3OV4A

Crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
120
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ketosteroid Isomerase P39GV40GS42G from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
molecule tags Transferase
molecule keywords Steroid Delta-isomerase
total genus 30
structure length 120
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ov4A00
4R9LA 3F7XA 1Z1SA 3KZTA 4WYKB 1K41A 3F8XA 5DRVA 1O7WB 4HKVB 1O7HB 2YFIB 4HM2B 4L8OA 4XB5A 3MKIA 5DREA 1WQLB 3EF8A 5IG5A 3F8HA 3MG3A 4IIAA 2QIYA 4U13A 5KP3A 5CF1A 3FF0A 3OV4A 1EG9B 3JUOA 2GEXA 3K7CA 4HZBB 1OF5B 3SEDA 3B4PA 3G16A 3F7SA 3GWRA 3VGNA 3OXAA 3FGYA 3RGAA 1C7HA 3ECFA 4HM4B 3GZRA 5IEPA 3NUVA 5STDA 1OUNA 3D9RA 5AEWB 2OWPA 2XR8B 2YFJB 2STDA 2W2CA 1GYBA 3EHCA 4R1KA 5IG3A 1OGXA 1Q40B 1W01A 2HMNB 4Q53A 1NDOB 1JKGA 5D82A 1OF5A 2R4IA 4MJDA 3WMDA 1DMQA 1TUHA 2HMLB 2BMRB 1QJGA 3B4OA 3BB9A 3FSDA 3K0ZA 1GY7A 2B1XB 2CKFB 2GBXB 1U5OA 2A15A 2HMOB 3GRDA 5KP1A 5AIIA 1ZO2A 3F40A 3Q90A 3HZPA 4XM4A 3F14A 3I0YA 2BMOB 2QGUA 4HM6B 1W00A 4HM8B 4J9AA 1EA2A 3JUQA 5D83A 3FZWA 2F86B 2RFRA 3NV0A 5JPPA 1ZX2A 4LMIA 3FLJA 3LYGA 4L7KA 3G0KA 4OVMA 5CXOA 1GY5A 1Q42A 1O7GB 3GZYB 3OX9A 3JUPA 1ASKA 5AIGA 1W02A 3SOAA 4KVHA 4PEJA 3EJVA 2F99A 1JKGB 1DMNA 1TP6A 2Z76A 4OUQA 1OCVA 5IG0A 2Z77A 4HM0B 1E3VA 4L8PA 2B24B 3GZXB 3G8ZA 4HM1B 3CPOA 1OH0A 2UX0A 3MG2A 4FCMA 5HGRA 1E3RA 4R9KA 1A2KA 1JB4A 3M8CA 2XSHB 3UNLA 3EBTA 3EC9A 1JN5B 3F9SA 3MHEA 1IDPA 3B8LA 1OHSA 3MSOA 4K1VA 4XDWA 5AI1A 1ULJB 3DUKA 2XRXB 1O7PB 1JB5A 3NV0B 3OWSA 4K1UA 5IERA 4X2OA 5IG4A 3DM8A 5IENA 1UUVB 6STDA 5JPUA 3CNMA 5FW5A 3EX9A 3OWYA 1QMAA 3DXOA 3CU3A 5IF6A 1GS3A 1OHOA 3EQQB 3IPTA 1O7MB 3CNXA 4H3UA 1W6YA 3NXJA 1NWWA 3LZAA 5AIFA 4GB5A 3ROBA 3SOYA 3HK4A 2IMJA 3KSPA 4FCJA 2I9WA 3BLZA 3NBRA 3NM2A 5AIHA 3STDA 2F98A 1DMMA 4WYKA 3H51A 4I4KA 4LGQA 5EVHA 3T8UA 2RCDA 1ISKA 1VZZA 3NHXA 1E97A 3JUMA 5TGNA 4WP5A 3KE7A 3KKGA 3FH1A 4HZ9B 1BUQA 3MYTA 3OWUA 2GXFA 2INXA 1JB2A 3MG1A 4HM5B 4STDA 4CDLA 1ULIB 1Q40A 3EN1B 4N3VA 1OHPA 3B7CA 2YFLB 5IEOA 1UUWB 3S5CA 1NU3A 2JQ5A 1STDA 5D81A 1S5AA 4LEHA 3H3HA 4ORLA 3FKAA 4XDVA 4WWUC 4X2HA 1SJWA 3E99A 3RGRA 4HM3B 7STDA 2GBWB 1HKXA 2HMMB 2Z7AA 1O7NB 3DZLA 3EN8A 5G2GA 5BVBA 1JN5A 3HX8A 1OGZA 8CHOA 2CHCA 3T8NA 1AR0A 3UJMA 3EBYA 2XSOB 3A76A 3ER7A 5CK6A 4XBYA 4XBXA 5BXQA 2RGQA 2PZVA 3FF2A 1OPYA 1CQSA 3DMCA 2HMKB 4RZMA 4HVNA 1GY6A 2BNGA 4J8TA 5KP4A 2K54A 2BMQB 3GZBA 5CLKA 4HM7B 3VSYA 5AEUB 2HMJB 5CF2A 3JUNA 4XBTA 2GEYA 4HJLB
chains in the Genus database with same CATH superfamily
1MGWA 1K734 4WFOA 4BIRA 1YJW3 3F8XA 4MMXB 1O7WB 2K3DA 1A67A 3HI7A 1GSPA 4GHOA 2C10A 4IIAA 5CF1A 4FMBA 4KFDA 1GD3A 2RNTA 3DGMA 3FF0A 3OV4A 4IPBA 4HZBB 1JRQA 1TRPA 2OCTA 3ZG0A 3RDEA 2W9QA 3OXAA 3ECFA 1AVKA 1QALA 1BUJA 5IEPA 1IVUA 2XGLA 2XR8B 2YFJB 4R1KA 4ZM8A 5BU4A 5IG3A 1RN1A 4Q53A 1W01A 2HMNB 5M19A 1NDOB 1C54A 3GSPA 2R4IA 1W2B2 1DMQA 3NQZA 3FG1A 2BMRB 1N8R4 4LZIA 3K0ZA 7RNTA 3IMAB 1UCKA 2CKFB 2GBXB 1BGSA 1SQWA 1EUIC 4AKZA 3Q90A 3A5EA 2ZL8A 2M7OA 2BMOB 3K9MC 1GOYA 4HM8B 1TRQA 1EA2A 1G96A 3WA3A 2FGTA 2RFRA 5JPPA 3PGBA 1ZX2A 4LMIA 2WO0A 3FLJA 2J8XB 1SIHA 4L7KA 1MGRA 2W6JH 1I0XA 1LQGC 2KF6A 1LOVA 2AAEA 3SOAA 3PZWA 1LNIA 1N9EA 1PFPA 2IA7A 1YIT3 1N5PA 1IV9A 1K8A4 1VQ43 1Q814 3GZXB 1NB3I 4HM1B 1VQL3 3MG2A 1RGGA 2CWTA 4O2HA 2P05A 2XSHB 3V98A 1TTOA 1JN5B 3D79A 4K1VA 3MSOA 1OHSA 2XRXB 1O7PB 3UB1A 4RNTA 1QVF2 1N8QA 4DKIA 1PU4A 1UUVB 6STDA 2C11A 3CD63 3CNMA 3VF1A 1BU4A 1BNEA 3RNTA 3CME3 3CCU3 4LYLB 3CU3A 1K9M4 1GS3A 3EQQB 1IVXA 3CNXA 1NWWA 3CCQ3 1IVWA 1BNIA 2KAAA 1CYUA 1FUWA 1FW7A 2I9WA 2P0XA 1RHLA 3STDA 2F98A 4FMDA 4LGQA 1IK3A 1PY3A 1J2BA 5M1AA 2CX0A 3ZG5A 3KKGA 3D3LA 3OWUA 4FR9A 1RGLA 1UI7A 1K28A 1LOWA 1N9JA 3MG1A 4CDLA 1Q824 1BRNL 4O3VA 1OHPA 2OQEC 5IEOA 2LQVA 3X40A 3S5CA 1ZS7A 5LC6A 1YGEA 1STDA 1CYVA 4LEHA 3H3HA 3FKAA 2D42A 2OQEA 4WWUC 1Y4KA 3Q2PA 2CG0A 2GBWB 1Q7HA 1JN5A 1U8CB 3HX8A 1WMPA 2CHCA 2ML6A 2FXTA 3LTDA 2QA43 3SLUA 1ROAA 1KWIA 3HOHA 3CPW2 1OPYA 3S27A 3V99A 4RZMA 5AYRB 1BNSA 5CLKA 4HM7B 3X41A 5AEUB 2GEYA 4RBNA 3KZTA 1RSNA 2ZA4A 4GL6A 2OTL3 4HKVB 1YVSA 4L8OA 2YFIB 5IG5A 1W6CA 3MG3A 1EG9B 1DVCA 3AHWA 3S67A 1GMQA 3I563 1AQZA 2CG1A 1UCIA 1RCLA 5STDA 1UGHI 2KCDA 2RSXA 2OWPA 1EKMA 2STDA 3G6E3 3QK9A 1X1UA 