2KRTA

Solution nmr structure of a conserved hypothetical membrane lipoprotein obtained from ureaplasma parvum: northeast structural genomics consortium target uur17a (139-239)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
121
Chain Sequence
MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKNGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Conserved hypothetical membrane lipoprotein
publication title NMR Solution Structure of a Conserved Hypothetical Membrane Lipoprotein obtained from Ureaplasma parvum : Northeast Structural Genomics Consortium Target UuR17A (139-239)
rcsb
source organism Ureaplasma parvum
total genus 18
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04200 Lipoprotein_17 Lipoprotein associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.270 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2krtA01
3K63A 3JVCA 2KRTA
chains in the Genus database with same CATH superfamily
1BSBA 2CFWA 1RHLA 4CPKA 3CXC2 4LSOA 2E2VA 1LOYA 1R4YA 3DM8A 1R4CA 1Y4KA 2F5WA 2LQVA 4RNTA 1BRIA 3GZRA 1LVNA 1LOWA 1O7GB 2XFTA 3B8LA 2GBWB 2W9QA 4LEHA 4O02B 3V99A 4R9KA 2GEXA 1KC84 3AMOA 1NNVA 3X3ZA 1OGXA 3BNDA 4HM6B 4HM1B 3KSED 2B1XB 1W2B2 3K63A 3NM2A 1YJ93 1E97A 3AMOB 2YFJB 4HOHA 1K9M4 1VQ53 3SOYA 2AAEA 4IPBA 2IUKA 3B7CA 4ZM8A 2YFIB 3MG3A 3SXXA 1M1K4 1FGQA 1RDSA 2PNCA 1M1XB 1OHOA 3EBTA 3F14A 1BRKA 4BTYA 3KFQC 4EYCA 1WMPA 1JZOA 3OX9A 2W9PA 5D81A 3OWYA 1VQ93 3NBBA 3S67A 1WTHA 2CFDA 4AEQA 3MPHA 4OUQA 1VQM3 2CG0A 3RDEA 2W03A 3NBJA 2XGNA 4GSPA 1W01A 2ML5A 2OQEA 3ROBA 1A67A 2MF7A 2STDA 1O7HB 2Q07A 4R9LA 1IQXA 3WODG 1Q40A 1SJWA 1AR0A 3QRDA 4HVNA 5BVBA 2BNGA 3WR2A 2F56A 2OOVC 1OPYA 2R4IA 1QAFA 2WGOA 1CH0A 1ISKA 3S29A 1Q40B 1UGHI 4H61A 1DMQA 4KFDA 1UI7A 1A90A 2M7OA 3LTBA 1OF5B 2C10A 5HOHA 2MC8A 1I3IA 1B27A 3CU3A 1Z1SA 3PCSA 4N6MA 3Q1CA 1I0XA 1GMPA 1NB3I 2H0HA 2HMKB 3K5TA 1YNVX 4J5KA 3ER7A 1QAKA 2UGIA 1OCVA 4RZMA 5M1AA 1VQ73 2CFKA 1T2IA 3ZFZA 1JBRA 3FG3A 1K734 3FLJA 4J8TA 3F7SA 3ALAA 1ZO2A 2WOHA 2XR8B 3V98A 1N9JA 3X40A 3D9RA 1GMQA 3K0ZA 1NDOB 3DXOA 2L4VA 3LTDA 3MYTA 5ELUA 4K1UA 1FGOA 4GL6A 3K7CA 4GB5A 2CFLA 2Z6BA 3ECFA 4MEIA 3D5IA 1UCJA 3S27A 1BNFA 3LXUX 4WFOA 1T5YA 1FUTA 3SLUA 2CKFB 2YFLB 4GHOA 1RNBA 5AIGA 1AY7A 3DY5A 3NQZA 3KCHA 3RNTA 3AGOA 3FZWA 5KP3A 3OXAA 3GRDA 3EC9A 4XBYA 2FNQA 3HOHA 2F99A 2V1LA 3A5EA 4MMXB 1RGAA 4J9AA 9RNTA 2K3DA 2GU1A 1RJOA 2O3OA 1E3RA 2KF6A 2RFRA 2BHMA 1LOXA 1IV9A 4KT3B 3B4OA 2XEPA 5IERA 1YVBI 2W6JH 1JB4A 3UB1A 3MWZA 4FMCA 1TIJA 3EB8A 3S28A 4STDA 1EA2A 4FCZA 3EN1B 4R1KA 3DUKA 1VQP3 4IIAA 1W4NA 5EVHA 3CME3 3BNEA 4EW5A 1YGWA 1OHPA 2JQ5A 2A15A 2W04A 1ULJB 1LRAA 3NM7A 3BIRA 3NX0A 2F98A 2OOVA 4HM4B 5IG5A 3DGMA 1JRQA 4H3UA 5A0OB 1FGRA 2OCTA 5I97A 1UCIA 1JBTA 3RGAA 1OUNA 2K0MA 1G02A 3NV0A 3ZG5A 1EKMA 1YHQ3 1FA3A 2ZL8A 3CCE3 1DVCA 2KAAA 1LNHA 1TRPA 1BSAA 1N5PA 1RNTA 1MWTA 2ZHXB 3FKAA 3IPTA 1EG9B 1FGMA 1UUGB 3PYJA 4HM2B 1Q7Y4 2W56B 1UI8A 1SPUA 4EXRA 5EQLA 3FF2A 2Z7AA 1FYSA 1VQQA 2ZA4A 3F40A 4WYKA 5AIFA 3CCV3 3I553 1RGHA 1O7PB 1RGCA 2W0QA 1TU5A 4OK0A 1CQSA 1G0TA 3F9SA 7STDA 1TP6A 4KVHA 2KRTA 2F4YA 3LH4A 1UGIA 4LGQA 4FMDA 3TDGA 2OTJ3 3BNBA 2P38A 3SOAA 5BXQA 4J5GA 5GSPA 4R4KA 4BU4A 1C54A 3OWUA 1JB2A 1JB5A 1RGGA 3LOYA 1G96A 3X42A 1X1XA 1RSNA 3X3XA 1S5AA 1M904 1GSPA 1KSIA 3CNMA 1NWWA 4IT7A 5D83A 1VQO3 3CCQ3 2CX1A 1MGWA 3G16A 1W02A 5IEPA 1STDA 1T3BA 3UNLA 4MMZB 1NB5I 1FGTA 4G1MB 4XBXA 3KIIA 2E2TA 1IK3A 1ASKA 4L8PA 5AYSC 2RCDA 4BIRA 3PCRA 1DVDA 2HMMB 3WMDA 1GOYA 1BNEA 2CG1A 1WMOA 3SEDA 4HZ9B 2AADA 1J2BA 3CCS3 4AKYA 3CC73 2BMRB 3T0UA 1FZUA 3BB9A 2B24B 3FG4A 1RGKA 2D1WA 3EBYA 2JDIH 2UX0A 3OW22 1DMNA 2QGUA 1YI23 3DZLA 2LYXA 1S723 