3CCR3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccr300
3OW22 1VQL3 2QA43 3CCV3 1K9M4 1VQ63 3CXC2 1VQP3 1YHQ3 3CCE3 1VQ43 3G6E3 1VQK3 1YI23 1YJW3 2QEX3 1Q814 3G4S3 3CCL3 1YIT3 1YIJ3 3CCJ3 1N8R4 1KD14 1M904 3CCM3 3CCS3 1YJ93 1Q824 1NJI4 3CC43 1VQ73 2OTJ3 3I553 3CME3 1Q7Y4 1KC84 1S723 1W2B2 1QVG2 1KQS2 1Q864 1VQM3 1VQN3 1VQ53 2OTL3 3CC73 1K734 3CCU3 1VQ93 3CMA3 1VQO3 3I563 3CC23 1QVF2 3CD63 1M1K4 1YJN3 1JJ22 1K8A4 3CCQ3 3CCR3 3CPW2 1VQ83 3G713
chains in the Genus database with same CATH superfamily
4LYLB 3EJVA 1N9EA 1BNJA 1AY7A 4G1MB 1IVUA 1NDOB 3LTDA 4DKIA 1TFKA 3NX0A 1O7MB 3FLJA 4K90B 1IV9A 2CFWA 2Y74A 4IIAA 1KWIA 3WHOA 3GAXA 1YIJ3 1G02A 2XSHB 2HMNB 4CJNA 1A90A 1Q824 3CCS3 2IY2A 4HZBB 1CYVA 5DREA 4AKZA 4XDVA 1FYSA 2CFDA 1R4YA 1FZUA 2ML5A 2F5MA 1W4NA 3S28A 1K734 2W6JH 3KIIA 1FGMA 3LZAA 3AGOA 3EHCA 3FG1A 3ZG0A 3D5IA 4N3VA 3O8YA 1IT7A 3DM8A 4EW5A 2YFIB 2QA43 4N6UA 2P05A 4HM4B 3RGRA 1ZO2A 3NV0B 4HOHA 3X41A 3EBTA 5IG5A 5AEUB 3VF1A 2WGQA 2ZHXB 1DMQA 3HX8A 2RBIA 3LXUX 4HM0B 1GD3A 2KF5A 2O3OA 3G16A 4CDLA 3AGNA 1BANA 1N5HA 3LT9A 1FW7A 1GS3A 3LTCA 4N6MA 3S27A 2Q07A 3BNDA 2CH9A 2GSPA 1DVDA 3Q3FA 3DY5A 4I5QA 3LT8A 5AI1A 3SYUA 3FF2A 1W02A 3X40A 1I2GA 4IT7A 3ECFA 3G0KA 3PCSA 1RGLA 1K41A 2CWTA 1TU5A 1LOVA 1VQ83 1QAFA 2CFKA 2Z77A 4OVMA 2HMLB 3BU4A 1W00A 1OHOA 4K61A 5CXOA 1HZ1A 1DMMA 2CWVA 3GSPA 4J5KA 2M7OA 3JUOA 1BSBA 3MHEA 3X3XA 1AR0A 1E97A 4R9KA 3CCL3 3B4OA 1M904 1IVVA 3KSPA 3SVAA 1BUJA 1D6ZA 1M9GA 6RNTA 3AMOB 3EF8A 3D9RA 4L7KA 1WMPA 2QGUA 3WA3A 4J8TA 5AIGA 1CYUA 3S29A 1LOXA 3BNCA 5IG0A 2SBLA 5JPPA 1F8NA 1DYUA 4EV5A 2HMKB 2L4VA 1W6GA 5HGRA 1VQO3 1JBRA 2Z6BA 3FF0A 2SARA 4K1VA 2MC8A 3X42A 3FSDA 3IPTA 3GZBA 3OW22 5IERA 1BNGA 1CEWI 1JN5B 2F98A 3NBJA 5EQLA 3BB9A 1OCVA 1B2SA 1DETA 3ZG5A 1YJW3 2V1LA 1RNTA 4BTWA 1BSCA 3PS8A 3SOYA 2OQEA 4QWTA 1R4CA 4O8SA 3UL6A 1KD14 3DZLA 4MJDA 2UUGC 3EN1B 1NB5I 2P09A 3GZRA 4KFFA 3DGNA 5EEOA 3WOEB 1RTUA 1ROAA 4XDWA 5I97A 1W6YA 2XF3A 1QVF2 2FGTA 3F40A 4I4KA 1LVNA 3S5CA 2BMQB 3BNBA 3GZYB 1JKGB 1ZX2A 4ILFA 4RNYA 4WYKA 5CK6A 3CCV3 3KSED 4FMBA 4HM3B 2A15A 1MGWA 1MWTA 3LOYA 4JRFA 5G2GA 3UJMA 1X1WA 4XBXA 2OOVA 1GOVA 4O02B 1AVKA 2IA7A 1QJGA 3UL5A 1ROVA 5AIHA 3JUMA 2OCTA 1EEJA 1MWSA 4FCZA 3GWRA 1I8VA 1PYLA 1GD4A 2STDA 3MWZA 4HM7B 4R9LA 1U8CB 1OACA 5JPUA 4N6LA 5D82A 3I553 2H0HA 1PY3A 4N6V0 1T2IA 3H3HA 4BL3A 1BNFA 3FG4A 3CC73 2AAEA 4Q53A 1RN4A 1MWUA 2CFLA 1RN1A 1TTOA 2PNCA 1A67A 3CNMA 3NV0A 3D5GA 1MWRA 3MPHA 3Q1CA 4BTYA 2H0IA 2LYXA 1K9M4 3T8NA 2W2CA 2K54A 1GMPA 1YHQ3 1RSNA 1RGGA 2F56A 2KCDA 1TJDA 1LOWA 2RFRA 1VQQA 5IEOA 1YGWA 3T8UA 2UX0A 3G6E3 1YI23 1Q814 1UCIA 3KZTA 3ROBA 4RNTA 2KF4A 1D6UA 3HIIA 1OH0A 1YIT3 5IF6A 1IQXA 2OWPA 3NXJA 4L8OA 5AYSC 1B27A 1UGIA 1WTHA 4TX4A 5RNTA 1D6YA 1UDII 3BLZA 3MSOA 3N9HA 3D79A 3NM2A 4HM2B 5ELUA 3A76A 3N54B 3VSYA 2O9UX 1Q864 3BNEA 5D81A 5CF2A 1QMAA 4XM4A 1VQ53 1JBSA 3EC9A 4MEIA 1WMNA 2FXTA 1B2XA 3V98A 3FCSB 3V92A 4R1KA 1Q40A 2W56B 1B20A 2HOHA 3IJEB 1IT8A 1GOYA 1NWWA 1JRQA 3QK9A 1OF5A 2ZL8A 5A0OB 1BRKA 5AIIA 5FW5A 1GY5A 1Z1SA 1OGXA 1VQ63 1B2UA 3LTBA 2AADA 1VQ43 2BHMA 3SOAA 1BNRA 3TDGA 1X1UA 2CG1A 1YVBI 1WNHA 3EN8A 3K63A 3MKIA 1N8R4 3CCJ3 3EB8A 3AMOA 2IUJA 1BSAA 1BNEA 1YJ93 1NJI4 4FMAA 3NBBA 1V74A 1GOUA 5G1LA 2BNGA 1SIIA 2RSXA 1IYYA 1OHPA 2LQVA 3F7SA 3G8ZA 1V57A 1YGEA 3NUVA 1UGHI 5AIFA 1UUWB 1TP6A 3CCU3 3CMA3 1J2BA 1MOLA 3B7CA 2QIYA 2J8XB 1LNHA 4OK0A 1JBTA 1AVLA 3CXC2 3NQZA 5KP1A 4EC6A 3B8LA 1RNBA 2INXA 1UUVB 2MF7A 9RNTA 1VQP3 3JUQA 1X1XA 7RNTA 4GL6A 2XR8B 1TRQA 3F8HA 1LXEA 1Q9EA 4ZM8A 1LNIA 1BU4A 1ZGXA 1I3FA 1UCKA 1RGFA 3DGYA 4X2OA 2WGOA 1BAOA 1RGHA 3NQYA 4AKYA 1AV4A 1DVCA 5KP3A 2F4YA 4HM8B 1VZZA 2BIRA 1PU4A 4HKVB 4U13A 