1IQXA 2F5WA 4I5QA 1A90A 1B2XA 2HMLB 1SIIA 5I97A 1IQ8A 2KF4A 1BNGA 1DE3A 2B1XB 2BO9B 2WOFA 2HMOB 3GRDA 1FA3A 1X1YA 5AIIA 1ZO2A 4IT7A 5A0OB 3PYJA 3F14A 3LTBA 4N6LA 1YJN3 4J9AA 4HAAA 4WHAA 3JUQA 4O02B 1NO3A 1UCLA 1YNVX 4K61A 3G0KA 1HZ1A 1Q42A 4N6V0 3MPHA 3OX9A 1ASKA 1FGMA 1B21A 1KC84 1I0VA 4PEJA 4EW5A 3EJVA 1JKGB 3LMLA 1L5GB 1BSAA 3S28A 1QAKA 2OOVC 1MOLA 1LQMB 1VQM3 2B24B 1RGAA 3KIIA 1BSDA 1JV2B 2UX0A 2GSPA 3AMOA 1JB4A 2OTJ3 1I8VA 2P38A 3X42A 3EBTA 5EEOA 3MHEA 3F9SA 5ELUA 3B8LA 3OWSA 3NV0B 5IERA 4N6TA 1GD4A 4FMCA 3X3XA 5IG4A 3WODG 1X1WA 2CX1A 2WGQA 1GOVA 3LH4A 2BHMA 3PCSA 3DXOA 3SYUA 4KFFA 3IPTA 4H3UA 7GSPA 1O7MB 1UW1A 3G713 1M904 1X1XA 3NQYA 3ROBA 4G1MB 1WMNA 1B27A 3CMA3 4RNZA 1F8NA 1SARA 2UGIA 3NM2A 3CC73 1DYUA 1HYFA 5HOHA 1RGKA 5ELJA 4I4KA 1CH0A 4N6OB 3T8UA 2RCDA 5RNTA 3NHXA 2SARA 3S29A 3JUMA 4WP5A 1UI8A 3FH1A 2E2TA 2KRTA 1KD14 1BRGA 1JB2A 2SBLA 4HM5B 4STDA 1Q40A 1N5HA 2YX9A 2KXGA 2YFLB 1FUTA 3LT9A 3CCM3 2JQ5A 1NNVA 4BU4A 1BRIA 1S5AA 3AHSA 3LT8A 4FMAA 4U13A 1IT7A 5D81A 1GMRA 2IYJA 3RGRA 7STDA 2CWUA 1T5YA 4HBRA 2Z7AA 2W04A 8CHOA 4BL2A 3T8NA 1RN7A 3EBYA 3N54B 1RGEA 4O8SA 1BRSA 3A76A 3N8BA 1I3FA 3QRDA 1KSIA 2KF5A 5GSPA 2KF3A 1Q7Y4 1CQSA 3DMCA 3BNEA 2BNGA 1US1A 2BMQB 5G1KA 4EYCA 5LC7A 1LOXA 3VSYA 1V74A 3HIGA 3JUNA 4R9LA 2D1WA 3U97A 3F7XA 3J7Yd 5DRVA 1TU5A 1I70A 1VQ83 4N6UA 4TX4A 1O7HB 4HM2B 5DREA 4XB5A 3DGNA 3MKIA 1RRLA 1WQLB 2MC8A 2CWVA 1VQ93 3GAXA 2QIYA 5KP3A 2ML5A 3JUOA 3SEDA 1OF5B 3K63A 3GWRA 3VGNA 1BRKA 3FGYA 1T3BA 3FCSB 1IYYA 1R4YA 3GZRA 3N9HA 3NUVA 1OACA 1DETA 1EEJA 5AEWB 5M18A 2CIUA 3EHCA 3V92A 3CCR3 3DGLA 1M1K4 1MWSA 1OGXA 1JZOA 3PCRA 2ZDJA 3Q1CA 3SX1A 1YGWA 3B4OA 1QJGA 3ALAA 2LYXA 3FSDA 1I3IA 4EC6A 2CFKA 4GSPA 1GY7A 3NBJA 1BNFA 3HIIA 1U5OA 2A15A 4KFEA 5KP1A 1VQ63 3F40A 2FNQA 2W03A 3I0YA 1VQP3 2F5MA 2QGUA 4HM6B 1W00A 2Y73A 3Q3FA 1TFOA 5D83A 2F86B 2QEX3 3NV0A 1Q9EA 1V58A 3LYGA 4OVMA 5CXOA 1GY5A 5IW9A 1O7GB 1IVVA 2C4BA 3JUPA 5AIGA 1W02A 4KVHA 1KQS2 1I2EA 1BOXA 1DMNA 4ILFA 2L4VA 1PYLA 4OUQA 1RRHA 1OCVA 5FGOA 1MWTA 2Z77A 1E3VA 2XGNA 4JF8A 3CCL3 2E2UA 2F56A 3G8ZA 1RNBA 3BIRA 5HGRA 1D6UA 1E3RA 1B2UA 1A2KA 1W2ZA 3M8CA 4KZ1A 4R9KA 4CCVA 2V1LA 3UNLA 3EC9A 1IDPA 4XDWA 3CC43 3BNBA 1ULJB 3DUKA 2H0HA 1RDSA 1B2ZA 4X2OA 3DM8A 5IENA 1FUSA 3K5TA 4BTWA 1LVNA 5FW5A 3DGOA 3EX9A 3OWYA 4HYZA 1QMAA 1GOUA 2F4YA 1DVDA 3SXXA 1WTHA 3NXJA 3LZAA 5AIFA 3EB8A 4OK0A 3SOYA 3KSPA 2IMJA 4FCJA 1FGQA 3BLZA 3WDGB 3NBRA 3ZFZA 2XEPA 1DMMA 4WYKA 2BU4A 3CCS3 1ISKA 3L0RA 1W5ZA 2E2VA 1VZZA 5AYSC 3G4S3 3KN4A 1S723 1JZDA 1RMSA 5TGNA 3KE7A 1IT8A 1G0TA 2IUJA 3MYTA 3URPA 5BIRA 1YHQ3 3NBBA 1JBRA 1RGCA 2W56B 1ULIB 1BVIA 1RJOA 2OOVA 4N3VA 2MF7A 1UUWB 1BSEA 3KFQC 4MMZB 1FGTA 2BIRA 4NPBA 3IJEB 1I2GA 4BTXA 5JBSA 1WNHA 1VQK3 4N6MA 1LNHA 4EV2A 3E99A 1B2SA 3AMOB 3D5GA 2HMMB 1HKXA 3DZLA 3EN8A 1O7NB 5G2GA 4BTYA 1OGZA 1T2IA 1LOYA 6GSPA 1UCJA 1A2VA 2XSOB 3BNCA 1BANA 4XBXA 1IU7A 1D6ZA 1FGOA 5BXQA 4BL3A 1STFI 3KSED 2HMKB 3KCHA 4HVNA 1LXEA 1ROVA 1YVBI 2P0MA 4H61A 4J8TA 2W56A 1RGHA 3GZBA 1HU9A 5KP4A 1I2FA 1JJ22 3O8YA 2HMJB 5CF2A 2CFGA 4J5KA 3WHOA 5IG0A 1IV7A 3PXMA 5G1LA 3DH2A 1A2PA 1EQKA 1Z1SA 4WYKB 1K41A 1RTUA 1W7CA 3EF8A 3F8HA 1YI23 1BNRA 3T0UA 3X3ZA 1Q864 4CJNA 2XFSA 8RNTA 3K7CA 1YIJ3 1W4NA 2GEXA 2K0MA 3B4PA 3F7SA 3DGYA 3G16A 3NM7A 4QWTA 3UL6A 1CEWI 2GU1A 1C7HA 2XH9A 2Y74A 3RGAA 4HM4B 3WR2A 3X3YA 4CPKA 1OUNA 3BNDA 3D9RA 4J5GA 2W2CA 3WA2X 1GYBA 1QAFA 1TIJA 3SVAA 1WMOA 1Q40B 1D6YA 2H0GA 4JRFA 1RKYA 1JKGA 5D82A 1AY7A 1OF5A 4MJDA 3WMDA 1FGRA 1TUHA 1ZGXA 3BB9A 3NX0A 1BIRA 1LRAA 1UGIA 1VQQA 1M1XB 2XFTA 3WOFB 3OW22 4K90B 2CW9A 1BSCA 3FG3A 3CXC2 3AGOA 3MWZA 3HZPA 3UL5A 4XM4A 4FCZA 4HOHA 2W0QA 1AVLA 3FZWA 4LSOA 1YJ93 2JDIH 3D5IA 1M9GA 4MEIA 2Q07A 1MWRA 1UUGB 3GZYB 1FYSA 2CK3H 1RCKA 2O3OA 4KT3B 3PS8A 2WOHA 2ZHXB 1JBSA 1V57A 2F99A 1TP6A 2IY2A 2Z76A 3LTAA 4R80A 1MWUA 4HM0B 2O9UX 4L8PA 1B20A 3AGNA 3CPOA 1OH0A 1JNQA 2IUKA 4FCMA 1T2HA 1BSBA 4AKYA 2L1SA 1RGFA 1B3SA 1IQYA 1BAOA 2RBIA 3CCE3 3BU4A 2W9PA 5AI1A 1NB5I 4K1UA 1JB5A 2AADA 5EQLA 3LTCA 2CH9A 5JPUA 1FZUA 1TJDA 3WOEB 1RNTA 1B2MA 2XF3A 5IF6A 2UUGC 1OHOA 1VQN3 1W6YA 2WGOA 3U1WA 4GB5A 1GMPA 3HK4A 1VQ53 5AIHA 2HOHA 1UDII 1TFKA 3H51A 5EVHA 1AV4A 3TDGA 4EBGA 1E97A 2CC3A 1NJI4 3CC23 2CFDA 1BUQA 4HZ9B 3I553 2P09A 2GXFA 3FG4A 3DY5A 2INXA 4AEQA 3EE1A 4EV5A 1RN4A 1QVG2 3EN1B 3B7CA 2CFWA 1NU3A 6RNTA 2Z6BA 1W6GA 1G02A 4ORLA 4XDVA 4R4KA 4X2HA 1SJWA 1BRJA 4HM3B 1R4CA 4NHFA 3JVCA 1VQ73 5BVBA 2CFLA 9RNTA 1SPUA 1AR0A 2BT3A 4EXRA 3UJMA 4MMYB 1BRHA 3LOYA 4N6NB 3ER7A 5CK6A 4XBYA 3CCJ3 1MNLA 2RGQA 2PNCA 2PZVA 3FF2A 3D4AA 4NREA 3CCV3 1BNJA 1GY6A 1RLSA 1JBTA 2K54A 3LXUX 1VQO3 2GU3A 2H0IA 4RNYA 4XBTA 2R41A 4HJLB