3N54B 1D6UA 4HM8B 1UDII 4CDLA 1N5HA 1W5ZA 3IMAB 4N6TA 1W6GA 1VQK3 1LOVA 3L0RA 1ZS7A 3T8UA 3N9HA 2RSXA 1KWIA 3NHXA 2FGTA 1MWUA 3H51A 3URPA 3NUVA 5CF2A 8CHOA 5CK6A 3G713 2GEYA 1EQKA 2L1SA 3LTCA 3IJEB 1Q42A 1UUVB 1DE3A 1YGEA 3PXMA 1TJDA 3GSPA 2KF4A 3NQYA 2KCDA 2QIYA 2IUJA 2FXTA 1STFI 3KE7A 3CCM3 4NHFA 5IEOA 4HM3B 1ROVA 2Z77A 3D4AA 1BRHA 1IVWA 4L8OA 4N6NB 4WHAA 2PZVA 3LTAA 3WOEB 4DKIA 5IG4A 1BRNL 3DGLA 3OWSA 3CCU3 2XH9A 2J8XB 2HMOB 3D5GA 4AKZA 5LC6A 3EE1A 4NPBA 4WP5A 1I70A 3CCR3 4K61A 2RBIA 2O9UX 2HMJB 3D79A 1I3FA 4LZIA 3JUPA 5IW9A 6RNTA 5BIRA 1DMMA 1Q9EA 1Q824 1U8CB 3U97A 1RN7A 5AEWB 1B3SA 1IVXA 3DGOA 3UJMA 1CYUA 1BIRA 1D6YA 4FCMA 1BNSA 3WOFB 3I0YA 3QK9A 5D82A 1C7HA 3FSDA 4HM7B 4KFFA 4N6OB 1IT7A 1SIIA 5M18A 2OWPA 6GSPA 5STDA 1BGSA 1GOUA 2UUGC 2ZDJA 1BUJA 4N3VA 1GD3A 1RLSA 3FGYA 3VF1A 5RNTA 1GS3A 4HM0B 3LZAA 1DETA 5KP1A 1BU4A 2Z76A 1I0VA 4HM5B 1BAOA 1BOXA 3DMCA 4JF8A 3G4S3 5JPPA 1SQWA 3LT9A 5FW5A 3F7XA 3JUMA 4NREA 5LC7A 3HX8A 3O8YA 2YX9A 4KFEA 5AIIA 5AEUB 4PEJA 1RRHA 1X1UA 2CK3H 5AI1A 1BUQA 1JNQA 3BLZA 1BNJA 2GU3A 1US1A 4ILFA 3ZG0A 1YJN3 1QVG2 3LT8A 4RBNA 1BNIA 1JKGA 4XDVA 2XRXB 1ROAA 1VQL3 5CLKA 1F8NA 4HZBB 3CPOA 4RNZA 1VQ43 1KQS2 4O2HA 3SYUA 3EQQB 3RGRA 2XF3A 1AV4A 1HYFA 1RCKA 1TFOA 1JBSA 1I2EA 3SVAA 3EF8A 3MHEA 1FUSA 1IQYA 1LQMB 4HYZA 3KKGA 3NV0B 3DGYA 1IT8A 1SIHA 2GBXB 3MG2A 3OV4A 1YIT3 1DYUA 1LNIA 3G8ZA 4FMAA 4QWTA 1GOVA 3VSYA 3V92A 1N8QA 1BANA 5ELJA 1WNHA 1OGZA 3CCL3 3GZYB 1UW1A 3HI7A 1X1WA 4N6LA 1QVF2 1JJ22 4XDWA 4HBRA 1BSCA 4BL3A 4U13A 4L7KA 2Y73A 2XSHB 1TUHA 2CFGA 2CHCA 4RNYA 2IA7A 4WYKB 1Q7HA 3FH1A 1MGRA 4MJDA 5CF1A 2QEX3 1WMNA 1CYVA 2RNTA 2BT3A 3G6E3 4CJNA 2HOHA 1ULIB 1ZX2A 3EX9A 3N8BA 4XBTA 3JUOA 2INXA 1BSDA 3NBRA 5EEOA 2IYJA 3X41A 2CIUA 3NXJA 3X3YA 3BU4A 2D42A 3WA2X 3HZPA 5AYRB 5M19A 5DRVA 1AQZA 1GYBA 2WOFA 1TTOA 1MOLA 7RNTA 1B2SA 3B4PA 4TX4A 1KD14 1EUIC 1VZZA 1RRLA 2R41A 4LMIA 1I8VA 3A76A 3M8CA 1W00A 1K41A 1OACA 3CCJ3 3SX1A 1X1YA 1JN5A 1BVIA 8RNTA 1UCKA 2GSPA 1IQ8A 1VQN3 2BMOB 2CX0A 1MWRA 1UUWB 2P0XA 1V57A 2HMNB 5JPUA 4N6UA 2RGQA 4I5QA 1IU7A 1RCLA 1RGFA 5G1KA 1JN5B 3KN4A 1B2UA 4XB5A 1YVSA 1A2KA 1Q864 1B2ZA 1N8R4 1U5OA 2CC3A 3EHCA 1I2FA 1MNLA 1IVUA 1EEJA 3WHOA 1UCLA 3CD63 1BNGA 3S5CA 3HK4A 3STDA 3Q90A 2K54A 1OHSA 3PZWA 2CW9A 1AVKA 1WQLB 1K28A 3CC43 1GY5A 1W2ZA 1AVLA 1O7NB 1ZGXA 2F86B 2H0GA 1HKXA 3I563 1RKYA 1IYYA 3GWRA 2XGLA 1OF5A 5FGOA 1V74A 3MSOA 1FUWA 4MMYB 3Q2PA 3JVCA 2ML6A 4X2OA 3Q3FA 5G2GA 3AHSA 1HU9A 2XFSA 2XSOB 3FG1A 5CXOA 5DREA 3WA3A 1RMSA 1NU3A 1L5GB 1QJGA 1PFPA 1V58A 1PY3A 1M9GA 3U1WA 4I4KA 3UL5A 5IF6A 3GZXB 4O3VA 1O7WB 1IDPA 4BL2A 4EBGA 3E99A 1LQGC 2SBLA 7GSPA 4FMBA 3CPW2 3F8XA 1RGEA 3DGNA 4FCJA 4N6V0 4JRFA 1E3VA 3LMLA 1SARA 4O8SA 1CEWI 1TFKA 3PS8A 5TGNA 1B2MA 2WO0A 4HAAA 1B2XA 2GXFA 1PYLA 1W7CA 2C11A 3GAXA 2CWUA 3VGNA 1A2VA 1VQ83 2BU4A 1IVVA 1B20A 1D6ZA 2WGQA 1T2HA 2Y74A 3H3HA 4K90B 2SARA 3F8HA 3K9MC 1PU4A 1B21A 4FR9A 1QMAA 2KXGA 4OVMA 1GY7A 4Q53A 4BTXA 3DH2A 1FW7A 2F5MA 4XM4A 1W6YA 3JUQA 4X2HA 3T8NA 3MG1A 4K1VA 2P05A 1YJW3 3MKIA 1RGLA 3BNCA 1BNRA 4WWUC 1LXEA 3AGNA 3HIGA 3CNXA 1TRQA 2IMJA 3WDGB 3EJVA 1Q814 2KF3A 2CWVA 5IG3A 4CCVA 2OQEC 3G0KA 5KP4A 2QA43 3D3LA 5HGRA 2CH9A 1RN1A 2BO9B 2IY2A 2W2CA 1IV7A 1N9EA 3PGBA 3FCSB 4EC6A 1I2GA 3HIIA 1BRGA 2I9WA 4HKVB 3CMA3 1GY6A 4KZ1A 1JKGB 1RN4A 4R80A 3GZBA 1NJI4 1GMRA 1BSEA 5IENA 1OH0A 1BRJA 3AHWA 4HJLB 4EV5A 1VQ63 2P09A 1JV2B 2CWTA 1O7MB 2BIRA 1GD4A 1A2PA 1HZ1A 3J7Yd 2H0IA 2HMLB 5AIHA 5BU4A 3KSPA 1BRSA 1NO3A 1MWSA 3FF0A 4ORLA 2P0MA 5JBSA 3LYGA 1YIJ3 2BMQB 1W6CA 3JUNA 2C4BA 1JZDA 5G1LA 2OTL3 4BTWA 1QALA 5IG0A 1K8A4 2E2UA 2W56A 2KF5A 3EN8A 6STDA 3KZTA 3CC23 3UL6A 4EV2A 4LYLB 1RTUA
