3OV4A

Crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
120
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase P39GV40GS42G from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
molecule tags Transferase
total genus 30
structure length 120
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ov4A00
3DZLA 3A76A 5AIFA 1EA2A 2F99A 5IG0A 3HZPA 1JN5B 3MSOA 5CF2A 5IENA 4WWUC 1C7HA 2OWPA 2STDA 5CXOA 3DM8A 5DREA 3F7SA 5AIIA 5D81A 3S5CA 2BNGA 3JUPA 3CNXA 1JB2A 1ISKA 4L8OA 3KKGA 3GZYB 3CNMA 5DRVA 3VGNA 5AEWB 2XRXB 2B24B 2QIYA 1O7WB 3EJVA 4FCMA 1GY7A 4OVMA 2GEYA 3MG3A 5IG5A 1HKXA 1O7MB 3JUOA 5CK6A 4HJLB 1U5OA 1W00A 1K41A 4R9LA 4X2HA 3FKAA 1TP6A 1ZO2A 2F86B 2I9WA 5CF1A 4WP5A 1OHPA 3MKIA 1OF5A 5IERA 3G16A 3MG2A 4LEHA 1JB5A 3MYTA 5JPPA 3Q90A 1Q42A 3B8LA 5EVHA 5KP4A 1DMMA 4GB5A 1STDA 2HMKB 2GEXA 3EX9A 3B4OA 1TUHA 4HKVB 5IEPA 2R4IA 3NM2A 4LMIA 1OPYA 2HMLB 4RZMA 2XSOB 2BMQB 5TGNA 4K1UA 3FH1A 1Z1SA 5AIHA 1E3VA 7STDA 4XDWA 1QMAA 4XDVA 2PZVA 1NWWA 1OF5B 5IF6A 3NXJA 3FLJA 5IG4A 3EBYA 1O7GB 3GWRA 3UNLA 1OGZA 3NHXA 4STDA 2GBXB 3EQQB 3FF2A 2HMOB 1SJWA 2HMJB 3OWYA 3H51A 5CLKA 1UUVB 3T8UA 2CKFB 3LYGA 4HM7B 1Q40B 3STDA 4J9AA 3F8XA 4WYKA 3B4PA 3HX8A 3K0ZA 1S5AA 3EF8A 1GYBA 1WQLB 3SEDA 3GZXB 6STDA 5AIGA 2Z7AA 5BVBA 3VSYA 5IEOA 2HMMB 1GY5A 5HGRA 4XBTA 4J8TA 1QJGA 2RCDA 3EHCA 3UJMA 1A2KA 2RGQA 4Q53A 1AR0A 2YFIB 3FSDA 1IDPA 4N3VA 4K1VA 4ORLA 1GY6A 2RFRA 5FW5A 5JPUA 3BB9A 3GZBA 1ULIB 3D9RA 3SOYA 1W01A 2F98A 4HM5B 4R9KA 4H3UA 2BMRB 1OGXA 2CHCA 2IMJA 4XM4A 3EN1B 3DXOA 3ER7A 3EBTA 1W02A 2JQ5A 5AEUB 3M8CA 1JB4A 3OXAA 3F14A 4L7KA 1O7PB 4HM1B 3G0KA 4HZBB 4LGQA 2YFJB 4MJDA 3OX9A 3SOAA 3OV4A 4KVHA 3JUQA 3H3HA 1O7NB 1BUQA 2B1XB 1NU3A 3RGRA 4PEJA 1VZZA 2Z77A 3FGYA 4HM8B 3E99A 3F40A 4CDLA 5AI1A 1E97A 4L8PA 3IPTA 3DUKA 3RGAA 5D82A 5D83A 3EN8A 1JKGA 3EC9A 3G8ZA 3GRDA 3CU3A 3CPOA 4OUQA 5STDA 1OH0A 3NV0A 3DMCA 3T8NA 3JUNA 4HM4B 3ECFA 2XR8B 2A15A 4HM0B 4R1KA 4XB5A 3MG1A 5BXQA 2BMOB 3JUMA 2YFLB 3FZWA 2INXA 3ROBA 4X2OA 3GZRA 3I0YA 4WYKB 4HM6B 1OUNA 1JKGB 1O7HB 1EG9B 2UX0A 8CHOA 3KZTA 3K7CA 3F7XA 3LZAA 1NDOB 3NV0B 3NBRA 1GS3A 2GBWB 1DMNA 1ZX2A 3KSPA 3FF0A 2GXFA 4HM3B 4XBYA 3OWUA 4HM2B 4XBXA 1E3RA 3MHEA 1OHOA 1UUWB 1OCVA 2W2CA 3HK4A 4IIAA 3WMDA 3BLZA 3NUVA 2XSHB 2HMNB 3OWSA 4I4KA 1JN5A 1ULJB 1DMQA 2K54A 3F9SA 1CQSA 5IG3A 1Q40A 2Z76A 3B7CA 3F8HA 5G2GA 4FCJA 5KP3A 1ASKA 1OHSA 4U13A 5KP1A 3KE7A 4HVNA 4HZ9B 1W6YA 2QGUA