chains in the Genus database with same CATH topology
1K734 4WFOA 1YJW3 3F8XA 4MMXB 1O7WB 1A67A 3HI7A 2C10A 4IIAA 5CF1A 4FMBA 4KFDA 1GD3A 3DGMA 3FF0A 3OV4A 4IPBA 4U13A 4HZBB 1JRQA 2OCTA 3RDEA 2W9QA 3OXAA 3ECFA 1AVKA 1QALA 5IEPA 1IVUA 2XGLA 2YFJB 2XR8B 4R1KA 4ZM8A 5IG3A 4Q53A 1W01A 2HMNB 1NDOB 2R4IA 1W2B2 1DMQA 3NQZA 3FG1A 2BMRB 1N8R4 4LZIA 3K0ZA 3IMAB 2CKFB 2GBXB 1SQWA 4AKZA 3Q90A 2ZL8A 2M7OA 2BMOB 3K9MC 4HM8B 1EA2A 1G96A 3WA3A 2FGTA 2RFRA 5JPPA 3PGBA 1ZX2A 4LMIA 2WO0A 3FLJA 4L7KA 1SIHA 2W6JH 3SOAA 3PZWA 1N9EA 1PFPA 2IA7A 1YIT3 1N5PA 1IV9A 1K8A4 1VQ43 1Q814 3GZXB 1NB3I 4HM1B 1VQL3 3MG2A 2CWTA 4O2HA 2P05A 2XSHB 3V98A 1JN5B 4K1VA 3MSOA 1OHSA 2XRXB 1O7PB 3UB1A 1QVF2 1N8QA 1PU4A 1UUVB 6STDA 2C11A 3CD63 3CNMA 3VF1A 3CME3 3CCU3 3CU3A 1K9M4 1GS3A 3EQQB 1IVXA 3CNXA 1NWWA 3CCQ3 1IVWA 1CYUA 1FUWA 2I9WA 2P0XA 3STDA 2F98A 4FMDA 4LGQA 1IK3A 1J2BA 3KKGA 3D3LA 3OWUA 4FR9A 1UI7A 1Q824 1K28A 1N9JA 3MG1A 4CDLA 4O3VA 1OHPA 2OQEC 5IEOA 2LQVA 3X40A 3S5CA 5LC6A 1YGEA 1STDA 1CYVA 4LEHA 3H3HA 3FKAA 2D42A 2OQEA 4WWUC 1Y4KA 3Q2PA 2CG0A 2GBWB 1JN5A 1U8CB 3HX8A 1WMPA 2CHCA 2ML6A 2FXTA 3LTDA 2QA43 3SLUA 1ROAA 1KWIA 3CPW2 1OPYA 3S27A 3V99A 4RZMA 5AYRB 5CLKA 4HM7B 3X41A 5AEUB 2GEYA 4RBNA 3KZTA 4GL6A 2OTL3 4HKVB 4L8OA 2YFIB 5IG5A 1W6CA 3MG3A 1EG9B 1DVCA 3S67A 3I563 2CG1A 5STDA 2KCDA 2RSXA 2OWPA 1EKMA 2STDA 3G6E3 3QK9A 1IQXA 1A90A 2HMLB 1SIIA 5I97A 1IQ8A 2B1XB 2BO9B 2WOFA 2HMOB 3GRDA 1FA3A 5AIIA 1ZO2A 4IT7A 5A0OB 3PYJA 3F14A 3LTBA 4N6LA 1YJN3 4J9AA 4WHAA 3JUQA 4O02B 1NO3A 4K61A 3G0KA 1Q42A 4N6V0 3MPHA 3OX9A 1ASKA 1FGMA 1KC84 4PEJA 3EJVA 1JKGB 3LMLA 1L5GB 3S28A 1QAKA 2OOVC 1MOLA 1VQM3 2B24B 3KIIA 1JV2B 2UX0A 3AMOA 1JB4A 2OTJ3 2P38A 3X42A 3EBTA 5EEOA 3MHEA 3F9SA 5ELUA 3B8LA 3OWSA 3NV0B 5IERA 4N6TA 1GD4A 4FMCA 3X3XA 5IG4A 3WODG 2WGQA 3LH4A 2BHMA 3PCSA 3DXOA 4KFFA 3IPTA 4H3UA 1M904 1O7MB 1UW1A 3G713 3NQYA 3ROBA 4G1MB 1WMNA 3CMA3 4RNZA 1F8NA 3NM2A 3CC73 1DYUA 5ELJA 4I4KA 4N6OB 3T8UA 2RCDA 3NHXA 3S29A 3JUMA 4WP5A 1UI8A 3FH1A 2E2TA 2KRTA 1KD14 4HM5B 1JB2A 2SBLA 4STDA 1Q40A 1N5HA 2YX9A 2KXGA 2YFLB 3LT9A 3CCM3 2JQ5A 4FMAA 1S5AA 5D81A 3LT8A 1IT7A 3RGRA 7STDA 2CWUA 1T5YA 4HBRA 2Z7AA 2W04A 8CHOA 3T8NA 1RN7A 3EBYA 3N54B 4O8SA 3A76A 3N8BA 3QRDA 1KSIA 1Q7Y4 1CQSA 3DMCA 3BNEA 2BNGA 1US1A 2BMQB 4EYCA 5LC7A 1LOXA 3VSYA 1V74A 3HIGA 3JUNA 4R9LA 2D1WA 3U97A 3F7XA 3J7Yd 5DRVA 1TU5A 4N6UA 4TX4A 1O7HB 4HM2B 5DREA 4XB5A 3DGNA 3MKIA 1RRLA 1WQLB 2MC8A 2CWVA 1VQ93 3GAXA 2QIYA 5KP3A 2ML5A 3JUOA 3SEDA 1OF5B 3K63A 3GWRA 3VGNA 3FGYA 3FCSB 3GZRA 3N9HA 3NUVA 1OACA 5AEWB 2CIUA 3EHCA 3V92A 3CCR3 3DGLA 1M1K4 1OGXA 3PCRA 2ZDJA 3Q1CA 3SX1A 3B4OA 1QJGA 3ALAA 2LYXA 3FSDA 4EC6A 2CFKA 1GY7A 3NBJA 3HIIA 1U5OA 2A15A 4KFEA 5KP1A 1VQ63 3F40A 2FNQA 2W03A 3I0YA 1VQP3 2QGUA 4HM6B 1W00A 2Y73A 1TFOA 5D83A 2F86B 2QEX3 3NV0A 3LYGA 4OVMA 5CXOA 1GY5A 5IW9A 1O7GB 1IVVA 3JUPA 5AIGA 1W02A 4KVHA 1KQS2 1DMNA 2L4VA 4OUQA 1RRHA 1OCVA 5FGOA 2Z77A 1E3VA 2XGNA 4JF8A 3CCL3 2E2UA 3G8ZA 5HGRA 1E3RA 1D6UA 4R9KA 1A2KA 1W2ZA 3M8CA 4KZ1A 4CCVA 2V1LA 3UNLA 3EC9A 1IDPA 4XDWA 3CC43 3BNBA 1ULJB 3DUKA 4X2OA 3DM8A 5IENA 3K5TA 4BTWA 1LVNA 5FW5A 3DGOA 3EX9A 3OWYA 4HYZA 1QMAA 1DVDA 3SXXA 1WTHA 3NXJA 3LZAA 5AIFA 3EB8A 4OK0A 3SOYA 3KSPA 2IMJA 4FCJA 1FGQA 3BLZA 3WDGB 3NBRA 2XEPA 1DMMA 4WYKA 3CCS3 1ISKA 3L0RA 1W5ZA 2E2VA 1VZZA 5AYSC 3G4S3 3KN4A 1S723 5TGNA 3KE7A 1IT8A 2IUJA 3MYTA 1YHQ3 3NBBA 2W56B 1ULIB 1RJOA 2OOVA 4N3VA 2MF7A 1UUWB 3KFQC 4MMZB 1FGTA 3IJEB 4BTXA 5JBSA 1WNHA 1VQK3 4N6MA 1LNHA 4EV2A 3E99A 3AMOB 3DZLA 1HKXA 2HMMB 3EN8A 1O7NB 5G2GA 4BTYA 1OGZA 1A2VA 2XSOB 3BNCA 5BXQA 4XBXA 1IU7A 1D6ZA 1FGOA 1STFI 3KSED 2HMKB 1VQ83 4HVNA 1LXEA 1ROVA 1YVBI 2P0MA 4H61A 4J8TA 2W56A 5KP4A 3GZBA 1HU9A 1JJ22 3O8YA 2HMJB 5CF2A 2CFGA 5IG0A 1IV7A 3PXMA 1EQKA 1Z1SA 4WYKB 1K41A 1W7CA 3EF8A 3F8HA 1YI23 3T0UA 3X3ZA 1Q864 2XFSA 3K7CA 1YIJ3 1W4NA 2GEXA 