3OV4A

Crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
120
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase P39GV40GS42G from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
total genus 30
structure length 120
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ov4A00
1Z1SA 4HJLB 4GB5A 3CPOA 5IG0A 4MJDA 5JPUA 2Z77A 3FF0A 8CHOA 1NWWA 3NBRA 5JPPA 3GZBA 4HM1B 1JB2A 4IIAA 5HGRA 1QMAA 2GXFA 3FLJA 1IDPA 1WQLB 1O7HB 2BNGA 2HMLB 3SOAA 4XDWA 3NXJA 2RCDA 4HKVB 1OHOA 5IF6A 4WYKA 5IERA 3EC9A 3EX9A 3B8LA 3F40A 1Q40A 5D83A 4R9KA 2W2CA 1AR0A 2GBWB 3EHCA 4HM8B 5IEOA 3DXOA 2YFIB 1W01A 4R9LA 4HM4B 3MG2A 4XBXA 5KP1A 3SEDA 3MSOA 2BMQB 4XDVA 1W00A 1GYBA 5IG5A 2PZVA 4HZBB 1UUWB 5IEPA 1OF5A 2STDA 5BVBA 4X2OA 5DREA 2HMKB 2XR8B 3F8XA 2I9WA 1ZO2A 1GY7A 1E3RA 3F9SA 1ISKA 3F14A 3HX8A 2HMOB 3NHXA 3FZWA 3NM2A 1JN5B 1O7WB 1OCVA 1UUVB 1ULJB 3E99A 3EN8A 5IG3A 1GS3A 3NV0B 3ER7A 4J8TA 4HM2B 4XBTA 3LYGA 4XBYA 2XRXB 3GZYB 2JQ5A 4XM4A 1OGZA 1W02A 3KE7A 4HM5B 1C7HA 2B1XB 2B24B 2QIYA 3F7XA 3JUPA 3OWUA 4LMIA 5D81A 1ZX2A 3MG3A 2XSHB 4R1KA 4FCMA 2INXA 3H3HA 3M8CA 4HM0B 3DMCA 5STDA 2HMJB 1DMQA 4U13A 3EN1B 3G8ZA 3B4PA 3VGNA 1ULIB 1JB5A 3IPTA 5IENA 2UX0A 1O7MB 4HM3B 2QGUA 3FKAA 3KSPA 5AEUB 4N3VA 3STDA 3F7SA 1CQSA 3UNLA 5CLKA 3JUNA 2XSOB 4KVHA 2K54A 1VZZA 5CF1A 3S5CA 2YFJB 1HKXA 1S5AA 3NUVA 1NU3A 3OX9A 3CNMA 4WP5A 1DMNA 3FH1A 5CK6A 4OUQA 3A76A 3MG1A 1ASKA 1JN5A 3KZTA 1O7PB 1JB4A 3I0YA 4H3UA 1BUQA 5G2GA 3OXAA 2CHCA 6STDA 3ROBA 4ORLA 3EBYA 2A15A 3MKIA 1NDOB 1TUHA 3OWSA 3NV0A 4STDA 4LEHA 4HVNA 4OVMA 5AIGA 1OH0A 5FW5A 1OGXA 5IG4A 1OUNA 4RZMA 2CKFB 4PEJA 1TP6A 3CU3A 4L8PA 1OHPA 1STDA 4XB5A 3DUKA 3T8NA 4FCJA 1U5OA 4K1UA 3VSYA 1W6YA 2Z7AA 5BXQA 1O7GB 4J9AA 3EQQB 3HZPA 2YFLB 1O7NB 3WMDA 1EA2A 3OWYA 1E3VA 5AIHA 1JKGB 3JUQA 2R4IA 3FF2A 3EF8A 4HM7B 3FGYA 1GY5A 3H51A 4CDLA 1A2KA 3HK4A 3MYTA 3BB9A 1QJGA 5CF2A 2IMJA 3EBTA 4HM6B 3K7CA 3GZXB 2GBXB 5TGNA 4L8OA 3MHEA 3JUMA 3OV4A 7STDA 4K1VA 3GZRA 3SOYA 3KKGA 4WYKB 3DM8A 2F98A 3EJVA 1Q40B 1Q42A 5AIFA 1K41A 3CNXA 3ECFA 3GRDA 3LZAA 1OPYA 5DRVA 3G0KA 3T8UA 3K0ZA 3Q90A 5KP4A 2F86B 5CXOA 1GY6A 2RFRA 4HZ9B 4X2HA 3B4OA 1E97A 2HMMB 3DZLA 3BLZA 2RGQA 3B7CA 2Z76A 3D9RA 2GEXA 1OHSA 3JUOA 1EG9B 2OWPA 3G16A 3UJMA 4I4KA 4Q53A 5EVHA 2BMOB 4L7KA 5AEWB 1OF5B 3RGAA 4WWUC 3RGRA 1SJWA 5KP3A 5D82A 2F99A 1JKGA 2HMNB 2GEYA 5AI1A 1DMMA 3GWRA 3F8HA 3FSDA 5AIIA 2BMRB 4LGQA
chains in the Genus database with same CATH superfamily
1Z1SA 5GSPA 1RCLA 2CIUA 1Y4KA 1K28A 4HJLB 1YJN3 4GB5A 1B21A 2CX0A 3LTDA 3CMA3 5EQLA 3CPOA 1RGCA 4R80A 4FMCA 5IG0A 3D4AA 1U8CB 4MJDA 3SVAA 5JPUA 1V58A 1CEWI 1R4YA 2Z77A 3FF0A 8CHOA 1NWWA 3ZG0A 3NBRA 3V99A 5JPPA 3GZBA 2D42A 3S67A 4HM1B 1JB2A 1Q7HA 4EV5A 3TDGA 1BNSA 1US1A 4NHFA 4JRFA 4NREA 1NB5I 1D6YA 1PFPA 4IIAA 4QWTA 5HGRA 1QMAA 3X42A 1BNIA 4EBGA 2GXFA 3FLJA 1IDPA 3LT8A 1WQLB 2O3OA 1JBTA 1O7HB 1W2B2 1RMSA 2M7OA 2XFSA 3NM7A 1RRLA 2BNGA 4RNYA 2HMLB 3SOAA 3MPHA 4XDWA 1IVXA 3NXJA 1YI23 4CPKA 2BT3A 2RCDA 2RSXA 4HKVB 1OHOA 2K3DA 3AGOA 5IF6A 4WYKA 4OK0A 4EW5A 5IERA 4EC6A 2XFTA 3EC9A 3EX9A 3B8LA 3F40A 1Q864 1UI7A 1Q40A 5D83A 3N8BA 1A2PA 1B2SA 4IPBA 1GD4A 3K63A 4R9KA 2W2CA 1YGWA 3PGBA 1AR0A 1MWRA 1ZGXA 2GBWB 3EHCA 4HM8B 4IT7A 4HOHA 3DXOA 5IEOA 2H0GA 2GSPA 2MC8A 2YX9A 2YFIB 4J5GA 1DYUA 2PNCA 3DY5A 2KAAA 3S28A 2CG1A 3Q2PA 1FW7A 2CFLA 4BTYA 1FGTA 6GSPA 1W01A 1BOXA 4HM4B 4R9LA 1UCJA 3DGNA 1N5HA 1YJ93 3MG2A 3HIIA 4XBXA 3KIIA 3LXUX 5KP1A 1VQ73 3SEDA 1HZ1A 1GD3A 1MGRA 1BNJA 3MSOA 1JRQA 5G1LA 2BMQB 2E2UA 4XDVA 1W00A 2Q07A 1FGMA 2CFWA 1T5YA 3LT9A 2HOHA 2IA7A 1AV4A 1VQ83 4RNTA 4TX4A 3D3LA 1DVDA 3CCS3 1YVSA 3AMOA 2K0MA 3CC43 1GYBA 2KRTA 5IG5A 1BRHA 3BNBA 2PZVA 1B27A 2P0MA 1QAKA 4HZBB 4N6V0 4KFDA 4GSPA 1UUWB 1R4CA 4MMXB 5IEPA 3HIGA 2ZA4A 1ROVA 4MMZB 1BRGA 1EEJA 1OF5A 2STDA 1RKYA 3OW22 2P09A 1IVVA 4X2OA 5BVBA 1IV9A 1TFOA 4FMDA 5DREA 1JZDA 2HMKB 3X3ZA 2XR8B 3F8XA 2AADA 1VQ93 3LOYA 4FCZA 2WGOA 2I9WA 1IT7A 3LTCA 2KCDA 1ZO2A 1GY7A 1E3RA 1CYVA 1VQK3 2KXGA 1TRPA 3N54B 2GU1A 3F9SA 4K90B 4RBNA 4O3VA 2JDIH 1ISKA 3F14A 1BSAA 1RGAA 3HX8A 1MOLA 2HMOB 2BU4A 1LNIA 2Z6BA 3NHXA 1EKMA 3FZWA 1UI8A 3NBJA 4KFFA 3NM2A 1I70A 1N5PA 1W6GA 1JN5B 1O7WB 1A2VA 1OCVA 1IQXA 1V74A 1RGHA 2WO0A 1UUVB 1ULJB 3E99A 3CCL3 2O9UX 3EN8A 