3CCR3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 11
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccr300
1YJN3 1K9M4 3CC43 1VQM3 3CD63 1Q864 1VQO3 3CMA3 1YHQ3 1YJW3 1YIJ3 3CCV3 1VQ53 3CC23 3CME3 1Q824 1QVG2 1Q814 1M1K4 1QVF2 1VQP3 3I553 3CCJ3 2OTJ3 3G4S3 3CCR3 3G6E3 1VQK3 1KC84 2OTL3 1W2B2 3CC73 3CCE3 1YJ93 1NJI4 1VQ43 1JJ22 1K734 1VQN3 3CCQ3 3CCL3 1N8R4 3CCU3 1YIT3 1KQS2 3G713 1K8A4 3CCM3 1VQ93 3CXC2 2QEX3 1Q7Y4 1KD14 3CPW2 1VQL3 3OW22 3CCS3 1M904 3I563 2QA43 1S723 1VQ63 1VQ83 1VQ73 1YI23
chains in the Genus database with same CATH superfamily
2KF5A 1UW1A 3WDGB 3CD63 1A2KA 1N8QA 3PCSA 3J7Yd 1IT8A 5EEOA 3FKAA 3DGNA 3GAXA 2SARA 3JUMA 1BSAA 3NBJA 5AIFA 1Q42A 1FYSA 3SEDA 3F7SA 2XH9A 3VGNA 1W2ZA 1VZZA 3K0ZA 4HAAA 3RGRA 3RNTA 4OK0A 3EX9A 2K54A 1W2B2 3H51A 1MWSA 1UCIA 4LSOA 3UL5A 4RNZA 1RMSA 1E3VA 3EC9A 3CCL3 4ORLA 3GWRA 1BUJA 3HK4A 4WFOA 1RGFA 2HMKB 2IUKA 4GSPA 1W6YA 3STDA 4IT7A 2C10A 3S27A 1BUQA 3FCSB 3FGYA 3LMLA 3LTBA 4HM2B 3DZLA 4GL6A 4I4KA 1OPYA 1YHQ3 2MF7A 1W5ZA 3EF8A 5RNTA 2CH9A 2CW9A 2HMNB 1WTHA 1SPUA 4J5KA 1Q814 3SLUA 8RNTA 1IVWA 3B4PA 1IU7A 4BTXA 2AADA 3HZPA 3CC73 2CX1A 1V58A 1JRQA 3S28A 2CFGA 1Q9EA 2ZHXB 4LGQA 2WOFA 1GD4A 3PXMA 4OVMA 1EKMA 4MMZB 4FMDA 1R4CA 1YVBI 1JN5B 3D3LA 4Q53A 4CPKA 1FGOA 9RNTA 3RDEA 1EUIC 3WODG 2E2TA 1UCJA 2XEPA 3NQZA 1BSDA 1IQ8A 1RRHA 1LXEA 1S5AA 2BMQB 4BIRA 1OHSA 4R1KA 2OQEA 3QK9A 1SQWA 1BRHA 5CLKA 3Q90A 1BANA 3HIGA 1VQ53 2ZA4A 4N6MA 1B2XA 4N6OB 1Q824 1IV9A 1STFI 3BNDA 2OWPA 3G4S3 1CQSA 1JZOA 1STDA 1WMNA 5ELJA 1L5GB 3A76A 1Q40A 1LNIA 4NPBA 1I2EA 4AKZA 4FMCA 1EEJA 3G713 3EJVA 2K3DA 1WNHA 4OUQA 2KF3A 3CNXA 1YVSA 3S5CA 1GOVA 4IIAA 3SVAA 1IYYA 1UUGB 2XSHB 3UJMA 2B1XB 2UUGC 3F7XA 1DE3A 1W01A 3LYGA 2R4IA 3D5GA 1T5YA 1GOUA 3PCRA 1GY5A 1I8VA 3D9RA 4HM4B 2LYXA 1UI7A 1AVKA 1U5OA 5IG4A 3A5EA 3MYTA 4XBXA 1RTUA 5AI1A 2F5WA 3UNLA 1HU9A 2ZL8A 3FG4A 1FW7A 2OTJ3 1IVXA 2SBLA 1LRAA 3EE1A 4R4KA 3FF2A 2F98A 5FGOA 3GZXB 2XFSA 3MPHA 2O3OA 4HM1B 1DVDA 5HGRA 1FA3A 3K5TA 1OF5A 1LNHA 2W2CA 2W6JH 4HBRA 3NV0A 1JB2A 2H0HA 4KT3B 3PS8A 1TTOA 4RNYA 5CF2A 2QIYA 3NM7A 1JKGB 2R41A 3UL6A 3D5IA 1AQZA 4ZM8A 1TP6A 3SOYA 1BOXA 2OOVA 1LOVA 1JV2B 1MNLA 3IJEB 1KWIA 1IVUA 1GY6A 4WYKB 3U1WA 2CWVA 1ZX2A 3BNBA 1GMPA 5IG5A 4U13A 2CWUA 1BNFA 4RBNA 3X3XA 1BRSA 2K0MA 5G1KA 1JN5A 4HZBB 3JUOA 1BU4A 4BU4A 2CX0A 2GU3A 2JQ5A 3CCE3 1YJ93 1MWRA 1QAFA 1NJI4 2Q07A 1RNBA 4HM0B 4CJNA 1DMNA 1UGHI 2XSOB 3CPOA 3AMOA 3KE7A 1MOLA 1R4YA 1K8A4 1O7HB 3DMCA 1X1WA 5DREA 3NBRA 1HZ1A 3MG3A 4R9LA 3U97A 2F4YA 1PYLA 3L0RA 2GBXB 1DYUA 1T3BA 3ZG0A 1BGSA 1WQLB 4N3VA 3S29A 2Z6BA 3CMA3 1WMPA 1WMOA 1C7HA 1ROVA 3EB8A 1ASKA 3PZWA 5AYSC 5BU4A 3BLZA 1Z1SA 1B27A 3X40A 1B3SA 1FGRA 1NB3I 5IF6A 1FGTA 1SIIA 3OWSA 3X3YA 2CFWA 5FW5A 4L8OA 2KRTA 2UX0A 3FG3A 4XBTA 1JJ22 3H3HA 1BAOA 1HKXA 1RJOA 2ZDJA 3LT9A 3KSED 3LXUX 4FMBA 5A0OB 2PNCA 5BVBA 1US1A 1KQS2 3EN8A 5LC7A 1X1UA 3F40A 3AGNA 1SARA 4O02B 3AGOA 1GS3A 2H0GA 1CYVA 5IG0A 1YGWA 4X2HA 2LQVA 1NNVA 1RGHA 3QRDA 1D6YA 1TJDA 1YI23 2FGTA 2L4VA 3CC43 1TFKA 5EQLA 4G1MB 3WA3A 1FUTA 1I3IA 2YFJB 2A15A 2YFLB 3K63A 3OXAA 1A90A 1F8NA 1B20A 4CDLA 2WGQA 5STDA 4BTYA 4EXRA 3GZRA 1ZGXA 1RGCA 2RGQA 1M1K4 2RFRA 1BNJA 2BHMA 1CEWI 2OTL3 5AEWB 3WOEB 2IUJA 1AVLA 4HM3B 5IERA 2L1SA 2INXA 1RCLA 5IEOA 3KN4A 4NHFA 1EG9B 1E97A 1VQQA 3K7CA 1GSPA 1LOYA 2CIUA 1OGXA 1T2IA 5DRVA 1BRKA 3EHCA 3JUQA 2CG1A 2WGOA 1BNIA 4K90B 1K9M4 3VSYA 1NU3A 3OWUA 3PYJA 4HOHA 2Y74A 1DVCA 2HOHA 2IY2A 1B2ZA 2P0MA 1OHOA 2RBIA 2STDA 4R9KA 1YIJ3 3IPTA 1BVIA 1W4NA 1AY7A 7STDA 3N54B 4HM8B 1B2MA 4I5QA 4LZIA 1GD3A 3D79A 3NUVA 2E2VA 2Z7AA 2CFLA 1FUWA 1O7MB 1OH0A 3X3ZA 3NHXA 1A67A 3HOHA 4J8TA 2V1LA 1O7WB 5TGNA 4PEJA 2BMOB 4HVNA 1VQ93 