3CCR3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccr300
1KC84 3CME3 3CCE3 3CCV3 3OW22 3CD63 1KD14 3CCQ3 3CCL3 3CCM3 1VQK3 3I553 1VQO3 3CCU3 1W2B2 1VQ53 1YIJ3 1M904 2OTJ3 3CC43 1VQ83 1VQN3 1Q824 3CC73 1VQM3 3I563 1YJW3 1Q864 1VQ43 1Q7Y4 1YJN3 1VQP3 1YI23 3CCJ3 1VQ73 2QA43 1K734 1VQ63 3G6E3 1QVG2 1M1K4 3CC23 3CXC2 3CPW2 1YIT3 3G713 2OTL3 1YJ93 1VQ93 1KQS2 1JJ22 1K8A4 1VQL3 1NJI4 1K9M4 1YHQ3 3CMA3 1QVF2 3CCR3 1N8R4 3CCS3 1Q814 3G4S3 1S723 2QEX3
chains in the Genus database with same CATH superfamily
1CYUA 4EV5A 1JRQA 4H3UA 1CH0A 1DMNA 1OF5A 2K54A 1W6GA 2C11A 1SQWA 1WNHA 1W02A 5M18A 1OUNA 4HM3B 1EG9B 3F40A 7RNTA 4BTXA 1O7NB 1G0TA 3JUQA 5JPUA 1WMPA 1O7PB 1N8QA 4DKIA 3I563 1RN4A 3LXUX 1X1XA 3JUMA 2XGLA 3CPW2 1T2HA 4I5QA 2INXA 2V1LA 4HM5B 4IIAA 4J9AA 1WQLB 3KSED 3U1WA 3WMDA 1CQSA 1CYVA 3OV4A 3HIIA 3Q2PA 4HVNA 3LT8A 5KP4A 3NUVA 3BNDA 4OK0A 3UNLA 1X1YA 1FGTA 3KIIA 3VF1A 3G16A 1BUJA 3D5GA 3CCV3 1RN7A 3EQQB 4K1VA 1NB3I 1BAOA 3U97A 3CCU3 2OWPA 1FA3A 1FW7A 1OACA 4FMBA 4N6V0 4KVHA 3LTBA 4XBYA 1VQ83 5D83A 4MMXB 4BL3A 4FMCA 3S5CA 2JDIH 3S29A 1RCLA 1GS3A 1A67A 2WGOA 1VQP3 3EBTA 1BSAA 4MMZB 3PS8A 1RTUA 4CDLA 1M1K4 1IVWA 2GU1A 5CLKA 1OGXA 1PY3A 5M19A 1RRLA 5M1AA 1W5ZA 3X3XA 3RDEA 4EXRA 1IV7A 2UUGC 4ORLA 3WOEB 2BHMA 3KFQC 3RNTA 3DGYA 1BIRA 4H61A 3RGRA 2W0QA 5AEUB 1BRHA 1HU9A 3GRDA 1BSBA 4RNYA 4XBXA 2XF3A 1FUTA 1JBSA 3STDA 1BNSA 1SPUA 1F8NA 3LZAA 5EEOA 1STFI 1N5HA 2XEPA 1DMQA 4LZIA 2STDA 2CG0A 5EVHA 3V92A 2CH9A 3S67A 3VSYA 3BU4A 4X2OA 2AADA 2CFLA 3X3ZA 1LVNA 4WYKA 1TRQA 3JVCA 4HZ9B 3G4S3 1K41A 2R4IA 1W6CA 5EQLA 2YFIB 3IPTA 1U8CB 5IW9A 1BRKA 4WYKB 3SYUA 1AY7A 3B4OA 3FG4A 4L7KA 2IY2A 2A15A 2D1WA 5CK6A 1YIJ3 1A2PA 1AQZA 1UDII 1IQYA 1JN5B 2W56B 1VQN3 1EKMA 2KF4A 2CK3H 3ZFZA 3LYGA 4WP5A 3T0UA 1I2FA 1R4CA 3BNBA 3DGMA 1LOYA 4KZ1A 5TGNA 1Q9EA 4O2HA 4PEJA 4CCVA 5FW5A 2K3DA 1YI23 1K734 1IYYA 1SIIA 3X40A 3MG1A 2RGQA 2WOHA 3SLUA 2P05A 1V57A 1C7HA 1RGLA 2XH9A 3WDGB 1JNQA 1PYLA 1RRHA 1QMAA 2CWVA 3KKGA 3AMOA 1QVF2 1N8R4 3WR2A 1RNBA 2RBIA 1UGIA 2QEX3 1DVCA 3FF2A 3QRDA 4HOHA 1RGAA 1RLSA 3JUNA 1ROAA 2IA7A 4FCMA 5KP1A 3K63A 2CWUA 3HI7A 1RGGA 3AGNA 2BIRA 1MGRA 1TRPA 2CW9A 1DETA 1T2IA 2YX9A 3ECFA 3D3LA 4HM1B 1NB5I 1WTHA 3IJEB 3O8YA 1FYSA 2CC3A 2Z76A 2CKFB 3SX1A 4HM8B 3B4PA 3CCJ3 1B2MA 3QK9A 2HMMB 1VQ63 3PCSA 4R80A 2OOVC 1I0XA 1QALA 3FCSB 1GOVA 1QAFA 4WWUC 1AVKA 4GB5A 3EN1B 3CCR3 3A76A 1JBRA 1GMPA 2OQEC 3K7CA 3CU3A 1BUQA 3WODG 1ULJB 3G8ZA 3SOAA 3NV0B 4RNZA 3I553 1FGRA 3MG2A 3NM7A 4O3VA 3CCM3 1NO3A 1X1UA 4EYCA 1LXEA 3GSPA 3UJMA 2OTJ3 1PFPA 3F8HA 1M9GA 1RGKA 2J8XB 3Q3FA 3D4AA 3DGNA 1UUWB 2HOHA 2ZL8A 4KFFA 1B2XA 1OCVA 3DMCA 1B2UA 1Q42A 2O9UX 2XR8B 4KT3B 4EW5A 2CFKA 2Z7AA 2Y73A 4FR9A 1B3SA 1RDSA 4N6LA 1TUHA 4HM4B 4LGQA 4BIRA 1RNTA 1TIJA 3L0RA 3NQYA 2OTL3 2CWTA 1O7WB 3KZTA 1UCLA 3BNEA 3CPOA 3LTCA 1VQL3 2SARA 1YHQ3 1RGCA 4EC6A 1GMQA 3FLJA 4XB5A 1O7MB 2GBXB 1LNHA 3WA2X 1D6YA 3FKAA 1VZZA 3MWZA 3F9SA 4IT7A 5AEWB 3GZBA 2GSPA 3SOYA 2H0GA 3SXXA 3DZLA 5D81A 1E97A 2YFLB 4NHFA 9RNTA 2F98A 1SIHA 2GEYA 2QGUA 1GSPA 3F8XA 2O3OA 1A2KA 5BXQA 1UCJA 1A90A 1DVDA 2Y74A 2KF6A 2FGTA 3FG3A 1RJOA 3K5TA 3IMAB 4O02B 1JKGA 5DRVA 4ZM8A 5HOHA 2CX0A 1IT7A 2XSOB 1AR0A 1NWWA 5A0OB 2KF3A 1STDA 1MWUA 3EBYA 4HM2B 4LMIA 2RFRA 4WHAA 5ELJA 3PXMA 1TFOA 3N54B 3OWSA 2ML6A 1BRJA 1Q40B 1GY5A 1LQMB 3FGYA 3CCQ3 5IEOA 2W9QA 1ULIB 1GY6A 2HMJB 3UL6A 1IQXA 2FXTA 3EF8A 4J5GA 1BGSA 2W04A 4GSPA 4MMYB 3RGAA 1I2EA 3KN4A 3NBRA 8CHOA 1Q824 8RNTA 7STDA 1VQM3 5DREA 2XFSA 1EA2A 1UCIA 1GOYA 1BANA 4HYZA 4NREA 1T3BA 3EN8A 2AAEA 3J7Yd 3B7CA 4N6MA 2KAAA 4FCZA 2GU3A 4HM6B 3ZG0A 3FSDA 3NQZA 2IMJA 2IUJA 2BNGA 3MYTA 2C4BA 1WMNA 4AKZA 1BNIA 1OHPA 2K0MA 3WOFB 4N3VA 