2K0MA 3B4PA 3F7SA 3G16A 3NM7A 4QWTA 3UL6A 1CEWI 2GU1A 1C7HA 2XH9A 2Y74A 3RGAA 4HM4B 3X3YA 1OUNA 3BNDA 3D9RA 2W2CA 3WA2X 1GYBA 1QAFA 1TIJA 3SVAA 1WMOA 1Q40B 1D6YA 4JRFA 1RKYA 1JKGA 5D82A 1OF5A 4MJDA 3WMDA 1FGRA 1TUHA 3BB9A 3NX0A 3OW22 2XFTA 1M1XB 3WOFB 4K90B 2CW9A 3FG3A 3CXC2 3MWZA 3HZPA 3UL5A 4XM4A 4FCZA 2W0QA 1AVLA 3FZWA 4LSOA 1YJ93 2JDIH 1M9GA 4MEIA 2Q07A 3GZYB 2CK3H 2O3OA 3PS8A 2WOHA 2F99A 1TP6A 2Z76A 3LTAA 4R80A 4HM0B 2O9UX 4L8PA 3CPOA 1OH0A 1JNQA 2IUKA 4FCMA 4AKYA 1IQYA 3CCE3 2W9PA 5AI1A 1NB5I 4K1UA 1JB5A 5EQLA 3LTCA 2CH9A 5JPUA 3WOEB 2XF3A 5IF6A 1OHOA 1VQN3 1W6YA 2WGOA 3U1WA 4GB5A 3HK4A 1VQ53 5AIHA 3H51A 5EVHA 1TFKA 3TDGA 4EBGA 1AV4A 1E97A 2CC3A 1NJI4 3CC23 2CFDA 1BUQA 4HZ9B 3I553 2P09A 2GXFA 3FG4A 3DY5A 2INXA 4AEQA 3EE1A 4EV5A 1QVG2 3EN1B 3B7CA 2CFWA 1NU3A 2Z6BA 1W6GA 4ORLA 4XDVA 4R4KA 4X2HA 1SJWA 4HM3B 1R4CA 4NHFA 3JVCA 1VQ73 5BVBA 2CFLA 1SPUA 1AR0A 2BT3A 4EXRA 3UJMA 4MMYB 3LOYA 4N6NB 3ER7A 5CK6A 4XBYA 3CCJ3 1MNLA 2RGQA 2PNCA 2PZVA 3FF2A 4NREA 3CCV3 1GY6A 2K54A 3LXUX 1VQO3 2GU3A 4RNYA 4XBTA 4HJLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9L A;  3F7X A;  1Z1S A;  3KZT A;  4WYK B;  1K41 A;  3F8X A;  5DRV A;  1O7W B;  4HKV B;  1O7H B;  2YFI B;  4HM2 B;  4L8O A;  4XB5 A;  3MKI A;  5DRE A;  1WQL B;  3EF8 A;  5IG5 A;  3F8H A;  3MG3 A;  4IIA A;  2QIY A;  4U13 A;  5KP3 A;  5CF1 A;  3FF0 A;  3OV4 A;  1EG9 B;  3JUO A;  2GEX A;  3K7C A;  4HZB B;  1OF5 B;  3SED A;  3B4P A;  3G16 A;  3F7S A;  3GWR A;  3VGN A;  3OXA A;  3FGY A;  3RGA A;  1C7H A;  3ECF A;  4HM4 B;  3GZR A;  5IEP A;  3NUV A;  5STD A;  1OUN A;  3D9R A;  5AEW B;  2OWP A;  2XR8 B;  2YFJ B;  2STD A;  2W2C A;  1GYB A;  3EHC A;  4R1K A;  5IG3 A;  1OGX A;  1Q40 B;  1W01 A;  2HMN B;  4Q53 A;  1NDO B;  1JKG A;  5D82 A;  1OF5 A;  2R4I A;  4MJD A;  3WMD A;  1DMQ A;  1TUH A;  2HML B;  2BMR B;  1QJG A;  3B4O A;  3BB9 A;  3FSD A;  3K0Z A;  1GY7 A;  2B1X B;  2CKF B;  2GBX B;  1U5O A;  2A15 A;  2HMO B;  3GRD A;  5KP1 A;  5AII A;  1ZO2 A;  3F40 A;  3Q90 A;  3HZP A;  4XM4 A;  3F14 A;  3I0Y A;  2BMO B;  2QGU A;  4HM6 B;  1W00 A;  4HM8 B;  4J9A A;  1EA2 A;  3JUQ A;  5D83 A;  3FZW A;  2F86 B;  2RFR A;  3NV0 A;  5JPP A;  1ZX2 A;  4LMI A;  3FLJ A;  3LYG A;  4L7K A;  3G0K A;  4OVM A;  5CXO A;  1GY5 A;  1Q42 A;  1O7G B;  3GZY B;  3OX9 A;  3JUP A;  1ASK A;  5AIG A;  1W02 A;  3SOA A;  4KVH A;  4PEJ A;  3EJV A;  2F99 A;  1JKG B;  1DMN A;  1TP6 A;  2Z76 A;  4OUQ A;  1OCV A;  5IG0 A;  2Z77 A;  4HM0 B;  1E3V A;  4L8P A;  2B24 B;  3GZX B;  3G8Z A;  4HM1 B;  3CPO A;  1OH0 A;  2UX0 A;  3MG2 A;  4FCM A;  5HGR A;  1E3R A;  4R9K A;  1A2K A;  1JB4 A;  3M8C A;  2XSH B;  3UNL A;  3EBT A;  3EC9 A;  1JN5 B;  3F9S A;  3MHE A;  1IDP A;  3B8L A;  1OHS A;  3MSO A;  4K1V A;  4XDW A;  5AI1 A;  1ULJ B;  3DUK A;  2XRX B;  1O7P B;  1JB5 A;  3NV0 B;  3OWS A;  4K1U A;  5IER A;  4X2O A;  5IG4 A;  3DM8 A;  5IEN A;  1UUV B;  6STD A;  5JPU A;  3CNM A;  5FW5 A;  3EX9 A;  3OWY A;  1QMA A;  3DXO A;  3CU3 A;  5IF6 A;  1GS3 A;  1OHO A;  3EQQ B;  3IPT A;  1O7M B;  3CNX A;  4H3U A;  1W6Y A;  3NXJ A;  1NWW A;  3LZA A;  5AIF A;  4GB5 A;  3ROB A;  3SOY A;  3HK4 A;  2IMJ A;  3KSP A;  4FCJ A;  2I9W A;  3BLZ A;  3NBR A;  3NM2 A;  5AIH A;  3STD A;  2F98 A;  1DMM A;  4WYK A;  3H51 A;  4I4K A;  4LGQ A;  5EVH A;  3T8U A;  2RCD A;  1ISK A;  1VZZ A;  3NHX A;  1E97 A;  3JUM A;  5TGN A;  4WP5 A;  3KE7 A;  3KKG A;  3FH1 A;  4HZ9 B;  1BUQ A;  3MYT A;  3OWU A;  2GXF A;  2INX A;  1JB2 A;  3MG1 A;  4HM5 B;  4STD A;  4CDL A;  1ULI B;  1Q40 A;  3EN1 B;  4N3V A;  1OHP A;  3B7C A;  2YFL B;  5IEO A;  1UUW B;  3S5C A;  1NU3 A;  2JQ5 A;  1STD A;  5D81 A;  1S5A A;  4LEH A;  3H3H A;  4ORL A;  3FKA A;  4XDV A;  4WWU C;  4X2H A;  1SJW A;  3E99 A;  3RGR A;  4HM3 B;  7STD A;  2GBW B;  1HKX A;  2HMM B;  2Z7A A;  1O7N B;  3DZL A;  3EN8 A;  5G2G A;  5BVB A;  1JN5 A;  3HX8 A;  1OGZ A;  8CHO A;  2CHC A;  3T8N A;  1AR0 A;  3UJM A;  3EBY A;  2XSO B;  3A76 A;  3ER7 A;  5CK6 A;  4XBY A;  4XBX A;  5BXQ A;  2RGQ A;  2PZV A;  3FF2 A;  1OPY A;  1CQS A;  3DMC A;  2HMK B;  4RZM A;  4HVN A;  1GY6 A;  2BNG A;  4J8T A;  5KP4 A;  2K54 A;  2BMQ B;  3GZB A;  5CLK A;  4HM7 B;  3VSY A;  5AEU B;  2HMJ B;  5CF2 A;  3JUN A;  4XBT A;  2GEY A;  4HJL B; 