3CU3A 2QEX3 4O3VA 1I3FA 2M7OA 2CFDA 3WHOA 2OQEC 5CF1A 5D81A 3I563 4EW5A 1A2VA 2F56A 1RHLA 1RGLA 3AHWA 1OACA 1B2SA 3GZYB 5AIGA 1IV7A 2OCTA 2C11A 3EQQB 3M8CA 1SIHA 2XFTA 1BRIA 4XB5A 2PZVA 3F9SA 2MC8A 1UDII 1RNTA 3WOFB 3F8HA 1JNQA 1HYFA 4FCMA 2IA7A 1JBSA 1RGGA 2GSPA 1QVF2 3NQYA 1BNEA 2HMJB 5IG3A 3MSOA 3DXOA 1PU4A 3HI7A 1I2FA 2BU4A 2Y73A 3GRDA 3UB1A 7GSPA 5IEPA 5GSPA 4H61A 3NM2A 1O7NB 1BRGA 1JB5A 3HIIA 3DUKA 4N6TA 1ROAA 3OW22 3BNCA 3T8NA 1BSBA 4ILFA 1N9JA 3G16A 3VF1A 1ULIB 3KZTA 5JPUA 3LTDA 2XR8B 1ZO2A 1IK3A 3FZWA 3NBBA 1N9EA 2Z76A 1BNRA 1B2UA 1I70A 4MMXB 5LC6A 4FR9A 1V74A 3ECFA 3G8ZA 2HMLB 3LOYA 4CCVA 3PGBA 1AV4A 1BRJA 1JZDA 4FCJA 3I553 3FG1A 4EC6A 2F86B 4HM6B 3G6E3 2BT3A 1QALA 4WWUC 1K734 3ER7A 4K61A 5M1AA 1N8R4 3ROBA 1TFOA 1ISKA 2GEYA 5ELUA 1UCKA 2W9PA 5AIHA 3WR2A 4BL3A 3GZBA 5I97A 3CXC2 1G0TA 2UGIA 2OOVC 1TRQA 1VQ63 1DETA 3LH4A 3BB9A 3LT8A 8CHOA 1YJN3 1OUNA 1QMAA 4LEHA 3DGOA 5AYRB 4HJLB 2D1WA 2O9UX 2IMJA 1LOXA 1UI8A 1ZS7A 1MGWA 3F8XA 5HOHA 4KFFA 4R80A 5IENA 2P09A 2KF6A 2Z77A 2I9WA 1BSCA 2KF4A 4L7KA 1RDSA 1VQP3 2BIRA 1T2HA 4LYLB 5BXQA 2HMMB 3CCJ3 1KC84 3LZAA 1OCVA 1LOWA 2CKFB 2FNQA 4N6UA 3B8LA 1GOYA 3B7CA 1JBRA 1X1YA 4AKYA 4HZ9B 3CCM3 1MGRA 4H3UA 4EV2A 2WO0A 1X1XA 5G1LA 4RZMA 3N9HA 1Q40B 3SOAA 3SXXA 3Q2PA 4EYCA 1S723 1VQ83 1V57A 4HYZA 4DKIA 4RNTA 4HM5B 3DM8A 1CYUA 1VQO3 1FGMA 1YJW3 1JB4A 1A2PA 2KCDA 2XRXB 1UGIA 5JPPA 1DMMA 1JBTA 1QJGA 2C4BA 3FSDA 3TDGA 1QVG2 3CNMA 1O7GB 2W9QA 3BIRA 1LQMB 1RSNA 3V98A 2RSXA 3DGMA 1GY7A 3CCR3 3G0KA 4KZ1A 2XGLA 2ML5A 1RN1A 1UUVB 4MJDA 5M18A 3CCQ3 1YGEA 5G2GA 4FMAA 3MG2A 3V92A 4WP5A 4NREA 1MWUA 1EA2A 4IPBA 1N5PA 2AAEA 1JKGA 3HX8A 1BNSA 2CFKA 3ZFZA 2W04A 2H0IA 1OF5B 3O8YA 1SJWA 1GMRA 1GYBA 4WYKA 7RNTA 5AEUB 1Q864 3NV0B 1Q7HA 1RN4A 1RN7A 1PY3A 2BO9B 2CHCA 2W0QA 2ML6A 3EBYA 3LTCA 6RNTA 1J2BA 4STDA 3MHEA 4MEIA 3T8UA 2W56B 4LMIA 1W00A 3CME3 1W7CA 2P0XA 3N8BA 4O2HA 3IMAB 3KIIA 3RGAA 3NXJA 3D4AA 1IT7A 3AHSA 3DGYA 4X2OA 2HMOB 3CCU3 4EBGA 2WOHA 4HKVB 4L8PA 1D6UA 3URPA 1KD14 3CPW2 2CWTA 2YX9A 1VQL3 5AIIA 1M904 1LQGC 1IQYA 2JDIH 4N6V0 2CK3H 3AMOB 4J5GA 2RCDA 1VQ73 3MG1A 5KP1A 2KXGA 1IVVA 1C54A 1CH0A 3KKGA 4N6NB 3CC23 3JUNA 5JBSA 3F14A 3KSPA 3CCV3 4BL2A 1BIRA 3WMDA 1RCKA 3FF0A 4EV5A 1I0XA 2BNGA 1RGEA 4KVHA 2GEXA 1RRLA 1ULJB 1GMQA 1OHPA 4FCZA 1AR0A 1TIJA 1VQK3 1LVNA 3WA2X 1FGQA 1RGKA 1NB5I 1BSEA 1VQN3 2P05A 1IQXA 1YNVX 4K1UA 5IW9A 1YIT3 1N5HA 4GB5A 3X41A 2B24B 3K9MC 2KAAA 2XGNA 3EN1B 4QWTA 2RNTA 5D82A 1PFPA 2D42A 1K28A 1NWWA 3S67A 2GXFA 5M19A 3OV4A 3EBTA 1BRNL 4XM4A 3MKIA 2F5MA 3ZG5A 1W02A 3FH1A 4KFDA 1RGAA 3I0YA 2F99A 1NDOB 2QGUA 1Y4KA 2J8XB 5KP4A 1FUSA 3B4OA 1TU5A 1K41A 1RLSA 3OWYA 3X42A 4GHOA 3ALAA 1TRPA 4J9AA 2GU1A 3OX9A 4KFEA 4JF8A 5EVHA 2GBWB 3KFQC 1U8CB 3BU4A 1VQ43 3E99A 1UUWB 2BMRB 2YFIB 5D83A 1G02A 1O7PB 2E2UA 4XDVA 1RKYA 1BNGA 3FLJA 1NO3A 1Q7Y4 2P38A 1TUHA 3NX0A 2CG0A 5CXOA 1W6GA 3DY5A 4HM7B 1D6ZA 3SX1A 1B21A 2W56A 3GSPA 1VQM3 4MMYB 2IYJA 1I0VA 4O8SA 1IDPA 4JRFA 5BIRA 1E3RA 1EQKA 1QAKA 3DH2A 3JVCA 1G96A 3Q1CA 3T0UA 1W6CA 5KP3A 4K1VA 3BNEA 4XBYA 6GSPA 4N6LA 3LTAA 1M1XB 1DMQA 1I2GA 2FXTA 4XDWA 6STDA 1M9GA 3V99A 2W03A 1OGZA 2XF3A 3Q3FA 3DGLA 3MWZA 3KCHA 4WHAA 1FZUA 4AEQA 4BTWA 1UCLA 1MWTA 5CK6A 3SYUA 3CCS3 1KSIA 2CC3A 2QA43 4TX4A 3JUPA
chains in the Genus database with same CATH topology