chains in the Genus database with same CATH topology
2CFWA 3CXC2 4LSOA 2E2VA 3DM8A 1R4CA 1Y4KA 2LQVA 3GZRA 1LVNA 1O7GB 2XFTA 3B8LA 2GBWB 2W9QA 4LEHA 4O02B 3V99A 4R9KA 2GEXA 1KC84 3AMOA 3X3ZA 1OGXA 3BNDA 4HM6B 4HM1B 3KSED 2B1XB 1W2B2 3K63A 3NM2A 1YJ93 1E97A 3AMOB 2YFJB 1K9M4 1VQ53 3SOYA 4IPBA 2IUKA 3B7CA 4ZM8A 2YFIB 3MG3A 3SXXA 1M1K4 1FGQA 2PNCA 1M1XB 1OHOA 3EBTA 3F14A 4BTYA 3KFQC 4EYCA 1WMPA 3OX9A 2W9PA 5D81A 3OWYA 1VQ93 3NBBA 3S67A 1WTHA 2CFDA 4AEQA 3MPHA 4OUQA 1VQM3 2CG0A 3RDEA 2W03A 3NBJA 2XGNA 2OQEA 1W01A 2ML5A 3ROBA 1A67A 2MF7A 2STDA 1O7HB 2Q07A 4R9LA 1IQXA 3WODG 1Q40A 1SJWA 1AR0A 3QRDA 4HVNA 5BVBA 2BNGA 2OOVC 1OPYA 2R4IA 1QAFA 2WGOA 1ISKA 3S29A 1Q40B 4H61A 1DMQA 4KFDA 1UI7A 1A90A 2M7OA 3LTBA 1OF5B 2C10A 2MC8A 3CU3A 1Z1SA 3PCSA 4N6MA 3Q1CA 1NB3I 2HMKB 3K5TA 3ER7A 1QAKA 1VQ73 1OCVA 4RZMA 2CFKA 3FG3A 1K734 3FLJA 4J8TA 3F7SA 3ALAA 1ZO2A 2WOHA 2XR8B 3V98A 1N9JA 3X40A 3D9RA 3K0ZA 1NDOB 3DXOA 2L4VA 3LTDA 3MYTA 5ELUA 4K1UA 1FGOA 4GL6A 3K7CA 4GB5A 2CFLA 2Z6BA 3ECFA 4MEIA 3S27A 3LXUX 4WFOA 1T5YA 3SLUA 2CKFB 2YFLB 5AIGA 3DY5A 3NQZA 3FZWA 5KP3A 3OXAA 3GRDA 3EC9A 4XBYA 2FNQA 2F99A 2V1LA 4MMXB 4J9AA 2GU1A 1RJOA 2O3OA 1E3RA 2RFRA 2BHMA 1LOXA 1IV9A 3B4OA 2XEPA 5IERA 1YVBI 2W6JH 1JB4A 3UB1A 3MWZA 4FMCA 1TIJA 3EB8A 3S28A 4STDA 1EA2A 4FCZA 3EN1B 4R1KA 3DUKA 1VQP3 4IIAA 1W4NA 5EVHA 3CME3 3BNEA 1OHPA 2JQ5A 2A15A 2W04A 1ULJB 3NM7A 3NX0A 2F98A 2OOVA 4HM4B 5IG5A 3DGMA 1JRQA 4H3UA 5A0OB 1FGRA 2OCTA 5I97A 1S723 3RGAA 1OUNA 2K0MA 3NV0A 1EKMA 1YHQ3 1FA3A 2ZL8A 3CCE3 1DVCA 1LNHA 1N5PA 3FKAA 3IPTA 3PYJA 1Q7Y4 4HM2B 1EG9B 1FGMA 2W56B 1UI8A 1SPUA 4EXRA 5EQLA 3FF2A 2Z7AA 3F40A 4WYKA 5AIFA 3CCV3 3I553 1O7PB 1TU5A 2W0QA 4OK0A 1CQSA 7STDA 3F9SA 1TP6A 4KVHA 2KRTA 3LH4A 4LGQA 4FMDA 3TDGA 2OTJ3 3BNBA 2P38A 3SOAA 5BXQA 4R4KA 3OWUA 1JB2A 1JB5A 3LOYA 1G96A 3X42A 3X3XA 1S5AA 1M904 3CNMA 1KSIA 4IT7A 1NWWA 5D83A 1VQO3 3CCQ3 3G16A 1W02A 5IEPA 1STDA 3UNLA 1NB5I 4MMZB 1FGTA 4G1MB 4XBXA 3KIIA 2E2TA 1IK3A 1ASKA 4L8PA 5AYSC 2RCDA 3PCRA 1DVDA 2HMMB 3WMDA 2CG1A 1WMOA 3SEDA 4HZ9B 1J2BA 3CCS3 4AKYA 3CC73 2BMRB 3T0UA 3BB9A 2B24B 3FG4A 2D1WA 3EBYA 2JDIH 2UX0A 3OW22 1DMNA 2QGUA 1YI23 3DZLA 2LYXA 3N54B 1D6UA 4HM8B 4CDLA 1N5HA 1W5ZA 3IMAB 4N6TA 1W6GA 1VQK3 3L0RA 3T8UA 3N9HA 2RSXA 1KWIA 3NHXA 2FGTA 3H51A 3NUVA 5CF2A 8CHOA 5CK6A 3G713 2GEYA 1EQKA 3LTCA 3IJEB 1Q42A 1UUVB 1YGEA 3PXMA 3NQYA 2KCDA 2QIYA 2IUJA 2FXTA 1STFI 3KE7A 3CCM3 4NHFA 5IEOA 4HM3B 2Z77A 1ROVA 1IVWA 4L8OA 4N6NB 4WHAA 2PZVA 3LTAA 3WOEB 5IG4A 3DGLA 3OWSA 3CCU3 2XH9A 2HMOB 4AKZA 5LC6A 3EE1A 4WP5A 3CCR3 4K61A 2O9UX 2HMJB 4LZIA 3JUPA 5IW9A 1DMMA 1Q824 1U8CB 3U97A 1RN7A 5AEWB 1IVXA 3DGOA 3UJMA 1CYUA 1D6YA 4FCMA 3WOFB 3I0YA 3QK9A 5D82A 1C7HA 3FSDA 4HM7B 4KFFA 4N6OB 1IT7A 1SIIA 2OWPA 5STDA 2ZDJA 4N3VA 1GD3A 3FGYA 3VF1A 1GS3A 4HM0B 3LZAA 5KP1A 2Z76A 4HM5B 3G4S3 3DMCA 4JF8A 5JPPA 1SQWA 3LT9A 5FW5A 3F7XA 3JUMA 4NREA 5LC7A 3HX8A 3O8YA 2YX9A 4KFEA 5AIIA 5AEUB 4PEJA 1RRHA 2CK3H 5AI1A 1BUQA 1JNQA 3BLZA 2GU3A 1US1A 1YJN3 1QVG2 3LT8A 4RBNA 1JKGA 4XDVA 2XRXB 1ROAA 1VQL3 5CLKA 1F8NA 4HZBB 3CPOA 4RNZA 1VQ43 1KQS2 4O2HA 3EQQB 3RGRA 2XF3A 1AV4A 1TFOA 3SVAA 3EF8A 3MHEA 4HYZA 1IQYA 3KKGA 3NV0B 1IT8A 1SIHA 2GBXB 3MG2A 3OV4A 1YIT3 1DYUA 3G8ZA 4FMAA 4QWTA 3VSYA 3V92A 1N8QA 5ELJA 1WNHA 1OGZA 3CCL3 3GZYB 1UW1A 3HI7A 4N6LA 1QVF2 1JJ22 4XDWA 4HBRA 4U13A 4L7KA 2Y73A 2XSHB 1TUHA 2CFGA 2CHCA 4RNYA 2IA7A 4WYKB 3FH1A 4MJDA 5CF1A 2QEX3 1WMNA 1CYVA 2BT3A 3G6E3 1ULIB 1ZX2A 3EX9A 3N8BA 4XBTA 3JUOA 2INXA 3NBRA 5EEOA 3X41A 2CIUA 3NXJA 3X3YA 2D42A 3WA2X 3HZPA 5AYRB 5DRVA 1GYBA 2WOFA 1MOLA 3B4PA 4TX4A 1KD14 1VZZA 1RRLA 4LMIA 3A76A 3M8CA 3CCJ3 1W00A 1K41A 1OACA 3SX1A 1JN5A 