2WGQA 1BRSA 4TX4A 1KD14 3F7XA 3CCL3 1YNVX 2PNCA 2CG1A 1VQO3 3F14A 1R4YA 2F5MA 3DH2A 2CX1A 1W01A 2W6JH 5ELUA 1KWIA 2IUKA 3GZYB 5LC6A 3EB8A 4N6TA 3T8UA 3I0YA 1JZOA 2W03A 1UW1A 1HZ1A 2HMNB 2MF7A 1N9EA 1BNRA 1Q40A 3DM8A 1UI8A 4LSOA 3GZXB 1B2SA 5BIRA 3CXC2 1JBTA 1BSDA 1VQ93 2F99A 2YFJB 4AKYA 5IG0A 5JPPA 1J2BA 2BMRB 1VQQA 1FZUA 1K9M4 1US1A 6GSPA 1LRAA 3Q1CA 4RZMA 1Q814 5G2GA 3HX8A 1RN1A 2B24B 3JUOA 1D6UA 1UCKA 5AIFA 3GWRA 4JRFA 3D5IA 1TTOA 3X42A 1YVBI 5RNTA 1VQ53 1UGHI 3MSOA 4CJNA 4U13A 3B8LA 3KSPA 1MNLA 1CEWI 3BLZA 3DGLA 4GHOA 2D42A 1YJN3 1OHOA 5LC7A 5STDA 3KE7A 1QVG2 3S28A 1I0VA 3FH1A 1YGEA 4WFOA 4HKVB 3LTDA 3G0KA 4N6NB 2E2VA 4FMDA 2W2CA 3LTAA 4K1UA 4R9LA 3BIRA 1S723 1JZDA 3BB9A 1EUIC 3OXAA 1FGOA 5AI1A 3EC9A 3CME3 3OW22 1I2GA 1IV9A 1BVIA 2E2TA 2ZDJA 3NBBA 1N5PA 1B27A 2UX0A 2P0XA 2BMQB 3NXJA 5IG3A 1TFKA 3A5EA 4FCJA 1N9JA 2OCTA 3DXOA 1RKYA 2JQ5A 1GMRA 2L1SA 1JKGB 2P0MA 5AIIA 1M1XB 1W2ZA 1YJW3 4MEIA 3URPA 5BVBA 2XSHB 5JBSA 2XRXB 1DMMA 1BOXA 3VGNA 3G713 1MGWA 1YJ93 1D6ZA 4EV2A 3FF0A 2Q07A 1JJ22 3MG3A 1B2ZA 1AVLA 4HZBB 3SVAA 3TDGA 3MHEA 1FGMA 1U5OA 1SARA 4Q53A 5IERA 1WMOA 4QWTA 3HOHA 1K28A 1BSCA 1I70A 5D82A 1BRIA 2KXGA 3AGOA 5FGOA 3CCE3 3F7SA 2E2UA 4LYLB 1OH0A 2F5WA 2XGNA 4L8PA 5IG5A 2CHCA 2XFTA 4KFDA 5AYRB 1EQKA 1I3IA 1MWSA 1E3VA 3K0ZA 4RNTA 4I4KA 1QAKA 1GD3A 4BTYA 1G96A 1BNFA 3H3HA 1ZO2A 2KF5A 5HGRA 4XDVA 1UUVB 5IENA 2QA43 3HIGA 1BRNL 3G6E3 1X1WA 5G1KA 2W9PA 1LOXA 1S5AA 2GBWB 2H0IA 4X2HA 3X3YA 3K9MC 1LQGC 1OHSA 2HMLB 2BU4A 2GEXA 3ER7A 3LOYA 4FMAA 4XDWA 1V74A 2R41A 1G02A 2UGIA 1FGQA 1JV2B 3NV0A 3KCHA 1VQK3 1GD4A 2Z77A 2P38A 1NNVA 2QIYA 1JN5A 1O7HB 2C10A 3JUPA 1A2VA 3H51A 2I9WA 3CC43 4ILFA 1BU4A 3DY5A 1W4NA 3WHOA 2HMKB 4GL6A 1IT8A 1KSIA 5AYSC 3OWUA 1RMSA 1OGZA 1IDPA 1W6YA 1MOLA 1Q7HA 4XM4A 3T8NA 6STDA 2RCDA 7GSPA 4HAAA 1O7GB 2SBLA 3EHCA 2RNTA 4K61A 3NM2A 1C54A 3LMLA 1RGEA 2LYXA 3CCS3 1NDOB 2PZVA 4LEHA 1ZS7A 3PYJA 3NX0A 1HKXA 4HBRA 1AV4A 2IYJA 3WA3A 1T5YA 3AMOB 4O8SA 4NPBA 2BO9B 4R9KA 1UI7A 1M904 2P09A 4BTWA 4CPKA 1RHLA 3EX9A 1TJDA 3FG1A 1Y4KA 3CNMA 2KRTA 3UB1A 4J8TA 2ZA4A 1LOWA 5CF2A 1RGFA 1YGWA 1BNJA 3FZWA 1JB5A 1VQ73 1IVUA 3LT9A 3V98A 3DUKA 3SEDA 4HM0B 1FUWA 3NBJA 1RSNA 2B1XB 2F56A 2M7OA 2W56A 3LH4A 2KCDA 5IEPA 1Z1SA 3UL5A 4OUQA 6RNTA 1BSEA 3S27A 3CNXA 1MWRA 3E99A 1LNIA 1ZGXA 3HK4A 3AHSA 1GY7A 1RCKA 3EE1A 3ROBA 1IU7A 1IQ8A 3CD63 4MJDA 1UUGB 4KFEA 1MWTA 4N6OB 1RGHA 1W2B2 1ISKA 1BNEA 2BT3A 5BU4A 2FNQA 1SJWA 3GZRA 4K90B 1EEJA 3MKIA 1YVSA 2ZHXB 2H0HA 1IVXA 2OOVA 3MPHA 2CIUA 3EJVA 3N9HA 1Q864 2BMOB 1VQ43 4XBTA 4IPBA 1BRGA 4N6UA 4JF8A 1ASKA 3X41A 3OWYA 1FUSA 2L4VA 1I8VA 1TP6A 1QJGA 1IVVA 4L8OA 5AIHA 5KP3A 1K8A4 1NJI4 2OQEA 3PGBA 1I3FA 2WO0A 4AEQA 2Z6BA 3Q90A 4HJLB 5CXOA 1NU3A 2ML5A 4BL2A 1GYBA 3OX9A 1ZX2A 2MC8A 5AIGA 1KC84 2HMOB 1LOVA 1B21A 1W00A 3AHWA 4BU4A 5I97A 3HZPA 4STDA 5IF6A 1OPYA 3D79A 2F86B 4OVMA 2F4YA 3CC73 3GAXA 4R1KA 1JB2A 3PCRA 3PZWA 5G1LA 3ZG5A 1IK3A 2CFWA 1OF5B 1JB4A 1W7CA 4EBGA 1TU5A 1Q7Y4 3D9RA 2CFDA 4R4KA 1BNGA 3ALAA 1E3RA 3BNCA 3N8BA 3NHXA 5IG4A 3CC23 1YIT3 4HM7B 5GSPA 1DE3A 2LQVA 1DYUA 1KQS2 4G1MB 1L5GB 1HYFA 1ROVA 2GXFA 2RSXA 3DGOA 3M8CA 4RBNA 4J5KA 3V99A 1GOUA 1PU4A 3CMA3 5CF1A 2WOFA 1B20A 1V58A 2CFGA
chains in the Genus database with same CATH topology