1UW1A 3WDGB 3CD63 1A2KA 1N8QA 3PCSA 3J7Yd 1IT8A 5EEOA 3FKAA 3DGNA 3GAXA 3JUMA 3NBJA 5AIFA 1Q42A 3SEDA 3F7SA 2XH9A 3VGNA 1W2ZA 1VZZA 3K0ZA 3RGRA 4OK0A 3EX9A 2K54A 1W2B2 3H51A 4LSOA 3UL5A 4RNZA 1E3VA 3EC9A 3CCL3 4ORLA 3GWRA 3HK4A 4WFOA 2HMKB 2IUKA 1W6YA 3STDA 4IT7A 2C10A 3S27A 1BUQA 3FCSB 3FGYA 3LMLA 3LTBA 4HM2B 3DZLA 4GL6A 4I4KA 1OPYA 1YHQ3 2MF7A 1W5ZA 3EF8A 2CH9A 2CW9A 2HMNB 1WTHA 1SPUA 1Q814 3SLUA 1IVWA 3B4PA 1IU7A 4BTXA 3CC73 3HZPA 1JRQA 3S28A 2CFGA 4OVMA 4LGQA 2WOFA 1GD4A 3PXMA 1EKMA 4MMZB 4FMDA 1R4CA 1YVBI 1JN5B 3D3LA 4Q53A 1FGOA 3RDEA 3WODG 2E2TA 2XEPA 3NQZA 1RRHA 1IQ8A 1LXEA 1S5AA 2BMQB 1OHSA 4R1KA 2OQEA 3QK9A 1SQWA 5CLKA 3Q90A 3HIGA 1VQ53 4N6MA 4N6OB 1Q824 1IV9A 1STFI 3BNDA 2OWPA 3G4S3 1CQSA 1STDA 1WMNA 5ELJA 1L5GB 3A76A 1Q40A 4AKZA 4FMCA 3G713 3EJVA 3S5CA 1WNHA 4OUQA 3CNXA 4IIAA 3SVAA 2XSHB 3UJMA 2B1XB 3F7XA 1W01A 3LYGA 2R4IA 1T5YA 3PCRA 1GY5A 3D9RA 5IG4A 4HM4B 2LYXA 1UI7A 1AVKA 1U5OA 3CC23 3MYTA 4XBXA 5AI1A 3UNLA 1HU9A 2ZL8A 3FG4A 2OTJ3 1IVXA 2SBLA 3EE1A 4R4KA 3FF2A 2F98A 5FGOA 3GZXB 2XFSA 3MPHA 2O3OA 4HM1B 1DVDA 5HGRA 1FA3A 3K5TA 1OF5A 1LNHA 2W2CA 2W6JH 4HBRA 3NV0A 1JB2A 3PS8A 4RNYA 5CF2A 2QIYA 3NM7A 1JKGB 3UL6A 4ZM8A 1TP6A 3SOYA 2OOVA 1JV2B 1MNLA 3IJEB 1KWIA 1IVUA 1GY6A 4WYKB 3U1WA 2CWVA 1ZX2A 3BNBA 5IG5A 4U13A 2CWUA 4RBNA 3X3XA 2K0MA 1JN5A 4HZBB 3JUOA 2GU3A 2JQ5A 3CCE3 1YJ93 1NJI4 1QAFA 2Q07A 4HM0B 1DMNA 2XSOB 3CPOA 3AMOA 3KE7A 1MOLA 1K8A4 1O7HB 3DMCA 5DREA 3NBRA 3MG3A 4R9LA 3U97A 3L0RA 2GBXB 1DYUA 1WQLB 4N3VA 3S29A 2Z6BA 3CMA3 1WMPA 1WMOA 1C7HA 1ROVA 3EB8A 1ASKA 3PZWA 5AYSC 3BLZA 1Z1SA 3X40A 1FGRA 1NB3I 5IF6A 1FGTA 1SIIA 3OWSA 3X3YA 2CFWA 5FW5A 4L8OA 2KRTA 2UX0A 3FG3A 4XBTA 1JJ22 3H3HA 1HKXA 1RJOA 4FMBA 2ZDJA 3LT9A 3KSED 3LXUX 1KQS2 5A0OB 2PNCA 5BVBA 1US1A 3EN8A 5LC7A 3F40A 4O02B 1GS3A 5IG0A 1CYVA 4X2HA 2LQVA 3QRDA 1D6YA 1YI23 2FGTA 2L4VA 3CC43 1TFKA 5EQLA 4G1MB 3WA3A 3OXAA 2YFJB 2A15A 2YFLB 3K63A 1A90A 1F8NA 4CDLA 2WGQA 5STDA 4BTYA 4EXRA 3GZRA 1M1K4 2RGQA 2RFRA 2BHMA 1CEWI 2OTL3 5AEWB 3WOEB 2IUJA 1AVLA 4HM3B 5IERA 2INXA 5IEOA 3KN4A 4NHFA 1EG9B 1E97A 3K7CA 2CIUA 1OGXA 5DRVA 3EHCA 3JUQA 2CG1A 2WGOA 4K90B 1K9M4 3VSYA 1NU3A 3OWUA 3PYJA 2Y74A 1DVCA 1YIJ3 2P0MA 2STDA 1OHOA 4R9KA 3IPTA 1W4NA 7STDA 3N54B 4HM8B 4LZIA 1GD3A 3NUVA 2E2VA 2Z7AA 2CFLA 1FUWA 1O7MB 1OH0A 3X3ZA 3NHXA 1A67A 4J8TA 2V1LA 1O7WB 5TGNA 4PEJA 2BMOB 4HVNA 1VQ93 3CU3A 2QEX3 4O3VA 2M7OA 2CFDA 2OQEC 5CF1A 5D81A 3I563 1A2VA 3GZYB 1OACA 5AIGA 1IV7A 2OCTA 2C11A 3EQQB 3M8CA 1SIHA 2XFTA 4XB5A 2PZVA 3F9SA 2MC8A 3WOFB 3F8HA 1JNQA 4FCMA 2IA7A 1QVF2 3NQYA 2HMJB 5IG3A 3MSOA 3DXOA 1PU4A 3HI7A 2Y73A 3GRDA 3UB1A 5IEPA 4H61A 3NM2A 1O7NB 1JB5A 3HIIA 3DUKA 4N6TA 1ROAA 3OW22 3BNCA 3T8NA 1N9JA 3G16A 3VF1A 1ULIB 3KZTA 5JPUA 3LTDA 2XR8B 1ZO2A 1IK3A 3FZWA 3NBBA 1N9EA 2Z76A 4MMXB 5LC6A 4FR9A 1V74A 3ECFA 3G8ZA 2HMLB 3LOYA 4CCVA 3PGBA 1AV4A 4FCJA 3I553 3FG1A 4EC6A 2F86B 4HM6B 3G6E3 2BT3A 1QALA 4WWUC 1K734 3ER7A 4K61A 1N8R4 3ROBA 1TFOA 1ISKA 2GEYA 5ELUA 2W9PA 5AIHA 5I97A 3CXC2 3GZBA 2OOVC 1VQ63 3LH4A 3BB9A 3LT8A 8CHOA 1YJN3 1OUNA 1QMAA 4LEHA 3DGOA 5AYRB 4HJLB 2D1WA 2O9UX 2IMJA 1LOXA 1UI8A 3F8XA 4KFFA 4R80A 5IENA 2P09A 2Z77A 2I9WA 4L7KA 1VQP3 5BXQA 2HMMB 1KC84 3LZAA 1OCVA 2CKFB 2FNQA 4N6UA 3B8LA 3B7CA 4AKYA 4HZ9B 3CCM3 4H3UA 4EV2A 2WO0A 4RZMA 3N9HA 1Q40B 3SOAA 3SXXA 3Q2PA 4EYCA 1S723 1VQ83 4HYZA 4HM5B 3DM8A 1CYUA 1VQO3 1FGMA 1YJW3 1JB4A 2KCDA 2XRXB 5JPPA 1DMMA 1QJGA 3FSDA 1QVG2 3TDGA 3CNMA 1O7GB 2W9QA 3V98A 3CCJ3 3CCR3 2RSXA 3DGMA 1GY7A 3G0KA 4KZ1A 2XGLA 2ML5A 1UUVB 4MJDA 3CCQ3 1YGEA 5G2GA 4FMAA 3MG2A 3V92A 4WP5A 4NREA 4IPBA 1EA2A 1N5PA 1JKGA 3HX8A 2CFKA 2W04A 1OF5B 3O8YA 1SJWA 4WYKA 1GYBA 5AEUB 1Q864 3NV0B 2CHCA 1RN7A 2W0QA 3LTCA 2BO9B 2ML6A 3EBYA 1J2BA 4STDA 3MHEA 4MEIA 3T8UA 2W56B 4LMIA 1W00A 3CME3 1W7CA 2P0XA 3N8BA 4O2HA 3IMAB 3KIIA 3RGAA 3NXJA 1IT7A 4X2OA 2HMOB 3CCU3 4EBGA 2WOHA 4HKVB 4L8PA 1D6UA 1KD14 3CPW2 2CWTA 2YX9A 1VQL3 5AIIA 1M904 1IQYA 2JDIH 4N6V0 2CK3H 3AMOB 1VQ73 2RCDA 3MG1A 5KP1A 2KXGA 1IVVA 3KKGA 4N6NB 3JUNA 5JBSA 3F14A 3KSPA 3CCV3 3WMDA 3FF0A 4EV5A 2BNGA 