#chains in the Genus database with same CATH topology
 1MGW A;  1K73 4;  4WFO A;  4BIR A;  1YJW 3;  3F8X A;  4MMX B;  1O7W B;  2K3D A;  1A67 A;  3HI7 A;  1GSP A;  4GHO A;  2C10 A;  4IIA A;  5CF1 A;  4FMB A;  4KFD A;  1GD3 A;  2RNT A;  3DGM A;  3FF0 A;  3OV4 A;  4IPB A;  4HZB B;  1JRQ A;  1TRP A;  2OCT A;  3ZG0 A;  3RDE A;  2W9Q A;  3OXA A;  3ECF A;  1AVK A;  1QAL A;  1BUJ A;  5IEP A;  1IVU A;  2XGL A;  2XR8 B;  2YFJ B;  4R1K A;  4ZM8 A;  5BU4 A;  5IG3 A;  1RN1 A;  4Q53 A;  1W01 A;  2HMN B;  5M19 A;  1NDO B;  1C54 A;  3GSP A;  2R4I A;  1W2B 2;  1DMQ A;  3NQZ A;  3FG1 A;  2BMR B;  1N8R 4;  4LZI A;  3K0Z A;  7RNT A;  3IMA B;  1UCK A;  2CKF B;  2GBX B;  1BGS A;  1SQW A;  1EUI C;  4AKZ A;  3Q90 A;  3A5E A;  2ZL8 A;  2M7O A;  2BMO B;  3K9M C;  1GOY A;  4HM8 B;  1TRQ A;  1EA2 A;  1G96 A;  3WA3 A;  2FGT A;  2RFR A;  5JPP A;  3PGB A;  1ZX2 A;  4LMI A;  2WO0 A;  3FLJ A;  2J8X B;  1SIH A;  4L7K A;  1MGR A;  2W6J H;  1I0X A;  1LQG C;  2KF6 A;  1LOV A;  2AAE A;  3SOA A;  3PZW A;  1LNI A;  1N9E A;  1PFP A;  2IA7 A;  1YIT 3;  1N5P A;  1IV9 A;  1K8A 4;  1VQ4 3;  1Q81 4;  3GZX B;  1NB3 I;  4HM1 B;  1VQL 3;  3MG2 A;  1RGG A;  2CWT A;  4O2H A;  2P05 A;  2XSH B;  3V98 A;  1TTO A;  1JN5 B;  3D79 A;  4K1V A;  3MSO A;  1OHS A;  2XRX B;  1O7P B;  3UB1 A;  4RNT A;  1QVF 2;  1N8Q A;  4DKI A;  1PU4 A;  1UUV B;  6STD A;  2C11 A;  3CD6 3;  3CNM A;  3VF1 A;  1BU4 A;  1BNE A;  3RNT A;  3CME 3;  3CCU 3;  4LYL B;  3CU3 A;  1K9M 4;  1GS3 A;  3EQQ B;  1IVX A;  3CNX A;  1NWW A;  3CCQ 3;  1IVW A;  1BNI A;  2KAA A;  1CYU A;  1FUW A;  1FW7 A;  2I9W A;  2P0X A;  1RHL A;  3STD A;  2F98 A;  4FMD A;  4LGQ A;  1IK3 A;  1PY3 A;  1J2B A;  5M1A A;  2CX0 A;  3ZG5 A;  3KKG A;  3D3L A;  3OWU A;  4FR9 A;  1RGL A;  1UI7 A;  1K28 A;  1LOW A;  1N9J A;  3MG1 A;  4CDL A;  1Q82 4;  1BRN L;  4O3V A;  1OHP A;  2OQE C;  5IEO A;  2LQV A;  3X40 A;  3S5C A;  1ZS7 A;  5LC6 A;  1YGE A;  1STD A;  1CYV A;  4LEH A;  3H3H A;  3FKA A;  2D42 A;  2OQE A;  4WWU C;  1Y4K A;  3Q2P A;  2CG0 A;  2GBW B;  1Q7H A;  1JN5 A;  1U8C B;  3HX8 A;  1WMP A;  2CHC A;  2ML6 A;  2FXT A;  3LTD A;  2QA4 3;  3SLU A;  1ROA A;  1KWI A;  3HOH A;  3CPW 2;  1OPY A;  3S27 A;  3V99 A;  4RZM A;  5AYR B;  1BNS A;  5CLK A;  4HM7 B;  3X41 A;  5AEU B;  2GEY A;  4RBN A;  3KZT A;  1RSN A;  2ZA4 A;  4GL6 A;  2OTL 3;  4HKV B;  1YVS A;  4L8O A;  2YFI B;  5IG5 A;  1W6C A;  3MG3 A;  1EG9 B;  1DVC A;  3AHW A;  3S67 A;  1GMQ A;  3I56 3;  1AQZ A;  2CG1 A;  1UCI A;  1RCL A;  5STD A;  1UGH I;  2KCD A;  2RSX A;  2OWP A;  1EKM A;  2STD A;  3G6E 3;  3QK9 A;  1X1U A;  1IQX A;  2F5W A;  4I5Q A;  1A90 A;  1B2X A;  2HML B;  1SII A;  5I97 A;  1IQ8 A;  2KF4 A;  1BNG A;  1DE3 A;  2B1X B;  2BO9 B;  2WOF A;  2HMO B;  3GRD A;  1FA3 A;  1X1Y A;  5AII A;  1ZO2 A;  4IT7 A;  5A0O B;  3PYJ A;  3F14 A;  3LTB A;  4N6L A;  1YJN 3;  4J9A A;  4HAA A;  4WHA A;  3JUQ A;  4O02 B;  1NO3 A;  1UCL A;  1YNV X;  4K61 A;  3G0K A;  1HZ1 A;  1Q42 A;  4N6V 0;  3MPH A;  3OX9 A;  1ASK A;  1FGM A;  1B21 A;  1KC8 4;  1I0V A;  4PEJ A;  4EW5 A;  3EJV A;  1JKG B;  3LML A;  1L5G B;  1BSA A;  3S28 A;  1QAK A;  2OOV C;  1MOL A;  1LQM B;  1VQM 3;  2B24 B;  1RGA A;  3KII A;  1BSD A;  1JV2 B;  2UX0 A;  2GSP A;  3AMO A;  1JB4 A;  2OTJ 3;  1I8V A;  2P38 A;  3X42 A;  3EBT A;  5EEO A;  3MHE A;  3F9S A;  5ELU A;  3B8L A;  3OWS A;  3NV0 B;  5IER A;  4N6T A;  1GD4 A;  4FMC A;  3X3X A;  5IG4 A;  3WOD G;  1X1W A;  2CX1 A;  2WGQ A;  1GOV A;  3LH4 A;  2BHM A;  3PCS A;  3DXO A;  3SYU A;  4KFF A;  3IPT A;  4H3U A;  7GSP A;  1O7M B;  1UW1 A;  3G71 3;  1M90 4;  1X1X A;  3NQY A;  3ROB A;  4G1M B;  1WMN A;  1B27 A;  3CMA 3;  4RNZ A;  1F8N A;  1SAR A;  2UGI A;  3NM2 A;  3CC7 3;  1DYU A;  1HYF A;  5HOH A;  1RGK A;  5ELJ A;  4I4K A;  1CH0 A;  4N6O B;  3T8U A;  2RCD A;  5RNT A;  3NHX A;  2SAR A;  3S29 A;  3JUM A;  4WP5 A;  1UI8 A;  3FH1 A;  2E2T A;  2KRT A;  1KD1 4;  1BRG A;  1JB2 A;  2SBL A;  4HM5 B;  4STD A;  1Q40 A;  1N5H A;  2YX9 A;  2KXG A;  2YFL B;  1FUT A;  3LT9 A;  3CCM 3;  2JQ5 A;  1NNV A;  4BU4 A;  1BRI A;  1S5A A;  3AHS A;  3LT8 A;  4FMA A;  4U13 A;  1IT7 A;  5D81 A;  1GMR A;  2IYJ A;  3RGR A;  7STD A;  2CWU A;  1T5Y A;  4HBR A;  2Z7A A;  2W04 A;  8CHO