1QAFA 4N6NB 1VQ63 1JV2B 2MF7A 2XGLA 2CWUA 4FMBA 4KZ1A 3X3YA 5IG3A 1WTHA 1S723 2OTJ3 1DVCA 3BNEA 5M18A 1YIT3 1IU7A 1GS3A 1D6UA 3NV0B 1BU4A 3ER7A 4J8TA 2F5WA 4HM2B 4XBTA 1G96A 2LYXA 4BU4A 3LYGA 3CME3 1DE3A 1EQKA 4XBYA 1FGOA 1WMPA 3NX0A 1RGLA 1UGHI 2XRXB 3GZYB 2FNQA 4GL6A 3WOEB 1GOUA 3VF1A 2GU3A 2JQ5A 3CCU3 1RGFA 4XM4A 1M1K4 3FG1A 5IW9A 1OGZA 1TFKA 1W02A 3PS8A 1HYFA 4BTXA 3KE7A 4HM5B 2OOVC 1C7HA 2P38A 1STFI 2B1XB 1WMOA 4I5QA 2ML6A 2WGQA 1GMRA 3S29A 2B24B 2QIYA 2XEPA 3NBBA 1VQO3 1BSBA 1IT8A 4EYCA 1RJOA 2OTL3 1VQM3 3F7XA 1YNVX 1AQZA 3JUPA 3OWUA 1RGGA 3J7Yd 1GMQA 4KFEA 1K8A4 2W56B 4LMIA 1X1XA 3IMAB 1RN4A 3BNDA 5D81A 1ZX2A 5AYSC 2CK3H 1LOXA 3BNCA 1X1UA 1T3BA 3MG3A 1GMPA 3X3XA 1I2GA 3CCM3 3AHWA 2XSHB 3KN4A 4R1KA 1JNQA 4FCMA 1RRHA 1VQ53 1VQN3 5BU4A 2INXA 3H3HA 1NB3I 1I8VA 1MWTA 1RCKA 1LOYA 3BIRA 3M8CA 3QK9A 3DMCA 4HM0B 3G6E3 4MMYB 1JJ22 1YVBI 2IY2A 2WOHA 3AHSA 3G4S3 5STDA 2HMJB 4CJNA 1DMQA 4U13A 3EN1B 3FCSB 1BRIA 3B4PA 3G8ZA 3VGNA 1BRKA 4AKZA 1I3IA 1LRAA 1MWSA 1UCIA 2F5MA 3LTBA 2E2TA 1F8NA 4NPBA 3X40A 3CPW2 5G1KA 3WDGB 1ULIB 1JB5A 1B2XA 1RTUA 3IPTA 5IENA 2J8XB 3S27A 2UX0A 5BIRA 3PCSA 1O7MB 4HM3B 2QGUA 3FKAA 3KSPA 5AEUB 1JBRA 4N3VA 1D6ZA 3STDA 2UUGC 2RNTA 3F7SA 4KT3B 2V1LA 4HBRA 1CQSA 3SXXA 4EV2A 4LYLB 4N6OB 3UNLA 5CLKA 1BSCA 2XSOB 3JUNA 1BNEA 3CD63 3IJEB 4KVHA 1BRNL 2K54A 1VZZA 1UUGB 1RSNA 1IYYA 5CF1A 1G02A 1DETA 1MGWA 3S5CA 2YFJB 5LC7A 2ML5A 5LC6A 1HKXA 1TRQA 1BSDA 3GAXA 4HAAA 3SYUA 4N6UA 1FA3A 3A5EA 2CWTA 1S5AA 4MEIA 1PU4A 3NUVA 1UDII 1NU3A 3OX9A 2L1SA 3UB1A 3ZG5A 3HI7A 1FUTA 3CNMA 5FGOA 4WP5A 1DMNA 3FH1A 1SQWA 5CK6A 4RNZA 4OUQA 3A76A 1FGRA 1RN7A 3FG4A 1N9EA 3MG1A 1ASKA 3LH4A 2KF6A 3Q3FA 1JN5A 2ZL8A 3KZTA 1NO3A 1T2HA 1O7PB 1JB4A 3I0YA 4H3UA 1BUQA 5ELUA 5G2GA 4CCVA 3OXAA 1YHQ3 3MWZA 1A90A 2CHCA 6STDA 3ROBA 6RNTA 1BANA 1M1XB 4ORLA 5A0OB 1Q824 1RNBA 1FUSA 3EBYA 3CCE3 1TTOA 2A15A 3MKIA 1NDOB 1TUHA 3DGLA 3OWSA 5M1AA 1RN1A 2CX1A 3NV0A 4FR9A 4STDA 1T2IA 1RGKA 2IYJA 3SX1A 1I2FA 3DGYA 1I2EA 4HVNA 4LEHA 2Y73A 1KQS2 4OVMA 2CW9A 3K9MC 5AIGA 1OH0A 1AVKA 1EUIC 4FMAA 5FW5A 2OQEC 1OGXA 3ALAA 5IG4A 1OUNA 1YGEA 4RZMA 3PZWA 9RNTA 3WA3A 1K9M4 1IV7A 2W9PA 2CKFB 3WR2A 1UCKA 4K61A 1RGEA 4PEJA 2BHMA 1SARA 1TP6A 3CU3A 4L8PA 1B2ZA 2WOFA 1OHPA 1STDA 1LOVA 4XB5A 2C4BA 3DUKA 2UGIA 3NQYA 3T8NA 4DKIA 1Q7Y4 2QA43 2L4VA 1B3SA 4FCJA 1U5OA 1SIHA 4K1UA 3EE1A 3VSYA 4BIRA 2P0XA 1W6YA 8RNTA 2W56A 1BNFA 1QVF2 1V57A 2KF4A 1MWUA 2Z7AA 1BRJA 3D5GA 2H0IA 5BXQA 1O7GB 3AGNA 4J9AA 3EQQB 3NQZA 3HZPA 2YFLB 2XH9A 1BSEA 2CFDA 2KF5A 4LSOA 1O7NB 1RDSA 3I553 2C10A 1QVG2 3I563 3WMDA 3WHOA 1KC84 1TU5A 1SIIA 3DH2A 3GSPA 3V98A 1EA2A 4ZM8A 1IQYA 2AAEA 1MNLA 1ROAA 3OWYA 2FXTA 4N6LA 1Q9EA 2BIRA 2CH9A 1E3VA 1IK3A 5AIHA 1JKGB 1KSIA 3JUQA 2R4IA 5ELJA 4N6TA 1W7CA 3FF2A 3CC23 3PYJA 1LQMB 1C54A 1FUWA 3EF8A 1G0TA 2SARA 2CC3A 2F4YA 4LZIA 4HM7B 3CXC2 1W4NA 3FGYA 4BL2A 1W2ZA 3UL6A 1GY5A 3H51A 4CDLA 1SPUA 2Y74A 3DGOA 3PXMA 1B2UA 1A2KA 3RDEA 1N9JA 3WOFB 1RLSA 1RNTA 1JBSA 4O2HA 2F56A 3HK4A 3MYTA 3BB9A 1QJGA 1VQL3 2XGNA 5CF2A 2IMJA 1BNGA 3RNTA 1BVIA 1I0VA 4H61A 2CFKA 3EBTA 4HM6B 3CCQ3 3U1WA 3URPA 7RNTA 1A67A 3K7CA 3GZXB 2GBXB 2W0QA 1IVWA 3CC73 2IUKA 2W03A 3L0RA 1IQ8A 1TJDA 3KFQC 1IVUA 1HU9A 2C11A 4R4KA 2BO9B 5TGNA 1BNRA 2OCTA 3EB8A 1CH0A 1M9GA 4L8OA 1VQQA 3KCHA 3HOHA 4BL3A 4EXRA 1LQGC 3MHEA 3JUMA 4G1MB 1FYSA 2CFGA 1BIRA 3OV4A 2SBLA 7STDA 1N8R4 3DGMA 4K1VA 3GZRA 3SOYA 1GSPA 1YJW3 5M19A 1TIJA 3KKGA 1UCLA 1LXEA 2D1WA 3Q1CA 4BTWA 4HYZA 2CWVA 3JVCA 2OQEA 2IUJA 4O8SA 3G713 4WYKB 1WNHA 3DM8A 1I0XA 3LMLA 1BUJA 5EEOA 1UGIA 1N8QA 2KF3A 4WFOA 1BGSA 2E2VA 2F98A 1AVLA 2ZHXB 1VQP3 1NJI4 2W04A 1FGQA 3EJVA 2W6JH 1Q40B 1WMNA 4O02B 1Q42A 1K41A 3CNXA 3LZAA 3ECFA 3GRDA 5AIFA 3UL5A 2R41A 1OPYA 3T0UA 7GSPA 1X1YA 5DRVA 3G0KA 1LOWA 3D79A 1YIJ3 3T8UA 3K0ZA 1QALA 3Q90A 3X41A 1AY7A 3O8YA 5KP4A 2F86B 3CCJ3 5CXOA 5I97A 2QEX3 1GY6A 1X1WA 2RFRA 4GHOA 1PYLA 1UW1A 5HOHA 5AYRB 3WA2X 3WODG 4N6MA 4HZ9B 4X2HA 1VQ43 3B4OA 1E97A 2HMMB 3PCRA 3DZLA 3BLZA 4ILFA 5JBSA 2RGQA 3CCV3 3B7CA 3FG3A 2Z76A 3KSED 1LNHA 3D9RA 1FZUA 3N9HA 2OOVA 2GEXA 1M904 1OHSA 2XF3A 1J2BA 3K5TA 2LQVA 2W9QA 2H0HA 3JUOA 1B2MA 1ZS7A 1EG9B 1JZOA 1BAOA 2P05A 2FGTA 2OWPA 3AMOB 3QRDA 4J5KA 3G16A 1PY3A 3UJMA 4I4KA 4Q53A 1W6CA 1OACA 5EVHA 3D5IA 1KWIA 2BMOB 2ZDJA 1W5ZA 1B20A 4L7KA 1LVNA 1Q814 5AEWB 1OF5B 2CG0A 3RGAA 4AEQA 1BRSA 4WWUC 1K734 1GOVA 3RGRA 1SJWA 3BU4A 3CCR3 3LTAA 5KP3A 1NNVA 2RBIA 5D82A 2F99A 1JKGA 1L5GB 2HMNB 1RHLA 2GEYA 5AI1A 3SLUA 4WHAA 1I3FA 1DMMA 3GWRA 3F8HA 1GOYA 4AKYA 1KD14 3FSDA 5AIIA 3V92A 2BMRB 5RNTA 4LGQA 3ZFZA 1CYUA 3U97A 4JF8A
