TUH A;  1A67 A;  1DVD A;  2UX0 A;  1BRJ A;  4PEJ A;  1T2H A;  1TP6 A;  4WYK A;  4WHA A;  3O8Y A;  1O7W B;  3GZY B;  4CPK A;  3PYJ A;  1JB4 A;  1W4N A;  5AEW B;  2J8X B;  3WA3 A;  1BSD A;  4LYL B;  1I2E A;  2CG1 A;  1L5G B;  1JKG A;  2CFW A;  1B20 A; 
#chains in the Genus database with same CATH homology
 3MG3 A;  5D81 A;  3IJE B;  2CFL A;  3WMD A;  2Y73 A;  3PXM A;  3FGY A;  4HM1 B;  3GWR A;  3RGA A;  1KSI A;  1JV2 B;  4XBX A;  1ROA A;  2STD A;  2W6J H;  1JN5 A;  5CXO A;  3S29 A;  3H51 A;  3VF1 A;  1DMN A;  1D6U A;  1N5H A;  3LZA A;  1IVW A;  1OF5 A;  4FCZ A;  2WOH A;  1QMA A;  2XGL A;  4O02 B;  5I97 A;  3LOY A;  1OH0 A;  3NBR A;  4N6O B;  1NU3 A;  2E2T A;  2GEY A;  5AII A;  1VZZ A;  1VQ9 3;  3BNC A;  3LXU X;  2W56 B;  1ISK A;  1D6Y A;  3T0U A;  4ORL A;  3WOD G;  1IQ8 A;  3EQQ B;  4K1U A;  4HVN A;  1UI7 A;  2BNG A;  1VQM 3;  3G16 A;  4IIA A;  4LZI A;  3SXX A;  4ZM8 A;  1JJ2 2;  3MSO A;  2HMK B;  1STD A;  2CG0 A;  4K1V A;  2CH9 A;  3STD A;  3PGB A;  3QRD A;  1UUW B;  1STF I;  3S5C A;  3NXJ A;  2OQE A;  1SPU A;  4FMD A;  4HM0 B;  4K90 B;  4X2O A;  1NO3 A;  4GL6 A;  1K41 A;  3DXO A;  2P05 A;  5AYS C;  4KFD A;  3X41 A;  2A15 A;  3HK4 A;  5D83 A;  3NV0 B;  1Z1S A;  5STD A;  2YFI B;  3LML A;  4BTY A;  1W02 A;  3VSY A;  3F14 A;  3MYT A;  1J2B A;  2JQ5 A;  4G1M B;  2QEX 3;  3CMA 3;  2W0Q A;  3LT8 A;  2FGT A;  5IEP A;  1GS3 A;  1WQL B;  1YHQ 3;  2CFD A;  4QWT A;  3HX8 A;  1CQS A;  3DM8 A;  4HM7 B;  3U97 A;  3NHX A;  2KRT A;  5IG4 A;  2W2C A;  3BND A;  1IQY A;  5JPU A;  1JB2 A;  1LOX A;  4HM6 B;  4FCJ A;  1GD4 A;  2V1L A;  4EXR A;  2BMR B;  2D1W A;  1W6Y A;  1OGX A;  4GB5 A;  5DRV A;  2QIY A;  1MOL A;  5BXQ A;  3EJV A;  3SVA A;  1FUW A;  4K61 A;  1YVB I;  5IER A;  3CME 3;  1WMO A;  1N8Q A;  1YI2 3;  1W2B 2;  1VQ8 3;  4N6T A;  1VQP 3;  4BTW A;  5FW5 A;  1YIJ 3;  5IEN A;  3X3X A;  1VQ6 3;  1R4C A;  2HMJ B;  4KZ1 A;  1DMM A;  3Q1C A;  3BNB A;  4EYC A;  1YJW 3;  2PNC A;  3OXA A;  1PU4 A;  1LNH A;  1QVG 2;  1YJ9 3;  1O7H B;  1E3R A;  3ER7 A;  1JKG B;  4L7K A;  1ULI B;  2GXF A;  3JVC A;  1A2K A;  3KSP A;  4XBT A;  1VQ4 3;  2Z77 A;  1WNH A;  1IVV A;  1UUV B;  6STD A;  3N9H A;  3FSD A;  3FLJ A;  1Q40 B;  1RN7 A;  2QA4 3;  2XGN A;  1KWI A;  1O7N B;  2HMM B;  2YFL B;  2GBX B;  5AYR B;  4HJL B;  1YJN 3;  2E2V A;  5HGR A;  4WP5 A;  1VQN 3;  2OQE C;  2OCT A;  3NBB A;  4XBY A;  4LMI A;  4CDL A;  4FMA A;  2W03 A;  4EV5 A;  3B8L A;  1WMP A;  3BNE A;  4HYZ A;  1C7H A;  3QK9 A;  2SBL A;  4R1K A;  1OHP A;  3X3Z A;  2KCD A;  1KD1 