4KVHA 2GEXA 1RRLA 1ULJB 1OHPA 4FCZA 1AR0A 1TIJA 1VQK3 1LVNA 3WA2X 1FGQA 1NB5I 1VQN3 2P05A 1IQXA 4K1UA 5IW9A 1YIT3 1N5HA 4GB5A 3X41A 2B24B 3K9MC 2XGNA 3EN1B 4QWTA 5D82A 1PFPA 2D42A 1K28A 1NWWA 3S67A 2GXFA 3OV4A 3EBTA 4XM4A 3MKIA 1W02A 3FH1A 4KFDA 3I0YA 2F99A 1NDOB 2QGUA 1Y4KA 5KP4A 1TU5A 3B4OA 1K41A 3OWYA 3X42A 3ALAA 4J9AA 2GU1A 3OX9A 4KFEA 4JF8A 5EVHA 2GBWB 3KFQC 1U8CB 1VQ43 3E99A 1UUWB 2BMRB 2YFIB 5D83A 1O7PB 1RKYA 2E2UA 4XDVA 3FLJA 1NO3A 1Q7Y4 2P38A 1TUHA 3NX0A 2CG0A 5CXOA 1W6GA 3DY5A 4HM7B 1D6ZA 3SX1A 2W56A 1VQM3 4MMYB 4O8SA 1IDPA 4JRFA 1E3RA 1EQKA 1QAKA 3Q1CA 3JVCA 1G96A 3T0UA 1W6CA 5KP3A 4K1VA 3BNEA 4XBYA 4N6LA 3LTAA 1M1XB 1DMQA 2FXTA 4XDWA 6STDA 1M9GA 3V99A 2W03A 1OGZA 2XF3A 3DGLA 3MWZA 4WHAA 4AEQA 4BTWA 3CCS3 5CK6A 1KSIA 2CC3A 2QA43 4TX4A 3JUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN 3;  1K9M 4;  3CC4 3;  1VQM 3;  3CD6 3;  1Q86 4;  1VQO 3;  3CMA 3;  1YHQ 3;  1YJW 3;  1YIJ 3;  3CCV 3;  1VQ5 3;  3CC2 3;  3CME 3;  1Q82 4;  1QVG 2;  1Q81 4;  1M1K 4;  1QVF 2;  1VQP 3;  3I55 3;  3CCJ 3;  2OTJ 3;  3G4S 3;  3CCR 3;  3G6E 3;  1VQK 3;  1KC8 4;  2OTL 3;  1W2B 2;  3CC7 3;  3CCE 3;  1YJ9 3;  1NJI 4;  1VQ4 3;  1JJ2 2;  1K73 4;  1VQN 3;  3CCQ 3;  3CCL 3;  1N8R 4;  3CCU 3;  1YIT 3;  1KQS 2;  3G71 3;  1K8A 4;  3CCM 3;  1VQ9 3;  3CXC 2;  2QEX 3;  1Q7Y 4;  1KD1 4;  3CPW 2;  1VQL 3;  3OW2 2;  3CCS 3;  1M90 4;  3I56 3;  2QA4 3;  1S72 3;  1VQ6 3;  1VQ8 3;  1VQ7 3;  1YI2 3; 
#chains in the Genus database with same CATH topology
 2KF5 A;  1UW1 A;  3WDG B;  3CD6 3;  1A2K A;  1N8Q A;  3PCS A;  3J7Y d;  1IT8 A;  5EEO A;  3FKA A;  3DGN A;  3GAX A;  2SAR A;  3JUM A;  1BSA A;  3NBJ A;  5AIF A;  1Q42 A;  1FYS A;  3SED A;  3F7S A;  2XH9 A;  3VGN A;  1W2Z A;  1VZZ A;  3K0Z A;  4HAA A;  3RGR A;  3RNT A;  4OK0 A;  3EX9 A;  2K54 A;  1W2B 2;  3H51 A;  1MWS A;  1UCI A;  4LSO A;  3UL5 A;  4RNZ A;  1RMS A;  1E3V A;  3EC9 A;  3CCL 3;  4ORL A;  3GWR A;  1BUJ A;  3HK4 A;  4WFO A;  1RGF A;  2HMK B;  2IUK A;  4GSP A;  1W6Y A;  3STD A;  4IT7 A;  2C10 A;  3S27 A;  1BUQ A;  3FCS B;  3FGY A;  3LML A;  3LTB A;  4HM2 B;  3DZL A;  4GL6 A;  4I4K A;  1OPY A;  1YHQ 3;  2MF7 A;  1W5Z A;  3EF8 A;  5RNT A;  2CH9 A;  2CW9 A;  2HMN B;  1WTH A;  1SPU A;  4J5K A;  1Q81 4;  3SLU A;  8RNT A;  1IVW A;  3B4P A;  1IU7 A;  4BTX A;  2AAD A;  3HZP A;  3CC7 3;  2CX1 A;  1V58 A;  1JRQ A;  3S28 A;  2CFG A;  1Q9E A;  2ZHX B;  4LGQ A;  2WOF A;  1GD4 A;  3PXM A;  4OVM A;  1EKM A;  4MMZ B;  4FMD A;  1R4C A;  1YVB I;  1JN5 B;  3D3L A;  4Q53 A;  4CPK A;  1FGO A;  9RNT A;  3RDE A;  1EUI C;  3WOD G;  2E2T A;  1UCJ A;  2XEP A;  3NQZ A;  1BSD A;  1IQ8 A;  1RRH A;  1LXE A;  1S5A A;  2BMQ B;  4BIR A;  1OHS A;  4R1K A;  2OQE A;  3QK9 A;  1SQW A;  1BRH A;  5CLK A;  3Q90 A;  1BAN A;  3HIG A;  1VQ5 3;  2ZA4 A;  4N6M A;  1B2X A;  4N6O B;  1Q82 4;  1IV9 A;  1STF I;  3BND A;  2OWP A;  3G4S 3;  1CQS A;  1JZO A;  1STD A;  1WMN A;  5ELJ A;  1L5G B;  3A76 A;  1Q40 A;  1LNI A;  4NPB A;  1I2E A;  4AKZ A;  4FMC A;  1EEJ A;  3G71 3;  3EJV A;  2K3D A;  1WNH A;  4OUQ A;  2KF3 A;  3CNX A;  1YVS A;  3S5C A;  1GOV A;  4IIA A;  3SVA A;  1IYY A;  1UUG B;  2XSH B;  3UJM A;  2B1X B;  2UUG C;  3F7X A;  1DE3 A;  1W01 A;  3LYG A;  2R4I A;  3D5G A;  1T5Y A;  1GOU A;  3PCR A;  1GY5 A;  1I8V A;  3D9R A;  4HM4 B;  2LYX A;  1UI7 A;  1AVK A;  1U5O A;  5IG4 A;  3A5E A;  3MYT A;  4XBX A;  1RTU A;  5AI1 A;  2F5W A;  3UNL A;  1HU9 A;  2ZL8 A;  3FG4 A;  1FW7 A;  2OTJ 3;  1IVX A;  2SBL A;  1LRA A;  3EE1 A;  4R4K A;  3FF2 A;  2F98 A;  5FGO A;  3GZX B;  2XFS A;  3MPH A;  2O3O A;  4HM1 B;  1DVD A;  5HGR A;  1FA3 A;  3K5T A;  1OF5 A;  1LNH A;  2W2C A;  2W6J H;  4HBR A;  