chains in the Genus database with same CATH topology
1Z1SA 2CIUA 1Y4KA 1K28A 4HJLB 1YJN3 4GB5A 3LTDA 3CMA3 5EQLA 3CPOA 4R80A 4FMCA 5IG0A 4MJDA 1U8CB 3SVAA 5JPUA 1CEWI 2Z77A 3FF0A 8CHOA 1NWWA 3NBRA 3V99A 5JPPA 3GZBA 2D42A 3S67A 4HM1B 1JB2A 4EV5A 3TDGA 1US1A 4NHFA 4JRFA 4NREA 1NB5I 1D6YA 1PFPA 4IIAA 4QWTA 5HGRA 1QMAA 3X42A 4EBGA 2GXFA 3FLJA 1IDPA 3LT8A 1WQLB 2O3OA 1O7HB 1W2B2 2M7OA 2XFSA 4RNYA 3NM7A 1RRLA 2BNGA 2HMLB 3SOAA 3MPHA 4XDWA 1IVXA 3NXJA 1YI23 2BT3A 2RCDA 2RSXA 4HKVB 1OHOA 5IF6A 4WYKA 4OK0A 5IERA 4EC6A 2XFTA 3EC9A 3EX9A 3B8LA 3F40A 1Q864 1UI7A 1Q40A 5D83A 3N8BA 4IPBA 1GD4A 3K63A 4R9KA 2W2CA 3PGBA 1AR0A 2GBWB 4IT7A 3EHCA 4HM8B 5IEOA 3DXOA 2MC8A 2YX9A 2YFIB 1DYUA 2PNCA 3DY5A 3S28A 2CG1A 3Q2PA 2CFLA 4BTYA 1FGTA 1W01A 4R9LA 4HM4B 3DGNA 1N5HA 1YJ93 3MG2A 3HIIA 4XBXA 3KIIA 3LXUX 5KP1A 1VQ73 3SEDA 3MSOA 1GD3A 1JRQA 2BMQB 2E2UA 4XDVA 1W00A 2Q07A 1FGMA 2CFWA 1T5YA 3LT9A 2IA7A 1AV4A 1VQ83 4TX4A 3D3LA 1DVDA 3CCS3 3AMOA 2K0MA 3CC43 1GYBA 2KRTA 5IG5A 3BNBA 2PZVA 2P0MA 1QAKA 4HZBB 4N6V0 4KFDA 1UUWB 1R4CA 4MMXB 5IEPA 3HIGA 4MMZB 1ROVA 1RKYA 1OF5A 2STDA 3OW22 2P09A 1IVVA 4X2OA 5BVBA 1IV9A 1TFOA 4FMDA 5DREA 2HMKB 3X3ZA 2XR8B 3F8XA 1VQ93 3LOYA 4FCZA 2WGOA 2I9WA 1IT7A 3LTCA 2KCDA 1ZO2A 1GY7A 1E3RA 1CYVA 1VQK3 2KXGA 3N54B 2GU1A 3F9SA 4K90B 4RBNA 4O3VA 2JDIH 1ISKA 3F14A 3HX8A 1MOLA 2HMOB 3NHXA 2Z6BA 1EKMA 3FZWA 1UI8A 3NBJA 4KFFA 3NM2A 1N5PA 1W6GA 1JN5B 1O7WB 1A2VA 1OCVA 1IQXA 1V74A 2WO0A 1UUVB 1ULJB 3E99A 3CCL3 2O9UX 3EN8A 1QAFA 4N6NB 1VQ63 1JV2B 2MF7A 2XGLA 2CWUA 4FMBA 4KZ1A 3X3YA 5IG3A 1WTHA 1S723 2OTJ3 1DVCA 3BNEA 1YIT3 1IU7A 1GS3A 1D6UA 3NV0B 3ER7A 4J8TA 4HM2B 4XBTA 1G96A 2LYXA 3LYGA 3CME3 1EQKA 4XBYA 1FGOA 1WMPA 3NX0A 2XRXB 3GZYB 2FNQA 4GL6A 3WOEB 3VF1A 2GU3A 2JQ5A 3CCU3 4XM4A 1M1K4 3FG1A 5IW9A 1OGZA 1TFKA 1W02A 3PS8A 4BTXA 3KE7A 4HM5B 2OOVC 1C7HA 2P38A 1STFI 2B1XB 1WMOA 2ML6A 2WGQA 3S29A 1VQO3 2B24B 2QIYA 2XEPA 3NBBA 1IT8A 4EYCA 1RJOA 2OTL3 1VQM3 3F7XA 3JUPA 3OWUA 3J7Yd 4KFEA 1K8A4 2W56B 4LMIA 3IMAB 3BNDA 5D81A 1ZX2A 5AYSC 2CK3H 1LOXA 3BNCA 3MG3A 3X3XA 3CCM3 2XSHB 3KN4A 4R1KA 1JNQA 4FCMA 1RRHA 1VQ53 1VQN3 2INXA 3H3HA 1NB3I 3M8CA 3QK9A 3G6E3 4HM0B 3DMCA 1JJ22 4MMYB 1YVBI 2WOHA 3G4S3 5STDA 2HMJB 5JBSA 1DMQA 4U13A 3EN1B 3FCSB 3G8ZA 3B4PA 3VGNA 4AKZA 3X40A 3LTBA 2E2TA 1F8NA 3CPW2 3WDGB 1ULIB 1JB5A 3IPTA 5IENA 3S27A 2UX0A 3PCSA 1O7MB 4HM3B 2QGUA 3FKAA 3KSPA 5AEUB 4N3VA 1D6ZA 3STDA 3F7SA 2V1LA 4HBRA 1CQSA 3SXXA 4EV2A 4N6OB 3UNLA 5CLKA 3JUNA 2XSOB 3CD63 3IJEB 4KVHA 2K54A 1VZZA 5CF1A 3S5CA 2YFJB 5LC7A 2ML5A 5LC6A 1HKXA 3GAXA 1FA3A 4N6UA 2CWTA 1S5AA 4MEIA 1PU4A 3NUVA 1NU3A 3OX9A 3UB1A 3HI7A 3CNMA 5FGOA 4WP5A 1DMNA 3FH1A 1SQWA 5CK6A 4RNZA 4OUQA 3A76A 1FGRA 1RN7A 3FG4A 1N9EA 3MG1A 1ASKA 3LH4A 1JN5A 2ZL8A 3KZTA 1NO3A 1O7PB 1JB4A 3I0YA 4H3UA 1BUQA 5ELUA 5G2GA 4CCVA 3OXAA 1YHQ3 3MWZA 1A90A 2CHCA 6STDA 3ROBA 1M1XB 4ORLA 5A0OB 1Q824 3EBYA 3CCE3 2A15A 3MKIA 1NDOB 1TUHA 3DGLA 3OWSA 3NV0A 4FR9A 4STDA 3SX1A 4HVNA 4LEHA 2Y73A 1KQS2 4OVMA 2CW9A 3K9MC 5AIGA 1OH0A 1AVKA 4FMAA 5FW5A 2OQEC 1OGXA 3ALAA 5IG4A 1OUNA 1YGEA 4RZMA 3PZWA 3WA3A 1K9M4 1IV7A 2W9PA 2CKFB 4K61A 4PEJA 2BHMA 1TP6A 3CU3A 4L8PA 2WOFA 1OHPA 1STDA 4XB5A 3DUKA 3NQYA 3T8NA 1Q7Y4 2QA43 2L4VA 4FCJA 1U5OA 1SIHA 4K1UA 3EE1A 3VSYA 2P0XA 1W6YA 2W56A 1QVF2 2Z7AA 5BXQA 1O7GB 4J9AA 3EQQB 3NQZA 3HZPA 2YFLB 2XH9A 2CFDA 4LSOA 1O7NB 3I553 2C10A 1QVG2 3I563 3WMDA 1KC84 1TU5A 1SIIA 3V98A 4ZM8A 1EA2A 1IQYA 1MNLA 1ROAA 3OWYA 2FXTA 4N6LA 2CH9A 1E3VA 1IK3A 5AIHA 1JKGB 1KSIA 3JUQA 2R4IA 5ELJA 4N6TA 1W7CA 3FF2A 3CC23 3PYJA 1FUWA 3EF8A 2CC3A 4LZIA 4HM7B 3CXC2 1W4NA 3FGYA 1W2ZA 3UL6A 1GY5A 3H51A 4CDLA 2Y74A 1SPUA 3DGOA 3PXMA 1A2KA 3RDEA 3WOFB 1N9JA 4O2HA 3HK4A 3MYTA 3BB9A 1QJGA 1VQL3 2XGNA 5CF2A 2IMJA 4H61A 2CFKA 3EBTA 4HM6B 3CCQ3 3U1WA 1A67A 3K7CA 3GZXB 2GBXB 2W0QA 1IVWA 3CC73 2IUKA 2W03A 3L0RA 1IQ8A 3KFQC 1IVUA 1HU9A 2C11A 4R4KA 2BO9B 5TGNA 2OCTA 3EB8A 1M9GA 