1FGTA 1TUHA 1LQMB 2RGQA 3H51A 4GHOA 1SPUA 3SXXA 5M18A 1JKGA 3LH4A 3PGBA 1JJ22 3CME3 1IU7A 3CCR3 3MG3A 2YX9A 2JDIH 4N6NB 1JB4A 1YNVX 2CWUA 5LC6A 1IDPA 4GSPA 2CFGA 3HK4A 5D83A 1NU3A 4KZ1A 1JV2B 1JZDA 3NHXA 5M19A 4LEHA 3SLUA 1PFPA 2CK3H 1ISKA 3SEDA 2XFSA 3EE1A 1I70A 3OWUA 3RNTA 3EBYA 1BUQA 5CF1A 1FGRA 1RRLA 2GEXA 3QRDA 2CC3A 7STDA 1IVWA 5IG4A 4XBYA 2H0GA 4MMYB 4J5GA 1IV7A 1TIJA 1VQN3 2XEPA 1FA3A 3STDA 5FGOA 1RGCA 4RBNA 4HAAA 4XBTA 3RDEA 3MYTA 3CC23 3CD63 1L5GB 3DGLA 1Q42A 2L1SA 4FMCA 4K1UA 3CPW2 1FUWA 1OUNA 3OV4A 1JB2A 3HIGA 3D4AA 4LMIA 4R80A 1K28A 1C7HA 2GBWB 1IK3A 2QEX3 1DMNA 1GY6A 1HKXA 4NHFA 2XFTA 4HM6B 3WMDA 3KCHA 4KVHA 2CX1A 1RGAA 4XB5A 3CCM3 5IEPA 1BNSA 1VQ73 1DE3A 2KF3A 2GEYA 2GU1A 1I2FA 2CG0A 2W9QA 3PCRA 1Q7HA 1QVG2 1KQS2 2CHCA 1VQM3 1UCLA 4MMZB 2OTL3 2CX0A 1A2VA 2F86B 1STFI 5BU4A 2RCDA 3JVCA 4IPBA 5IW9A 4N6OB 3Q90A 1O7HB 4OUQA 1FUSA 4ORLA 2F5WA 1JNQA 8RNTA 3M8CA 4LGQA 2ML6A 1EUIC 2R4IA 3EX9A 3CCE3 1SJWA 3LTAA 1OPYA 3K5TA 2IMJA 4FCJA 1QAKA 3MG2A 3U1WA 1RKYA 1SQWA 1V58A 2W03A 2XGLA 3DXOA 3RGAA 3I0YA 3X3ZA 2WOHA 3ZFZA 4AEQA 1G0TA 1RRHA 3MG1A 2BT3A 3URPA 2B1XB 1BNIA 1S723 2XH9A 3EQQB 1W2B2 4FMDA 2F99A 4EYCA 1W6CA 2P0MA 1FGQA 2GBXB 3DMCA 1W5ZA 3F8XA 3JUPA 1VQ93 1UCJA 3WODG 5ELJA 5IENA 1I0VA 3KE7A 2KAAA 1TFOA 2C4BA 1T5YA 3K7CA 3F7XA 4WYKB 1WMOA 1SIHA 1UI7A 2Y73A 4KFEA 1A2KA 3LYGA 1B21A 1FUTA 4N6TA 3DH2A 1HU9A 1STDA 4HM5B 5LC7A 4JF8A 1CH0A 1IQ8A 1E3VA 3S67A 3VGNA 3Q2PA 1RCLA 3UB1A 3WDGB 4RZMA 3WOFB 4WFOA 3DGMA 1RJOA 4CPKA 2Z7AA 2BU4A 1OHSA 1BRJA 1MNLA 3U97A 1FGOA 4NREA 4RNZA 1JN5A 3OWYA 3UNLA 2HMOB 2E2VA 3AHWA 1W2ZA 3CNXA 4H3UA 3X3YA 2YFLB 5TGNA 1AQZA 5AEWB 3LMLA 3ER7A 1NO3A 4KT3B 1UI8A 3GZXB 2JQ5A 5BIRA 1N9JA 2XGNA 1BRNL 1WQLB 2UGIA 4BTXA 1ULIB 4FR9A 4H61A 4O2HA 5G1KA 4EXRA 1Q7Y4 1RDSA 2OQEC 3CU3A 3F14A 1MGRA 1RCKA 1O7NB 2K3DA 1RHLA 2C10A 1O7WB 1RN7A 4R4KA 2B24B 1LQGC 1Q40B 1RGEA 3DGOA 1NNVA 1N8QA 4EV2A 6STDA 1OF5B 2RNTA 3OX9A 2CIUA 1ZS7A 3AHSA 1BRIA 3ALAA 1VQL3 2C11A 2PZVA 5EVHA 1KSIA 2XSOB 3T0UA 1W7CA 2W0QA 2FNQA 1GMRA 2K0MA 1BGSA 2BMOB 1JB5A 1GYBA 1US1A 1N5PA 2E2TA 2E2UA 2W9PA 1GMQA 3FH1A 1Y4KA 3FKAA 4GB5A 3J7Yd 1BVIA 1X1YA 1S5AA 3N8BA 2BMRB 2BO9B 2OOVC 3HOHA 8CHOA 3NBRA 1RMSA 3GRDA 1CQSA 1EKMA 1M1XB 4BU4A 4LSOA 4J9AA 1IQYA 1OGZA 4KFDA 2P0XA 1I0XA 3I563 1YVSA 1I2EA 2GXFA 1YJN3 1BRSA 1RLSA 3CCQ3 3WR2A 3KN4A 3G713 1UW1A 1BRGA 1QALA 3IMAB 4NPBA 2HMMB 1O7PB 2CKFB 3FZWA 1RGKA 2R41A 1ASKA 3KFQC 1I3IA 4L8PA 5AYRB 3WA2X 3BIRA 1GSPA 4WP5A 1BSEA 1NB3I 5DRVA 3K0ZA 2XRXB 3OXAA 3E99A 2ZDJA 4X2HA 5IG3A 5BXQA 1EQKA 3NM7A 2OTJ3 2HMJB 3DUKA 3D3LA 5BVBA 1KC84 1GY7A 1T2HA 1BOXA 3HZPA 2KXGA 3OWSA 3FG3A 1EA2A 1G96A 2P38A 2ZA4A 2IUKA 3K9MC 1W01A 2I9WA 2W56A 2WOFA 1C54A 4WWUC 4FCMA 5STDA 1K8A4 1A2PA 3KKGA 3G4S3 3F9SA 3HI7A 4CCVA 3B4PA 4HZ9B 1B2ZA 1IVXA 5JBSA 2W04A 3PYJA 1B3SA 5HOHA 1JZOA 3JUNA 1O7GB 2YFJB 4EBGA 1VQK3 1B2MA 2GU3A 4LZIA 5M1AA 1LOYA 1U5OA 1HYFA 1BIRA 4HJLB 4HBRA 6GSPA 1E3RA 2KRTA 1T3BA 3V99A 3PZWA 4HM1B 1BRHA 3FGYA 5GSPA 1UUGB 4HYZA 3CC43 2KF6A 4WHAA 3SX1A 5KP4A 1TRPA 4HVNA 1EG9B 2D42A 2D1WA 3PXMA 4BIRA 4STDA 2IYJA 2CW9A 1BSDA 4O3VA 3L0RA 3CPOA 2Z76A 4MMXB 1LRAA 5CLKA 1M1K4 7GSPA 3A5EA 2WO0A 4BL2A 4PEJA 1ULJB 1SARA
chains in the Genus database with same CATH topology