3NV0 A;  1JB2 A;  2H0H A;  4KT3 B;  3PS8 A;  1TTO A;  4RNY A;  5CF2 A;  2QIY A;  3NM7 A;  1JKG B;  2R41 A;  3UL6 A;  3D5I A;  1AQZ A;  4ZM8 A;  1TP6 A;  3SOY A;  1BOX A;  2OOV A;  1LOV A;  1JV2 B;  1MNL A;  3IJE B;  1KWI A;  1IVU A;  1GY6 A;  4WYK B;  3U1W A;  2CWV A;  1ZX2 A;  3BNB A;  1GMP A;  5IG5 A;  4U13 A;  2CWU A;  1BNF A;  4RBN A;  3X3X A;  1BRS A;  2K0M A;  5G1K A;  1JN5 A;  4HZB B;  3JUO A;  1BU4 A;  4BU4 A;  2CX0 A;  2GU3 A;  2JQ5 A;  3CCE 3;  1YJ9 3;  1MWR A;  1QAF A;  1NJI 4;  2Q07 A;  1RNB A;  4HM0 B;  4CJN A;  1DMN A;  1UGH I;  2XSO B;  3CPO A;  3AMO A;  3KE7 A;  1MOL A;  1R4Y A;  1K8A 4;  1O7H B;  3DMC A;  1X1W A;  5DRE A;  3NBR A;  1HZ1 A;  3MG3 A;  4R9L A;  3U97 A;  2F4Y A;  1PYL A;  3L0R A;  2GBX B;  1DYU A;  1T3B A;  3ZG0 A;  1BGS A;  1WQL B;  4N3V A;  3S29 A;  2Z6B A;  3CMA 3;  1WMP A;  1WMO A;  1C7H A;  1ROV A;  3EB8 A;  1ASK A;  3PZW A;  5AYS C;  5BU4 A;  3BLZ A;  1Z1S A;  1B27 A;  3X40 A;  1B3S A;  1FGR A;  1NB3 I;  5IF6 A;  1FGT A;  1SII A;  3OWS A;  3X3Y A;  2CFW A;  5FW5 A;  4L8O A;  2KRT A;  2UX0 A;  3FG3 A;  4XBT A;  1JJ2 2;  3H3H A;  1BAO A;  1HKX A;  1RJO A;  2ZDJ A;  3LT9 A;  3KSE D;  3LXU X;  4FMB A;  5A0O B;  2PNC A;  5BVB A;  1US1 A;  1KQS 2;  3EN8 A;  5LC7 A;  1X1U A;  3F40 A;  3AGN A;  1SAR A;  4O02 B;  3AGO A;  1GS3 A;  2H0G A;  1CYV A;  5IG0 A;  1YGW A;  4X2H A;  2LQV A;  1NNV A;  1RGH A;  3QRD A;  1D6Y A;  1TJD A;  1YI2 3;  2FGT A;  2L4V A;  3CC4 3;  1TFK A;  5EQL A;  4G1M B;  3WA3 A;  1FUT A;  1I3I A;  2YFJ B;  2A15 A;  2YFL B;  3K63 A;  3OXA A;  1A90 A;  1F8N A;  1B20 A;  4CDL A;  2WGQ A;  5STD A;  4BTY A;  4EXR A;  3GZR A;  1ZGX A;  1RGC A;  2RGQ A;  1M1K 4;  2RFR A;  1BNJ A;  2BHM A;  1CEW I;  2OTL 3;  5AEW B;  3WOE B;  2IUJ A;  1AVL A;  4HM3 B;  5IER A;  2L1S A;  2INX A;  1RCL A;  5IEO A;  3KN4 A;  4NHF A;  1EG9 B;  1E97 A;  1VQQ A;  3K7C A;  1GSP A;  1LOY A;  2CIU A;  1OGX A;  1T2I A;  5DRV A;  1BRK A;  3EHC A;  3JUQ A;  2CG1 A;  2WGO A;  1BNI A;  4K90 B;  1K9M 4;  3VSY A;  1NU3 A;  3OWU A;  3PYJ A;  4HOH A;  2Y74 A;  1DVC A;  2HOH A;  2IY2 A;  1B2Z A;  2P0M A;  1OHO A;  2RBI A;  2STD A;  4R9K A;  1YIJ 3;  3IPT A;  1BVI A;  1W4N A;  1AY7 A;  7STD A;  3N54 B;  4HM8 B;  1B2M A;  4I5Q A;  4LZI A;  1GD3 A;  3D79 A;  3NUV A;  2E2V A;  2Z7A A;  2CFL A;  1FUW A;  1O7M B;  1OH0 A;  3X3Z A;  3NHX A;  1A67 A;  3HOH A;  4J8T A;  2V1L A;  1O7W B;  5TGN A;  4PEJ A;  2BMO B;  4HVN A;  1VQ9 3;  3CU3 A;  2QEX 3;  4O3V A;  1I3F A;  2M7O A;  2CFD A;  3WHO A;  2OQE C;  5CF1 A;  5D81 A;  3I56 3;  4EW5 A;  1A2V A;  2F56 A;  1RHL A;  1RGL A;  3AHW A;  1OAC A;  1B2S A;  3GZY B;  5AIG A;  1IV7 A;  2OCT A;  2C11 A;  3EQQ B;  3M8C A;  1SIH A;  2XFT A;  1BRI A;  4XB5 A;  2PZV A;  3F9S A;  2MC8 A;  1UDI I;  1RNT A;  3WOF B;  3F8H A;  1JNQ A;  1HYF A;  4FCM A;  2IA7 A;  1JBS A;  1RGG A;  2GSP A;  1QVF 2;  3NQY A;  1BNE A;  2HMJ B;  5IG3 A;  3MSO A;  3DXO A;  1PU4 A;  3HI7 A;  1I2F A;  2BU4 A;  2Y73 A;  3GRD A;  3UB1 A;  7GSP A;  5IEP A;  5GSP A;  4H61 A;  3NM2 A;  1O7N B;  1BRG A;  1JB5 A;  3HII A;  3DUK A;  4N6T A;  1ROA A;  3OW2 2;  3BNC A;  3T8N A;  1BSB A;  4ILF A;  1N9J A;  3G16 A;  3VF1 A;  1ULI B;  3KZT A;  5JPU A;  3LTD A;  2XR8 B;  1ZO2 A;  1IK3 A;  3FZW A;  3NBB A;  1N9E A;  2Z76 A;  1BNR A;  1B2U A;  1I70 A;  4MMX B;  5LC6 A;  4FR9 A;  1V74 A;  3ECF A;  3G8Z A;  2HML B;  3LOY A;  4CCV A;  3PGB A;  1AV4 A;  1BRJ A;  1JZD A;  4FCJ A;  3I55 3;  3FG1 A;  4EC6 A;  2F86 B;  4HM6 B;  3G6E 3;  2BT3 A;  1QAL A;  4WWU C;  1K73 4;  3ER7 A;  4K61 A;  5M1A A;  1N8R 4;  3ROB A;  1TFO A;  1ISK A;  2GEY A;  5ELU A;  1UCK A;  2W9P A;  5AIH A;  3WR2 A;  4BL3 