4L8OA 4EXRA 3MHEA 4G1MB 3JUMA 2CFGA 3OV4A 2SBLA 7STDA 1N8R4 3DGMA 4K1VA 3GZRA 3SOYA 1YJW3 1TIJA 3KKGA 1LXEA 2D1WA 3Q1CA 4BTWA 4HYZA 2CWVA 3JVCA 2OQEA 2IUJA 4O8SA 3G713 4WYKB 1WNHA 3DM8A 3LMLA 5EEOA 1N8QA 4WFOA 2E2VA 2F98A 1AVLA 1VQP3 1NJI4 2W04A 1FGQA 3EJVA 2W6JH 1Q40B 1WMNA 4O02B 1Q42A 1K41A 3CNXA 3LZAA 3ECFA 3GRDA 5AIFA 3UL5A 1OPYA 3T0UA 5DRVA 3G0KA 1YIJ3 3T8UA 3K0ZA 1QALA 3Q90A 3X41A 3O8YA 5KP4A 2F86B 3CCJ3 5CXOA 5I97A 2QEX3 1GY6A 2RFRA 1UW1A 5AYRB 3WA2X 3WODG 4N6MA 4HZ9B 4X2HA 1VQ43 3B4OA 1E97A 2HMMB 3PCRA 3DZLA 3BLZA 3CCV3 2RGQA 3B7CA 3FG3A 2Z76A 3KSED 1LNHA 3D9RA 3N9HA 2OOVA 2GEXA 1M904 1OHSA 2XF3A 1J2BA 3K5TA 2LQVA 2W9QA 3JUOA 1EG9B 2P05A 2FGTA 2OWPA 3AMOB 3QRDA 3G16A 3UJMA 4I4KA 4Q53A 1W6CA 1OACA 5EVHA 1KWIA 2BMOB 2ZDJA 1W5ZA 4L7KA 1LVNA 1Q814 5AEWB 1OF5B 2CG0A 3RGAA 4AEQA 4WWUC 1K734 3RGRA 1SJWA 3CCR3 3LTAA 5KP3A 5D82A 2F99A 1JKGA 1L5GB 2HMNB 2GEYA 5AI1A 3SLUA 4WHAA 1DMMA 3GWRA 3F8HA 4AKYA 1KD14 3FSDA 5AIIA 3V92A 2BMRB 4LGQA 1CYUA 3U97A 4JF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1S A;  4HJL B;  4GB5 A;  3CPO A;  5IG0 A;  4MJD A;  5JPU A;  2Z77 A;  3FF0 A;  8CHO A;  1NWW A;  3NBR A;  5JPP A;  3GZB A;  4HM1 B;  1JB2 A;  4IIA A;  5HGR A;  1QMA A;  2GXF A;  3FLJ A;  1IDP A;  1WQL B;  1O7H B;  2BNG A;  2HML B;  3SOA A;  4XDW A;  3NXJ A;  2RCD A;  4HKV B;  1OHO A;  5IF6 A;  4WYK A;  5IER A;  3EC9 A;  3EX9 A;  3B8L A;  3F40 A;  1Q40 A;  5D83 A;  4R9K A;  2W2C A;  1AR0 A;  2GBW B;  3EHC A;  4HM8 B;  5IEO A;  3DXO A;  2YFI B;  1W01 A;  4R9L A;  4HM4 B;  3MG2 A;  4XBX A;  5KP1 A;  3SED A;  3MSO A;  2BMQ B;  4XDV A;  1W00 A;  1GYB A;  5IG5 A;  2PZV A;  4HZB B;  1UUW B;  5IEP A;  1OF5 A;  2STD A;  5BVB A;  4X2O A;  5DRE A;  2HMK B;  2XR8 B;  3F8X A;  2I9W A;  1ZO2 A;  1GY7 A;  1E3R A;  3F9S A;  1ISK A;  3F14 A;  3HX8 A;  2HMO B;  3NHX A;  3FZW A;  3NM2 A;  1JN5 B;  1O7W B;  1OCV A;  1UUV B;  1ULJ B;  3E99 A;  3EN8 A;  5IG3 A;  1GS3 A;  3NV0 B;  3ER7 A;  4J8T A;  4HM2 B;  4XBT A;  3LYG A;  4XBY A;  2XRX B;  3GZY B;  2JQ5 A;  4XM4 A;  1OGZ A;  1W02 A;  3KE7 A;  4HM5 B;  1C7H A;  2B1X B;  2B24 B;  2QIY A;  3F7X A;  3JUP A;  3OWU A;  4LMI A;  5D81 A;  1ZX2 A;  3MG3 A;  2XSH B;  4R1K A;  4FCM A;  2INX A;  3H3H A;  3M8C A;  4HM0 B;  3DMC A;  5STD A;  2HMJ B;  1DMQ A;  4U13 A;  3EN1 B;  3G8Z A;  3B4P A;  3VGN A;  1ULI B;  1JB5 A;  3IPT A;  5IEN A;  2UX0 A;  1O7M B;  4HM3 B;  2QGU A;  3FKA A;  3KSP A;  5AEU B;  4N3V A;  3STD A;  3F7S A;  1CQS A;  3UNL A;  5CLK A;  3JUN A;  2XSO B;  4KVH A;  2K54 A;  1VZZ A;  5CF1 A;  3S5C A;  2YFJ B;  1HKX A;  1S5A A;  3NUV A;  1NU3 A;  3OX9 A;  3CNM A;  4WP5 A;  1DMN A;  3FH1 A;  5CK6 A;  4OUQ A;  3A76 A;  3MG1 A;  1ASK A;  1JN5 A;  3KZT A;  1O7P B;  1JB4 A;  3I0Y A;  4H3U A;  1BUQ A;  5G2G A;  3OXA A;  2CHC A;  6STD A;  3ROB A;  4ORL A;  3EBY A;  2A15 A;  3MKI A;  1NDO B;  1TUH A;  3OWS A;  3NV0 A;  4STD A;  4LEH A;  4HVN A;  4OVM A;  5AIG A;  1OH0 A;  5FW5 A;  1OGX A;  5IG4 A;  1OUN A;  4RZM A;  2CKF B;  4PEJ A;  1TP6 A;  3CU3 A;  4L8P A;  1OHP A;  1STD A;  4XB5 A;  3DUK A;  3T8N A;  4FCJ A;  1U5O A;  4K1U A;  3VSY A;  1W6Y A;  2Z7A A;  5BXQ A;  1O7G B;  4J9A A;  3EQQ B;  3HZP A;  2YFL B;  1O7N B;  3WMD A;  1EA2 A;  3OWY A;  1E3V A;  5AIH A;  1JKG B;  3JUQ A;  2R4I A;  3FF2 A;  3EF8 A;  4HM7 B;  3FGY A;  1GY5 A;  3H51 A;  4CDL A;  1A2K A;  3HK4 A;  3MYT A;  3BB9 A;  1QJG A;  5CF2 A;  2IMJ A;  3EBT A;  4HM6 B;  3K7C A;  3GZX B;  2GBX B;  5TGN A;  4L8O A;  3MHE A;  3JUM A;  3OV4 A;  7STD A;  4K1V A;  3GZR A;  3SOY A;  3KKG A;  4WYK B;  3DM8 A;  2F98 A;  3EJV A;  1Q40 B;  1Q42 A;  5AIF A;  1K41 A;  3CNX A;  3ECF A;  3GRD A;  3LZA A;  1OPY A;  5DRV A;  3G0K A;  3T8U A;  3K0Z A;  3Q90 A;  5KP4 A;  2F86 B;  5CXO A;  1GY6 A;  2RFR A;  4HZ9 B;  4X2H A;  3B4O A;  1E97 A;  2HMM B;  3DZL A;  3BLZ A;  2RGQ A;  3B7C A;  2Z76 A;  3D9R A;  2GEX A;  1OHS A;  3JUO A;  1EG9 B;  2OWP A;  3G16 A;  3UJM A;  4I4K A;  4Q53 A;  5EVH A;  2BMO B;  4L7K A;  5AEW B;  1OF5 B;  3RGA A;  4WWU C;  3RGR A;  1SJW A;  5KP3 A;  5D82 A;  2F99 A;  1JKG A;  2HMN B;  2GEY A;  5AI1 A;  1DMM A;  3GWR A;  3F8H A;  3FSD A;  5AII A;  2BMR B;  4LGQ A; 
#chains in the Genus database with same CATH topology