3EJVA 1N9EA 4G1MB 1IVUA 1NDOB 3LTDA 1TFKA 3NX0A 1O7MB 3FLJA 4K90B 1IV9A 2CFWA 2Y74A 4IIAA 1KWIA 3GAXA 1YIJ3 2XSHB 2HMNB 1A90A 1Q824 3CCS3 4HZBB 1CYVA 5DREA 4AKZA 4XDVA 2CFDA 2ML5A 1W4NA 3S28A 1K734 2W6JH 3KIIA 1FGMA 3LZAA 3EHCA 3FG1A 4N3VA 3O8YA 1IT7A 3DM8A 2YFIB 2QA43 4N6UA 2P05A 4HM4B 3RGRA 1ZO2A 3NV0B 5IG5A 3X41A 3EBTA 5AEUB 3VF1A 2WGQA 1DMQA 3HX8A 3LXUX 4HM0B 1GD3A 2O3OA 3G16A 4CDLA 1N5HA 3LT9A 1GS3A 3LTCA 4N6MA 3S27A 2Q07A 3BNDA 2CH9A 1DVDA 3DY5A 3LT8A 5AI1A 3FF2A 1W02A 3X40A 4IT7A 3ECFA 3G0KA 3PCSA 1K41A 2CWTA 1TU5A 1VQ83 1QAFA 2CFKA 2Z77A 4OVMA 2HMLB 1W00A 1OHOA 4K61A 5CXOA 1DMMA 2CWVA 2M7OA 3JUOA 3MHEA 3X3XA 1AR0A 1E97A 4R9KA 3CCL3 3B4OA 1M904 1IVVA 3KSPA 3SVAA 1D6ZA 1M9GA 3AMOB 3EF8A 3D9RA 4L7KA 1WMPA 2QGUA 3WA3A 4J8TA 5AIGA 1CYUA 3S29A 1LOXA 3BNCA 5IG0A 2SBLA 5JPPA 1F8NA 1DYUA 4EV5A 2HMKB 2L4VA 1W6GA 5HGRA 1VQO3 2Z6BA 3FF0A 4K1VA 2MC8A 3X42A 3FSDA 3IPTA 3GZBA 3OW22 5IERA 1CEWI 1JN5B 2F98A 3NBJA 5EQLA 3BB9A 1OCVA 1YJW3 2V1LA 4BTWA 3PS8A 3SOYA 2OQEA 4QWTA 1R4CA 4O8SA 3UL6A 1KD14 3DZLA 4MJDA 3EN1B 1NB5I 2P09A 3GZRA 4KFFA 3DGNA 5EEOA 3WOEB 1ROAA 4XDWA 5I97A 1W6YA 2XF3A 1QVF2 2FGTA 3F40A 4I4KA 1LVNA 3S5CA 2BMQB 3BNBA 3GZYB 1JKGB 1ZX2A 4RNYA 4WYKA 5CK6A 3CCV3 3KSED 4FMBA 4HM3B 2A15A 3LOYA 4JRFA 5G2GA 3UJMA 4XBXA 2OOVA 4O02B 1AVKA 2IA7A 1QJGA 3UL5A 1ROVA 5AIHA 3JUMA 2OCTA 4FCZA 3GWRA 1GD4A 2STDA 3MWZA 4HM7B 4R9LA 1U8CB 1OACA 5JPUA 4N6LA 5D82A 3I553 4N6V0 3H3HA 3FG4A 3CC73 4Q53A 2CFLA 2PNCA 1A67A 3CNMA 3NV0A 3Q1CA 3MPHA 4BTYA 2LYXA 1K9M4 3T8NA 2W2CA 2K54A 1YHQ3 2KCDA 5IEOA 3G6E3 2RFRA 1YI23 2UX0A 1Q814 3KZTA 3ROBA 1YIT3 1D6UA 3HIIA 1OH0A 5IF6A 1IQXA 2OWPA 3NXJA 4L8OA 5AYSC 1WTHA 4TX4A 1D6YA 3BLZA 3MSOA 3N9HA 3NM2A 4HM2B 5ELUA 3A76A 3N54B 3VSYA 2O9UX 1Q864 3BNEA 5D81A 5CF2A 1QMAA 4XM4A 1VQ53 3EC9A 4MEIA 1WMNA 2FXTA 3V98A 3FCSB 3V92A 4R1KA 1Q40A 2W56B 3IJEB 3QK9A 5A0OB 1IT8A 1NWWA 1JRQA 1OF5A 2ZL8A 5AIIA 5FW5A 1GY5A 1Z1SA 1OGXA 1VQ63 3LTBA 1VQ43 2BHMA 3SOAA 3TDGA 2CG1A 1YVBI 1WNHA 3EN8A 3K63A 3MKIA 1N8R4 3CCJ3 3EB8A 3AMOA 2IUJA 1YJ93 1NJI4 4FMAA 3NBBA 1V74A 2BNGA 1SIIA 2RSXA 1OHPA 2LQVA 3F7SA 3G8ZA 1YGEA 3NUVA 5AIFA 1UUWB 1TP6A 3CCU3 3CMA3 1J2BA 1MOLA 3B7CA 2QIYA 1LNHA 4OK0A 1AVLA 3CXC2 3NQZA 5KP1A 4EC6A 3B8LA 2INXA 1UUVB 2MF7A 1VQP3 3JUQA 4GL6A 2XR8B 3F8HA 1LXEA 4ZM8A 4X2OA 2WGOA 3NQYA 4AKYA 1AV4A 1DVCA 5KP3A 4HM8B 1VZZA 1PU4A 4HKVB 4U13A 1FGTA 1TUHA 2RGQA 3H51A 3SXXA 1SPUA 1JKGA 3LH4A 3PGBA 1JJ22 3CME3 1IU7A 3CCR3 3MG3A 2YX9A 2JDIH 4N6NB 1JB4A 2CWUA 5LC6A 1IDPA 2CFGA 3HK4A 5D83A 1NU3A 4KZ1A 1JV2B 3NHXA 4LEHA 3SLUA 1PFPA 2CK3H 1ISKA 3SEDA 2XFSA 3EE1A 3OWUA 3EBYA 1BUQA 5CF1A 1FGRA 1RRLA 2GEXA 3QRDA 2CC3A 7STDA 1IVWA 5IG4A 4XBYA 4MMYB 1IV7A 1TIJA 1VQN3 2XEPA 1FA3A 3STDA 5FGOA 4RBNA 4XBTA 3RDEA 3CC23 3CD63 3MYTA 1L5GB 3DGLA 1Q42A 4FMCA 4K1UA 3CPW2 1FUWA 1OUNA 3OV4A 1JB2A 3HIGA 4LMIA 4R80A 1K28A 1C7HA 2GBWB 1IK3A 2QEX3 1DMNA 1GY6A 1HKXA 4NHFA 2XFTA 4HM6B 3WMDA 4KVHA 4XB5A 3CCM3 5IEPA 1VQ73 2GEYA 2GU1A 3PCRA 2CG0A 2W9QA 1QVG2 1KQS2 2CHCA 1VQM3 4MMZB 2OTL3 1A2VA 2F86B 1STFI 2RCDA 3JVCA 4IPBA 5IW9A 4N6OB 3Q90A 1O7HB 4OUQA 4ORLA 1JNQA 3M8CA 4LGQA 2ML6A 2R4IA 3EX9A 3CCE3 1SJWA 3LTAA 1OPYA 3K5TA 2IMJA 4FCJA 1QAKA 3MG2A 3U1WA 1RKYA 1SQWA 2XGLA 2W03A 3DXOA 3RGAA 3X3ZA 3I0YA 2WOHA 4AEQA 1RRHA 3MG1A 2BT3A 2B1XB 1S723 2XH9A 3EQQB 1W2B2 4FMDA 2F99A 4EYCA 1W6CA 2P0MA 1FGQA 2GBXB 3DMCA 1W5ZA 3F8XA 3JUPA 1VQ93 3WODG 5ELJA 5IENA 3KE7A 1TFOA 1T5YA 3K7CA 3F7XA 4WYKB 1WMOA 1SIHA 1UI7A 2Y73A 4KFEA 1A2KA 3LYGA 4N6TA 1HU9A 1STDA 4HM5B 5LC7A 4JF8A 1IQ8A 1E3VA 3S67A 3VGNA 3Q2PA 3UB1A 3WDGB 4RZMA 3WOFB 4WFOA 3DGMA 1RJOA 2Z7AA 1OHSA 1MNLA 3U97A 1FGOA 4NREA 4RNZA 1JN5A 3OWYA 3UNLA 2HMOB 2E2VA 3CNXA 1W2ZA 4H3UA 3X3YA 5AEWB 2YFLB 5TGNA 3LMLA 3ER7A 1NO3A 1UI8A 3GZXB 2JQ5A 1N9JA 2XGNA 1WQLB 4BTXA 1ULIB 4FR9A 4H61A 4O2HA 1Q7Y4 4EXRA 2OQEC 3CU3A 3F14A 1O7NB 2C10A 1O7WB 1RN7A 4R4KA 2B24B 1Q40B 3DGOA 4EV2A 1N8QA 6STDA 1OF5B 3OX9A 2CIUA 1VQL3 3ALAA 2C11A 2PZVA 5EVHA 1KSIA 2XSOB 3T0UA 1W7CA 2W0QA 2FNQA 2K0MA 2BMOB 1JB5A 1GYBA 1US1A 1N5PA 2E2TA 2E2UA 2W9PA 3FH1A 3FKAA 1Y4KA 3J7Yd 4GB5A 1S5AA 