1IQ8A 1VQN3 2BMOB 1UUWB 2P0XA 2HMNB 5JPUA 4N6UA 2RGQA 1IU7A 1JN5B 3KN4A 4XB5A 1A2KA 1Q864 1N8R4 1U5OA 2CC3A 3EHCA 1MNLA 1IVUA 3CD63 3S5CA 3HK4A 3STDA 3Q90A 2K54A 1OHSA 3PZWA 2CW9A 1AVKA 1WQLB 1K28A 3CC43 1GY5A 1W2ZA 1AVLA 1O7NB 2F86B 3I563 1HKXA 1RKYA 3GWRA 2XGLA 1OF5A 5FGOA 1V74A 3MSOA 1FUWA 4MMYB 3Q2PA 3JVCA 2ML6A 4X2OA 5G2GA 1HU9A 2XFSA 2XSOB 3FG1A 5CXOA 5DREA 3WA3A 1NU3A 1L5GB 1QJGA 1PFPA 1M9GA 3U1WA 4I4KA 3UL5A 5IF6A 3GZXB 4O3VA 1O7WB 1IDPA 4EBGA 3E99A 2SBLA 4FMBA 3CPW2 3F8XA 3DGNA 4FCJA 4N6V0 4JRFA 1E3VA 3LMLA 4O8SA 1CEWI 1TFKA 3PS8A 5TGNA 2WO0A 3GAXA 2GXFA 1W7CA 2C11A 1VQ83 2CWUA 3VGNA 1A2VA 1IVVA 1D6ZA 2WGQA 2Y74A 3H3HA 4K90B 3F8HA 3K9MC 1PU4A 4FR9A 1QMAA 2KXGA 4OVMA 1GY7A 4Q53A 4BTXA 4XM4A 1W6YA 3JUQA 4X2HA 3T8NA 3MG1A 4K1VA 2P05A 1YJW3 3MKIA 3BNCA 4WWUC 1LXEA 3HIGA 3CNXA 2IMJA 3WDGB 3EJVA 1Q814 2CWVA 5IG3A 4CCVA 2OQEC 3G0KA 5KP4A 2QA43 3D3LA 5HGRA 2CH9A 2BO9B 2W2CA 4EC6A 3PGBA 1IV7A 3FCSB 3HIIA 4HKVB 2I9WA 3CMA3 1GY6A 4KZ1A 1JKGB 4R80A 3GZBA 1NJI4 5IENA 1OH0A 4HJLB 4EV5A 1VQ63 2P09A 1JV2B 2CWTA 1O7MB 1GD4A 3J7Yd 2HMLB 5AIHA 3KSPA 1NO3A 3FF0A 4ORLA 2P0MA 5JBSA 3LYGA 1YIJ3 2BMQB 1W6CA 3JUNA 2OTL3 4BTWA 1QALA 5IG0A 1K8A4 2E2UA 2W56A 6STDA 3EN8A 3KZTA 3CC23 3UL6A 4EV2A 1N9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K63 A;  3JVC A;  2KRT A; 
#chains in the Genus database with same CATH topology
 1BSB A;  2CFW A;  1RHL A;  4CPK A;  3CXC 2;  4LSO A;  2E2V A;  1LOY A;  1R4Y A;  3DM8 A;  1R4C A;  1Y4K A;  2F5W A;  2LQV A;  4RNT A;  1BRI A;  3GZR A;  1LVN A;  1LOW A;  1O7G B;  2XFT A;  3B8L A;  2GBW B;  2W9Q A;  4LEH A;  4O02 B;  3V99 A;  4R9K A;  2GEX A;  1KC8 4;  3AMO A;  1NNV A;  3X3Z A;  1OGX A;  3BND A;  4HM6 B;  4HM1 B;  3KSE D;  2B1X B;  1W2B 2;  3K63 A;  3NM2 A;  1YJ9 3;  1E97 A;  3AMO B;  2YFJ B;  4HOH A;  1K9M 4;  1VQ5 3;  3SOY A;  2AAE A;  4IPB A;  2IUK A;  3B7C A;  4ZM8 A;  2YFI B;  3MG3 A;  3SXX A;  1M1K 4;  1FGQ A;  1RDS A;  2PNC A;  1M1X B;  1OHO A;  3EBT A;  3F14 A;  1BRK A;  4BTY A;  3KFQ C;  4EYC A;  1WMP A;  1JZO A;  3OX9 A;  2W9P A;  5D81 A;  3OWY A;  1VQ9 3;  3NBB A;  3S67 A;  1WTH A;  2CFD A;  4AEQ A;  3MPH A;  4OUQ A;  1VQM 3;  2CG0 A;  3RDE A;  2W03 A;  3NBJ A;  2XGN A;  4GSP A;  1W01 A;  2ML5 A;  2OQE A;  3ROB A;  1A67 A;  2MF7 A;  2STD A;  1O7H B;  2Q07 A;  4R9L A;  1IQX A;  3WOD G;  1Q40 A;  1SJW A;  1AR0 A;  3QRD A;  4HVN A;  5BVB A;  2BNG A;  3WR2 A;  2F56 A;  2OOV C;  1OPY A;  2R4I A;  1QAF A;  2WGO A;  1CH0 A;  1ISK A;  3S29 A;  1Q40 B;  1UGH I;  4H61 A;  1DMQ A;  4KFD A;  1UI7 A;  1A90 A;  2M7O A;  3LTB A;  1OF5 B;  2C10 A;  5HOH A;  2MC8 A;  1I3I A;  1B27 A;  3CU3 A;  1Z1S A;  3PCS A;  4N6M A;  3Q1C A;  1I0X A;  1GMP A;  1NB3 I;  2H0H A;  2HMK B;  3K5T A;  1YNV X;  4J5K A;  3ER7 A;  1QAK A;  2UGI A;  1OCV A;  4RZM A;  5M1A A;  1VQ7 3;  2CFK A;  1T2I A;  3ZFZ A;  1JBR A;  3FG3 A;  1K73 4;  3FLJ A;  4J8T A;  3F7S A;  3ALA A;  1ZO2 A;  2WOH A;  2XR8 B;  3V98 A;  1N9J A;  3X40 A;  3D9R A;  1GMQ A;  3K0Z A;  1NDO B;  3DXO A;  2L4V A;  3LTD A;  3MYT A;  5ELU A;  4K1U A;  1FGO A;  4GL6 A;  3K7C A;  4GB5 A;  2CFL A;  2Z6B A;  3ECF A;  4MEI A;  3D5I A;  1UCJ A;  3S27 A;  1BNF A;  3LXU X;  4WFO A;  1T5Y A;  1FUT A;  3SLU A;  2CKF B;  2YFL B;  4GHO A;  1RNB A;  5AIG A;  1AY7 A;  3DY5 A;  3NQZ A;  3KCH A;  3RNT A;  3AGO A;  3FZW A;  5KP3 A;  3OXA A;  3GRD A;  3EC9 A;  4XBY A;  2FNQ A;  3HOH A;  2F99 A;  2V1L A;  3A5E A;  4MMX B;  1RGA A;  4J9A A;  9RNT A;  2K3D A;  2GU1 A;  1RJO A;  2O3O A;  1E3R A;  2KF6 A;  2RFR A;  2BHM A;  1LOX A;  1IV9 A;  4KT3 B;  3B4O A;  2XEP A;  5IER A;  1YVB I;  2W6J H;  1JB4 A;  3UB1 A;  