 1Z1S A;  5GSP A;  1RCL A;  2CIU A;  1Y4K A;  1K28 A;  4HJL B;  1YJN 3;  4GB5 A;  1B21 A;  2CX0 A;  3LTD A;  3CMA 3;  5EQL A;  3CPO A;  1RGC A;  4R80 A;  4FMC A;  5IG0 A;  3D4A A;  1U8C B;  4MJD A;  3SVA A;  5JPU A;  1V58 A;  1CEW I;  1R4Y A;  2Z77 A;  3FF0 A;  8CHO A;  1NWW A;  3ZG0 A;  3NBR A;  3V99 A;  5JPP A;  3GZB A;  2D42 A;  3S67 A;  4HM1 B;  1JB2 A;  1Q7H A;  4EV5 A;  3TDG A;  1BNS A;  1US1 A;  4NHF A;  4JRF A;  4NRE A;  1NB5 I;  1D6Y A;  1PFP A;  4IIA A;  4QWT A;  5HGR A;  1QMA A;  3X42 A;  1BNI A;  4EBG A;  2GXF A;  3FLJ A;  1IDP A;  3LT8 A;  1WQL B;  2O3O A;  1JBT A;  1O7H B;  1W2B 2;  1RMS A;  2M7O A;  2XFS A;  3NM7 A;  1RRL A;  2BNG A;  4RNY A;  2HML B;  3SOA A;  3MPH A;  4XDW A;  1IVX A;  3NXJ A;  1YI2 3;  4CPK A;  2BT3 A;  2RCD A;  2RSX A;  4HKV B;  1OHO A;  2K3D A;  3AGO A;  5IF6 A;  4WYK A;  4OK0 A;  4EW5 A;  5IER A;  4EC6 A;  2XFT A;  3EC9 A;  3EX9 A;  3B8L A;  3F40 A;  1Q86 4;  1UI7 A;  1Q40 A;  5D83 A;  3N8B A;  1A2P A;  1B2S A;  4IPB A;  1GD4 A;  3K63 A;  4R9K A;  2W2C A;  1YGW A;  3PGB A;  1AR0 A;  1MWR A;  1ZGX A;  2GBW B;  3EHC A;  4HM8 B;  4IT7 A;  4HOH A;  3DXO A;  5IEO A;  2H0G A;  2GSP A;  2MC8 A;  2YX9 A;  2YFI B;  4J5G A;  1DYU A;  2PNC A;  3DY5 A;  2KAA A;  3S28 A;  2CG1 A;  3Q2P A;  1FW7 A;  2CFL A;  4BTY A;  1FGT A;  6GSP A;  1W01 A;  1BOX A;  4HM4 B;  4R9L A;  1UCJ A;  3DGN A;  1N5H A;  1YJ9 3;  3MG2 A;  3HII A;  4XBX A;  3KII A;  3LXU X;  5KP1 A;  1VQ7 3;  3SED A;  1HZ1 A;  1GD3 A;  1MGR A;  1BNJ A;  3MSO A;  1JRQ A;  5G1L A;  2BMQ B;  2E2U A;  4XDV A;  1W00 A;  2Q07 A;  1FGM A;  2CFW A;  1T5Y A;  3LT9 A;  2HOH A;  2IA7 A;  1AV4 A;  1VQ8 3;  4RNT A;  4TX4 A;  3D3L A;  1DVD A;  3CCS 3;  1YVS A;  3AMO A;  2K0M A;  3CC4 3;  1GYB A;  2KRT A;  5IG5 A;  1BRH A;  3BNB A;  2PZV A;  1B27 A;  2P0M A;  1QAK A;  4HZB B;  4N6V 0;  4KFD A;  4GSP A;  1UUW B;  1R4C A;  4MMX B;  5IEP A;  3HIG A;  2ZA4 A;  1ROV A;  4MMZ B;  1BRG A;  1EEJ A;  1OF5 A;  2STD A;  1RKY A;  3OW2 2;  2P09 A;  1IVV A;  4X2O A;  5BVB A;  1IV9 A;  1TFO A;  4FMD A;  5DRE A;  1JZD A;  2HMK B;  3X3Z A;  2XR8 B;  3F8X A;  2AAD A;  1VQ9 3;  3LOY A;  4FCZ A;  2WGO A;  2I9W A;  1IT7 A;  3LTC A;  2KCD A;  1ZO2 A;  1GY7 A;  1E3R A;  1CYV A;  1VQK 3;  2KXG A;  1TRP A;  3N54 B;  2GU1 A;  3F9S A;  4K90 B;  4RBN A;  4O3V A;  2JDI H;  1ISK A;  3F14 A;  1BSA A;  1RGA A;  3HX8 A;  1MOL A;  2HMO B;  2BU4 A;  1LNI A;  2Z6B A;  3NHX A;  1EKM A;  3FZW A;  1UI8 A;  3NBJ A;  4KFF A;  3NM2 A;  1I70 A;  1N5P A;  1W6G A;  1JN5 B;  1O7W B;  1A2V A;  1OCV A;  1IQX A;  1V74 A;  1RGH A;  2WO0 A;  1UUV B;  1ULJ B;  3E99 A;  3CCL 3;  2O9U X;  3EN8 A;  1QAF A;  4N6N B;  1VQ6 3;  1JV2 B;  2MF7 A;  2XGL A;  2CWU A;  4FMB A;  4KZ1 A;  3X3Y A;  5IG3 A;  1WTH A;  1S72 3;  2OTJ 3;  1DVC A;  3BNE A;  5M18 A;  1YIT 3;  1IU7 A;  1GS3 A;  1D6U A;  3NV0 B;  1BU4 A;  3ER7 A;  4J8T A;  2F5W A;  4HM2 B;  4XBT A;  1G96 A;  2LYX A;  4BU4 A;  3LYG A;  3CME 3;  1DE3 A;  1EQK A;  4XBY A;  1FGO A;  1WMP A;  3NX0 A;  1RGL A;  1UGH I;  2XRX B;  3GZY B;  2FNQ A;  4GL6 A;  3WOE B;  1GOU A;  3VF1 A;  2GU3 A;  2JQ5 A;  3CCU 3;  1RGF A;  4XM4 A;  1M1K 4;  3FG1 A;  5IW9 A;  1OGZ A;  1TFK A;  1W02 A;  3PS8 A;  1HYF A;  4BTX A;  3KE7 A;  4HM5 B;  2OOV C;  1C7H A;  2P38 A;  1STF I;  2B1X B;  1WMO A;  4I5Q A;  2ML6 A;  2WGQ A;  1GMR A;  3S29 A;  2B24 B;  2QIY A;  2XEP A;  3NBB A;  1VQO 3;  1BSB A;  1IT8 A;  4EYC A;  1RJO A;  2OTL 3;  1VQM 3;  3F7X A;  1YNV X;  1AQZ A;  3JUP A;  3OWU A;  1RGG A;  3J7Y d;  1GMQ A;  4KFE A;  1K8A 4;  2W56 B;  4LMI A;  1X1X A;  3IMA B;  1RN4 A;  3BND A;  5D81 A;  1ZX2 A;  5AYS C;  2CK3 H;  1LOX A;  3BNC A;  1X1U A;  1T3B A;  3MG3 A;  1GMP A;  3X3X A;  1I2G A;  3CCM 3;  3AHW A;  2XSH B;  3KN4 A;  4R1K A;  1JNQ A;  4FCM A;  1RRH A;  1VQ5 3;  1VQN 3;  5BU4 A;  2INX A;  3H3H A;  1NB3 I;  1I8V A;  1MWT A;  1RCK A;  1LOY A;  3BIR A;  3M8C A;  3QK9 A;  3DMC A;  4HM0 B;  3G6E 3;  4MMY B;  1JJ2 2;  1YVB I;  2IY2 A;  2WOH A;  3AHS A;  3G4S 3;  5STD A;  2HMJ B;  4CJN A;  1DMQ A;  4U13 A;  3EN1 B;  3FCS B;  1BRI A;  3B4P A;  3G8Z A;  3VGN A;  1BRK A;  4AKZ A;  1I3I A;  1LRA A;  1MWS A;  1UCI A;  2F5M A;  3LTB A;  