1CYUA 4EV5A 1JRQA 4H3UA 1OF5A 1DMNA 2K54A 1W6GA 2C11A 1SQWA 1WNHA 1W02A 1OUNA 4HM3B 1EG9B 3F40A 4BTXA 1O7NB 3JUQA 5JPUA 1WMPA 1O7PB 1N8QA 3I563 3LXUX 3JUMA 2XGLA 3CPW2 2INXA 2V1LA 4HM5B 4IIAA 4J9AA 1WQLB 3KSED 3U1WA 3WMDA 1CQSA 1CYVA 3OV4A 3HIIA 3Q2PA 4HVNA 3LT8A 5KP4A 3NUVA 3BNDA 4OK0A 3UNLA 1FGTA 3KIIA 3VF1A 3G16A 3CCV3 1RN7A 3EQQB 4K1VA 1NB3I 3U97A 3CCU3 2OWPA 1FA3A 1OACA 4FMBA 4N6V0 4KVHA 3LTBA 4XBYA 1VQ83 5D83A 4MMXB 4FMCA 3S5CA 2JDIH 3S29A 1GS3A 1A67A 2WGOA 1VQP3 3EBTA 4MMZB 3PS8A 4CDLA 1M1K4 1IVWA 2GU1A 5CLKA 1OGXA 1RRLA 1W5ZA 3X3XA 3RDEA 4EXRA 1IV7A 4ORLA 3WOEB 2BHMA 3KFQC 4H61A 3RGRA 2W0QA 5AEUB 3GRDA 1HU9A 4RNYA 4XBXA 2XF3A 3STDA 1SPUA 1F8NA 3LZAA 5EEOA 1STFI 1N5HA 2XEPA 1DMQA 4LZIA 2STDA 2CG0A 5EVHA 3V92A 2CH9A 3S67A 3VSYA 4X2OA 2CFLA 3X3ZA 1LVNA 4WYKA 3JVCA 4HZ9B 3G4S3 1K41A 2R4IA 1W6CA 5EQLA 2YFIB 3IPTA 1U8CB 5IW9A 4WYKB 3B4OA 3FG4A 4L7KA 2A15A 2D1WA 5CK6A 1YIJ3 1IQYA 1JN5B 2W56B 1VQN3 1EKMA 2CK3H 3LYGA 4WP5A 3T0UA 1R4CA 3BNBA 3DGMA 4KZ1A 5TGNA 4PEJA 4O2HA 4CCVA 1YI23 5FW5A 1K734 1SIIA 3X40A 3MG1A 2RGQA 2WOHA 3SLUA 2P05A 1C7HA 3WDGB 2XH9A 1JNQA 1RRHA 1QMAA 2CWVA 3KKGA 3AMOA 1QVF2 1N8R4 2QEX3 1DVCA 3FF2A 3QRDA 3JUNA 1ROAA 2IA7A 4FCMA 5KP1A 3K63A 2CWUA 3HI7A 3ECFA 4HM1B 2CW9A 2YX9A 1NB5I 3D3LA 1WTHA 3IJEB 3O8YA 2CC3A 2Z76A 2CKFB 3SX1A 4HM8B 3B4PA 3CCJ3 3QK9A 2HMMB 1VQ63 3PCSA 4R80A 2OOVC 3FCSB 1QALA 1QAFA 4WWUC 1AVKA 4GB5A 3EN1B 3CCR3 3A76A 3K7CA 2OQEC 1BUQA 3CU3A 3WODG 1ULJB 3G8ZA 3SOAA 3NV0B 4RNZA 3I553 1FGRA 3MG2A 3NM7A 4O3VA 3CCM3 1NO3A 4EYCA 1LXEA 3UJMA 2OTJ3 1PFPA 3F8HA 1M9GA 3DGNA 1UUWB 2ZL8A 4KFFA 1OCVA 3DMCA 1Q42A 2O9UX 2XR8B 2CFKA 2Z7AA 2Y73A 4FR9A 4N6LA 1TUHA 4HM4B 4LGQA 2OTL3 1TIJA 3L0RA 3NQYA 2CWTA 1O7WB 3KZTA 3BNEA 3LTCA 3CPOA 1VQL3 1YHQ3 4EC6A 3FLJA 4XB5A 1O7MB 2GBXB 1LNHA 3WA2X 1D6YA 3FKAA 1VZZA 3MWZA 3F9SA 4IT7A 5AEWB 3GZBA 3SOYA 3SXXA 3DZLA 5D81A 1E97A 2YFLB 4NHFA 2F98A 1SIHA 2GEYA 2QGUA 3F8XA 2O3OA 1A2KA 5BXQA 1A90A 1DVDA 2Y74A 2FGTA 3FG3A 1RJOA 3K5TA 3IMAB 4O02B 1JKGA 5DRVA 4ZM8A 1IT7A 2XSOB 1AR0A 1NWWA 5A0OB 1STDA 3EBYA 4HM2B 4LMIA 2RFRA 4WHAA 5ELJA 3PXMA 1TFOA 3N54B 3OWSA 2ML6A 1Q40B 3FGYA 1GY5A 3CCQ3 5IEOA 2W9QA 1ULIB 1GY6A 2HMJB 3UL6A 1IQXA 2FXTA 3EF8A 2W04A 4MMYB 3RGAA 8CHOA 3KN4A 3NBRA 1Q824 1VQM3 7STDA 5DREA 2XFSA 1EA2A 4HYZA 4NREA 3EN8A 3J7Yd 3B7CA 4N6MA 4FCZA 2GU3A 4HM6B 3FSDA 3NQZA 2IMJA 2IUJA 2BNGA 3MYTA 1WMNA 4AKZA 1OHPA 2K0MA 3WOFB 4N3VA 2WGQA 4TX4A 1KD14 3F7XA 3CCL3 2PNCA 2CG1A 1VQO3 3F14A 1W01A 2W6JH 5ELUA 1KWIA 2IUKA 3GZYB 5LC6A 3EB8A 4N6TA 3T8UA 3I0YA 2W03A 1UW1A 2HMNB 2MF7A 1N9EA 1Q40A 3DM8A 1UI8A 4LSOA 3GZXB 3CXC2 1VQ93 2F99A 2YFJB 4AKYA 5IG0A 5JPPA 1J2BA 2BMRB 1K9M4 1US1A 3Q1CA 4RZMA 1Q814 5G2GA 3HX8A 2B24B 3JUOA 1D6UA 5AIFA 3GWRA 4JRFA 3X42A 1YVBI 1VQ53 3MSOA 4U13A 3B8LA 3KSPA 1MNLA 1CEWI 3BLZA 3DGLA 2D42A 1YJN3 1OHOA 5LC7A 5STDA 3KE7A 1QVG2 3S28A 3FH1A 1YGEA 4WFOA 4HKVB 3LTDA 3G0KA 4N6NB 2E2VA 4FMDA 2W2CA 3LTAA 4K1UA 4R9LA 1S723 3BB9A 3OXAA 1FGOA 5AI1A 3EC9A 3CME3 3OW22 1IV9A 2E2TA 2ZDJA 3NBBA 1N5PA 2UX0A 3NXJA 2P0XA 2BMQB 5IG3A 1TFKA 4FCJA 1N9JA 2OCTA 3DXOA 1RKYA 2JQ5A 2P0MA 5AIIA 1JKGB 1M1XB 1W2ZA 1YJW3 4MEIA 5BVBA 2XSHB 5JBSA 2XRXB 1DMMA 3VGNA 3G713 1YJ93 1D6ZA 4EV2A 3FF0A 2Q07A 1JJ22 3MG3A 1AVLA 4HZBB 3SVAA 3TDGA 3MHEA 1FGMA 1U5OA 4Q53A 5IERA 1WMOA 4QWTA 1K28A 5D82A 2KXGA 5FGOA 3CCE3 3F7SA 2E2UA 1OH0A 2XGNA 4L8PA 5IG5A 2CHCA 2XFTA 4KFDA 5AYRB 1EQKA 1E3VA 3K0ZA 4I4KA 1QAKA 1GD3A 4BTYA 1G96A 3H3HA 1ZO2A 5HGRA 4XDVA 1UUVB 5IENA 2QA43 3HIGA 3G6E3 2W9PA 1LOXA 1S5AA 2GBWB 4X2HA 3K9MC 1OHSA 2HMLB 2GEXA 3ER7A 3LOYA 4FMAA 4XDWA 1V74A 1FGQA 1JV2B 3NV0A 1VQK3 1GD4A 2Z77A 2P38A 2QIYA 1JN5A 1O7HB 2C10A 3JUPA 1A2VA 3H51A 2I9WA 3CC43 3DY5A 1W4NA 2HMKB 4GL6A 1IT8A 1KSIA 5AYSC 3OWUA 1OGZA 1IDPA 1W6YA 1MOLA 4XM4A 3T8NA 6STDA 2RCDA 1O7GB 2SBLA 3EHCA 4K61A 3NM2A 3LMLA 2LYXA 3CCS3 1NDOB 2PZVA 4LEHA 3PYJA 3NX0A 1HKXA 4HBRA 1AV4A 3WA3A 1T5YA 3AMOB 4O8SA 4R9KA 2BO9B 1UI7A 1M904 2P09A 4BTWA 3EX9A 3FG1A 1Y4KA 3CNMA 2KRTA 3UB1A 4J8TA 5CF2A 3FZWA 1JB5A 1VQ73 1IVUA 3LT9A 3V98A 3DUKA 3SEDA 4HM0B 1FUWA 3NBJA 2B1XB 2M7OA 2W56A 