3MWZ A;  4FMC A;  1TIJ A;  3EB8 A;  3S28 A;  4STD A;  1EA2 A;  4FCZ A;  3EN1 B;  4R1K A;  3DUK A;  1VQP 3;  4IIA A;  1W4N A;  5EVH A;  3CME 3;  3BNE A;  4EW5 A;  1YGW A;  1OHP A;  2JQ5 A;  2A15 A;  2W04 A;  1ULJ B;  1LRA A;  3NM7 A;  3BIR A;  3NX0 A;  2F98 A;  2OOV A;  4HM4 B;  5IG5 A;  3DGM A;  1JRQ A;  4H3U A;  5A0O B;  1FGR A;  2OCT A;  5I97 A;  1UCI A;  1JBT A;  3RGA A;  1OUN A;  2K0M A;  1G02 A;  3NV0 A;  3ZG5 A;  1EKM A;  1YHQ 3;  1FA3 A;  2ZL8 A;  3CCE 3;  1DVC A;  2KAA A;  1LNH A;  1TRP A;  1BSA A;  1N5P A;  1RNT A;  1MWT A;  2ZHX B;  3FKA A;  3IPT A;  1EG9 B;  1FGM A;  1UUG B;  3PYJ A;  4HM2 B;  1Q7Y 4;  2W56 B;  1UI8 A;  1SPU A;  4EXR A;  5EQL A;  3FF2 A;  2Z7A A;  1FYS A;  1VQQ A;  2ZA4 A;  3F40 A;  4WYK A;  5AIF A;  3CCV 3;  3I55 3;  1RGH A;  1O7P B;  1RGC A;  2W0Q A;  1TU5 A;  4OK0 A;  1CQS A;  1G0T A;  3F9S A;  7STD A;  1TP6 A;  4KVH A;  2KRT A;  2F4Y A;  3LH4 A;  1UGI A;  4LGQ A;  4FMD A;  3TDG A;  2OTJ 3;  3BNB A;  2P38 A;  3SOA A;  5BXQ A;  4J5G A;  5GSP A;  4R4K A;  4BU4 A;  1C54 A;  3OWU A;  1JB2 A;  1JB5 A;  1RGG A;  3LOY A;  1G96 A;  3X42 A;  1X1X A;  1RSN A;  3X3X A;  1S5A A;  1M90 4;  1GSP A;  1KSI A;  3CNM A;  1NWW A;  4IT7 A;  5D83 A;  1VQO 3;  3CCQ 3;  2CX1 A;  1MGW A;  3G16 A;  1W02 A;  5IEP A;  1STD A;  1T3B A;  3UNL A;  4MMZ B;  1NB5 I;  1FGT A;  4G1M B;  4XBX A;  3KII A;  2E2T A;  1IK3 A;  1ASK A;  4L8P A;  5AYS C;  2RCD A;  4BIR A;  3PCR A;  1DVD A;  2HMM B;  3WMD A;  1GOY A;  1BNE A;  2CG1 A;  1WMO A;  3SED A;  4HZ9 B;  2AAD A;  1J2B A;  3CCS 3;  4AKY A;  3CC7 3;  2BMR B;  3T0U A;  1FZU A;  3BB9 A;  2B24 B;  3FG4 A;  1RGK A;  2D1W A;  3EBY A;  2JDI H;  2UX0 A;  3OW2 2;  1DMN A;  2QGU A;  1YI2 3;  3DZL A;  2LYX A;  1S72 3;  3N54 B;  1D6U A;  4HM8 B;  1UDI I;  4CDL A;  1N5H A;  1W5Z A;  3IMA B;  4N6T A;  1W6G A;  1VQK 3;  1LOV A;  3L0R A;  1ZS7 A;  3T8U A;  3N9H A;  2RSX A;  1KWI A;  3NHX A;  2FGT A;  1MWU A;  3H51 A;  3URP A;  3NUV A;  5CF2 A;  8CHO A;  5CK6 A;  3G71 3;  2GEY A;  1EQK A;  2L1S A;  3LTC A;  3IJE B;  1Q42 A;  1UUV B;  1DE3 A;  1YGE A;  3PXM A;  1TJD A;  3GSP A;  2KF4 A;  3NQY A;  2KCD A;  2QIY A;  2IUJ A;  2FXT A;  1STF I;  3KE7 A;  3CCM 3;  4NHF A;  5IEO A;  4HM3 B;  1ROV A;  2Z77 A;  3D4A A;  1BRH A;  1IVW A;  4L8O A;  4N6N B;  4WHA A;  2PZV A;  3LTA A;  3WOE B;  4DKI A;  5IG4 A;  1BRN L;  3DGL A;  3OWS A;  3CCU 3;  2XH9 A;  2J8X B;  2HMO B;  3D5G A;  4AKZ A;  5LC6 A;  3EE1 A;  4NPB A;  4WP5 A;  1I70 A;  3CCR 3;  4K61 A;  2RBI A;  2O9U X;  2HMJ B;  3D79 A;  1I3F A;  4LZI A;  3JUP A;  5IW9 A;  6RNT A;  5BIR A;  1DMM A;  1Q9E A;  1Q82 4;  1U8C B;  3U97 A;  1RN7 A;  5AEW B;  1B3S A;  1IVX A;  3DGO A;  3UJM A;  1CYU A;  1BIR A;  1D6Y A;  4FCM A;  1BNS A;  3WOF B;  3I0Y A;  3QK9 A;  5D82 A;  1C7H A;  3FSD A;  4HM7 B;  4KFF A;  4N6O B;  1IT7 A;  1SII A;  5M18 A;  2OWP A;  6GSP A;  5STD A;  1BGS A;  1GOU A;  2UUG C;  2ZDJ A;  1BUJ A;  4N3V A;  1GD3 A;  1RLS A;  3FGY A;  3VF1 A;  5RNT A;  1GS3 A;  4HM0 B;  3LZA A;  1DET A;  5KP1 A;  1BU4 A;  2Z76 A;  1I0V A;  4HM5 B;  1BAO A;  1BOX A;  3DMC A;  4JF8 A;  3G4S 3;  5JPP A;  1SQW A;  3LT9 A;  5FW5 A;  3F7X A;  3JUM A;  4NRE A;  5LC7 A;  3HX8 A;  3O8Y A;  2YX9 A;  4KFE A;  5AII A;  5AEU B;  4PEJ A;  1RRH A;  1X1U A;  2CK3 H;  5AI1 A;  1BUQ A;  1JNQ A;  3BLZ A;  1BNJ A;  2GU3 A;  1US1 A;  4ILF A;  3ZG0 A;  1YJN 3;  1QVG 2;  3LT8 A;  4RBN A;  1BNI A;  1JKG A;  4XDV A;  2XRX B;  1ROA A;  1VQL 3;  5CLK A;  1F8N A;  4HZB B;  3CPO A;  4RNZ A;  1VQ4 3;  1KQS 2;  4O2H A;  3SYU A;  3EQQ B;  3RGR A;  2XF3 A;  1AV4 A;  1HYF A;  1RCK A;  1TFO A;  1JBS A;  1I2E A;  3SVA