3N8BA 2BMRB 2BO9B 2OOVC 8CHOA 3NBRA 3GRDA 1CQSA 1EKMA 1M1XB 4LSOA 4J9AA 1IQYA 1OGZA 4KFDA 2P0XA 3I563 2GXFA 1YJN3 3CCQ3 3KN4A 3G713 1UW1A 1QALA 3IMAB 3T8UA 2HMMB 1O7PB 2CKFB 3FZWA 3KFQC 5AYRB 1ASKA 3WA2X 4L8PA 4WP5A 1NB3I 5DRVA 3K0ZA 2XRXB 3OXAA 3E99A 2ZDJA 4X2HA 5IG3A 5BXQA 1EQKA 3NM7A 2OTJ3 2HMJB 3DUKA 3D3LA 5BVBA 1KC84 1GY7A 3HZPA 2KXGA 3OWSA 3FG3A 1EA2A 1G96A 2P38A 2IUKA 3K9MC 1W01A 2I9WA 2W56A 2WOFA 4WWUC 4FCMA 5STDA 1K8A4 3KKGA 3G4S3 3F9SA 3HI7A 4CCVA 3B4PA 4HZ9B 1IVXA 5JBSA 2W04A 3PYJA 3JUNA 1O7GB 2YFJB 4EBGA 1VQK3 2GU3A 4LZIA 1U5OA 4HJLB 4HBRA 1E3RA 2KRTA 3V99A 3PZWA 4HM1B 3FGYA 4HYZA 3CC43 4WHAA 3SX1A 5KP4A 4HVNA 1EG9B 2D42A 2D1WA 3PXMA 4STDA 2CW9A 4O3VA 3L0RA 3CPOA 2Z76A 4MMXB 5CLKA 1M1K4 2WO0A 4PEJA 1ULJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 2;  1VQL 3;  2QA4 3;  3CCV 3;  1K9M 4;  1VQ6 3;  3CXC 2;  1VQP 3;  1YHQ 3;  3CCE 3;  1VQ4 3;  3G6E 3;  1VQK 3;  1YI2 3;  1YJW 3;  2QEX 3;  1Q81 4;  3G4S 3;  3CCL 3;  1YIT 3;  1YIJ 3;  3CCJ 3;  1N8R 4;  1KD1 4;  1M90 4;  3CCM 3;  3CCS 3;  1YJ9 3;  1Q82 4;  1NJI 4;  3CC4 3;  1VQ7 3;  2OTJ 3;  3I55 3;  3CME 3;  1Q7Y 4;  1KC8 4;  1S72 3;  1W2B 2;  1QVG 2;  1KQS 2;  1Q86 4;  1VQM 3;  1VQN 3;  1VQ5 3;  2OTL 3;  3CC7 3;  1K73 4;  3CCU 3;  1VQ9 3;  3CMA 3;  1VQO 3;  3I56 3;  3CC2 3;  1QVF 2;  3CD6 3;  1M1K 4;  1YJN 3;  1JJ2 2;  1K8A 4;  3CCQ 3;  3CCR 3;  3CPW 2;  1VQ8 3;  3G71 3; 
#chains in the Genus database with same CATH topology
 4LYL B;  3EJV A;  1N9E A;  1BNJ A;  1AY7 A;  4G1M B;  1IVU A;  1NDO B;  3LTD A;  4DKI A;  1TFK A;  3NX0 A;  1O7M B;  3FLJ A;  4K90 B;  1IV9 A;  2CFW A;  2Y74 A;  4IIA A;  1KWI A;  3WHO A;  3GAX A;  1YIJ 3;  1G02 A;  2XSH B;  2HMN B;  4CJN A;  1A90 A;  1Q82 4;  3CCS 3;  2IY2 A;  4HZB B;  1CYV A;  5DRE A;  4AKZ A;  4XDV A;  1FYS A;  2CFD A;  1R4Y A;  1FZU A;  2ML5 A;  2F5M A;  1W4N A;  3S28 A;  1K73 4;  2W6J H;  3KII A;  1FGM A;  3LZA A;  3AGO A;  3EHC A;  3FG1 A;  3ZG0 A;  3D5I A;  4N3V A;  3O8Y A;  1IT7 A;  3DM8 A;  4EW5 A;  2YFI B;  2QA4 3;  4N6U A;  2P05 A;  4HM4 B;  3RGR A;  1ZO2 A;  3NV0 B;  4HOH A;  3X41 A;  3EBT A;  5IG5 A;  5AEU B;  3VF1 A;  2WGQ A;  2ZHX B;  1DMQ A;  3HX8 A;  2RBI A;  3LXU X;  4HM0 B;  1GD3 A;  2KF5 A;  2O3O A;  3G16 A;  4CDL A;  3AGN A;  1BAN A;  1N5H A;  3LT9 A;  1FW7 A;  1GS3 A;  3LTC A;  4N6M A;  3S27 A;  2Q07 A;  3BND A;  2CH9 A;  2GSP A;  1DVD A;  3Q3F A;  3DY5 A;  4I5Q A;  3LT8 A;  5AI1 A;  3SYU A;  3FF2 A;  1W02 A;  3X40 A;  1I2G A;  4IT7 A;  3ECF A;  3G0K A;  3PCS A;  1RGL A;  1K41 A;  2CWT A;  1TU5 A;  1LOV A;  1VQ8 3;  1QAF A;  2CFK A;  2Z77 A;  4OVM A;  2HML B;  3BU4 A;  1W00 A;  1OHO A;  4K61 A;  5CXO A;  1HZ1 A;  1DMM A;  2CWV A;  3GSP A;  4J5K A;  2M7O A;  3JUO A;  1BSB A;  3MHE A;  3X3X A;  1AR0 A;  1E97 A;  4R9K A;  3CCL 3;  3B4O A;  1M90 4;  1IVV A;  3KSP A;  3SVA A;  1BUJ A;  1D6Z A;  1M9G A;  6RNT A;  3AMO B;  3EF8 A;  3D9R A;  4L7K A;  1WMP A;  2QGU A;  3WA3 A;  4J8T A;  5AIG A;  1CYU A;  3S29 A;  1LOX A;  3BNC A;  5IG0 A;  2SBL A;  5JPP A;  1F8N A;  1DYU A;  4EV5 A;  2HMK B;  2L4V A;  1W6G A;  5HGR A;  1VQO 3;  1JBR A;  2Z6B A;  3FF0 A;  2SAR A;  4K1V A;  2MC8 A;  3X42 A;  3FSD A;  3IPT A;  3GZB A;  3OW2 2;  5IER A;  1BNG A;  1CEW I;  1JN5 B;  2F98 A;  3NBJ A;  5EQL A;  3BB9 A;  1OCV A;  1B2S A;  1DET A;  3ZG5 A;  1YJW 3;  2V1L A;  1RNT A;  4BTW A;  1BSC A;  3PS8 A;  3SOY A;  2OQE A;  4QWT A;  1R4C A;  4O8S A;  3UL6 A;  1KD1 4;  3DZL A;  4MJD A;  2UUG C;  3EN1 B;  1NB5 I;  2P09 A;  3GZR A;  4KFF A;  3DGN A;  5EEO A;  3WOE B;  1RTU A;  1ROA A;  4XDW A;  5I97 A;  1W6Y A;  2XF3 A;  1QVF 2;  2FGT A;  3F40 A;  4I4K A;  1LVN A;  3S5C