A;  4BL2 A;  3T8N A;  1RN7 A;  3EBY A;  3N54 B;  1RGE A;  4O8S A;  1BRS A;  3A76 A;  3N8B A;  1I3F A;  3QRD A;  1KSI A;  2KF5 A;  5GSP A;  2KF3 A;  1Q7Y 4;  1CQS A;  3DMC A;  3BNE A;  2BNG A;  1US1 A;  2BMQ B;  5G1K A;  4EYC A;  5LC7 A;  1LOX A;  3VSY A;  1V74 A;  3HIG A;  3JUN A;  4R9L A;  2D1W A;  3U97 A;  3F7X A;  3J7Y d;  5DRV A;  1TU5 A;  1I70 A;  1VQ8 3;  4N6U A;  4TX4 A;  1O7H B;  4HM2 B;  5DRE A;  4XB5 A;  3DGN A;  3MKI A;  1RRL A;  1WQL B;  2MC8 A;  2CWV A;  1VQ9 3;  3GAX A;  2QIY A;  5KP3 A;  2ML5 A;  3JUO A;  3SED A;  1OF5 B;  3K63 A;  3GWR A;  3VGN A;  1BRK A;  3FGY A;  1T3B A;  3FCS B;  1IYY A;  1R4Y A;  3GZR A;  3N9H A;  3NUV A;  1OAC A;  1DET A;  1EEJ A;  5AEW B;  5M18 A;  2CIU A;  3EHC A;  3V92 A;  3CCR 3;  3DGL A;  1M1K 4;  1MWS A;  1OGX A;  1JZO A;  3PCR A;  2ZDJ A;  3Q1C A;  3SX1 A;  1YGW A;  3B4O A;  1QJG A;  3ALA A;  2LYX A;  3FSD A;  1I3I A;  4EC6 A;  2CFK A;  4GSP A;  1GY7 A;  3NBJ A;  1BNF A;  3HII A;  1U5O A;  2A15 A;  4KFE A;  5KP1 A;  1VQ6 3;  3F40 A;  2FNQ A;  2W03 A;  3I0Y A;  1VQP 3;  2F5M A;  2QGU A;  4HM6 B;  1W00 A;  2Y73 A;  3Q3F A;  1TFO A;  5D83 A;  2F86 B;  2QEX 3;  3NV0 A;  1Q9E A;  1V58 A;  3LYG A;  4OVM A;  5CXO A;  1GY5 A;  5IW9 A;  1O7G B;  1IVV A;  2C4B A;  3JUP A;  5AIG A;  1W02 A;  4KVH A;  1KQS 2;  1I2E A;  1BOX A;  1DMN A;  4ILF A;  2L4V A;  1PYL A;  4OUQ A;  1RRH A;  1OCV A;  5FGO A;  1MWT A;  2Z77 A;  1E3V A;  2XGN A;  4JF8 A;  3CCL 3;  2E2U A;  2F56 A;  3G8Z A;  1RNB A;  3BIR A;  5HGR A;  1D6U A;  1E3R A;  1B2U A;  1A2K A;  1W2Z A;  3M8C A;  4KZ1 A;  4R9K A;  4CCV A;  2V1L A;  3UNL A;  3EC9 A;  1IDP A;  4XDW A;  3CC4 3;  3BNB A;  1ULJ B;  3DUK A;  2H0H A;  1RDS A;  1B2Z A;  4X2O A;  3DM8 A;  5IEN A;  1FUS A;  3K5T A;  4BTW A;  1LVN A;  5FW5 A;  3DGO A;  3EX9 A;  3OWY A;  4HYZ A;  1QMA A;  1GOU A;  2F4Y A;  1DVD A;  3SXX A;  1WTH A;  3NXJ A;  3LZA A;  5AIF A;  3EB8 A;  4OK0 A;  3SOY A;  3KSP A;  2IMJ A;  4FCJ A;  1FGQ A;  3BLZ A;  3WDG B;  3NBR A;  3ZFZ A;  2XEP A;  1DMM A;  4WYK A;  2BU4 A;  3CCS 3;  1ISK A;  3L0R A;  1W5Z A;  2E2V A;  1VZZ A;  5AYS C;  3G4S 3;  3KN4 A;  1S72 3;  1JZD A;  1RMS A;  5TGN A;  3KE7 A;  1IT8 A;  1G0T A;  2IUJ A;  3MYT A;  3URP A;  5BIR A;  1YHQ 3;  3NBB A;  1JBR A;  1RGC A;  2W56 B;  1ULI B;  1BVI A;  1RJO A;  2OOV A;  4N3V A;  2MF7 A;  1UUW B;  1BSE A;  3KFQ C;  4MMZ B;  1FGT A;  2BIR A;  4NPB A;  3IJE B;  1I2G A;  4BTX A;  5JBS A;  1WNH A;  1VQK 3;  4N6M A;  1LNH A;  4EV2 A;  3E99 A;  1B2S A;  3AMO B;  3D5G A;  2HMM B;  1HKX A;  3DZL A;  3EN8 A;  1O7N B;  5G2G A;  4BTY A;  1OGZ A;  1T2I A;  1LOY A;  6GSP A;  1UCJ A;  1A2V A;  2XSO B;  3BNC A;  1BAN A;  4XBX A;  1IU7 A;  1D6Z A;  1FGO A;  5BXQ A;  4BL3 A;  1STF I;  3KSE D;  2HMK B;  3KCH A;  4HVN A;  1LXE A;  1ROV A;  1YVB I;  2P0M A;  4H61 A;  4J8T A;  2W56 A;  1RGH A;  3GZB A;  1HU9 A;  5KP4 A;  1I2F A;  1JJ2 2;  3O8Y A;  2HMJ B;  5CF2 A;  2CFG A;  4J5K A;  3WHO A;  5IG0 A;  1IV7 A;  3PXM A;  5G1L A;  3DH2 A;  1A2P A;  1EQK A;  1Z1S A;  4WYK B;  1K41 A;  1RTU A;  1W7C A;  3EF8 A;  3F8H A;  1YI2 3;  1BNR A;  3T0U A;  3X3Z A;  1Q86 4;  4CJN A;  2XFS A;  8RNT A;  3K7C A;  1YIJ 3;  1W4N A;  2GEX A;  2K0M A;  3B4P A;  3F7S A;  3DGY A;  3G16 A;  3NM7 A;  4QWT A;  3UL6 A;  1CEW I;  2GU1 A;  1C7H A;  2XH9 A;  2Y74 A;  3RGA A;  4HM4 B;  3WR2 A;  3X3Y A;  4CPK A;  1OUN A;  3BND A;  3D9R A;  4J5G A;  2W2C A;  3WA2 X;  1GYB A;  1QAF A;  1TIJ A;  3SVA A;  1WMO A;  1Q40 B;  1D6Y A;  2H0G A;  4JRF A;  1RKY A;  1JKG A;  5D82 A;  1AY7 A;  1OF5 A;  4MJD A;  3WMD A;  1FGR A;  1TUH A;  1ZGX A;  3BB9 A;  3NX0 A;  1BIR A;  1LRA A;  1UGI A;  1VQQ A;  1M1X B;  2XFT A;  3WOF B;  3OW2 2;  4K90 B;  2CW9 A;  1BSC A;  3FG3 A;  3CXC 2;  3AGO A;  3MWZ A;  3HZP A;  3UL5 A;  4XM4 A;  4FCZ A;  4HOH A;  2W0Q A;  1AVL A;  3FZW A;  4LSO A;  1YJ9 3;  2JDI H;  3D5I A;  1M9G A;  4MEI A;  2Q07 A;  1MWR A;  1UUG B;  3GZY B;  1FYS A;  2CK3 H;  1RCK A;  2O3O A;  4KT3 B;  3PS8 A;  2WOH A;  2ZHX B;  1JBS A;  1V57 A;  2F99 A;  1TP6 A;  2IY2 A;  2Z76 A;  3LTA A;  4R80 A;  1MWU A;  4HM0 B;  2O9U X;  4L8P A;  1B20 A;  3AGN A;  3CPO A;  1OH0 A;  1JNQ A;  2IUK A;  4FCM A;  1T2H A;  1BSB A;  4AKY A;  2L1S A;  