3LH4A 2KCDA 5IEPA 1Z1SA 3UL5A 4OUQA 3S27A 3CNXA 3E99A 3HK4A 1GY7A 3EE1A 3ROBA 1IU7A 1IQ8A 3CD63 4MJDA 4KFEA 4N6OB 1W2B2 1ISKA 2BT3A 2FNQA 1SJWA 3GZRA 4K90B 3MKIA 1IVXA 2OOVA 3MPHA 2CIUA 3EJVA 3N9HA 1Q864 2BMOB 1VQ43 4XBTA 4IPBA 4N6UA 4JF8A 1ASKA 3X41A 3OWYA 2L4VA 1TP6A 1QJGA 1IVVA 4L8OA 5AIHA 5KP3A 1K8A4 1NJI4 2OQEA 3PGBA 2WO0A 4AEQA 2Z6BA 3Q90A 4HJLB 5CXOA 1NU3A 2ML5A 1GYBA 3OX9A 1ZX2A 2MC8A 5AIGA 1KC84 2HMOB 1W00A 5I97A 3HZPA 4STDA 5IF6A 1OPYA 2F86B 4OVMA 3CC73 3GAXA 4R1KA 1JB2A 3PCRA 3PZWA 1IK3A 1OF5B 1JB4A 1W7CA 2CFWA 4EBGA 1TU5A 1Q7Y4 3D9RA 2CFDA 4R4KA 3ALAA 1E3RA 3BNCA 3N8BA 3NHXA 5IG4A 3CC23 1YIT3 4HM7B 2LQVA 1DYUA 1KQS2 4G1MB 1L5GB 1ROVA 2GXFA 2RSXA 3M8CA 3DGOA 4RBNA 3V99A 1PU4A 3CMA3 5CF1A 2WOFA 3X3YA 2CFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 4;  3CME 3;  3CCE 3;  3CCV 3;  3OW2 2;  3CD6 3;  1KD1 4;  3CCQ 3;  3CCL 3;  3CCM 3;  1VQK 3;  3I55 3;  1VQO 3;  3CCU 3;  1W2B 2;  1VQ5 3;  1YIJ 3;  1M90 4;  2OTJ 3;  3CC4 3;  1VQ8 3;  1VQN 3;  1Q82 4;  3CC7 3;  1VQM 3;  3I56 3;  1YJW 3;  1Q86 4;  1VQ4 3;  1Q7Y 4;  1YJN 3;  1VQP 3;  1YI2 3;  3CCJ 3;  1VQ7 3;  2QA4 3;  1K73 4;  1VQ6 3;  3G6E 3;  1QVG 2;  1M1K 4;  3CC2 3;  3CXC 2;  3CPW 2;  1YIT 3;  3G71 3;  2OTL 3;  1YJ9 3;  1VQ9 3;  1KQS 2;  1JJ2 2;  1K8A 4;  1VQL 3;  1NJI 4;  1K9M 4;  1YHQ 3;  3CMA 3;  1QVF 2;  3CCR 3;  1N8R 4;  3CCS 3;  1Q81 4;  3G4S 3;  1S72 3;  2QEX 3; 
#chains in the Genus database with same CATH topology
 1CYU A;  4EV5 A;  1JRQ A;  4H3U A;  1CH0 A;  1DMN A;  1OF5 A;  2K54 A;  1W6G A;  2C11 A;  1SQW A;  1WNH A;  1W02 A;  5M18 A;  1OUN A;  4HM3 B;  1EG9 B;  3F40 A;  7RNT A;  4BTX A;  1O7N B;  1G0T A;  3JUQ A;  5JPU A;  1WMP A;  1O7P B;  1N8Q A;  4DKI A;  3I56 3;  1RN4 A;  3LXU X;  1X1X A;  3JUM A;  2XGL A;  3CPW 2;  1T2H A;  4I5Q A;  2INX A;  2V1L A;  4HM5 B;  4IIA A;  4J9A A;  1WQL B;  3KSE D;  3U1W A;  3WMD A;  1CQS A;  1CYV A;  3OV4 A;  3HII A;  3Q2P A;  4HVN A;  3LT8 A;  5KP4 A;  3NUV A;  3BND A;  4OK0 A;  3UNL A;  1X1Y A;  1FGT A;  3KII A;  3VF1 A;  3G16 A;  1BUJ A;  3D5G A;  3CCV 3;  1RN7 A;  3EQQ B;  4K1V A;  1NB3 I;  1BAO A;  3U97 A;  3CCU 3;  2OWP A;  1FA3 A;  1FW7 A;  1OAC A;  4FMB A;  4N6V 0;  4KVH A;  3LTB A;  4XBY A;  1VQ8 3;  5D83 A;  4MMX B;  4BL3 A;  4FMC A;  3S5C A;  2JDI H;  3S29 A;  1RCL A;  1GS3 A;  1A67 A;  2WGO A;  1VQP 3;  3EBT A;  1BSA A;  4MMZ B;  3PS8 A;  1RTU A;  4CDL A;  1M1K 4;  1IVW A;  2GU1 A;  5CLK A;  1OGX A;  1PY3 A;  5M19 A;  1RRL A;  5M1A A;  1W5Z A;  3X3X A;  3RDE A;  4EXR A;  1IV7 A;  2UUG C;  4ORL A;  3WOE B;  2BHM A;  3KFQ C;  3RNT A;  3DGY A;  1BIR A;  4H61 A;  3RGR A;  2W0Q A;  5AEU B;  1BRH A;  1HU9 A;  3GRD A;  1BSB A;  4RNY A;  4XBX A;  2XF3 A;  1FUT A;  1JBS A;  3STD A;  1BNS A;  1SPU A;  1F8N A;  3LZA A;  5EEO A;  1STF I;  1N5H A;  2XEP A;  1DMQ A;  4LZI A;  2STD A;  2CG0 A;  5EVH A;  3V92 A;  2CH9 A;  3S67 A;  3VSY A;  3BU4 A;  4X2O A;  2AAD A;  2CFL A;  3X3Z A;  1LVN A;  4WYK A;  1TRQ A;  3JVC A;  4HZ9 B;  3G4S 3;  1K41 A;  2R4I A;  1W6C A;  5EQL A;  2YFI B;  3IPT A;  1U8C B;  5IW9 A;  1BRK A;  4WYK B;  3SYU A;  1AY7 A;  3B4O A;  3FG4 A;  4L7K A;  2IY2 A;  2A15 A;  2D1W A;  5CK6 A;  1YIJ 3;  1A2P A;  1AQZ A;  1UDI I;  1IQY A;  1JN5 B;  2W56 B;  1VQN 3;  1EKM A;  2KF4 A;  2CK3 H;  3ZFZ A;  3LYG A;  4WP5 A;  3T0U A;  1I2F A;  1R4C A;  3BNB A;  3DGM A;  1LOY A;  4KZ1 A;  5TGN A;  1Q9E A;  4O2H A;  4PEJ A;  4CCV A;  5FW5 A;  2K3D A;  1YI2 3;  1K73 4;  1IYY A;  1SII A;  3X40 A;  3MG1 A;  2RGQ A;  2WOH A;  3SLU A;  2P05 A;  1V57 A;  1C7H A;  1RGL A;  2XH9 A;  3WDG B;  1JNQ A;  1PYL A;  1RRH A;  1QMA A;  2CWV A;  3KKG A;  3AMO A;  1QVF 