4;  1VQ5 3;  3CPO A;  2W9Q A;  2Z7A A;  3OWS A;  4NRE A;  2P0M A;  4WWU C;  2XR8 B;  3CCJ 3;  4J8T A;  3CCQ 3;  4JF8 A;  3F9S A;  1GY6 A;  5IG3 A;  1OUN A;  4IPB A;  1ZO2 A;  3WOF B;  2CWU A;  2FXT A;  2XSO B;  3V92 A;  2O9U X;  1TIJ A;  3CCU 3;  3EN1 B;  4HM8 B;  2YX9 A;  3JUP A;  3HIG A;  2RCD A;  1D6Z A;  1E97 A;  1EG9 B;  2HMO B;  3KN4 A;  3UL6 A;  4BTX A;  1TFK A;  2F99 A;  2ML5 A;  2WO0 A;  1VQ7 3;  3Q2P A;  4EBG A;  3WOE B;  2XSH B;  3FKA A;  1O7G B;  1Y4K A;  2BMQ B;  1LXE A;  1AVK A;  2I9W A;  2OOV A;  4XDW A;  5TGN A;  3G8Z A;  3DGL A;  3CXC 2;  2C11 A;  3A76 A;  3AMO A;  4R80 A;  1V74 A;  3FG3 A;  2Z76 A;  3EB8 A;  1CYV A;  1A2V A;  3PCS A;  3ALA A;  4O3V A;  2GU3 A;  3MG2 A;  4LGQ A;  3FH1 A;  3LH4 A;  4HBR A;  3CCM 3;  3N8B A;  2P0X A;  2HML B;  3K9M C;  5AIF A;  3K0Z A;  4XDV A;  3X42 A;  3ECF A;  3F7X A;  5LC7 A;  2KXG A;  3B7C A;  2CFK A;  1GY5 A;  2CC3 A;  5G2G A;  2K0M A;  5LC6 A;  4WFO A;  1OAC A;  1YGE A;  5JBS A;  1K8A 4;  3FG1 A;  1NB5 I;  1W7C A;  3NUV A;  3NM7 A;  1O7M B;  3EC9 A;  3SLU A;  3HI7 A;  2INX A;  2Q07 A;  1SII A;  3UB1 A;  2LQV A;  1W01 A;  3KZT A;  3CC4 3;  1W00 A;  5IEO A;  1W6C A;  1M1K 4;  3CCR 3;  2FNQ A;  3RDE A;  2RFR A;  4OK0 A;  1QJG A;  1DVC A;  3UL5 A;  1K9M 4;  3LTA A;  5CLK A;  4N6L A;  1S72 3;  3S67 A;  2HMN B;  3G6E 3;  1VQL 3;  5FGO A;  1T5Y A;  3V98 A;  1Q86 4;  2ZDJ A;  3KII A;  4RNY A;  1JRQ A;  3S28 A;  2CKF B;  4LSO A;  1JNQ A;  4KVH A;  3SX1 A;  5CF1 A;  2CK3 H;  2C10 A;  2R4I A;  2B24 B;  1N9E A;  3EBY A;  3F8X A;  1ASK A;  1AVL A;  1OHS A;  3CNM A;  3HZP A;  4O8S A;  3B4P A;  4MMZ B;  1UW1 A;  3I56 3;  4J9A A;  2P38 A;  1OHO A;  4WYK B;  1IV7 A;  2OOV C;  3NQY A;  1M9G A;  4IT7 A;  5IG0 A;  2CHC A;  3WDG B;  3DMC A;  1IVU A;  1DYU A;  1QAF A;  5EVH A;  3WA2 X;  1K28 A;  1PFP A;  3MKI A;  2M7O A;  4FR9 A;  2O3O A;  3CCV 3;  4R9L A;  4HM2 B;  1EQK A;  1HU9 A;  3K5T A;  4HKV B;  2GU1 A;  2Z6B A;  4RNZ A;  3FF0 A;  3GRD A;  4HM3 B;  3PS8 A;  1IVX A;  1JN5 B;  1F8N A;  3MWZ A;  5DRE A;  3Q90 A;  2JDI H;  3G0K A;  4NHF A;  5JPP A;  3DZL A;  1K73 4;  1GD3 A;  3CC2 3;  1VQO 3;  3MG1 A;  1OF5 B;  5AEU B;  4OVM A;  3T8U A;  4MMY B;  4HZ9 B;  2Y74 A;  1U8C B;  2XFS A;  2YFJ B;  1N5P A;  4R4K A;  4XB5 A;  4JRF A;  3SOY A;  3EF8 A;  4N6V 0;  3UJM A;  2L4V A;  2K54 A;  3ROB A;  5ELJ A;  3AMO B;  3NQZ A;  3J7Y d;  2LYX A;  3EBT A;  3VGN A;  4HZB B;  4AKY A;  3OWY A;  3GZB A;  1Q81 4;  1GY7 A;  1W6G A;  7STD A;  1LVN A;  3NM2 A;  3D3L A;  4R9K A;  3CC7 3;  