1RGF A;  1B3S A;  1IQY A;  1BAO A;  2RBI A;  3CCE 3;  3BU4 A;  2W9P A;  5AI1 A;  1NB5 I;  4K1U A;  1JB5 A;  2AAD A;  5EQL A;  3LTC A;  2CH9 A;  5JPU A;  1FZU A;  1TJD A;  3WOE B;  1RNT A;  1B2M A;  2XF3 A;  5IF6 A;  2UUG C;  1OHO A;  1VQN 3;  1W6Y A;  2WGO A;  3U1W A;  4GB5 A;  1GMP A;  3HK4 A;  1VQ5 3;  5AIH A;  2HOH A;  1UDI I;  1TFK A;  3H51 A;  5EVH A;  1AV4 A;  3TDG A;  4EBG A;  1E97 A;  2CC3 A;  1NJI 4;  3CC2 3;  2CFD A;  1BUQ A;  4HZ9 B;  3I55 3;  2P09 A;  2GXF A;  3FG4 A;  3DY5 A;  2INX A;  4AEQ A;  3EE1 A;  4EV5 A;  1RN4 A;  1QVG 2;  3EN1 B;  3B7C A;  2CFW A;  1NU3 A;  6RNT A;  2Z6B A;  1W6G A;  1G02 A;  4ORL A;  4XDV A;  4R4K A;  4X2H A;  1SJW A;  1BRJ A;  4HM3 B;  1R4C A;  4NHF A;  3JVC A;  1VQ7 3;  5BVB A;  2CFL A;  9RNT A;  1SPU A;  1AR0 A;  2BT3 A;  4EXR A;  3UJM A;  4MMY B;  1BRH A;  3LOY A;  4N6N B;  3ER7 A;  5CK6 A;  4XBY A;  3CCJ 3;  1MNL A;  2RGQ A;  2PNC A;  2PZV A;  3FF2 A;  3D4A A;  4NRE A;  3CCV 3;  1BNJ A;  1GY6 A;  1RLS A;  1JBT A;  2K54 A;  3LXU X;  1VQO 3;  2GU3 A;  2H0I A;  4RNY A;  4XBT A;  2R41 A;  4HJL B; 
#chains in the Genus database with same CATH homology
 1K73 4;  4WFO A;  1YJW 3;  3F8X A;  4MMX B;  1O7W B;  1A67 A;  3HI7 A;  2C10 A;  4IIA A;  5CF1 A;  4FMB A;  4KFD A;  1GD3 A;  3DGM A;  3FF0 A;  3OV4 A;  4IPB A;  4U13 A;  4HZB B;  1JRQ A;  2OCT A;  3RDE A;  2W9Q A;  3OXA A;  3ECF A;  1AVK A;  1QAL A;  5IEP A;  1IVU A;  2XGL A;  2YFJ B;  2XR8 B;  4R1K A;  4ZM8 A;  5IG3 A;  4Q53 A;  1W01 A;  2HMN B;  1NDO B;  2R4I A;  1W2B 2;  1DMQ A;  3NQZ A;  3FG1 A;  2BMR B;  1N8R 4;  4LZI A;  3K0Z A;  3IMA B;  2CKF B;  2GBX B;  1SQW A;  4AKZ A;  3Q90 A;  2ZL8 A;  2M7O A;  2BMO B;  3K9M C;  4HM8 B;  1EA2 A;  1G96 A;  3WA3 A;  2FGT A;  2RFR A;  5JPP A;  3PGB A;  1ZX2 A;  4LMI A;  2WO0 A;  3FLJ A;  4L7K A;  1SIH A;  2W6J H;  3SOA A;  3PZW A;  1N9E A;  1PFP A;  2IA7 A;  1YIT 3;  1N5P A;  1IV9 A;  1K8A 4;  1VQ4 3;  1Q81 4;  3GZX B;  1NB3 I;  4HM1 B;  1VQL 3;  3MG2 A;  2CWT A;  4O2H A;  2P05 A;  2XSH B;  3V98 A;  1JN5 B;  4K1V A;  3MSO A;  1OHS A;  2XRX B;  1O7P B;  3UB1 A;  1QVF 2;  1N8Q A;  1PU4 A;  1UUV B;  6STD A;  2C11 A;  3CD6 3;  3CNM A;  3VF1 A;  3CME 3;  3CCU 3;  3CU3 A;  1K9M 4;  1GS3 A;  3EQQ B;  1IVX A;  3CNX A;  1NWW A;  3CCQ 3;  1IVW A;  1CYU A;  1FUW A;  2I9W A;  2P0X A;  3STD A;  2F98 A;  4FMD A;  4LGQ A;  1IK3 A;  1J2B A;  3KKG A;  3D3L A;  3OWU A;  4FR9 A;  1UI7 A;  1Q82 4;  1K28 A;  1N9J A;  3MG1 A;  4CDL A;  4O3V A;  1OHP A;  2OQE C;  5IEO A;  2LQV A;  3X40 A;  3S5C A;  5LC6 A;  1YGE A;  1STD A;  1CYV A;  4LEH A;  3H3H A;  3FKA A;  2D42 A;  2OQE A;  4WWU C;  1Y4K A;  3Q2P A;  2CG0 A;  2GBW B;  1JN5 A;  1U8C B;  3HX8 A;  1WMP A;  2CHC A;  2ML6 A;  2FXT A;  3LTD A;  2QA4 3;  3SLU A;  1ROA A;  1KWI A;  3CPW 2;  1OPY A;  3S27 A;  3V99 A;  4RZM A;  5AYR B;  5CLK A;  4HM7 B;  3X41 A;  5AEU B;  2GEY A;  4RBN A;  3KZT A;  4GL6 A;  2OTL 3;  4HKV B;  4L8O A;  2YFI B;  5IG5 A;  1W6C A;  3MG3 A;  1EG9 B;  1DVC A;  3S67 A;  3I56 3;  2CG1 A;  5STD A;  2KCD A;  2RSX A;  2OWP A;  1EKM A;  2STD A;  3G6E 3;  3QK9 A;  1IQX A;  1A90 A;  2HML B;  1SII A;  5I97 A;  1IQ8 A;  2B1X B;  2BO9 B;  2WOF A;  2HMO B;  3GRD A;  1FA3 A;  5AII A;  1ZO2 A;  4IT7 A;  5A0O B;  3PYJ A;  3F14 A;  3LTB A;  4N6L A;  1YJN 3;  4J9A A;  4WHA A;  3JUQ A;  4O02 B;  1NO3 A;  4K61 A;  3G0K A;  1Q42 A;  4N6V 0;  3MPH A;  3OX9 A;  1ASK A;  1FGM A;  1KC8 4;  4PEJ A;  3EJV A;  1JKG B;  3LML A;  1L5G B;  3S28 A;  1QAK A;  2OOV C;  1MOL A;  1VQM 3;  2B24 B;  3KII A;  1JV2 B;  2UX0 A;  3AMO A;  1JB4 A;  2OTJ 3;  2P38 A;  3X42 A;  3EBT A;  5EEO A;  3MHE A;  3F9S A;  5ELU A;  3B8L A;  3OWS A;  3NV0 B;  5IER A;  4N6T A;  1GD4 A;  4FMC A;  3X3X A;  5IG4 A;  3WOD G;  2WGQ A;  3LH4 A;  2BHM A;  3PCS A;  3DXO A;  4KFF A;  3IPT A;  4H3U A;  1M90 4;  1O7M B;  1UW1 A;  3G71 3;  3NQY A;  3ROB A;  4G1M B;  1WMN A;  3CMA 3;  4RNZ A;  1F8N A;  3NM2 A;  3CC7 3;  1DYU A;  5ELJ A;  4I4K A;  4N6O B;  3T8U A;  2RCD A;  3NHX A;  3S29 A;  3JUM A;  4WP5 A;  1UI8 A;  3FH1 A;  2E2T A;  2KRT A;  1KD1 4;  4HM5 B;  1JB2 A;  2SBL A;  4STD A;  1Q40 A;  1N5H A;  2YX9 A;  2KXG A;  2YFL B;  3LT9 A;  3CCM 3;  2JQ5 A;  4FMA A;  1S5A A;  5D81 A;  