2E2T A;  1F8N A;  4NPB A;  3X40 A;  3CPW 2;  5G1K A;  3WDG B;  1ULI B;  1JB5 A;  1B2X A;  1RTU A;  3IPT A;  5IEN A;  2J8X B;  3S27 A;  2UX0 A;  5BIR A;  3PCS A;  1O7M B;  4HM3 B;  2QGU A;  3FKA A;  3KSP A;  5AEU B;  1JBR A;  4N3V A;  1D6Z A;  3STD A;  2UUG C;  2RNT A;  3F7S A;  4KT3 B;  2V1L A;  4HBR A;  1CQS A;  3SXX A;  4EV2 A;  4LYL B;  4N6O B;  3UNL A;  5CLK A;  1BSC A;  2XSO B;  3JUN A;  1BNE A;  3CD6 3;  3IJE B;  4KVH A;  1BRN L;  2K54 A;  1VZZ A;  1UUG B;  1RSN A;  1IYY A;  5CF1 A;  1G02 A;  1DET A;  1MGW A;  3S5C A;  2YFJ B;  5LC7 A;  2ML5 A;  5LC6 A;  1HKX A;  1TRQ A;  1BSD A;  3GAX A;  4HAA A;  3SYU A;  4N6U A;  1FA3 A;  3A5E A;  2CWT A;  1S5A A;  4MEI A;  1PU4 A;  3NUV A;  1UDI I;  1NU3 A;  3OX9 A;  2L1S A;  3UB1 A;  3ZG5 A;  3HI7 A;  1FUT A;  3CNM A;  5FGO A;  4WP5 A;  1DMN A;  3FH1 A;  1SQW A;  5CK6 A;  4RNZ A;  4OUQ A;  3A76 A;  1FGR A;  1RN7 A;  3FG4 A;  1N9E A;  3MG1 A;  1ASK A;  3LH4 A;  2KF6 A;  3Q3F A;  1JN5 A;  2ZL8 A;  3KZT A;  1NO3 A;  1T2H A;  1O7P B;  1JB4 A;  3I0Y A;  4H3U A;  1BUQ A;  5ELU A;  5G2G A;  4CCV A;  3OXA A;  1YHQ 3;  3MWZ A;  1A90 A;  2CHC A;  6STD A;  3ROB A;  6RNT A;  1BAN A;  1M1X B;  4ORL A;  5A0O B;  1Q82 4;  1RNB A;  1FUS A;  3EBY A;  3CCE 3;  1TTO A;  2A15 A;  3MKI A;  1NDO B;  1TUH A;  3DGL A;  3OWS A;  5M1A A;  1RN1 A;  2CX1 A;  3NV0 A;  4FR9 A;  4STD A;  1T2I A;  1RGK A;  2IYJ A;  3SX1 A;  1I2F A;  3DGY A;  1I2E A;  4HVN A;  4LEH A;  2Y73 A;  1KQS 2;  4OVM A;  2CW9 A;  3K9M C;  5AIG A;  1OH0 A;  1AVK A;  1EUI C;  4FMA A;  5FW5 A;  2OQE C;  1OGX A;  3ALA A;  5IG4 A;  1OUN A;  1YGE A;  4RZM A;  3PZW A;  9RNT A;  3WA3 A;  1K9M 4;  1IV7 A;  2W9P A;  2CKF B;  3WR2 A;  1UCK A;  4K61 A;  1RGE A;  4PEJ A;  2BHM A;  1SAR A;  1TP6 A;  3CU3 A;  4L8P A;  1B2Z A;  2WOF A;  1OHP A;  1STD A;  1LOV A;  4XB5 A;  2C4B A;  3DUK A;  2UGI A;  3NQY A;  3T8N A;  4DKI A;  1Q7Y 4;  2QA4 3;  2L4V A;  1B3S A;  4FCJ A;  1U5O A;  1SIH A;  4K1U A;  3EE1 A;  3VSY A;  4BIR A;  2P0X A;  1W6Y A;  8RNT A;  2W56 A;  1BNF A;  1QVF 2;  1V57 A;  2KF4 A;  1MWU A;  2Z7A A;  1BRJ A;  3D5G A;  2H0I A;  5BXQ A;  1O7G B;  3AGN A;  4J9A A;  3EQQ B;  3NQZ A;  3HZP A;  2YFL B;  2XH9 A;  1BSE A;  2CFD A;  2KF5 A;  4LSO A;  1O7N B;  1RDS A;  3I55 3;  2C10 A;  1QVG 2;  3I56 3;  3WMD A;  3WHO A;  1KC8 4;  1TU5 A;  1SII A;  3DH2 A;  3GSP A;  3V98 A;  1EA2 A;  4ZM8 A;  1IQY A;  2AAE A;  1MNL A;  1ROA A;  3OWY A;  2FXT A;  4N6L A;  1Q9E A;  2BIR A;  2CH9 A;  1E3V A;  1IK3 A;  5AIH A;  1JKG B;  1KSI A;  3JUQ A;  2R4I A;  5ELJ A;  4N6T A;  1W7C A;  3FF2 A;  3CC2 3;  3PYJ A;  1LQM B;  1C54 A;  1FUW A;  3EF8 A;  1G0T A;  2SAR A;  2CC3 A;  2F4Y A;  4LZI A;  4HM7 B;  3CXC 2;  1W4N A;  3FGY A;  4BL2 A;  1W2Z A;  3UL6 A;  1GY5 A;  3H51 A;  4CDL A;  1SPU A;  2Y74 A;  3DGO A;  3PXM A;  1B2U A;  1A2K A;  3RDE A;  1N9J A;  3WOF B;  1RLS A;  1RNT A;  1JBS A;  4O2H A;  2F56 A;  3HK4 A;  3MYT A;  3BB9 A;  1QJG A;  1VQL 3;  2XGN A;  5CF2 A;  2IMJ A;  1BNG A;  3RNT A;  1BVI A;  1I0V A;  4H61 A;  2CFK A;  3EBT A;  4HM6 B;  3CCQ 3;  3U1W A;  3URP A;  7RNT A;  1A67 A;  3K7C A;  3GZX B;  2GBX B;  2W0Q A;  1IVW A;  3CC7 3;  2IUK A;  2W03 A;  3L0R A;  1IQ8 A;  1TJD A;  3KFQ C;  1IVU A;  1HU9 A;  2C11 A;  4R4K A;  2BO9 B;  5TGN A;  1BNR A;  2OCT A;  3EB8 A;  1CH0 A;  1M9G A;  4L8O A;  1VQQ A;  3KCH A;  3HOH A;  4BL3 A;  4EXR A;  1LQG C;  3MHE A;  3JUM A;  4G1M B;  1FYS A;  2CFG A;  1BIR A;  3OV4 A;  2SBL A;  7STD A;  1N8R 4;  3DGM A;  4K1V A;  3GZR A;  3SOY A;  1GSP A;  1YJW 3;  5M19 A;  1TIJ A;  3KKG A;  1UCL A;  1LXE A;  2D1W A;  3Q1C A;  4BTW A;  4HYZ A;  2CWV A;  3JVC A;  2OQE A;  2IUJ A;  4O8S A;  3G71 3;  4WYK B;  1WNH A;  3DM8 A;  1I0X A;  3LML A;  1BUJ A;  5EEO A;  1UGI A;  1N8Q A;  2KF3 A;  4WFO A;  1BGS A;  2E2V A;  2F98 A;  1AVL A;  2ZHX B;  1VQP 3;  1NJI 4;  2W04 A;  1FGQ A;  3EJV A;  2W6J H;  1Q40 B;  1WMN A;  4O02 B;  1Q42 A;  1K41 A;  3CNX A;  3LZA A;  3ECF A;  3GRD A;  5AIF A;  3UL5 A;  2R41 A;  1OPY A;  3T0U A;  7GSP A;  1X1Y A;  5DRV A;  3G0K A;  1LOW A;  3D79 A;  1YIJ 3;  3T8U A;  3K0Z A;  1QAL A;  3Q90 A;  3X41 A;  1AY7 A;  3O8Y A;  5KP4 A;  2F86 B;  3CCJ 3;  5CXO A;  5I97 A;  2QEX 3;  1GY6 