3CD6 3;  1NB3 I;  3SED A;  2W9P A;  1ULJ B;  3X3Y A;  4MEI A;  4N6N B;  4STD A;  3LTB A;  3KE7 A;  4N6M A;  5CK6 A;  1AV4 A;  4HM5 B;  4MJD A;  1TU5 A;  2BMO B;  1US1 A;  2CW9 A;  4L8O A;  1W2Z A;  3BB9 A;  1IT8 A;  1MNL A;  3CCE 3;  2PZV A;  1KC8 4;  5KP3 A;  2B1X B;  1Q40 A;  3CNX A;  1RRL A;  2OTJ 3;  2CFG A;  1O7P B;  3IMA B;  3EN8 A;  1IQX A;  2WGO A;  1OGZ A;  3FCS B;  4FMB A;  1EKM A;  3S27 A;  2CWV A;  2XH9 A;  3EHC A;  3RGR A;  1KQS 2;  1E3V A;  2IA7 A;  3KSE D;  3X40 A;  3LTC A;  4EC6 A;  3E99 A;  3U1W A;  1IU7 A;  3FZW A;  1AR0 A;  2F98 A;  2QGU A;  4FCM A;  4MMX B;  1SQW A;  3CCL 3;  3TDG A;  3V99 A;  3EE1 A;  3GZR A;  1FGO A;  2WOF A;  3OW2 2;  2OWP A;  3EX9 A;  4TX4 A;  1QAL A;  1IV9 A;  3KFQ C;  2GEX A;  4OUQ A;  4U13 A;  5ELU A;  1M90 4;  4N6U A;  5D82 A;  5EEO A;  2MF7 A;  3B4O A;  5KP1 A;  3OX9 A;  3MPH A;  1A90 A;  3GZX B;  1IT7 A;  3UNL A;  2D42 A;  4CCV A;  1SIH A;  3G71 3;  3LTD A;  3FF2 A;  3L0R A;  3JUM A;  1Q82 4;  4AEQ A;  5KP4 A;  1RKY A;  3F40 A;  1OPY A;  3SOA A;  1CEW I;  4XM4 A;  4L8P A;  3N54 B;  2BT3 A;  2GBW B;  3CU3 A;  1W5Z A;  5IW9 A;  1FGT A;  3K7C A;  3DY5 A;  4FMC A;  4Q53 A;  5A0O B;  5IF6 A;  1DMQ A;  2XRX B;  1UI8 A;  1FGM A;  1JB5 A;  4RZM A;  3JUN A;  1U5O A;  2XEP A;  1CYU A;  2E2U A;  1BUQ A;  2WGQ A;  2W56 A;  4RBN A;  2IUK A;  3KKG A;  3K63 A;  3DUK A;  4N3V A;  3M8C A;  3F7S A;  3FG4 A;  4I4K A;  3IPT A;  4KFE A;  2P09 A;  5IG5 A;  5AIG A;  1EA2 A;  1S5A A;  2MC8 A;  3I0Y A;  3PZW A;  2ZL8 A;  3OWU A;  4O2H A;  1HKX A;  3G4S 3;  3D9R A;  3OV4 A;  5CF2 A;  4EV2 A;  3NBJ A;  1FGQ A;  1WMN A;  1SJW A;  3DGM A;  2ML6 A;  4H3U A;  5BVB A;  8CHO A;  4H61 A;  1FA3 A;  1QVF 2;  1RJO A;  1QAK A;  3T8N A;  2IMJ A;  2W04 A;  1NJI 4;  1IDP A;  3NV0 A;  1VQK 3;  4X2H A;  1RRH A;  2CIU A;  4AKZ A;  1Q7Y 4;  3CCS 3;  3NX0 A;  1OCV A;  2BHM A;  2XFT A;  1WTH A;  1G96 A;  2CWT A;  3CPW 2;  1NDO B;  3GAX A;  3DGO A;  3LT9 A;  2RSX A;  2F86 B;  1N9J A;  5EQL A;  3JUQ A;  1NWW A;  1Q42 A;  2RGQ A;  3HII A;  2XF3 A;  3PCR A;  3F8H A;  3JUO A;  3H3H A;  1FGR A;  4HM4 B;  5AI1 A;  3I55 3;  1IK3 A;  2OTL 3;  1M1X B;  3MHE A;  3BLZ A;  2IUJ A;  1YIT 3;  4LEH A;  3DGN A;  3LYG A;  1ZX2 A;  1GYB A;  4KFF A;  5AIH A;  1N8R 4;  2BO9 B;  1ROV A;  1TFO A;  1TUH A;  1A67 A;  1DVD A;  2UX0 A;  4PEJ A;  1TP6 A;  4WYK A;  4WHA A;  3O8Y A;  1O7W B;  3GZY B;  3PYJ A;  1JB4 A;  1W4N A;  5AEW B;  3WA3 A;  2CG1 A;  1L5G B;  1JKG A;  2CFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...