A;  3GZB A;  5I97 A;  3CXC 2;  1G0T A;  2UGI A;  2OOV C;  1TRQ A;  1VQ6 3;  1DET A;  3LH4 A;  3BB9 A;  3LT8 A;  8CHO A;  1YJN 3;  1OUN A;  1QMA A;  4LEH A;  3DGO A;  5AYR B;  4HJL B;  2D1W A;  2O9U X;  2IMJ A;  1LOX A;  1UI8 A;  1ZS7 A;  1MGW A;  3F8X A;  5HOH A;  4KFF A;  4R80 A;  5IEN A;  2P09 A;  2KF6 A;  2Z77 A;  2I9W A;  1BSC A;  2KF4 A;  4L7K A;  1RDS A;  1VQP 3;  2BIR A;  1T2H A;  4LYL B;  5BXQ A;  2HMM B;  3CCJ 3;  1KC8 4;  3LZA A;  1OCV A;  1LOW A;  2CKF B;  2FNQ A;  4N6U A;  3B8L A;  1GOY A;  3B7C A;  1JBR A;  1X1Y A;  4AKY A;  4HZ9 B;  3CCM 3;  1MGR A;  4H3U A;  4EV2 A;  2WO0 A;  1X1X A;  5G1L A;  4RZM A;  3N9H A;  1Q40 B;  3SOA A;  3SXX A;  3Q2P A;  4EYC A;  1S72 3;  1VQ8 3;  1V57 A;  4HYZ A;  4DKI A;  4RNT A;  4HM5 B;  3DM8 A;  1CYU A;  1VQO 3;  1FGM A;  1YJW 3;  1JB4 A;  1A2P A;  2KCD A;  2XRX B;  1UGI A;  5JPP A;  1DMM A;  1JBT A;  1QJG A;  2C4B A;  3FSD A;  3TDG A;  1QVG 2;  3CNM A;  1O7G B;  2W9Q A;  3BIR A;  1LQM B;  1RSN A;  3V98 A;  2RSX A;  3DGM A;  1GY7 A;  3CCR 3;  3G0K A;  4KZ1 A;  2XGL A;  2ML5 A;  1RN1 A;  1UUV B;  4MJD A;  5M18 A;  3CCQ 3;  1YGE A;  5G2G A;  4FMA A;  3MG2 A;  3V92 A;  4WP5 A;  4NRE A;  1MWU A;  1EA2 A;  4IPB A;  1N5P A;  2AAE A;  1JKG A;  3HX8 A;  1BNS A;  2CFK A;  3ZFZ A;  2W04 A;  2H0I A;  1OF5 B;  3O8Y A;  1SJW A;  1GMR A;  1GYB A;  4WYK A;  7RNT A;  5AEU B;  1Q86 4;  3NV0 B;  1Q7H A;  1RN4 A;  1RN7 A;  1PY3 A;  2BO9 B;  2CHC A;  2W0Q A;  2ML6 A;  3EBY A;  3LTC A;  6RNT A;  1J2B A;  4STD A;  3MHE A;  4MEI A;  3T8U A;  2W56 B;  4LMI A;  1W00 A;  3CME 3;  1W7C A;  2P0X A;  3N8B A;  4O2H A;  3IMA B;  3KII A;  3RGA A;  3NXJ A;  3D4A A;  1IT7 A;  3AHS A;  3DGY A;  4X2O A;  2HMO B;  3CCU 3;  4EBG A;  2WOH A;  4HKV B;  4L8P A;  1D6U A;  3URP A;  1KD1 4;  3CPW 2;  2CWT A;  2YX9 A;  1VQL 3;  5AII A;  1M90 4;  1LQG C;  1IQY A;  2JDI H;  4N6V 0;  2CK3 H;  3AMO B;  4J5G A;  2RCD A;  1VQ7 3;  3MG1 A;  5KP1 A;  2KXG A;  1IVV A;  1C54 A;  1CH0 A;  3KKG A;  4N6N B;  3CC2 3;  3JUN A;  5JBS A;  3F14 A;  3KSP A;  3CCV 3;  4BL2 A;  1BIR A;  3WMD A;  1RCK A;  3FF0 A;  4EV5 A;  1I0X A;  2BNG A;  1RGE A;  4KVH A;  2GEX A;  1RRL A;  1ULJ B;  1GMQ A;  1OHP A;  4FCZ A;  1AR0 A;  1TIJ A;  1VQK 3;  1LVN A;  3WA2 X;  1FGQ A;  1RGK A;  1NB5 I;  1BSE A;  1VQN 3;  2P05 A;  1IQX A;  1YNV X;  4K1U A;  5IW9 A;  1YIT 3;  1N5H A;  4GB5 A;  3X41 A;  2B24 B;  3K9M C;  2KAA A;  2XGN A;  3EN1 B;  4QWT A;  2RNT A;  5D82 A;  1PFP A;  2D42 A;  1K28 A;  1NWW A;  3S67 A;  2GXF A;  5M19 A;  3OV4 A;  3EBT A;  1BRN L;  4XM4 A;  3MKI A;  2F5M A;  3ZG5 A;  1W02 A;  3FH1 A;  4KFD A;  1RGA A;  3I0Y A;  2F99 A;  1NDO B;  2QGU A;  1Y4K A;  2J8X B;  5KP4 A;  1FUS A;  3B4O A;  1TU5 A;  1K41 A;  1RLS A;  3OWY A;  3X42 A;  4GHO A;  3ALA A;  1TRP A;  4J9A A;  2GU1 A;  3OX9 A;  4KFE A;  4JF8 A;  5EVH A;  2GBW B;  3KFQ C;  1U8C B;  3BU4 A;  1VQ4 3;  3E99 A;  1UUW B;  2BMR B;  2YFI B;  5D83 A;  1G02 A;  1O7P B;  2E2U A;  4XDV A;  1RKY A;  1BNG A;  3FLJ A;  1NO3 A;  1Q7Y 4;  2P38 A;  1TUH A;  3NX0 A;  2CG0 A;  5CXO A;  1W6G A;  3DY5 A;  4HM7 B;  1D6Z A;  3SX1 A;  1B21 A;  2W56 A;  3GSP A;  1VQM 3;  4MMY B;  2IYJ A;  1I0V A;  4O8S A;  1IDP A;  4JRF A;  5BIR A;  1E3R A;  1EQK A;  1QAK A;  3DH2 A;  3JVC A;  1G96 A;  3Q1C A;  3T0U A;  1W6C A;  5KP3 A;  4K1V A;  3BNE A;  4XBY A;  6GSP A;  4N6L A;  3LTA A;  1M1X B;  1DMQ A;  1I2G A;  2FXT A;  4XDW A;  6STD A;  1M9G A;  3V99 A;  2W03 A;  1OGZ A;  2XF3 A;  3Q3F A;  3DGL A;  3MWZ A;  3KCH A;  4WHA A;  1FZU A;  4AEQ A;  4BTW A;  1UCL A;  1MWT A;  5CK6 A;  3SYU A;  3CCS 3;  1KSI A;  2CC3 A;  2QA4 3;  4TX4 A;  3JUP A; 