A;  1X1W A;  2RFR A;  4GHO A;  1PYL A;  1UW1 A;  5HOH A;  5AYR B;  3WA2 X;  3WOD G;  4N6M A;  4HZ9 B;  4X2H A;  1VQ4 3;  3B4O A;  1E97 A;  2HMM B;  3PCR A;  3DZL A;  3BLZ A;  4ILF A;  5JBS A;  2RGQ A;  3CCV 3;  3B7C A;  3FG3 A;  2Z76 A;  3KSE D;  1LNH A;  3D9R A;  1FZU A;  3N9H A;  2OOV A;  2GEX A;  1M90 4;  1OHS A;  2XF3 A;  1J2B A;  3K5T A;  2LQV A;  2W9Q A;  2H0H A;  3JUO A;  1B2M A;  1ZS7 A;  1EG9 B;  1JZO A;  1BAO A;  2P05 A;  2FGT A;  2OWP A;  3AMO B;  3QRD A;  4J5K A;  3G16 A;  1PY3 A;  3UJM A;  4I4K A;  4Q53 A;  1W6C A;  1OAC A;  5EVH A;  3D5I A;  1KWI A;  2BMO B;  2ZDJ A;  1W5Z A;  1B20 A;  4L7K A;  1LVN A;  1Q81 4;  5AEW B;  1OF5 B;  2CG0 A;  3RGA A;  4AEQ A;  1BRS A;  4WWU C;  1K73 4;  1GOV A;  3RGR A;  1SJW A;  3BU4 A;  3CCR 3;  3LTA A;  5KP3 A;  1NNV A;  2RBI A;  5D82 A;  2F99 A;  1JKG A;  1L5G B;  2HMN B;  1RHL A;  2GEY A;  5AI1 A;  3SLU A;  4WHA A;  1I3F A;  1DMM A;  3GWR A;  3F8H A;  1GOY A;  4AKY A;  1KD1 4;  3FSD A;  5AII A;  3V92 A;  2BMR B;  5RNT A;  4LGQ A;  3ZFZ A;  1CYU A;  3U97 A;  4JF8 A; 
#chains in the Genus database with same CATH homology
 1Z1S A;  2CIU A;  1Y4K A;  1K28 A;  4HJL B;  1YJN 3;  4GB5 A;  3LTD A;  3CMA 3;  5EQL A;  3CPO A;  4R80 A;  4FMC A;  5IG0 A;  4MJD A;  1U8C B;  3SVA A;  5JPU A;  1CEW I;  2Z77 A;  3FF0 A;  8CHO A;  1NWW A;  3NBR A;  3V99 A;  5JPP A;  3GZB A;  2D42 A;  3S67 A;  4HM1 B;  1JB2 A;  4EV5 A;  3TDG A;  1US1 A;  4NHF A;  4JRF A;  4NRE A;  1NB5 I;  1D6Y A;  1PFP A;  4IIA A;  4QWT A;  5HGR A;  1QMA A;  3X42 A;  4EBG A;  2GXF A;  3FLJ A;  1IDP A;  3LT8 A;  1WQL B;  2O3O A;  1O7H B;  1W2B 2;  2M7O A;  2XFS A;  4RNY A;  3NM7 A;  1RRL A;  2BNG A;  2HML B;  3SOA A;  3MPH A;  4XDW A;  1IVX A;  3NXJ A;  1YI2 3;  2BT3 A;  2RCD A;  2RSX A;  4HKV B;  1OHO A;  5IF6 A;  4WYK A;  4OK0 A;  5IER A;  4EC6 A;  2XFT A;  3EC9 A;  3EX9 A;  3B8L A;  3F40 A;  1Q86 4;  1UI7 A;  1Q40 A;  5D83 A;  3N8B A;  4IPB A;  1GD4 A;  3K63 A;  4R9K A;  2W2C A;  3PGB A;  1AR0 A;  2GBW B;  4IT7 A;  3EHC A;  4HM8 B;  5IEO A;  3DXO A;  2MC8 A;  2YX9 A;  2YFI B;  1DYU A;  2PNC A;  3DY5 A;  3S28 A;  2CG1 A;  3Q2P A;  2CFL A;  4BTY A;  1FGT A;  1W01 A;  4R9L A;  4HM4 B;  3DGN A;  1N5H A;  1YJ9 3;  3MG2 A;  3HII A;  4XBX A;  3KII A;  3LXU X;  5KP1 A;  1VQ7 3;  3SED A;  3MSO A;  1GD3 A;  1JRQ A;  2BMQ B;  2E2U A;  4XDV A;  1W00 A;  2Q07 A;  1FGM A;  2CFW A;  1T5Y A;  3LT9 A;  2IA7 A;  1AV4 A;  1VQ8 3;  4TX4 A;  3D3L A;  1DVD A;  3CCS 3;  3AMO A;  2K0M A;  3CC4 3;  1GYB A;  2KRT A;  5IG5 A;  3BNB A;  2PZV A;  2P0M A;  1QAK A;  4HZB B;  4N6V 0;  4KFD A;  1UUW B;  1R4C A;  4MMX B;  5IEP A;  3HIG A;  4MMZ B;  1ROV A;  1RKY A;  1OF5 A;  2STD A;  3OW2 2;  2P09 A;  1IVV A;  4X2O A;  5BVB A;  1IV9 A;  1TFO A;  4FMD A;  5DRE A;  2HMK B;  3X3Z A;  2XR8 B;  3F8X A;  1VQ9 3;  3LOY A;  4FCZ A;  2WGO A;  2I9W A;  1IT7 A;  3LTC A;  2KCD A;  1ZO2 A;  1GY7 A;  1E3R A;  1CYV A;  1VQK 3;  2KXG A;  3N54 B;  2GU1 A;  3F9S A;  4K90 B;  4RBN A;  4O3V A;  2JDI H;  1ISK A;  3F14 A;  3HX8 A;  1MOL A;  2HMO B;  3NHX A;  2Z6B A;  1EKM A;  3FZW A;  1UI8 A;  3NBJ A;  4KFF A;  3NM2 A;  1N5P A;  1W6G A;  1JN5 B;  1O7W B;  1A2V A;  1OCV A;  1IQX A;  1V74 A;  2WO0 A;  1UUV B;  1ULJ B;  3E99 A;  3CCL 3;  2O9U X;  3EN8 A;  1QAF A;  4N6N B;  1VQ6 3;  1JV2 B;  2MF7 A;  2XGL A;  2CWU A;  4FMB A;  4KZ1 A;  3X3Y A;  5IG3 A;  1WTH A;  1S72 3;  2OTJ 3;  1DVC A;  3BNE A;  1YIT 3;  1IU7 A;  1GS3 A;  1D6U A;  3NV0 B;  3ER7 A;  4J8T A;  4HM2 B;  4XBT A;  1G96 A;  2LYX A;  3LYG A;  3CME 3;  1EQK A;  4XBY A;  1FGO A;  1WMP A;  3NX0 A;  2XRX B;  3GZY B;  2FNQ A;  4GL6 A;  3WOE B;  3VF1 A;  2GU3 A;  2JQ5 A;  3CCU 3;  4XM4 A;  1M1K 4;  3FG1 A;  5IW9 A;  1OGZ A;  1TFK A;  1W02 A;  3PS8 A;  4BTX A;  3KE7 A;  4HM5 B;  2OOV C;  1C7H A;  2P38 A;  1STF I;  2B1X B;  1WMO A;  2ML6 A;  2WGQ A;  3S29 A;  1VQO 3;  2B24 B;  2QIY A;  2XEP A;  3NBB A;  1IT8 A;  4EYC A;  1RJO A;  2OTL 3;  1VQM 3;  3F7X A;  3JUP A;  3OWU A;  3J7Y d;  4KFE A;  1K8A 4;  2W56 B;  4LMI A;  3IMA B;  3BND A;  5D81 A;  1ZX2 A;  5AYS C;  2CK3 H;  1LOX A;  3BNC A;  3MG3 A;  3X3X A;  3CCM 3;  2XSH B;  3KN4 A;  4R1K A;  1JNQ A;  4FCM A;  1RRH A;  1VQ5 3;  1VQN 3;  