A;  3EF8 A;  3MHE A;  1FUS A;  1IQY A;  1LQM B;  4HYZ A;  3KKG A;  3NV0 B;  3DGY A;  1IT8 A;  1SIH A;  2GBX B;  3MG2 A;  3OV4 A;  1YIT 3;  1DYU A;  1LNI A;  3G8Z A;  4FMA A;  4QWT A;  1GOV A;  3VSY A;  3V92 A;  1N8Q A;  1BAN A;  5ELJ A;  1WNH A;  1OGZ A;  3CCL 3;  3GZY B;  1UW1 A;  3HI7 A;  1X1W A;  4N6L A;  1QVF 2;  1JJ2 2;  4XDW A;  4HBR A;  1BSC A;  4BL3 A;  4U13 A;  4L7K A;  2Y73 A;  2XSH B;  1TUH A;  2CFG A;  2CHC A;  4RNY A;  2IA7 A;  4WYK B;  1Q7H A;  3FH1 A;  1MGR A;  4MJD A;  5CF1 A;  2QEX 3;  1WMN A;  1CYV A;  2RNT A;  2BT3 A;  3G6E 3;  4CJN A;  2HOH A;  1ULI B;  1ZX2 A;  3EX9 A;  3N8B A;  4XBT A;  3JUO A;  2INX A;  1BSD A;  3NBR A;  5EEO A;  2IYJ A;  3X41 A;  2CIU A;  3NXJ A;  3X3Y A;  3BU4 A;  2D42 A;  3WA2 X;  3HZP A;  5AYR B;  5M19 A;  5DRV A;  1AQZ A;  1GYB A;  2WOF A;  1TTO A;  1MOL A;  7RNT A;  1B2S A;  3B4P A;  4TX4 A;  1KD1 4;  1EUI C;  1VZZ A;  1RRL A;  2R41 A;  4LMI A;  1I8V A;  3A76 A;  3M8C A;  1W00 A;  1K41 A;  1OAC A;  3CCJ 3;  3SX1 A;  1X1Y A;  1JN5 A;  1BVI A;  8RNT A;  1UCK A;  2GSP A;  1IQ8 A;  1VQN 3;  2BMO B;  2CX0 A;  1MWR A;  1UUW B;  2P0X A;  1V57 A;  2HMN B;  5JPU A;  4N6U A;  2RGQ A;  4I5Q A;  1IU7 A;  1RCL A;  1RGF A;  5G1K A;  1JN5 B;  3KN4 A;  1B2U A;  4XB5 A;  1YVS A;  1A2K A;  1Q86 4;  1B2Z A;  1N8R 4;  1U5O A;  2CC3 A;  3EHC A;  1I2F A;  1MNL A;  1IVU A;  1EEJ A;  3WHO A;  1UCL A;  3CD6 3;  1BNG A;  3S5C A;  3HK4 A;  3STD A;  3Q90 A;  2K54 A;  1OHS A;  3PZW A;  2CW9 A;  1AVK A;  1WQL B;  1K28 A;  3CC4 3;  1GY5 A;  1W2Z A;  1AVL A;  1O7N B;  1ZGX A;  2F86 B;  2H0G A;  1HKX A;  3I56 3;  1RKY A;  1IYY A;  3GWR A;  2XGL A;  1OF5 A;  5FGO A;  1V74 A;  3MSO A;  1FUW A;  4MMY B;  3Q2P A;  3JVC A;  2ML6 A;  4X2O A;  3Q3F A;  5G2G A;  3AHS A;  1HU9 A;  2XFS A;  2XSO B;  3FG1 A;  5CXO A;  5DRE A;  3WA3 A;  1RMS A;  1NU3 A;  1L5G B;  1QJG A;  1PFP A;  1V58 A;  1PY3 A;  1M9G A;  3U1W A;  4I4K A;  3UL5 A;  5IF6 A;  3GZX B;  4O3V A;  1O7W B;  1IDP A;  4BL2 A;  4EBG A;  3E99 A;  1LQG C;  2SBL A;  7GSP A;  4FMB A;  3CPW 2;  3F8X A;  1RGE A;  3DGN A;  4FCJ A;  4N6V 0;  4JRF A;  1E3V A;  3LML A;  1SAR A;  4O8S A;  1CEW I;  1TFK A;  3PS8 A;  5TGN A;  1B2M A;  2WO0 A;  4HAA A;  1B2X A;  2GXF A;  1PYL A;  1W7C A;  2C11 A;  3GAX A;  2CWU A;  3VGN A;  1A2V A;  1VQ8 3;  2BU4 A;  1IVV A;  1B20 A;  1D6Z A;  2WGQ A;  1T2H A;  2Y74 A;  3H3H A;  4K90 B;  2SAR A;  3F8H A;  3K9M C;  1PU4 A;  1B21 A;  4FR9 A;  1QMA A;  2KXG A;  4OVM A;  1GY7 A;  4Q53 A;  4BTX A;  3DH2 A;  1FW7 A;  2F5M A;  4XM4 A;  1W6Y A;  3JUQ A;  4X2H A;  3T8N A;  3MG1 A;  4K1V A;  2P05 A;  1YJW 3;  3MKI A;  1RGL A;  3BNC A;  1BNR A;  4WWU C;  1LXE A;  3AGN A;  3HIG A;  3CNX A;  1TRQ A;  2IMJ A;  3WDG B;  3EJV A;  1Q81 4;  2KF3 A;  2CWV A;  5IG3 A;  4CCV A;  2OQE C;  3G0K A;  5KP4 A;  2QA4 3;  3D3L A;  5HGR A;  2CH9 A;  1RN1 A;  2BO9 B;  2IY2 A;  2W2C A;  1IV7 A;  1N9E A;  3PGB A;  3FCS B;  4EC6 A;  1I2G A;  3HII A;  1BRG A;  2I9W A;  4HKV B;  3CMA 3;  1GY6 A;  4KZ1 A;  1JKG B;  1RN4 A;  4R80 A;  3GZB A;  1NJI 4;  1GMR A;  1BSE A;  5IEN A;  1OH0 A;  1BRJ A;  3AHW A;  4HJL B;  4EV5 A;  1VQ6 3;  2P09 A;  1JV2 B;  2CWT A;  1O7M B;  2BIR A;  1GD4 A;  1A2P A;  1HZ1 A;  3J7Y d;  2H0I A;  2HML B;  5AIH A;  5BU4 A;  3KSP A;  1BRS A;  1NO3 A;  1MWS A;  3FF0 A;  4ORL A;  2P0M A;  5JBS A;  3LYG A;  1YIJ 3;  2BMQ B;  1W6C A;  3JUN A;  2C4B A;  1JZD A;  5G1L A;  2OTL 3;  4BTW A;  1QAL A;  5IG0 A;  1K8A 4;  2E2U A;  2W56 A;  2KF5 A;  3EN8 A;  6STD A;  3KZT A;  3CC2 3;  3UL6 A;  4EV2 A;  4LYL B;  1RTU A; 
#chains in the Genus database with same CATH homology