A;  2BMQ B;  3BNB A;  3GZY B;  1JKG B;  1ZX2 A;  4ILF A;  4RNY A;  4WYK A;  5CK6 A;  3CCV 3;  3KSE D;  4FMB A;  4HM3 B;  2A15 A;  1MGW A;  1MWT A;  3LOY A;  4JRF A;  5G2G A;  3UJM A;  1X1W A;  4XBX A;  2OOV A;  1GOV A;  4O02 B;  1AVK A;  2IA7 A;  1QJG A;  3UL5 A;  1ROV A;  5AIH A;  3JUM A;  2OCT A;  1EEJ A;  1MWS A;  4FCZ A;  3GWR A;  1I8V A;  1PYL A;  1GD4 A;  2STD A;  3MWZ A;  4HM7 B;  4R9L A;  1U8C B;  1OAC A;  5JPU A;  4N6L A;  5D82 A;  3I55 3;  2H0H A;  1PY3 A;  4N6V 0;  1T2I A;  3H3H A;  4BL3 A;  1BNF A;  3FG4 A;  3CC7 3;  2AAE A;  4Q53 A;  1RN4 A;  1MWU A;  2CFL A;  1RN1 A;  1TTO A;  2PNC A;  1A67 A;  3CNM A;  3NV0 A;  3D5G A;  1MWR A;  3MPH A;  3Q1C A;  4BTY A;  2H0I A;  2LYX A;  1K9M 4;  3T8N A;  2W2C A;  2K54 A;  1GMP A;  1YHQ 3;  1RSN A;  1RGG A;  2F56 A;  2KCD A;  1TJD A;  1LOW A;  2RFR A;  1VQQ A;  5IEO A;  1YGW A;  3T8U A;  2UX0 A;  3G6E 3;  1YI2 3;  1Q81 4;  1UCI A;  3KZT A;  3ROB A;  4RNT A;  2KF4 A;  1D6U A;  3HII A;  1OH0 A;  1YIT 3;  5IF6 A;  1IQX A;  2OWP A;  3NXJ A;  4L8O A;  5AYS C;  1B27 A;  1UGI A;  1WTH A;  4TX4 A;  5RNT A;  1D6Y A;  1UDI I;  3BLZ A;  3MSO A;  3N9H A;  3D79 A;  3NM2 A;  4HM2 B;  5ELU A;  3A76 A;  3N54 B;  3VSY A;  2O9U X;  1Q86 4;  3BNE A;  5D81 A;  5CF2 A;  1QMA A;  4XM4 A;  1VQ5 3;  1JBS A;  3EC9 A;  4MEI A;  1WMN A;  2FXT A;  1B2X A;  3V98 A;  3FCS B;  3V92 A;  4R1K A;  1Q40 A;  2W56 B;  1B20 A;  2HOH A;  3IJE B;  1IT8 A;  1GOY A;  1NWW A;  1JRQ A;  3QK9 A;  1OF5 A;  2ZL8 A;  5A0O B;  1BRK A;  5AII A;  5FW5 A;  1GY5 A;  1Z1S A;  1OGX A;  1VQ6 3;  1B2U A;  3LTB A;  2AAD A;  1VQ4 3;  2BHM A;  3SOA A;  1BNR A;  3TDG A;  1X1U A;  2CG1 A;  1YVB I;  1WNH A;  3EN8 A;  3K63 A;  3MKI A;  1N8R 4;  3CCJ 3;  3EB8 A;  3AMO A;  2IUJ A;  1BSA A;  1BNE A;  1YJ9 3;  1NJI 4;  4FMA A;  3NBB A;  1V74 A;  1GOU A;  5G1L A;  2BNG A;  1SII A;  2RSX A;  1IYY A;  1OHP A;  2LQV A;  3F7S A;  3G8Z A;  1V57 A;  1YGE A;  3NUV A;  1UGH I;  5AIF A;  1UUW B;  1TP6 A;  3CCU 3;  3CMA 3;  1J2B A;  1MOL A;  3B7C A;  2QIY A;  2J8X B;  1LNH A;  4OK0 A;  1JBT A;  1AVL A;  3CXC 2;  3NQZ A;  5KP1 A;  4EC6 A;  3B8L A;  1RNB A;  2INX A;  1UUV B;  2MF7 A;  9RNT A;  1VQP 3;  3JUQ A;  1X1X A;  7RNT A;  4GL6 A;  2XR8 B;  1TRQ A;  3F8H A;  1LXE A;  1Q9E A;  4ZM8 A;  1LNI A;  1BU4 A;  1ZGX A;  1I3F A;  1UCK A;  1RGF A;  3DGY A;  4X2O A;  2WGO A;  1BAO A;  1RGH A;  3NQY A;  4AKY A;  1AV4 A;  1DVC A;  5KP3 A;  2F4Y A;  4HM8 B;  1VZZ A;  2BIR A;  1PU4 A;  4HKV B;  4U13 A;  1FGT A;  1TUH A;  1LQM B;  2RGQ A;  3H51 A;  4GHO A;  1SPU A;  3SXX A;  5M18 A;  1JKG A;  3LH4 A;  3PGB A;  1JJ2 2;  3CME 3;  1IU7 A;  3CCR 3;  3MG3 A;  2YX9 A;  2JDI H;  4N6N B;  1JB4 A;  1YNV X;  2CWU A;  5LC6 A;  1IDP A;  4GSP A;  2CFG A;  3HK4 A;  5D83 A;  1NU3 A;  4KZ1 A;  1JV2 B;  1JZD A;  3NHX A;  5M19 A;  4LEH A;  3SLU A;  1PFP A;  2CK3 H;  1ISK A;  3SED A;  2XFS A;  3EE1 A;  1I70 A;  3OWU A;  3RNT A;  3EBY A;  1BUQ A;  5CF1 A;  1FGR A;  1RRL A;  2GEX A;  3QRD A;  2CC3 A;  7STD A;  1IVW A;  5IG4 A;  4XBY A;  2H0G A;  4MMY B;  4J5G A;  1IV7 A;  1TIJ A;  1VQN 3;  2XEP A;  1FA3 A;  3STD A;  5FGO A;  1RGC A;  4RBN A;  4HAA A;  4XBT A;  3RDE A;  3MYT A;  3CC2 3;  3CD6 3;  1L5G B;  3DGL A;  1Q42 A;  2L1S A;  4FMC A;  4K1U A;  3CPW 2;  1FUW A;  1OUN A;  3OV4 A;  1JB2 A;  3HIG A;  3D4A A;  4LMI A;  4R80 A;  1K28 A;  1C7H A;  2GBW B;  1IK3 A;  2QEX 3;  1DMN A;  1GY6 A;  1HKX A;  4NHF A;  2XFT A;  4HM6 B;  3WMD A;  3KCH A;  4KVH A;  2CX1 A;  1RGA A;  4XB5 A;  3CCM 3;  5IEP A;  1BNS A;  1VQ7 3;  1DE3 A;  2KF3 A;  2GEY A;  2GU1 A;  1I2F A;  2CG0 A;  2W9Q A;  3PCR A;  1Q7H A;  1QVG 2;  1KQS 2;  2CHC