#chains in the Genus database with same CATH homology
 1UW1 A;  3WDG B;  3CD6 3;  1A2K A;  1N8Q A;  3PCS A;  3J7Y d;  1IT8 A;  5EEO A;  3FKA A;  3DGN A;  3GAX A;  3JUM A;  3NBJ A;  5AIF A;  1Q42 A;  3SED A;  3F7S A;  2XH9 A;  3VGN A;  1W2Z A;  1VZZ A;  3K0Z A;  3RGR A;  4OK0 A;  3EX9 A;  2K54 A;  1W2B 2;  3H51 A;  4LSO A;  3UL5 A;  4RNZ A;  1E3V A;  3EC9 A;  3CCL 3;  4ORL A;  3GWR A;  3HK4 A;  4WFO A;  2HMK B;  2IUK A;  1W6Y A;  3STD A;  4IT7 A;  2C10 A;  3S27 A;  1BUQ A;  3FCS B;  3FGY A;  3LML A;  3LTB A;  4HM2 B;  3DZL A;  4GL6 A;  4I4K A;  1OPY A;  1YHQ 3;  2MF7 A;  1W5Z A;  3EF8 A;  2CH9 A;  2CW9 A;  2HMN B;  1WTH A;  1SPU A;  1Q81 4;  3SLU A;  1IVW A;  3B4P A;  1IU7 A;  4BTX A;  3CC7 3;  3HZP A;  1JRQ A;  3S28 A;  2CFG A;  4OVM A;  4LGQ A;  2WOF A;  1GD4 A;  3PXM A;  1EKM A;  4MMZ B;  4FMD A;  1R4C A;  1YVB I;  1JN5 B;  3D3L A;  4Q53 A;  1FGO A;  3RDE A;  3WOD G;  2E2T A;  2XEP A;  3NQZ A;  1RRH A;  1IQ8 A;  1LXE A;  1S5A A;  2BMQ B;  1OHS A;  4R1K A;  2OQE A;  3QK9 A;  1SQW A;  5CLK A;  3Q90 A;  3HIG A;  1VQ5 3;  4N6M A;  4N6O B;  1Q82 4;  1IV9 A;  1STF I;  3BND A;  2OWP A;  3G4S 3;  1CQS A;  1STD A;  1WMN A;  5ELJ A;  1L5G B;  3A76 A;  1Q40 A;  4AKZ A;  4FMC A;  3G71 3;  3EJV A;  3S5C A;  1WNH A;  4OUQ A;  3CNX A;  4IIA A;  3SVA A;  2XSH B;  3UJM A;  2B1X B;  3F7X A;  1W01 A;  3LYG A;  2R4I A;  1T5Y A;  3PCR A;  1GY5 A;  3D9R A;  5IG4 A;  4HM4 B;  2LYX A;  1UI7 A;  1AVK A;  1U5O A;  3CC2 3;  3MYT A;  4XBX A;  5AI1 A;  3UNL A;  1HU9 A;  2ZL8 A;  3FG4 A;  2OTJ 3;  1IVX A;  2SBL A;  3EE1 A;  4R4K A;  3FF2 A;  2F98 A;  5FGO A;  3GZX B;  2XFS A;  3MPH A;  2O3O A;  4HM1 B;  1DVD A;  5HGR A;  1FA3 A;  3K5T A;  1OF5 A;  1LNH A;  2W2C A;  2W6J H;  4HBR A;  3NV0 A;  1JB2 A;  3PS8 A;  4RNY A;  5CF2 A;  2QIY A;  3NM7 A;  1JKG B;  3UL6 A;  4ZM8 A;  1TP6 A;  3SOY A;  2OOV A;  1JV2 B;  1MNL A;  3IJE B;  1KWI A;  1IVU A;  1GY6 A;  4WYK B;  3U1W A;  2CWV A;  1ZX2 A;  3BNB A;  5IG5 A;  4U13 A;  2CWU A;  4RBN A;  3X3X A;  2K0M A;  1JN5 A;  4HZB B;  3JUO A;  2GU3 A;  2JQ5 A;  3CCE 3;  1YJ9 3;  1NJI 4;  1QAF A;  2Q07 A;  4HM0 B;  1DMN A;  2XSO B;  3CPO A;  3AMO A;  3KE7 A;  1MOL A;  1K8A 4;  1O7H B;  3DMC A;  5DRE A;  3NBR A;  3MG3 A;  4R9L A;  3U97 A;  3L0R A;  2GBX B;  1DYU A;  1WQL B;  4N3V A;  3S29 A;  2Z6B A;  3CMA 3;  1WMP A;  1WMO A;  1C7H A;  1ROV A;  3EB8 A;  1ASK A;  3PZW A;  5AYS C;  3BLZ A;  1Z1S A;  3X40 A;  1FGR A;  1NB3 I;  5IF6 A;  1FGT A;  1SII A;  3OWS A;  3X3Y A;  2CFW A;  5FW5 A;  4L8O A;  2KRT A;  2UX0 A;  3FG3 A;  4XBT A;  1JJ2 2;  3H3H A;  1HKX A;  1RJO A;  4FMB A;  2ZDJ A;  3LT9 A;  3KSE D;  3LXU X;  1KQS 2;  5A0O B;  2PNC A;  5BVB A;  1US1 A;  3EN8 A;  5LC7 A;  3F40 A;  4O02 B;  1GS3 A;  5IG0 A;  1CYV A;  4X2H A;  2LQV A;  3QRD A;  1D6Y A;  1YI2 3;  2FGT A;  2L4V A;  3CC4 3;  1TFK A;  5EQL A;  4G1M B;  3WA3 A;  3OXA A;  2YFJ B;  2A15 A;  2YFL B;  3K63 A;  1A90 A;  1F8N A;  4CDL A;  2WGQ A;  5STD A;  4BTY A;  4EXR A;  3GZR A;  1M1K 4;  2RGQ A;  2RFR A;  2BHM A;  1CEW I;  2OTL 3;  5AEW B;  3WOE B;  2IUJ A;  1AVL A;  4HM3 B;  5IER A;  2INX A;  5IEO A;  3KN4 A;  4NHF A;  1EG9 B;  1E97 A;  3K7C A;  2CIU A;  1OGX A;  5DRV A;  3EHC A;  3JUQ A;  2CG1 A;  2WGO A;  4K90 B;  1K9M 4;  3VSY A;  1NU3 A;  3OWU A;  3PYJ A;  2Y74 A;  1DVC A;  1YIJ 3;  2P0M A;  2STD A;  1OHO A;  4R9K A;  3IPT A;  1W4N A;  7STD A;  3N54 B;  4HM8 B;  4LZI A;  1GD3 A;  3NUV A;  2E2V A;  2Z7A A;  2CFL A;  1FUW A;  1O7M B;  1OH0 A;  3X3Z A;  3NHX A;  1A67 A;  4J8T A;  2V1L A;  1O7W B;  5TGN A;  4PEJ A;  2BMO B;  4HVN A;  1VQ9 3;  3CU3 A;  2QEX 3;  4O3V A;  2M7O A;  2CFD A;  2OQE C;  5CF1 A;  5D81 A;  3I56 3;  1A2V