2;  1N8R 4;  3WR2 A;  1RNB A;  2RBI A;  1UGI A;  2QEX 3;  1DVC A;  3FF2 A;  3QRD A;  4HOH A;  1RGA A;  1RLS A;  3JUN A;  1ROA A;  2IA7 A;  4FCM A;  5KP1 A;  3K63 A;  2CWU A;  3HI7 A;  1RGG A;  3AGN A;  2BIR A;  1MGR A;  1TRP A;  2CW9 A;  1DET A;  1T2I A;  2YX9 A;  3ECF A;  3D3L A;  4HM1 B;  1NB5 I;  1WTH A;  3IJE B;  3O8Y A;  1FYS A;  2CC3 A;  2Z76 A;  2CKF B;  3SX1 A;  4HM8 B;  3B4P A;  3CCJ 3;  1B2M A;  3QK9 A;  2HMM B;  1VQ6 3;  3PCS A;  4R80 A;  2OOV C;  1I0X A;  1QAL A;  3FCS B;  1GOV A;  1QAF A;  4WWU C;  1AVK A;  4GB5 A;  3EN1 B;  3CCR 3;  3A76 A;  1JBR A;  1GMP A;  2OQE C;  3K7C A;  3CU3 A;  1BUQ A;  3WOD G;  1ULJ B;  3G8Z A;  3SOA A;  3NV0 B;  4RNZ A;  3I55 3;  1FGR A;  3MG2 A;  3NM7 A;  4O3V A;  3CCM 3;  1NO3 A;  1X1U A;  4EYC A;  1LXE A;  3GSP A;  3UJM A;  2OTJ 3;  1PFP A;  3F8H A;  1M9G A;  1RGK A;  2J8X B;  3Q3F A;  3D4A A;  3DGN A;  1UUW B;  2HOH A;  2ZL8 A;  4KFF A;  1B2X A;  1OCV A;  3DMC A;  1B2U A;  1Q42 A;  2O9U X;  2XR8 B;  4KT3 B;  4EW5 A;  2CFK A;  2Z7A A;  2Y73 A;  4FR9 A;  1B3S A;  1RDS A;  4N6L A;  1TUH A;  4HM4 B;  4LGQ A;  4BIR A;  1RNT A;  1TIJ A;  3L0R A;  3NQY A;  2OTL 3;  2CWT A;  1O7W B;  3KZT A;  1UCL A;  3BNE A;  3CPO A;  3LTC A;  1VQL 3;  2SAR A;  1YHQ 3;  1RGC A;  4EC6 A;  1GMQ A;  3FLJ A;  4XB5 A;  1O7M B;  2GBX B;  1LNH A;  3WA2 X;  1D6Y A;  3FKA A;  1VZZ A;  3MWZ A;  3F9S A;  4IT7 A;  5AEW B;  3GZB A;  2GSP A;  3SOY A;  2H0G A;  3SXX A;  3DZL A;  5D81 A;  1E97 A;  2YFL B;  4NHF A;  9RNT A;  2F98 A;  1SIH A;  2GEY A;  2QGU A;  1GSP A;  3F8X A;  2O3O A;  1A2K A;  5BXQ A;  1UCJ A;  1A90 A;  1DVD A;  2Y74 A;  2KF6 A;  2FGT A;  3FG3 A;  1RJO A;  3K5T A;  3IMA B;  4O02 B;  1JKG A;  5DRV A;  4ZM8 A;  5HOH A;  2CX0 A;  1IT7 A;  2XSO B;  1AR0 A;  1NWW A;  5A0O B;  2KF3 A;  1STD A;  1MWU A;  3EBY A;  4HM2 B;  4LMI A;  2RFR A;  4WHA A;  5ELJ A;  3PXM A;  1TFO A;  3N54 B;  3OWS A;  2ML6 A;  1BRJ A;  1Q40 B;  1GY5 A;  1LQM B;  3FGY A;  3CCQ 3;  5IEO A;  2W9Q A;  1ULI B;  1GY6 A;  2HMJ B;  3UL6 A;  1IQX A;  2FXT A;  3EF8 A;  4J5G A;  1BGS A;  2W04 A;  4GSP A;  4MMY B;  3RGA A;  1I2E A;  3KN4 A;  3NBR A;  8CHO A;  1Q82 4;  8RNT A;  7STD A;  1VQM 3;  5DRE A;  2XFS A;  1EA2 A;  1UCI A;  1GOY A;  1BAN A;  4HYZ A;  4NRE A;  1T3B A;  3EN8 A;  2AAE A;  3J7Y d;  3B7C A;  4N6M A;  2KAA A;  4FCZ A;  2GU3 A;  4HM6 B;  3ZG0 A;  3FSD A;  3NQZ A;  2IMJ A;  2IUJ A;  2BNG A;  3MYT A;  2C4B A;  1WMN A;  4AKZ A;  1BNI A;  1OHP A;  2K0M A;  3WOF B;  4N3V A;  2WGQ A;  1BRS A;  4TX4 A;  1KD1 4;  3F7X A;  3CCL 3;  1YNV X;  2PNC A;  2CG1 A;  1VQO 3;  3F14 A;  1R4Y A;  2F5M A;  3DH2 A;  2CX1 A;  1W01 A;  2W6J H;  5ELU A;  1KWI A;  2IUK A;  3GZY B;  5LC6 A;  3EB8 A;  4N6T A;  3T8U A;  3I0Y A;  1JZO A;  2W03 A;  1UW1 A;  1HZ1 A;  2HMN B;  2MF7 A;  1N9E A;  1BNR A;  1Q40 A;  3DM8 A;  1UI8 A;  4LSO A;  3GZX B;  1B2S A;  5BIR A;  3CXC 2;  1JBT A;  1BSD A;  1VQ9 3;  2F99 A;  2YFJ B;  4AKY A;  5IG0 A;  5JPP A;  1J2B A;  2BMR B;  1VQQ A;  1FZU A;  1K9M 4;  1US1 A;  6GSP A;  1LRA A;  3Q1C A;  4RZM A;  1Q81 4;  5G2G A;  3HX8 A;  1RN1 A;  2B24 B;  3JUO A;  1D6U A;  1UCK A;  5AIF A;  3GWR A;  4JRF A;  3D5I A;  1TTO A;  3X42 A;  1YVB I;  5RNT A;  1VQ5 3;  1UGH I;  3MSO A;  4CJN A;  4U13 A;  3B8L A;  3KSP A;  1MNL A;  1CEW I;  3BLZ A;  3DGL A;  4GHO A;  2D42 A;  1YJN 3;  1OHO A;  5LC7 A;  5STD A;  3KE7 A;  1QVG 2;  3S28 A;  1I0V A;  3FH1 A;  1YGE A;  4WFO A;  4HKV B;  3LTD A;  3G0K A;  4N6N B;  2E2V A;  4FMD A;  2W2C A;  3LTA A;  4K1U A;  4R9L A;  3BIR A;  1S72 3;  1JZD A;  3BB9 A;  1EUI C;  3OXA A;  1FGO A;  5AI1 A;  3EC9 A;  3CME 3;  3OW2 2;  1I2G A;  1IV9 A;  1BVI