A;  1VQM 3;  1UCL A;  4MMZ B;  2OTL 3;  2CX0 A;  1A2V A;  2F86 B;  1STF I;  5BU4 A;  2RCD A;  3JVC A;  4IPB A;  5IW9 A;  4N6O B;  3Q90 A;  1O7H B;  4OUQ A;  1FUS A;  4ORL A;  2F5W A;  1JNQ A;  8RNT A;  3M8C A;  4LGQ A;  2ML6 A;  1EUI C;  2R4I A;  3EX9 A;  3CCE 3;  1SJW A;  3LTA A;  1OPY A;  3K5T A;  2IMJ A;  4FCJ A;  1QAK A;  3MG2 A;  3U1W A;  1RKY A;  1SQW A;  1V58 A;  2W03 A;  2XGL A;  3DXO A;  3RGA A;  3I0Y A;  3X3Z A;  2WOH A;  3ZFZ A;  4AEQ A;  1G0T A;  1RRH A;  3MG1 A;  2BT3 A;  3URP A;  2B1X B;  1BNI A;  1S72 3;  2XH9 A;  3EQQ B;  1W2B 2;  4FMD A;  2F99 A;  4EYC A;  1W6C A;  2P0M A;  1FGQ A;  2GBX B;  3DMC A;  1W5Z A;  3F8X A;  3JUP A;  1VQ9 3;  1UCJ A;  3WOD G;  5ELJ A;  5IEN A;  1I0V A;  3KE7 A;  2KAA A;  1TFO A;  2C4B A;  1T5Y A;  3K7C A;  3F7X A;  4WYK B;  1WMO A;  1SIH A;  1UI7 A;  2Y73 A;  4KFE A;  1A2K A;  3LYG A;  1B21 A;  1FUT A;  4N6T A;  3DH2 A;  1HU9 A;  1STD A;  4HM5 B;  5LC7 A;  4JF8 A;  1CH0 A;  1IQ8 A;  1E3V A;  3S67 A;  3VGN A;  3Q2P A;  1RCL A;  3UB1 A;  3WDG B;  4RZM A;  3WOF B;  4WFO A;  3DGM A;  1RJO A;  4CPK A;  2Z7A A;  2BU4 A;  1OHS A;  1BRJ A;  1MNL A;  3U97 A;  1FGO A;  4NRE A;  4RNZ A;  1JN5 A;  3OWY A;  3UNL A;  2HMO B;  2E2V A;  3AHW A;  1W2Z A;  3CNX A;  4H3U A;  3X3Y A;  2YFL B;  5TGN A;  1AQZ A;  5AEW B;  3LML A;  3ER7 A;  1NO3 A;  4KT3 B;  1UI8 A;  3GZX B;  2JQ5 A;  5BIR A;  1N9J A;  2XGN A;  1BRN L;  1WQL B;  2UGI A;  4BTX A;  1ULI B;  4FR9 A;  4H61 A;  4O2H A;  5G1K A;  4EXR A;  1Q7Y 4;  1RDS A;  2OQE C;  3CU3 A;  3F14 A;  1MGR A;  1RCK A;  1O7N B;  2K3D A;  1RHL A;  2C10 A;  1O7W B;  1RN7 A;  4R4K A;  2B24 B;  1LQG C;  1Q40 B;  1RGE A;  3DGO A;  1NNV A;  1N8Q A;  4EV2 A;  6STD A;  1OF5 B;  2RNT A;  3OX9 A;  2CIU A;  1ZS7 A;  3AHS A;  1BRI A;  3ALA A;  1VQL 3;  2C11 A;  2PZV A;  5EVH A;  1KSI A;  2XSO B;  3T0U A;  1W7C A;  2W0Q A;  2FNQ A;  1GMR A;  2K0M A;  1BGS A;  2BMO B;  1JB5 A;  1GYB A;  1US1 A;  1N5P A;  2E2T A;  2E2U A;  2W9P A;  1GMQ A;  3FH1 A;  1Y4K A;  3FKA A;  4GB5 A;  3J7Y d;  1BVI A;  1X1Y A;  1S5A A;  3N8B A;  2BMR B;  2BO9 B;  2OOV C;  3HOH A;  8CHO A;  3NBR A;  1RMS A;  3GRD A;  1CQS A;  1EKM A;  1M1X B;  4BU4 A;  4LSO A;  4J9A A;  1IQY A;  1OGZ A;  4KFD A;  2P0X A;  1I0X A;  3I56 3;  1YVS A;  1I2E A;  2GXF A;  1YJN 3;  1BRS A;  1RLS A;  3CCQ 3;  3WR2 A;  3KN4 A;  3G71 3;  1UW1 A;  1BRG A;  1QAL A;  3IMA B;  4NPB A;  2HMM B;  1O7P B;  2CKF B;  3FZW A;  1RGK A;  2R41 A;  1ASK A;  3KFQ C;  1I3I A;  4L8P A;  5AYR B;  3WA2 X;  3BIR A;  1GSP A;  4WP5 A;  1BSE A;  1NB3 I;  5DRV A;  3K0Z A;  2XRX B;  3OXA A;  3E99 A;  2ZDJ A;  4X2H A;  5IG3 A;  5BXQ A;  1EQK A;  3NM7 A;  2OTJ 3;  2HMJ B;  3DUK A;  3D3L A;  5BVB A;  1KC8 4;  1GY7 A;  1T2H A;  1BOX A;  3HZP A;  2KXG A;  3OWS A;  3FG3 A;  1EA2 A;  1G96 A;  2P38 A;  2ZA4 A;  2IUK A;  3K9M C;  1W01 A;  2I9W A;  2W56 A;  2WOF A;  1C54 A;  4WWU C;  4FCM A;  5STD A;  1K8A 4;  1A2P A;  3KKG A;  3G4S 3;  3F9S A;  3HI7 A;  4CCV A;  3B4P A;  4HZ9 B;  1B2Z A;  1IVX A;  5JBS A;  2W04 A;  3PYJ A;  1B3S A;  5HOH A;  1JZO A;  3JUN A;  1O7G B;  2YFJ B;  4EBG A;  1VQK 3;  1B2M A;  2GU3 A;  4LZI A;  5M1A A;  1LOY A;  1U5O A;  1HYF A;  1BIR A;  4HJL B;  4HBR A;  6GSP A;  1E3R A;  2KRT A;  1T3B A;  3V99 A;  3PZW A;  4HM1 B;  1BRH A;  3FGY A;  5GSP A;  1UUG B;  4HYZ A;  3CC4 3;  2KF6 A;  4WHA A;  3SX1 A;  5KP4 A;  1TRP A;  4HVN A;  1EG9 B;  2D42 A;  2D1W A;  3PXM A;  4BIR A;  4STD A;  2IYJ A;  2CW9 A;  1BSD A;  4O3V A;  3L0R A;  3CPO A;  2Z76 A;  4MMX B;  1LRA A;  5CLK A;  1M1K 4;  7GSP A;  3A5E A;  2WO0 A;  4BL2 A;  4PEJ A;  1ULJ B;  1SAR A; 
#chains in the Genus database with same CATH homology