A;  3GZY B;  1OAC A;  5AIG A;  1IV7 A;  2OCT A;  2C11 A;  3EQQ B;  3M8C A;  1SIH A;  2XFT A;  4XB5 A;  2PZV A;  3F9S A;  2MC8 A;  3WOF B;  3F8H A;  1JNQ A;  4FCM A;  2IA7 A;  1QVF 2;  3NQY A;  2HMJ B;  5IG3 A;  3MSO A;  3DXO A;  1PU4 A;  3HI7 A;  2Y73 A;  3GRD A;  3UB1 A;  5IEP A;  4H61 A;  3NM2 A;  1O7N B;  1JB5 A;  3HII A;  3DUK A;  4N6T A;  1ROA A;  3OW2 2;  3BNC A;  3T8N A;  1N9J A;  3G16 A;  3VF1 A;  1ULI B;  3KZT A;  5JPU A;  3LTD A;  2XR8 B;  1ZO2 A;  1IK3 A;  3FZW A;  3NBB A;  1N9E A;  2Z76 A;  4MMX B;  5LC6 A;  4FR9 A;  1V74 A;  3ECF A;  3G8Z A;  2HML B;  3LOY A;  4CCV A;  3PGB A;  1AV4 A;  4FCJ A;  3I55 3;  3FG1 A;  4EC6 A;  2F86 B;  4HM6 B;  3G6E 3;  2BT3 A;  1QAL A;  4WWU C;  1K73 4;  3ER7 A;  4K61 A;  1N8R 4;  3ROB A;  1TFO A;  1ISK A;  2GEY A;  5ELU A;  2W9P A;  5AIH A;  5I97 A;  3CXC 2;  3GZB A;  2OOV C;  1VQ6 3;  3LH4 A;  3BB9 A;  3LT8 A;  8CHO A;  1YJN 3;  1OUN A;  1QMA A;  4LEH A;  3DGO A;  5AYR B;  4HJL B;  2D1W A;  2O9U X;  2IMJ A;  1LOX A;  1UI8 A;  3F8X A;  4KFF A;  4R80 A;  5IEN A;  2P09 A;  2Z77 A;  2I9W A;  4L7K A;  1VQP 3;  5BXQ A;  2HMM B;  1KC8 4;  3LZA A;  1OCV A;  2CKF B;  2FNQ A;  4N6U A;  3B8L A;  3B7C A;  4AKY A;  4HZ9 B;  3CCM 3;  4H3U A;  4EV2 A;  2WO0 A;  4RZM A;  3N9H A;  1Q40 B;  3SOA A;  3SXX A;  3Q2P A;  4EYC A;  1S72 3;  1VQ8 3;  4HYZ A;  4HM5 B;  3DM8 A;  1CYU A;  1VQO 3;  1FGM A;  1YJW 3;  1JB4 A;  2KCD A;  2XRX B;  5JPP A;  1DMM A;  1QJG A;  3FSD A;  1QVG 2;  3TDG A;  3CNM A;  1O7G B;  2W9Q A;  3V98 A;  3CCJ 3;  3CCR 3;  2RSX A;  3DGM A;  1GY7 A;  3G0K A;  4KZ1 A;  2XGL A;  2ML5 A;  1UUV B;  4MJD A;  3CCQ 3;  1YGE A;  5G2G A;  4FMA A;  3MG2 A;  3V92 A;  4WP5 A;  4NRE A;  4IPB A;  1EA2 A;  1N5P A;  1JKG A;  3HX8 A;  2CFK A;  2W04 A;  1OF5 B;  3O8Y A;  1SJW A;  4WYK A;  1GYB A;  5AEU B;  1Q86 4;  3NV0 B;  2CHC A;  1RN7 A;  2W0Q A;  3LTC A;  2BO9 B;  2ML6 A;  3EBY A;  1J2B A;  4STD A;  3MHE A;  4MEI A;  3T8U A;  2W56 B;  4LMI A;  1W00 A;  3CME 3;  1W7C A;  2P0X A;  3N8B A;  4O2H A;  3IMA B;  3KII A;  3RGA A;  3NXJ A;  1IT7 A;  4X2O A;  2HMO B;  3CCU 3;  4EBG A;  2WOH A;  4HKV B;  4L8P A;  1D6U A;  1KD1 4;  3CPW 2;  2CWT A;  2YX9 A;  1VQL 3;  5AII A;  1M90 4;  1IQY A;  2JDI H;  4N6V 0;  2CK3 H;  3AMO B;  1VQ7 3;  2RCD A;  3MG1 A;  5KP1 A;  2KXG A;  1IVV A;  3KKG A;  4N6N B;  3JUN A;  5JBS A;  3F14 A;  3KSP A;  3CCV 3;  3WMD A;  3FF0 A;  4EV5 A;  2BNG A;  4KVH A;  2GEX A;  1RRL A;  1ULJ B;  1OHP A;  4FCZ A;  1AR0 A;  1TIJ A;  1VQK 3;  1LVN A;  3WA2 X;  1FGQ A;  1NB5 I;  1VQN 3;  2P05 A;  1IQX A;  4K1U A;  5IW9 A;  1YIT 3;  1N5H A;  4GB5 A;  3X41 A;  2B24 B;  3K9M C;  2XGN A;  3EN1 B;  4QWT A;  5D82 A;  1PFP A;  2D42 A;  1K28 A;  1NWW A;  3S67 A;  2GXF A;  3OV4 A;  3EBT A;  4XM4 A;  3MKI A;  1W02 A;  3FH1 A;  4KFD A;  3I0Y A;  2F99 A;  1NDO B;  2QGU A;  1Y4K A;  5KP4 A;  1TU5 A;  3B4O A;  1K41 A;  3OWY A;  3X42 A;  3ALA A;  4J9A A;  2GU1 A;  3OX9 A;  4KFE A;  4JF8 A;  5EVH A;  2GBW B;  3KFQ C;  1U8C B;  1VQ4 3;  3E99 A;  1UUW B;  2BMR B;  2YFI B;  5D83 A;  1O7P B;  1RKY A;  2E2U A;  4XDV A;  3FLJ A;  1NO3 A;  1Q7Y 4;  2P38 A;  1TUH A;  3NX0 A;  2CG0 A;  5CXO A;  1W6G A;  3DY5 A;  4HM7 B;  1D6Z A;  3SX1 A;  2W56 A;  1VQM 3;  4MMY B;  4O8S A;  1IDP A;  4JRF A;  1E3R A;  1EQK A;  1QAK A;  3Q1C A;  3JVC A;  1G96 A;  3T0U A;  1W6C A;  5KP3 A;  4K1V A;  3BNE A;  4XBY A;  4N6L A;  3LTA A;  1M1X B;  1DMQ A;  2FXT A;  4XDW A;  6STD A;  1M9G A;  3V99 A;  2W03 A;  1OGZ A;  2XF3 A;  3DGL A;  3MWZ A;  4WHA A;  4AEQ A;  4BTW A;  3CCS 3;  5CK6 A;  1KSI A;  2CC3 A;  2QA4 3;  4TX4 A;  3JUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...