A;  2E2T A;  2ZDJ A;  3NBB A;  1N5P A;  1B27 A;  2UX0 A;  2P0X A;  2BMQ B;  3NXJ A;  5IG3 A;  1TFK A;  3A5E A;  4FCJ A;  1N9J A;  2OCT A;  3DXO A;  1RKY A;  2JQ5 A;  1GMR A;  2L1S A;  1JKG B;  2P0M A;  5AII A;  1M1X B;  1W2Z A;  1YJW 3;  4MEI A;  3URP A;  5BVB A;  2XSH B;  5JBS A;  2XRX B;  1DMM A;  1BOX A;  3VGN A;  3G71 3;  1MGW A;  1YJ9 3;  1D6Z A;  4EV2 A;  3FF0 A;  2Q07 A;  1JJ2 2;  3MG3 A;  1B2Z A;  1AVL A;  4HZB B;  3SVA A;  3TDG A;  3MHE A;  1FGM A;  1U5O A;  1SAR A;  4Q53 A;  5IER A;  1WMO A;  4QWT A;  3HOH A;  1K28 A;  1BSC A;  1I70 A;  5D82 A;  1BRI A;  2KXG A;  3AGO A;  5FGO A;  3CCE 3;  3F7S A;  2E2U A;  4LYL B;  1OH0 A;  2F5W A;  2XGN A;  4L8P A;  5IG5 A;  2CHC A;  2XFT A;  4KFD A;  5AYR B;  1EQK A;  1I3I A;  1MWS A;  1E3V A;  3K0Z A;  4RNT A;  4I4K A;  1QAK A;  1GD3 A;  4BTY A;  1G96 A;  1BNF A;  3H3H A;  1ZO2 A;  2KF5 A;  5HGR A;  4XDV A;  1UUV B;  5IEN A;  2QA4 3;  3HIG A;  1BRN L;  3G6E 3;  1X1W A;  5G1K A;  2W9P A;  1LOX A;  1S5A A;  2GBW B;  2H0I A;  4X2H A;  3X3Y A;  3K9M C;  1LQG C;  1OHS A;  2HML B;  2BU4 A;  2GEX A;  3ER7 A;  3LOY A;  4FMA A;  4XDW A;  1V74 A;  2R41 A;  1G02 A;  2UGI A;  1FGQ A;  1JV2 B;  3NV0 A;  3KCH A;  1VQK 3;  1GD4 A;  2Z77 A;  2P38 A;  1NNV A;  2QIY A;  1JN5 A;  1O7H B;  2C10 A;  3JUP A;  1A2V A;  3H51 A;  2I9W A;  3CC4 3;  4ILF A;  1BU4 A;  3DY5 A;  1W4N A;  3WHO A;  2HMK B;  4GL6 A;  1IT8 A;  1KSI A;  5AYS C;  3OWU A;  1RMS A;  1OGZ A;  1IDP A;  1W6Y A;  1MOL A;  1Q7H A;  4XM4 A;  3T8N A;  6STD A;  2RCD A;  7GSP A;  4HAA A;  1O7G B;  2SBL A;  3EHC A;  2RNT A;  4K61 A;  3NM2 A;  1C54 A;  3LML A;  1RGE A;  2LYX A;  3CCS 3;  1NDO B;  2PZV A;  4LEH A;  1ZS7 A;  3PYJ A;  3NX0 A;  1HKX A;  4HBR A;  1AV4 A;  2IYJ A;  3WA3 A;  1T5Y A;  3AMO B;  4O8S A;  4NPB A;  2BO9 B;  4R9K A;  1UI7 A;  1M90 4;  2P09 A;  4BTW A;  4CPK A;  1RHL A;  3EX9 A;  1TJD A;  3FG1 A;  1Y4K A;  3CNM A;  2KRT A;  3UB1 A;  4J8T A;  2ZA4 A;  1LOW A;  5CF2 A;  1RGF A;  1YGW A;  1BNJ A;  3FZW A;  1JB5 A;  1VQ7 3;  1IVU A;  3LT9 A;  3V98 A;  3DUK A;  3SED A;  4HM0 B;  1FUW A;  3NBJ A;  1RSN A;  2B1X B;  2F56 A;  2M7O A;  2W56 A;  3LH4 A;  2KCD A;  5IEP A;  1Z1S A;  3UL5 A;  4OUQ A;  6RNT A;  1BSE A;  3S27 A;  3CNX A;  1MWR A;  3E99 A;  1LNI A;  1ZGX A;  3HK4 A;  3AHS A;  1GY7 A;  1RCK A;  3EE1 A;  3ROB A;  1IU7 A;  1IQ8 A;  3CD6 3;  4MJD A;  1UUG B;  4KFE A;  1MWT A;  4N6O B;  1RGH A;  1W2B 2;  1ISK A;  1BNE A;  2BT3 A;  5BU4 A;  2FNQ A;  1SJW A;  3GZR A;  4K90 B;  1EEJ A;  3MKI A;  1YVS A;  2ZHX B;  2H0H A;  1IVX A;  2OOV A;  3MPH A;  2CIU A;  3EJV A;  3N9H A;  1Q86 4;  2BMO B;  1VQ4 3;  4XBT A;  4IPB A;  1BRG A;  4N6U A;  4JF8 A;  1ASK A;  3X41 A;  3OWY A;  1FUS A;  2L4V A;  1I8V A;  1TP6 A;  1QJG A;  1IVV A;  4L8O A;  5AIH A;  5KP3 A;  1K8A 4;  1NJI 4;  2OQE A;  3PGB A;  1I3F A;  2WO0 A;  4AEQ A;  2Z6B A;  3Q90 A;  4HJL B;  5CXO A;  1NU3 A;  2ML5 A;  4BL2 A;  1GYB A;  3OX9 A;  1ZX2 A;  2MC8 A;  5AIG A;  1KC8 4;  2HMO B;  1LOV A;  1B21 A;  1W00 A;  3AHW A;  4BU4 A;  5I97 A;  3HZP A;  4STD A;  5IF6 A;  1OPY A;  3D79 A;  2F86 B;  4OVM A;  2F4Y A;  3CC7 3;  3GAX A;  4R1K A;  1JB2 A;  3PCR A;  3PZW A;  5G1L A;  3ZG5 A;  1IK3 A;  2CFW A;  1OF5 B;  1JB4 A;  1W7C A;  4EBG A;  1TU5 A;  1Q7Y 4;  3D9R A;  2CFD A;  4R4K A;  1BNG A;  3ALA A;  1E3R A;  3BNC A;  3N8B A;  3NHX A;  5IG4 A;  3CC2 3;  1YIT 3;  4HM7 B;  5GSP A;  1DE3 A;  2LQV A;  1DYU A;  1KQS 2;  4G1M B;  1L5G B;  1HYF A;  1ROV A;  2GXF A;  2RSX A;  3DGO A;  3M8C A;  4RBN A;  4J5K A;  3V99 A;  1GOU A;  1PU4 A;  3CMA 3;  5CF1 A;  2WOF A;  1B20 A;  1V58 A;  2CFG A; 
#chains in the Genus database with same CATH homology