 3EJV A;  1N9E A;  4G1M B;  1IVU A;  1NDO B;  3LTD A;  1TFK A;  3NX0 A;  1O7M B;  3FLJ A;  4K90 B;  1IV9 A;  2CFW A;  2Y74 A;  4IIA A;  1KWI A;  3GAX A;  1YIJ 3;  2XSH B;  2HMN B;  1A90 A;  1Q82 4;  3CCS 3;  4HZB B;  1CYV A;  5DRE A;  4AKZ A;  4XDV A;  2CFD A;  2ML5 A;  1W4N A;  3S28 A;  1K73 4;  2W6J H;  3KII A;  1FGM A;  3LZA A;  3EHC A;  3FG1 A;  4N3V A;  3O8Y A;  1IT7 A;  3DM8 A;  2YFI B;  2QA4 3;  4N6U A;  2P05 A;  4HM4 B;  3RGR A;  1ZO2 A;  3NV0 B;  5IG5 A;  3X41 A;  3EBT A;  5AEU B;  3VF1 A;  2WGQ A;  1DMQ A;  3HX8 A;  3LXU X;  4HM0 B;  1GD3 A;  2O3O A;  3G16 A;  4CDL A;  1N5H A;  3LT9 A;  1GS3 A;  3LTC A;  4N6M A;  3S27 A;  2Q07 A;  3BND A;  2CH9 A;  1DVD A;  3DY5 A;  3LT8 A;  5AI1 A;  3FF2 A;  1W02 A;  3X40 A;  4IT7 A;  3ECF A;  3G0K A;  3PCS A;  1K41 A;  2CWT A;  1TU5 A;  1VQ8 3;  1QAF A;  2CFK A;  2Z77 A;  4OVM A;  2HML B;  1W00 A;  1OHO A;  4K61 A;  5CXO A;  1DMM A;  2CWV A;  2M7O A;  3JUO A;  3MHE A;  3X3X A;  1AR0 A;  1E97 A;  4R9K A;  3CCL 3;  3B4O A;  1M90 4;  1IVV A;  3KSP A;  3SVA A;  1D6Z A;  1M9G A;  3AMO B;  3EF8 A;  3D9R A;  4L7K A;  1WMP A;  2QGU A;  3WA3 A;  4J8T A;  5AIG A;  1CYU A;  3S29 A;  1LOX A;  3BNC A;  5IG0 A;  2SBL A;  5JPP A;  1F8N A;  1DYU A;  4EV5 A;  2HMK B;  2L4V A;  1W6G A;  5HGR A;  1VQO 3;  2Z6B A;  3FF0 A;  4K1V A;  2MC8 A;  3X42 A;  3FSD A;  3IPT A;  3GZB A;  3OW2 2;  5IER A;  1CEW I;  1JN5 B;  2F98 A;  3NBJ A;  5EQL A;  3BB9 A;  1OCV A;  1YJW 3;  2V1L A;  4BTW A;  3PS8 A;  3SOY A;  2OQE A;  4QWT A;  1R4C A;  4O8S A;  3UL6 A;  1KD1 4;  3DZL A;  4MJD A;  3EN1 B;  1NB5 I;  2P09 A;  3GZR A;  4KFF A;  3DGN A;  5EEO A;  3WOE B;  1ROA A;  4XDW A;  5I97 A;  1W6Y A;  2XF3 A;  1QVF 2;  2FGT A;  3F40 A;  4I4K A;  1LVN A;  3S5C A;  2BMQ B;  3BNB A;  3GZY B;  1JKG B;  1ZX2 A;  4RNY A;  4WYK A;  5CK6 A;  3CCV 3;  3KSE D;  4FMB A;  4HM3 B;  2A15 A;  3LOY A;  4JRF A;  5G2G A;  3UJM A;  4XBX A;  2OOV A;  4O02 B;  1AVK A;  2IA7 A;  1QJG A;  3UL5 A;  1ROV A;  5AIH A;  3JUM A;  2OCT A;  4FCZ A;  3GWR A;  1GD4 A;  2STD A;  3MWZ A;  4HM7 B;  4R9L A;  1U8C B;  1OAC A;  5JPU A;  4N6L A;  5D82 A;  3I55 3;  4N6V 0;  3H3H A;  3FG4 A;  3CC7 3;  4Q53 A;  2CFL A;  2PNC A;  1A67 A;  3CNM A;  3NV0 A;  3Q1C A;  3MPH A;  4BTY A;  2LYX A;  1K9M 4;  3T8N A;  2W2C A;  2K54 A;  1YHQ 3;  2KCD A;  5IEO A;  3G6E 3;  2RFR A;  1YI2 3;  2UX0 A;  1Q81 4;  3KZT A;  3ROB A;  1YIT 3;  1D6U A;  3HII A;  1OH0 A;  5IF6 A;  1IQX A;  2OWP A;  3NXJ A;  4L8O A;  5AYS C;  1WTH A;  4TX4 A;  1D6Y A;  3BLZ A;  3MSO A;  3N9H A;  3NM2 A;  4HM2 B;  5ELU A;  3A76 A;  3N54 B;  3VSY A;  2O9U X;  1Q86 4;  3BNE A;  5D81 A;  5CF2 A;  1QMA A;  4XM4 A;  1VQ5 3;  3EC9 A;  4MEI A;  1WMN A;  2FXT A;  3V98 A;  3FCS B;  3V92 A;  4R1K A;  1Q40 A;  2W56 B;  3IJE B;  3QK9 A;  5A0O B;  1IT8 A;  1NWW A;  1JRQ A;  1OF5 A;  2ZL8 A;  5AII A;  5FW5 A;  1GY5 A;  1Z1S A;  1OGX A;  1VQ6 3;  3LTB A;  1VQ4 3;  2BHM A;  3SOA A;  3TDG A;  2CG1 A;  1YVB I;  1WNH A;  3EN8 A;  3K63 A;  3MKI A;  1N8R 4;  3CCJ 3;  3EB8 A;  3AMO A;  2IUJ A;  1YJ9 3;  1NJI 4;  4FMA A;  3NBB A;  1V74 A;  2BNG A;  1SII A;  2RSX A;  1OHP A;  2LQV A;  3F7S A;  3G8Z A;  1YGE A;  3NUV A;  5AIF A;  1UUW B;  1TP6 A;  3CCU 3;  3CMA 3;  1J2B A;  1MOL A;  3B7C A;  2QIY A;  1LNH A;  4OK0 A;  1AVL A;  3CXC 2;  3NQZ A;  5KP1 A;  4EC6 A;  3B8L A;  2INX A;  1UUV B;  2MF7 A;  1VQP 3;  3JUQ A;  4GL6 A;  2XR8 B;  3F8H A;  1LXE A;  4ZM8 A;  4X2O A;  2WGO A;  3NQY A;  4AKY A;  1AV4 A;  1DVC A;  5KP3 A;  4HM8 B;  1VZZ A;  1PU4 A;  4HKV B;  4U13 A;  1FGT A;  1TUH A;  2RGQ A;  3H51 A;  3SXX A;  1SPU A;  1JKG A;  3LH4 A;  3PGB A;  1JJ2 