 2CFW A;  3CXC 2;  4LSO A;  2E2V A;  3DM8 A;  1R4C A;  1Y4K A;  2LQV A;  3GZR A;  1LVN A;  1O7G B;  2XFT A;  3B8L A;  2GBW B;  2W9Q A;  4LEH A;  4O02 B;  3V99 A;  4R9K A;  2GEX A;  1KC8 4;  3AMO A;  3X3Z A;  1OGX A;  3BND A;  4HM6 B;  4HM1 B;  3KSE D;  2B1X B;  1W2B 2;  3K63 A;  3NM2 A;  1YJ9 3;  1E97 A;  3AMO B;  2YFJ B;  1K9M 4;  1VQ5 3;  3SOY A;  4IPB A;  2IUK A;  3B7C A;  4ZM8 A;  2YFI B;  3MG3 A;  3SXX A;  1M1K 4;  1FGQ A;  2PNC A;  1M1X B;  1OHO A;  3EBT A;  3F14 A;  4BTY A;  3KFQ C;  4EYC A;  1WMP A;  3OX9 A;  2W9P A;  5D81 A;  3OWY A;  1VQ9 3;  3NBB A;  3S67 A;  1WTH A;  2CFD A;  4AEQ A;  3MPH A;  4OUQ A;  1VQM 3;  2CG0 A;  3RDE A;  2W03 A;  3NBJ A;  2XGN A;  2OQE A;  1W01 A;  2ML5 A;  3ROB A;  1A67 A;  2MF7 A;  2STD A;  1O7H B;  2Q07 A;  4R9L A;  1IQX A;  3WOD G;  1Q40 A;  1SJW A;  1AR0 A;  3QRD A;  4HVN A;  5BVB A;  2BNG A;  2OOV C;  1OPY A;  2R4I A;  1QAF A;  2WGO A;  1ISK A;  3S29 A;  1Q40 B;  4H61 A;  1DMQ A;  4KFD A;  1UI7 A;  1A90 A;  2M7O A;  3LTB A;  1OF5 B;  2C10 A;  2MC8 A;  3CU3 A;  1Z1S A;  3PCS A;  4N6M A;  3Q1C A;  1NB3 I;  2HMK B;  3K5T A;  3ER7 A;  1QAK A;  1VQ7 3;  1OCV A;  4RZM A;  2CFK A;  3FG3 A;  1K73 4;  3FLJ A;  4J8T A;  3F7S A;  3ALA A;  1ZO2 A;  2WOH A;  2XR8 B;  3V98 A;  1N9J A;  3X40 A;  3D9R A;  3K0Z A;  1NDO B;  3DXO A;  2L4V A;  3LTD A;  3MYT A;  5ELU A;  4K1U A;  1FGO A;  4GL6 A;  3K7C A;  4GB5 A;  2CFL A;  2Z6B A;  3ECF A;  4MEI A;  3S27 A;  3LXU X;  4WFO A;  1T5Y A;  3SLU A;  2CKF B;  2YFL B;  5AIG A;  3DY5 A;  3NQZ A;  3FZW A;  5KP3 A;  3OXA A;  3GRD A;  3EC9 A;  4XBY A;  2FNQ A;  2F99 A;  2V1L A;  4MMX B;  4J9A A;  2GU1 A;  1RJO A;  2O3O A;  1E3R A;  2RFR A;  2BHM A;  1LOX A;  1IV9 A;  3B4O A;  2XEP A;  5IER A;  1YVB I;  2W6J H;  1JB4 A;  3UB1 A;  3MWZ A;  4FMC A;  1TIJ A;  3EB8 A;  3S28 A;  4STD A;  1EA2 A;  4FCZ A;  3EN1 B;  4R1K A;  3DUK A;  1VQP 3;  4IIA A;  1W4N A;  5EVH A;  3CME 3;  3BNE A;  1OHP A;  2JQ5 A;  2A15 A;  2W04 A;  1ULJ B;  3NM7 A;  3NX0 A;  2F98 A;  2OOV A;  4HM4 B;  5IG5 A;  3DGM A;  1JRQ A;  4H3U A;  5A0O B;  1FGR A;  2OCT A;  5I97 A;  1S72 3;  3RGA A;  1OUN A;  2K0M A;  3NV0 A;  1EKM A;  1YHQ 3;  1FA3 A;  2ZL8 A;  3CCE 3;  1DVC A;  1LNH A;  1N5P A;  3FKA A;  3IPT A;  3PYJ A;  1Q7Y 4;  4HM2 B;  1EG9 B;  1FGM A;  2W56 B;  1UI8 A;  1SPU A;  4EXR A;  5EQL A;  3FF2 A;  2Z7A A;  3F40 A;  4WYK A;  5AIF A;  3CCV 3;  3I55 3;  1O7P B;  1TU5 A;  2W0Q A;  4OK0 A;  1CQS A;  7STD A;  3F9S A;  1TP6 A;  4KVH A;  2KRT A;  3LH4 A;  4LGQ A;  4FMD A;  3TDG A;  2OTJ 3;  3BNB A;  2P38 A;  3SOA A;  5BXQ A;  4R4K A;  3OWU A;  1JB2 A;  1JB5 A;  3LOY A;  1G96 A;  3X42 A;  3X3X A;  1S5A A;  1M90 4;  3CNM A;  1KSI A;  4IT7 A;  1NWW A;  5D83 A;  1VQO 3;  3CCQ 3;  3G16 A;  1W02 A;  5IEP A;  1STD A;  3UNL A;  1NB5 I;  4MMZ B;  1FGT A;  4G1M B;  4XBX A;  3KII A;  2E2T A;  1IK3 A;  1ASK A;  4L8P A;  5AYS C;  2RCD A;  3PCR A;  1DVD A;  2HMM B;  3WMD A;  2CG1 A;  1WMO A;  3SED A;  4HZ9 B;  1J2B A;  3CCS 3;  4AKY A;  3CC7 3;  2BMR B;  3T0U A;  3BB9 A;  2B24 B;  3FG4 A;  2D1W A;  3EBY A;  2JDI H;  2UX0 A;  3OW2 2;  1DMN A;  2QGU A;  1YI2 3;  3DZL A;  2LYX A;  3N54 B;  1D6U A;  4HM8 B;  4CDL A;  1N5H A;  1W5Z A;  3IMA B;  4N6T A;  1W6G A;  1VQK 3;  3L0R A;  3T8U A;  3N9H A;  2RSX A;  1KWI A;  3NHX A;  2FGT A;  3H51 A;  3NUV A;  5CF2 A;  8CHO A;  5CK6 A;  3G71 3;  2GEY A;  1EQK A;  3LTC A;  3IJE B;  1Q42 A;  1UUV B;  1YGE A;  3PXM A;  3NQY A;  2KCD A;  2QIY A;  2IUJ A;  2FXT A;  1STF I;  3KE7 A;  3CCM 3;  4NHF A;  5IEO A;  4HM3 B;  2Z77 A;  1ROV A;  1IVW A;  4L8O A;  4N6N B;  4WHA A;  2PZV A;  3LTA A;  3WOE B;  5IG4 A;  3DGL A;  