2INX A;  3H3H A;  1NB3 I;  3M8C A;  3QK9 A;  3G6E 3;  4HM0 B;  3DMC A;  1JJ2 2;  4MMY B;  1YVB I;  2WOH A;  3G4S 3;  5STD A;  2HMJ B;  5JBS A;  1DMQ A;  4U13 A;  3EN1 B;  3FCS B;  3G8Z A;  3B4P A;  3VGN A;  4AKZ A;  3X40 A;  3LTB A;  2E2T A;  1F8N A;  3CPW 2;  3WDG B;  1ULI B;  1JB5 A;  3IPT A;  5IEN A;  3S27 A;  2UX0 A;  3PCS A;  1O7M B;  4HM3 B;  2QGU A;  3FKA A;  3KSP A;  5AEU B;  4N3V A;  1D6Z A;  3STD A;  3F7S A;  2V1L A;  4HBR A;  1CQS A;  3SXX A;  4EV2 A;  4N6O B;  3UNL A;  5CLK A;  3JUN A;  2XSO B;  3CD6 3;  3IJE B;  4KVH A;  2K54 A;  1VZZ A;  5CF1 A;  3S5C A;  2YFJ B;  5LC7 A;  2ML5 A;  5LC6 A;  1HKX A;  3GAX A;  1FA3 A;  4N6U A;  2CWT A;  1S5A A;  4MEI A;  1PU4 A;  3NUV A;  1NU3 A;  3OX9 A;  3UB1 A;  3HI7 A;  3CNM A;  5FGO A;  4WP5 A;  1DMN A;  3FH1 A;  1SQW A;  5CK6 A;  4RNZ A;  4OUQ A;  3A76 A;  1FGR A;  1RN7 A;  3FG4 A;  1N9E A;  3MG1 A;  1ASK A;  3LH4 A;  1JN5 A;  2ZL8 A;  3KZT A;  1NO3 A;  1O7P B;  1JB4 A;  3I0Y A;  4H3U A;  1BUQ A;  5ELU A;  5G2G A;  4CCV A;  3OXA A;  1YHQ 3;  3MWZ A;  1A90 A;  2CHC A;  6STD A;  3ROB A;  1M1X B;  4ORL A;  5A0O B;  1Q82 4;  3EBY A;  3CCE 3;  2A15 A;  3MKI A;  1NDO B;  1TUH A;  3DGL A;  3OWS A;  3NV0 A;  4FR9 A;  4STD A;  3SX1 A;  4HVN A;  4LEH A;  2Y73 A;  1KQS 2;  4OVM A;  2CW9 A;  3K9M C;  5AIG A;  1OH0 A;  1AVK A;  4FMA A;  5FW5 A;  2OQE C;  1OGX A;  3ALA A;  5IG4 A;  1OUN A;  1YGE A;  4RZM A;  3PZW A;  3WA3 A;  1K9M 4;  1IV7 A;  2W9P A;  2CKF B;  4K61 A;  4PEJ A;  2BHM A;  1TP6 A;  3CU3 A;  4L8P A;  2WOF A;  1OHP A;  1STD A;  4XB5 A;  3DUK A;  3NQY A;  3T8N A;  1Q7Y 4;  2QA4 3;  2L4V A;  4FCJ A;  1U5O A;  1SIH A;  4K1U A;  3EE1 A;  3VSY A;  2P0X A;  1W6Y A;  2W56 A;  1QVF 2;  2Z7A A;  5BXQ A;  1O7G B;  4J9A A;  3EQQ B;  3NQZ A;  3HZP A;  2YFL B;  2XH9 A;  2CFD A;  4LSO A;  1O7N B;  3I55 3;  2C10 A;  1QVG 2;  3I56 3;  3WMD A;  1KC8 4;  1TU5 A;  1SII A;  3V98 A;  4ZM8 A;  1EA2 A;  1IQY A;  1MNL A;  1ROA A;  3OWY A;  2FXT A;  4N6L A;  2CH9 A;  1E3V A;  1IK3 A;  5AIH A;  1JKG B;  1KSI A;  3JUQ A;  2R4I A;  5ELJ A;  4N6T A;  1W7C A;  3FF2 A;  3CC2 3;  3PYJ A;  1FUW A;  3EF8 A;  2CC3 A;  4LZI A;  4HM7 B;  3CXC 2;  1W4N A;  3FGY A;  1W2Z A;  3UL6 A;  1GY5 A;  3H51 A;  4CDL A;  2Y74 A;  1SPU A;  3DGO A;  3PXM A;  1A2K A;  3RDE A;  3WOF B;  1N9J A;  4O2H A;  3HK4 A;  3MYT A;  3BB9 A;  1QJG A;  1VQL 3;  2XGN A;  5CF2 A;  2IMJ A;  4H61 A;  2CFK A;  3EBT A;  4HM6 B;  3CCQ 3;  3U1W A;  1A67 A;  3K7C A;  3GZX B;  2GBX B;  2W0Q A;  1IVW A;  3CC7 3;  2IUK A;  2W03 A;  3L0R A;  1IQ8 A;  3KFQ C;  1IVU A;  1HU9 A;  2C11 A;  4R4K A;  2BO9 B;  5TGN A;  2OCT A;  3EB8 A;  1M9G A;  4L8O A;  4EXR A;  3MHE A;  4G1M B;  3JUM A;  2CFG A;  3OV4 A;  2SBL A;  7STD A;  1N8R 4;  3DGM A;  4K1V A;  3GZR A;  3SOY A;  1YJW 3;  1TIJ A;  3KKG A;  1LXE A;  2D1W A;  3Q1C A;  4BTW A;  4HYZ A;  2CWV A;  3JVC A;  2OQE A;  2IUJ A;  4O8S A;  3G71 3;  4WYK B;  1WNH A;  3DM8 A;  3LML A;  5EEO A;  1N8Q A;  4WFO A;  2E2V A;  2F98 A;  1AVL A;  1VQP 3;  1NJI 4;  2W04 A;  1FGQ A;  3EJV A;  2W6J H;  1Q40 B;  1WMN A;  4O02 B;  1Q42 A;  1K41 A;  3CNX A;  3LZA A;  3ECF A;  3GRD A;  5AIF A;  3UL5 A;  1OPY A;  3T0U A;  5DRV A;  3G0K A;  1YIJ 3;  3T8U A;  3K0Z A;  1QAL A;  3Q90 A;  3X41 A;  3O8Y A;  5KP4 A;  2F86 B;  3CCJ 3;  5CXO A;  5I97 A;  2QEX 3;  1GY6 A;  2RFR A;  1UW1 A;  5AYR B;  3WA2 X;  3WOD G;  4N6M A;  4HZ9 B;  4X2H A;  1VQ4 3;  3B4O A;  1E97 A;  2HMM B;  3PCR A;  3DZL A;  3BLZ A;  3CCV 3;  2RGQ A;  3B7C A;  3FG3 A;  2Z76 A;  3KSE D;  1LNH A;  3D9R A;  3N9H A;  2OOV A;  2GEX A;  1M90 4;  1OHS A;  2XF3 A;  1J2B A;  3K5T A;  2LQV A;  2W9Q A;  3JUO A;  1EG9 B;  2P05 A;  2FGT A;  2OWP A;  3AMO B;  3QRD A;  3G16 A;  3UJM A;  4I4K A;  4Q53 A;  1W6C A;  1OAC A;  5EVH A;  1KWI A;  2BMO B;  2ZDJ A;  1W5Z A;  4L7K A;  1LVN A;  1Q81 4;  5AEW B;  1OF5 B;  2CG0 A;  3RGA A;  4AEQ A;  4WWU C;  1K73 4;  3RGR A;  1SJW A;  3CCR 3;  3LTA A;  5KP3 A;  5D82 A;  2F99 A;  1JKG A;  1L5G B;  2HMN B;  2GEY A;  5AI1 A;  3SLU A;  4WHA A;  1DMM A;  3GWR A;  3F8H A;  4AKY A;  1KD1 4;  3FSD A;  5AII A;  3V92 A;  2BMR B;  4LGQ A;  1CYU A;  3U97 A;  4JF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...