3LT8 A;  1IT7 A;  3RGR A;  7STD A;  2CWU A;  1T5Y A;  4HBR A;  2Z7A A;  2W04 A;  8CHO A;  3T8N A;  1RN7 A;  3EBY A;  3N54 B;  4O8S A;  3A76 A;  3N8B A;  3QRD A;  1KSI A;  1Q7Y 4;  1CQS A;  3DMC A;  3BNE A;  2BNG A;  1US1 A;  2BMQ B;  4EYC A;  5LC7 A;  1LOX A;  3VSY A;  1V74 A;  3HIG A;  3JUN A;  4R9L A;  2D1W A;  3U97 A;  3F7X A;  3J7Y d;  5DRV A;  1TU5 A;  4N6U A;  4TX4 A;  1O7H B;  4HM2 B;  5DRE A;  4XB5 A;  3DGN A;  3MKI A;  1RRL A;  1WQL B;  2MC8 A;  2CWV A;  1VQ9 3;  3GAX A;  2QIY A;  5KP3 A;  2ML5 A;  3JUO A;  3SED A;  1OF5 B;  3K63 A;  3GWR A;  3VGN A;  3FGY A;  3FCS B;  3GZR A;  3N9H A;  3NUV A;  1OAC A;  5AEW B;  2CIU A;  3EHC A;  3V92 A;  3CCR 3;  3DGL A;  1M1K 4;  1OGX A;  3PCR A;  2ZDJ A;  3Q1C A;  3SX1 A;  3B4O A;  1QJG A;  3ALA A;  2LYX A;  3FSD A;  4EC6 A;  2CFK A;  1GY7 A;  3NBJ A;  3HII A;  1U5O A;  2A15 A;  4KFE A;  5KP1 A;  1VQ6 3;  3F40 A;  2FNQ A;  2W03 A;  3I0Y A;  1VQP 3;  2QGU A;  4HM6 B;  1W00 A;  2Y73 A;  1TFO A;  5D83 A;  2F86 B;  2QEX 3;  3NV0 A;  3LYG A;  4OVM A;  5CXO A;  1GY5 A;  5IW9 A;  1O7G B;  1IVV A;  3JUP A;  5AIG A;  1W02 A;  4KVH A;  1KQS 2;  1DMN A;  2L4V A;  4OUQ A;  1RRH A;  1OCV A;  5FGO A;  2Z77 A;  1E3V A;  2XGN A;  4JF8 A;  3CCL 3;  2E2U A;  3G8Z A;  5HGR A;  1E3R A;  1D6U A;  4R9K A;  1A2K A;  1W2Z A;  3M8C A;  4KZ1 A;  4CCV A;  2V1L A;  3UNL A;  3EC9 A;  1IDP A;  4XDW A;  3CC4 3;  3BNB A;  1ULJ B;  3DUK A;  4X2O A;  3DM8 A;  5IEN A;  3K5T A;  4BTW A;  1LVN A;  5FW5 A;  3DGO A;  3EX9 A;  3OWY A;  4HYZ A;  1QMA A;  1DVD A;  3SXX A;  1WTH A;  3NXJ A;  3LZA A;  5AIF A;  3EB8 A;  4OK0 A;  3SOY A;  3KSP A;  2IMJ A;  4FCJ A;  1FGQ A;  3BLZ A;  3WDG B;  3NBR A;  2XEP A;  1DMM A;  4WYK A;  3CCS 3;  1ISK A;  3L0R A;  1W5Z A;  2E2V A;  1VZZ A;  5AYS C;  3G4S 3;  3KN4 A;  1S72 3;  5TGN A;  3KE7 A;  1IT8 A;  2IUJ A;  3MYT A;  1YHQ 3;  3NBB A;  2W56 B;  1ULI B;  1RJO A;  2OOV A;  4N3V A;  2MF7 A;  1UUW B;  3KFQ C;  4MMZ B;  1FGT A;  3IJE B;  4BTX A;  5JBS A;  1WNH A;  1VQK 3;  4N6M A;  1LNH A;  4EV2 A;  3E99 A;  3AMO B;  3DZL A;  1HKX A;  2HMM B;  3EN8 A;  1O7N B;  5G2G A;  4BTY A;  1OGZ A;  1A2V A;  2XSO B;  3BNC A;  5BXQ A;  4XBX A;  1IU7 A;  1D6Z A;  1FGO A;  1STF I;  3KSE D;  2HMK B;  1VQ8 3;  4HVN A;  1LXE A;  1ROV A;  1YVB I;  2P0M A;  4H61 A;  4J8T A;  2W56 A;  5KP4 A;  3GZB A;  1HU9 A;  1JJ2 2;  3O8Y A;  2HMJ B;  5CF2 A;  2CFG A;  5IG0 A;  1IV7 A;  3PXM A;  1EQK A;  1Z1S A;  4WYK B;  1K41 A;  1W7C A;  3EF8 A;  3F8H A;  1YI2 3;  3T0U A;  3X3Z A;  1Q86 4;  2XFS A;  3K7C A;  1YIJ 3;  1W4N A;  2GEX A;  2K0M A;  3B4P A;  3F7S A;  3G16 A;  3NM7 A;  4QWT A;  3UL6 A;  1CEW I;  2GU1 A;  1C7H A;  2XH9 A;  2Y74 A;  3RGA A;  4HM4 B;  3X3Y A;  1OUN A;  3BND A;  3D9R A;  2W2C A;  3WA2 X;  1GYB A;  1QAF A;  1TIJ A;  3SVA A;  1WMO A;  1Q40 B;  1D6Y A;  4JRF A;  1RKY A;  1JKG A;  5D82 A;  1OF5 A;  4MJD A;  3WMD A;  1FGR A;  1TUH A;  3BB9 A;  3NX0 A;  3OW2 2;  2XFT A;  1M1X B;  3WOF B;  4K90 B;  2CW9 A;  3FG3 A;  3CXC 2;  3MWZ A;  3HZP A;  3UL5 A;  4XM4 A;  4FCZ A;  2W0Q A;  1AVL A;  3FZW A;  4LSO A;  1YJ9 3;  2JDI H;  1M9G A;  4MEI A;  2Q07 A;  3GZY B;  2CK3 H;  2O3O A;  3PS8 A;  2WOH A;  2F99 A;  1TP6 A;  2Z76 A;  3LTA A;  4R80 A;  4HM0 B;  2O9U X;  4L8P A;  3CPO A;  1OH0 A;  1JNQ A;  2IUK A;  4FCM A;  4AKY A;  1IQY A;  3CCE 3;  2W9P A;  5AI1 A;  1NB5 I;  4K1U A;  1JB5 A;  5EQL A;  3LTC A;  2CH9 A;  5JPU A;  3WOE B;  2XF3 A;  5IF6 A;  1OHO A;  1VQN 3;  1W6Y A;  2WGO A;  3U1W A;  4GB5 A;  3HK4 A;  1VQ5 3;  5AIH A;  3H51 A;  5EVH A;  1TFK A;  3TDG A;  4EBG A;  1AV4 A;  1E97 A;  2CC3 A;  1NJI 4;  3CC2 3;  2CFD A;  1BUQ A;  4HZ9 B;  3I55 3;  2P09 A;  2GXF A;  3FG4 A;  3DY5 A;  2INX A;  4AEQ A;  3EE1 A;  4EV5 A;  1QVG 2;  3EN1 B;  3B7C A;  2CFW A;  1NU3 A;  2Z6B A;  1W6G A;  4ORL A;  4XDV A;  4R4K A;  4X2H A;  1SJW A;  4HM3 B;  1R4C A;  4NHF A;  3JVC A;  1VQ7 3;  5BVB A;  2CFL A;  1SPU A;  1AR0 A;  2BT3 A;  4EXR A;  3UJM A;  4MMY B;  3LOY A;  4N6N B;  3ER7 A;  5CK6 A;  4XBY A;  3CCJ 3;  1MNL A;  2RGQ A;  2PNC A;  2PZV A;  3FF2 A;  4NRE A;  3CCV 3;  1GY6 A;  2K54 A;  3LXU X;  1VQO 3;  2GU3 A;  4RNY A;  4XBT A;  4HJL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...