 1CYU A;  4EV5 A;  1JRQ A;  4H3U A;  1OF5 A;  1DMN A;  2K54 A;  1W6G A;  2C11 A;  1SQW A;  1WNH A;  1W02 A;  1OUN A;  4HM3 B;  1EG9 B;  3F40 A;  4BTX A;  1O7N B;  3JUQ A;  5JPU A;  1WMP A;  1O7P B;  1N8Q A;  3I56 3;  3LXU X;  3JUM A;  2XGL A;  3CPW 2;  2INX A;  2V1L A;  4HM5 B;  4IIA A;  4J9A A;  1WQL B;  3KSE D;  3U1W A;  3WMD A;  1CQS A;  1CYV A;  3OV4 A;  3HII A;  3Q2P A;  4HVN A;  3LT8 A;  5KP4 A;  3NUV A;  3BND A;  4OK0 A;  3UNL A;  1FGT A;  3KII A;  3VF1 A;  3G16 A;  3CCV 3;  1RN7 A;  3EQQ B;  4K1V A;  1NB3 I;  3U97 A;  3CCU 3;  2OWP A;  1FA3 A;  1OAC A;  4FMB A;  4N6V 0;  4KVH A;  3LTB A;  4XBY A;  1VQ8 3;  5D83 A;  4MMX B;  4FMC A;  3S5C A;  2JDI H;  3S29 A;  1GS3 A;  1A67 A;  2WGO A;  1VQP 3;  3EBT A;  4MMZ B;  3PS8 A;  4CDL A;  1M1K 4;  1IVW A;  2GU1 A;  5CLK A;  1OGX A;  1RRL A;  1W5Z A;  3X3X A;  3RDE A;  4EXR A;  1IV7 A;  4ORL A;  3WOE B;  2BHM A;  3KFQ C;  4H61 A;  3RGR A;  2W0Q A;  5AEU B;  3GRD A;  1HU9 A;  4RNY A;  4XBX A;  2XF3 A;  3STD A;  1SPU A;  1F8N A;  3LZA A;  5EEO A;  1STF I;  1N5H A;  2XEP A;  1DMQ A;  4LZI A;  2STD A;  2CG0 A;  5EVH A;  3V92 A;  2CH9 A;  3S67 A;  3VSY A;  4X2O A;  2CFL A;  3X3Z A;  1LVN A;  4WYK A;  3JVC A;  4HZ9 B;  3G4S 3;  1K41 A;  2R4I A;  1W6C A;  5EQL A;  2YFI B;  3IPT A;  1U8C B;  5IW9 A;  4WYK B;  3B4O A;  3FG4 A;  4L7K A;  2A15 A;  2D1W A;  5CK6 A;  1YIJ 3;  1IQY A;  1JN5 B;  2W56 B;  1VQN 3;  1EKM A;  2CK3 H;  3LYG A;  4WP5 A;  3T0U A;  1R4C A;  3BNB A;  3DGM A;  4KZ1 A;  5TGN A;  4PEJ A;  4O2H A;  4CCV A;  1YI2 3;  5FW5 A;  1K73 4;  1SII A;  3X40 A;  3MG1 A;  2RGQ A;  2WOH A;  3SLU A;  2P05 A;  1C7H A;  3WDG B;  2XH9 A;  1JNQ A;  1RRH A;  1QMA A;  2CWV A;  3KKG A;  3AMO A;  1QVF 2;  1N8R 4;  2QEX 3;  1DVC A;  3FF2 A;  3QRD A;  3JUN A;  1ROA A;  2IA7 A;  4FCM A;  5KP1 A;  3K63 A;  2CWU A;  3HI7 A;  3ECF A;  4HM1 B;  2CW9 A;  2YX9 A;  1NB5 I;  3D3L A;  1WTH A;  3IJE B;  3O8Y A;  2CC3 A;  2Z76 A;  2CKF B;  3SX1 A;  4HM8 B;  3B4P A;  3CCJ 3;  3QK9 A;  2HMM B;  1VQ6 3;  3PCS A;  4R80 A;  2OOV C;  3FCS B;  1QAL A;  1QAF A;  4WWU C;  1AVK A;  4GB5 A;  3EN1 B;  3CCR 3;  3A76 A;  3K7C A;  2OQE C;  1BUQ A;  3CU3 A;  3WOD G;  1ULJ B;  3G8Z A;  3SOA A;  3NV0 B;  4RNZ A;  3I55 3;  1FGR A;  3MG2 A;  3NM7 A;  4O3V A;  3CCM 3;  1NO3 A;  4EYC A;  1LXE A;  3UJM A;  2OTJ 3;  1PFP A;  3F8H A;  1M9G A;  3DGN A;  1UUW B;  2ZL8 A;  4KFF A;  1OCV A;  3DMC A;  1Q42 A;  2O9U X;  2XR8 B;  2CFK A;  2Z7A A;  2Y73 A;  4FR9 A;  4N6L A;  1TUH A;  4HM4 B;  4LGQ A;  2OTL 3;  1TIJ A;  3L0R A;  3NQY A;  2CWT A;  1O7W B;  3KZT A;  3BNE A;  3LTC A;  3CPO A;  1VQL 3;  1YHQ 3;  4EC6 A;  3FLJ A;  4XB5 A;  1O7M B;  2GBX B;  1LNH A;  3WA2 X;  1D6Y A;  3FKA A;  1VZZ A;  3MWZ A;  3F9S A;  4IT7 A;  5AEW B;  3GZB A;  3SOY A;  3SXX A;  3DZL A;  5D81 A;  1E97 A;  2YFL B;  4NHF A;  2F98 A;  1SIH A;  2GEY A;  2QGU A;  3F8X A;  2O3O A;  1A2K A;  5BXQ A;  1A90 A;  1DVD A;  2Y74 A;  2FGT A;  3FG3 A;  1RJO A;  3K5T A;  3IMA B;  4O02 B;  1JKG A;  5DRV A;  4ZM8 A;  1IT7 A;  2XSO B;  1AR0 A;  1NWW A;  5A0O B;  1STD A;  3EBY A;  4HM2 B;  4LMI A;  2RFR A;  4WHA A;  5ELJ A;  3PXM A;  1TFO A;  3N54 B;  3OWS A;  2ML6 A;  1Q40 B;  3FGY A;  1GY5 A;  3CCQ 3;  5IEO A;  2W9Q A;  1ULI B;  1GY6 A;  2HMJ B;  3UL6 A;  1IQX A;  2FXT A;  3EF8 A;  2W04 A;  4MMY B;  3RGA A;  8CHO A;  3KN4 A;  3NBR A;  1Q82 4;  1VQM 3;  7STD A;  5DRE A;  2XFS A;  1EA2 A;  4HYZ A;  4NRE A;  3EN8 A;  3J7Y d;  3B7C A;  4N6M A;  4FCZ A;  2GU3 A;  4HM6 B;  3FSD A;  3NQZ A;  2IMJ A;  2IUJ A;  2BNG A;  3MYT A;  1WMN A;  4AKZ A;  1OHP A;  2K0M A;  3WOF B;  4N3V A;  2WGQ A;  4TX4 A;  