3OWS A;  3CCU 3;  2XH9 A;  2HMO B;  4AKZ A;  5LC6 A;  3EE1 A;  4WP5 A;  3CCR 3;  4K61 A;  2O9U X;  2HMJ B;  4LZI A;  3JUP A;  5IW9 A;  1DMM A;  1Q82 4;  1U8C B;  3U97 A;  1RN7 A;  5AEW B;  1IVX A;  3DGO A;  3UJM A;  1CYU A;  1D6Y A;  4FCM A;  3WOF B;  3I0Y A;  3QK9 A;  5D82 A;  1C7H A;  3FSD A;  4HM7 B;  4KFF A;  4N6O B;  1IT7 A;  1SII A;  2OWP A;  5STD A;  2ZDJ A;  4N3V A;  1GD3 A;  3FGY A;  3VF1 A;  1GS3 A;  4HM0 B;  3LZA A;  5KP1 A;  2Z76 A;  4HM5 B;  3G4S 3;  3DMC A;  4JF8 A;  5JPP A;  1SQW A;  3LT9 A;  5FW5 A;  3F7X A;  3JUM A;  4NRE A;  5LC7 A;  3HX8 A;  3O8Y A;  2YX9 A;  4KFE A;  5AII A;  5AEU B;  4PEJ A;  1RRH A;  2CK3 H;  5AI1 A;  1BUQ A;  1JNQ A;  3BLZ A;  2GU3 A;  1US1 A;  1YJN 3;  1QVG 2;  3LT8 A;  4RBN A;  1JKG A;  4XDV A;  2XRX B;  1ROA A;  1VQL 3;  5CLK A;  1F8N A;  4HZB B;  3CPO A;  4RNZ A;  1VQ4 3;  1KQS 2;  4O2H A;  3EQQ B;  3RGR A;  2XF3 A;  1AV4 A;  1TFO A;  3SVA A;  3EF8 A;  3MHE A;  4HYZ A;  1IQY A;  3KKG A;  3NV0 B;  1IT8 A;  1SIH A;  2GBX B;  3MG2 A;  3OV4 A;  1YIT 3;  1DYU A;  3G8Z A;  4FMA A;  4QWT A;  3VSY A;  3V92 A;  1N8Q A;  5ELJ A;  1WNH A;  1OGZ A;  3CCL 3;  3GZY B;  1UW1 A;  3HI7 A;  4N6L A;  1QVF 2;  1JJ2 2;  4XDW A;  4HBR A;  4U13 A;  4L7K A;  2Y73 A;  2XSH B;  1TUH A;  2CFG A;  2CHC A;  4RNY A;  2IA7 A;  4WYK B;  3FH1 A;  4MJD A;  5CF1 A;  2QEX 3;  1WMN A;  1CYV A;  2BT3 A;  3G6E 3;  1ULI B;  1ZX2 A;  3EX9 A;  3N8B A;  4XBT A;  3JUO A;  2INX A;  3NBR A;  5EEO A;  3X41 A;  2CIU A;  3NXJ A;  3X3Y A;  2D42 A;  3WA2 X;  3HZP A;  5AYR B;  5DRV A;  1GYB A;  2WOF A;  1MOL A;  3B4P A;  4TX4 A;  1KD1 4;  1VZZ A;  1RRL A;  4LMI A;  3A76 A;  3M8C A;  3CCJ 3;  1W00 A;  1K41 A;  1OAC A;  3SX1 A;  1JN5 A;  1IQ8 A;  1VQN 3;  2BMO B;  1UUW B;  2P0X A;  2HMN B;  5JPU A;  4N6U A;  2RGQ A;  1IU7 A;  1JN5 B;  3KN4 A;  4XB5 A;  1A2K A;  1Q86 4;  1N8R 4;  1U5O A;  2CC3 A;  3EHC A;  1MNL A;  1IVU A;  3CD6 3;  3S5C A;  3HK4 A;  3STD A;  3Q90 A;  2K54 A;  1OHS A;  3PZW A;  2CW9 A;  1AVK A;  1WQL B;  1K28 A;  3CC4 3;  1GY5 A;  1W2Z A;  1AVL A;  1O7N B;  2F86 B;  3I56 3;  1HKX A;  1RKY A;  3GWR A;  2XGL A;  1OF5 A;  5FGO A;  1V74 A;  3MSO A;  1FUW A;  4MMY B;  3Q2P A;  3JVC A;  2ML6 A;  4X2O A;  5G2G A;  1HU9 A;  2XFS A;  2XSO B;  3FG1 A;  5CXO A;  5DRE A;  3WA3 A;  1NU3 A;  1L5G B;  1QJG A;  1PFP A;  1M9G A;  3U1W A;  4I4K A;  3UL5 A;  5IF6 A;  3GZX B;  4O3V A;  1O7W B;  1IDP A;  4EBG A;  3E99 A;  2SBL A;  4FMB A;  3CPW 2;  3F8X A;  3DGN A;  4FCJ A;  4N6V 0;  4JRF A;  1E3V A;  3LML A;  4O8S A;  1CEW I;  1TFK A;  3PS8 A;  5TGN A;  2WO0 A;  3GAX A;  2GXF A;  1W7C A;  2C11 A;  1VQ8 3;  2CWU A;  3VGN A;  1A2V A;  1IVV A;  1D6Z A;  2WGQ A;  2Y74 A;  3H3H A;  4K90 B;  3F8H A;  3K9M C;  1PU4 A;  4FR9 A;  1QMA A;  2KXG A;  4OVM A;  1GY7 A;  4Q53 A;  4BTX A;  4XM4 A;  1W6Y A;  3JUQ A;  4X2H A;  3T8N A;  3MG1 A;  4K1V A;  2P05 A;  1YJW 3;  3MKI A;  3BNC A;  4WWU C;  1LXE A;  3HIG A;  3CNX A;  2IMJ A;  3WDG B;  3EJV A;  1Q81 4;  2CWV A;  5IG3 A;  4CCV A;  2OQE C;  3G0K A;  5KP4 A;  2QA4 3;  3D3L A;  5HGR A;  2CH9 A;  2BO9 B;  2W2C A;  4EC6 A;  3PGB A;  1IV7 A;  3FCS B;  3HII A;  4HKV B;  2I9W A;  3CMA 3;  1GY6 A;  4KZ1 A;  1JKG B;  4R80 A;  3GZB A;  1NJI 4;  5IEN A;  1OH0 A;  4HJL B;  4EV5 A;  1VQ6 3;  2P09 A;  1JV2 B;  2CWT A;  1O7M B;  1GD4 A;  3J7Y d;  2HML B;  5AIH A;  3KSP A;  1NO3 A;  3FF0 A;  4ORL A;  2P0M A;  5JBS A;  3LYG A;  1YIJ 3;  2BMQ B;  1W6C A;  3JUN A;  2OTL 3;  4BTW A;  1QAL A;  5IG0 A;  1K8A 4;  2E2U A;  2W56 A;  6STD A;  3EN8 A;  3KZT A;  3CC2 3;  3UL6 A;  4EV2 A;  1N9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...