2;  3CME 3;  1IU7 A;  3CCR 3;  3MG3 A;  2YX9 A;  2JDI H;  4N6N B;  1JB4 A;  2CWU A;  5LC6 A;  1IDP A;  2CFG A;  3HK4 A;  5D83 A;  1NU3 A;  4KZ1 A;  1JV2 B;  3NHX A;  4LEH A;  3SLU A;  1PFP A;  2CK3 H;  1ISK A;  3SED A;  2XFS A;  3EE1 A;  3OWU A;  3EBY A;  1BUQ A;  5CF1 A;  1FGR A;  1RRL A;  2GEX A;  3QRD A;  2CC3 A;  7STD A;  1IVW A;  5IG4 A;  4XBY A;  4MMY B;  1IV7 A;  1TIJ A;  1VQN 3;  2XEP A;  1FA3 A;  3STD A;  5FGO A;  4RBN A;  4XBT A;  3RDE A;  3CC2 3;  3CD6 3;  3MYT A;  1L5G B;  3DGL A;  1Q42 A;  4FMC A;  4K1U A;  3CPW 2;  1FUW A;  1OUN A;  3OV4 A;  1JB2 A;  3HIG A;  4LMI A;  4R80 A;  1K28 A;  1C7H A;  2GBW B;  1IK3 A;  2QEX 3;  1DMN A;  1GY6 A;  1HKX A;  4NHF A;  2XFT A;  4HM6 B;  3WMD A;  4KVH A;  4XB5 A;  3CCM 3;  5IEP A;  1VQ7 3;  2GEY A;  2GU1 A;  3PCR A;  2CG0 A;  2W9Q A;  1QVG 2;  1KQS 2;  2CHC A;  1VQM 3;  4MMZ B;  2OTL 3;  1A2V A;  2F86 B;  1STF I;  2RCD A;  3JVC A;  4IPB A;  5IW9 A;  4N6O B;  3Q90 A;  1O7H B;  4OUQ A;  4ORL A;  1JNQ A;  3M8C A;  4LGQ A;  2ML6 A;  2R4I A;  3EX9 A;  3CCE 3;  1SJW A;  3LTA A;  1OPY A;  3K5T A;  2IMJ A;  4FCJ A;  1QAK A;  3MG2 A;  3U1W A;  1RKY A;  1SQW A;  2XGL A;  2W03 A;  3DXO A;  3RGA A;  3X3Z A;  3I0Y A;  2WOH A;  4AEQ A;  1RRH A;  3MG1 A;  2BT3 A;  2B1X B;  1S72 3;  2XH9 A;  3EQQ B;  1W2B 2;  4FMD A;  2F99 A;  4EYC A;  1W6C A;  2P0M A;  1FGQ A;  2GBX B;  3DMC A;  1W5Z A;  3F8X A;  3JUP A;  1VQ9 3;  3WOD G;  5ELJ A;  5IEN A;  3KE7 A;  1TFO A;  1T5Y A;  3K7C A;  3F7X A;  4WYK B;  1WMO A;  1SIH A;  1UI7 A;  2Y73 A;  4KFE A;  1A2K A;  3LYG A;  4N6T A;  1HU9 A;  1STD A;  4HM5 B;  5LC7 A;  4JF8 A;  1IQ8 A;  1E3V A;  3S67 A;  3VGN A;  3Q2P A;  3UB1 A;  3WDG B;  4RZM A;  3WOF B;  4WFO A;  3DGM A;  1RJO A;  2Z7A A;  1OHS A;  1MNL A;  3U97 A;  1FGO A;  4NRE A;  4RNZ A;  1JN5 A;  3OWY A;  3UNL A;  2HMO B;  2E2V A;  3CNX A;  1W2Z A;  4H3U A;  3X3Y A;  5AEW B;  2YFL B;  5TGN A;  3LML A;  3ER7 A;  1NO3 A;  1UI8 A;  3GZX B;  2JQ5 A;  1N9J A;  2XGN A;  1WQL B;  4BTX A;  1ULI B;  4FR9 A;  4H61 A;  4O2H A;  1Q7Y 4;  4EXR A;  2OQE C;  3CU3 A;  3F14 A;  1O7N B;  2C10 A;  1O7W B;  1RN7 A;  4R4K A;  2B24 B;  1Q40 B;  3DGO A;  4EV2 A;  1N8Q A;  6STD A;  1OF5 B;  3OX9 A;  2CIU A;  1VQL 3;  3ALA A;  2C11 A;  2PZV A;  5EVH A;  1KSI A;  2XSO B;  3T0U A;  1W7C A;  2W0Q A;  2FNQ A;  2K0M A;  2BMO B;  1JB5 A;  1GYB A;  1US1 A;  1N5P A;  2E2T A;  2E2U A;  2W9P A;  3FH1 A;  3FKA A;  1Y4K A;  3J7Y d;  4GB5 A;  1S5A A;  3N8B A;  2BMR B;  2BO9 B;  2OOV C;  8CHO A;  3NBR A;  3GRD A;  1CQS A;  1EKM A;  1M1X B;  4LSO A;  4J9A A;  1IQY A;  1OGZ A;  4KFD A;  2P0X A;  3I56 3;  2GXF A;  1YJN 3;  3CCQ 3;  3KN4 A;  3G71 3;  1UW1 A;  1QAL A;  3IMA B;  3T8U A;  2HMM B;  1O7P B;  2CKF B;  3FZW A;  3KFQ C;  5AYR B;  1ASK A;  3WA2 X;  4L8P A;  4WP5 A;  1NB3 I;  5DRV A;  3K0Z A;  2XRX B;  3OXA A;  3E99 A;  2ZDJ A;  4X2H A;  5IG3 A;  5BXQ A;  1EQK A;  3NM7 A;  2OTJ 3;  2HMJ B;  3DUK A;  3D3L A;  5BVB A;  1KC8 4;  1GY7 A;  3HZP A;  2KXG A;  3OWS A;  3FG3 A;  1EA2 A;  1G96 A;  2P38 A;  2IUK A;  3K9M C;  1W01 A;  2I9W A;  2W56 A;  2WOF A;  4WWU C;  4FCM A;  5STD A;  1K8A 4;  3KKG A;  3G4S 3;  3F9S A;  3HI7 A;  4CCV A;  3B4P A;  4HZ9 B;  1IVX A;  5JBS A;  2W04 A;  3PYJ A;  3JUN A;  1O7G B;  2YFJ B;  4EBG A;  1VQK 3;  2GU3 A;  4LZI A;  1U5O A;  4HJL B;  4HBR A;  1E3R A;  2KRT A;  3V99 A;  3PZW A;  4HM1 B;  3FGY A;  4HYZ A;  3CC4 3;  4WHA A;  3SX1 A;  5KP4 A;  4HVN A;  1EG9 B;  2D42 A;  2D1W A;  3PXM A;  4STD A;  2CW9 A;  4O3V A;  3L0R A;  3CPO A;  2Z76 A;  4MMX B;  5CLK A;  1M1K 4;  2WO0 A;  4PEJ A;  1ULJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...