1KD1 4;  3F7X A;  3CCL 3;  2PNC A;  2CG1 A;  1VQO 3;  3F14 A;  1W01 A;  2W6J H;  5ELU A;  1KWI A;  2IUK A;  3GZY B;  5LC6 A;  3EB8 A;  4N6T A;  3T8U A;  3I0Y A;  2W03 A;  1UW1 A;  2HMN B;  2MF7 A;  1N9E A;  1Q40 A;  3DM8 A;  1UI8 A;  4LSO A;  3GZX B;  3CXC 2;  1VQ9 3;  2F99 A;  2YFJ B;  4AKY A;  5IG0 A;  5JPP A;  1J2B A;  2BMR B;  1K9M 4;  1US1 A;  3Q1C A;  4RZM A;  1Q81 4;  5G2G A;  3HX8 A;  2B24 B;  3JUO A;  1D6U A;  5AIF A;  3GWR A;  4JRF A;  3X42 A;  1YVB I;  1VQ5 3;  3MSO A;  4U13 A;  3B8L A;  3KSP A;  1MNL A;  1CEW I;  3BLZ A;  3DGL A;  2D42 A;  1YJN 3;  1OHO A;  5LC7 A;  5STD A;  3KE7 A;  1QVG 2;  3S28 A;  3FH1 A;  1YGE A;  4WFO A;  4HKV B;  3LTD A;  3G0K A;  4N6N B;  2E2V A;  4FMD A;  2W2C A;  3LTA A;  4K1U A;  4R9L A;  1S72 3;  3BB9 A;  3OXA A;  1FGO A;  5AI1 A;  3EC9 A;  3CME 3;  3OW2 2;  1IV9 A;  2E2T A;  2ZDJ A;  3NBB A;  1N5P A;  2UX0 A;  3NXJ A;  2P0X A;  2BMQ B;  5IG3 A;  1TFK A;  4FCJ A;  1N9J A;  2OCT A;  3DXO A;  1RKY A;  2JQ5 A;  2P0M A;  5AII A;  1JKG B;  1M1X B;  1W2Z A;  1YJW 3;  4MEI A;  5BVB A;  2XSH B;  5JBS A;  2XRX B;  1DMM A;  3VGN A;  3G71 3;  1YJ9 3;  1D6Z A;  4EV2 A;  3FF0 A;  2Q07 A;  1JJ2 2;  3MG3 A;  1AVL A;  4HZB B;  3SVA A;  3TDG A;  3MHE A;  1FGM A;  1U5O A;  4Q53 A;  5IER A;  1WMO A;  4QWT A;  1K28 A;  5D82 A;  2KXG A;  5FGO A;  3CCE 3;  3F7S A;  2E2U A;  1OH0 A;  2XGN A;  4L8P A;  5IG5 A;  2CHC A;  2XFT A;  4KFD A;  5AYR B;  1EQK A;  1E3V A;  3K0Z A;  4I4K A;  1QAK A;  1GD3 A;  4BTY A;  1G96 A;  3H3H A;  1ZO2 A;  5HGR A;  4XDV A;  1UUV B;  5IEN A;  2QA4 3;  3HIG A;  3G6E 3;  2W9P A;  1LOX A;  1S5A A;  2GBW B;  4X2H A;  3K9M C;  1OHS A;  2HML B;  2GEX A;  3ER7 A;  3LOY A;  4FMA A;  4XDW A;  1V74 A;  1FGQ A;  1JV2 B;  3NV0 A;  1VQK 3;  1GD4 A;  2Z77 A;  2P38 A;  2QIY A;  1JN5 A;  1O7H B;  2C10 A;  3JUP A;  1A2V A;  3H51 A;  2I9W A;  3CC4 3;  3DY5 A;  1W4N A;  2HMK B;  4GL6 A;  1IT8 A;  1KSI A;  5AYS C;  3OWU A;  1OGZ A;  1IDP A;  1W6Y A;  1MOL A;  4XM4 A;  3T8N A;  6STD A;  2RCD A;  1O7G B;  2SBL A;  3EHC A;  4K61 A;  3NM2 A;  3LML A;  2LYX A;  3CCS 3;  1NDO B;  2PZV A;  4LEH A;  3PYJ A;  3NX0 A;  1HKX A;  4HBR A;  1AV4 A;  3WA3 A;  1T5Y A;  3AMO B;  4O8S A;  4R9K A;  2BO9 B;  1UI7 A;  1M90 4;  2P09 A;  4BTW A;  3EX9 A;  3FG1 A;  1Y4K A;  3CNM A;  2KRT A;  3UB1 A;  4J8T A;  5CF2 A;  3FZW A;  1JB5 A;  1VQ7 3;  1IVU A;  3LT9 A;  3V98 A;  3DUK A;  3SED A;  4HM0 B;  1FUW A;  3NBJ A;  2B1X B;  2M7O A;  2W56 A;  3LH4 A;  2KCD A;  5IEP A;  1Z1S A;  3UL5 A;  4OUQ A;  3S27 A;  3CNX A;  3E99 A;  3HK4 A;  1GY7 A;  3EE1 A;  3ROB A;  1IU7 A;  1IQ8 A;  3CD6 3;  4MJD A;  4KFE A;  4N6O B;  1W2B 2;  1ISK A;  2BT3 A;  2FNQ A;  1SJW A;  3GZR A;  4K90 B;  3MKI A;  1IVX A;  2OOV A;  3MPH A;  2CIU A;  3EJV A;  3N9H A;  1Q86 4;  2BMO B;  1VQ4 3;  4XBT A;  4IPB A;  4N6U A;  4JF8 A;  1ASK A;  3X41 A;  3OWY A;  2L4V A;  1TP6 A;  1QJG A;  1IVV A;  4L8O A;  5AIH A;  5KP3 A;  1K8A 4;  1NJI 4;  2OQE A;  3PGB A;  2WO0 A;  4AEQ A;  2Z6B A;  3Q90 A;  4HJL B;  5CXO A;  1NU3 A;  2ML5 A;  1GYB A;  3OX9 A;  1ZX2 A;  2MC8 A;  5AIG A;  1KC8 4;  2HMO B;  1W00 A;  5I97 A;  3HZP A;  4STD A;  5IF6 A;  1OPY A;  2F86 B;  4OVM A;  3CC7 3;  3GAX A;  4R1K A;  1JB2 A;  3PCR A;  3PZW A;  1IK3 A;  1OF5 B;  1JB4 A;  1W7C A;  2CFW A;  4EBG A;  1TU5 A;  1Q7Y 4;  3D9R A;  2CFD A;  4R4K A;  3ALA A;  1E3R A;  3BNC A;  3N8B A;  3NHX A;  5IG4 A;  3CC2 3;  1YIT 3;  4HM7 B;  2LQV A;  1DYU A;  1KQS 2;  4G1M B;  1L5G B;  1ROV A;  2GXF A;  2RSX A;  3M8C A;  3DGO A;  4RBN A;  3V99 A;  1PU4 A;  3CMA 3;  5CF1 A;  2WOF A;  3X3Y A;  2CFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...