chains in the Genus database with same CATH superfamily
3DZLA 1IQ8A 1UW1A 1PY3A 1TTOA 4FMCA 3X42A 3A76A 5AIFA 1B21A 1I0VA 3CME3 1EA2A 2H0IA 2F99A 2W0QA 1BSBA 1EEJA 3K5TA 1ROVA 1I2EA 3BU4A 3PCSA 1RGHA 5IG0A 2ML5A 3HZPA 1JBRA 1RKYA 3LXUX 1JBSA 1JN5B 3D5IA 3MSOA 4FR9A 1MGWA 5CF2A 5IENA 2CWVA 4WWUC 1C7HA 2CFGA 2OWPA 4FMDA 1D6ZA 3FCSB 1YJ93 4H61A 2OTJ3 2CIUA 2STDA 5CXOA 3DM8A 2WO0A 4NREA 3DGYA 5DREA 3FG3A 1S723 2GSPA 1G96A 4JRFA 3F7SA 5AIIA 2M7OA 1Y4KA 1D6YA 1I8VA 1G02A 2P38A 2YX9A 3LMLA 5D81A 3DH2A 3S5CA 3S28A 1KQS2 2QA43 2BNGA 2OQEA 3EB8A 1FUSA 3JUPA 3CNXA 1JB2A 1ISKA 1LQGC 4L8OA 3KKGA 1BRIA 1VQ83 1NNVA 1RRLA 1B2XA 1TFKA 3GZYB 3WDGB 1GSPA 2W56B 1DE3A 3CNMA 4N6V0 4NPBA 1GOUA 5DRVA 1AY7A 2KF5A 3VGNA 1NB3I 5AEWB 2XRXB 1VQP3 1IVXA 2B24B 1WTHA 2Y73A 2ZDJA 1V57A 4K61A 2QIYA 1O7WB 4EXRA 3EJVA 1BNEA 4FCMA 1GY7A 4OVMA 2GEYA 2P0MA 3WHOA 3MG3A 1ZS7A 1N8R4 5IG5A 1HKXA 1KWIA 3NBBA 1LOYA 5GSPA 1O7MB 1BSEA 1CYUA 3HIGA 3JUOA 5CK6A 4HJLB 1NO3A 1U5OA 1W00A 2LQVA 3Q1CA 3VF1A 1K41A 4R9LA 4LSOA 3IJEB 3CXC2 1VQO3 1W4NA 3LTCA 3DGOA 4X2HA 3FKAA 1BRKA 4WFOA 1Q864 1YI23 1YIJ3 1TP6A 1ZO2A 2F86B 2I9WA 2JDIH 5CF1A 3WA3A 2Y74A 3Q3FA 4O2HA 4WP5A 1BNGA 2D42A 1OHPA 3BIRA 1FGQA 2E2VA 4N6TA 3MKIA 1KD14 2CFLA 4BTWA 1OF5A 1LNIA 5IERA 3G16A 3MG2A 4RNYA 1BRGA 2KF4A 4LEHA 1JB5A 3MYTA 3K9MC 5JPPA 4NHFA 3Q90A 1B27A 1TFOA 3CCJ3 1VQM3 3G713 1Q42A 3B8LA 5EVHA 2W04A 1DMMA 2XEPA 4EV2A 5KP4A 1V58A 2CWUA 1B2UA 3LH4A 4G1MB 4GB5A 1STDA 3EE1A 4TX4A 4FMAA 3N8BA 2HMKB 1JNQA 1M1XB 2GEXA 3EX9A 3ALAA 3B4OA 3ZFZA 1WMPA 4O02B 1TUHA 4HKVB 1M904 5IEPA 3GSPA 2R4IA 3CC43 1EQKA 4N6LA 3NM2A 3WA2X 4LMIA 1VQ63 5HOHA 1OPYA 2HMLB 1MOLA 1IYYA 4RZMA 1A2VA 2BMQB 2XSOB 2CFWA 5EQLA 1I2FA 1LOVA 1JZDA 1X1YA 1IT7A 5TGNA 3CCU3 4K1UA 3FH1A 3CD63 4DKIA 1RCLA 2H0GA 1BAOA 3LTAA 1QAKA 3CCL3 1Z1SA 5AIHA 2H0HA 3PXMA 1AV4A 1E3VA 3N54B 7STDA 4HOHA 1YVBI 1RN7A 2SBLA 4XDWA 3WOEB 1QMAA 3NX0A 6RNTA 1JV2B 4XDVA 2PZVA 1MWSA 1NWWA 3I553 3G4S3 4HBRA 3KIIA 1OF5B 4LZIA 4EBGA 1EUIC 3DGMA 3NXJA 5IF6A 3FLJA 5IG4A 1UCKA 3EBYA 1BNJA 2WGOA 1O7GB 1PYLA 3BNDA 3GWRA 3UNLA 1CYVA 2KF6A 1OGZA 1BRJA 2O9UX 2OQEC 1M9GA 3NHXA 4IPBA 4STDA 2GBXB 2ZL8A 3T0UA 4BIRA 3J7Yd 1BSDA 3EQQB 1BVIA 1PU4A 1YJN3 3FF2A 2K3DA 1LQMB 2HMOB 1SJWA 4MEIA 1VQ73 1K734 2HMJB 1RLSA 2XF3A 3OWYA 1J2BA 1B20A 1GMRA 3BNCA 3H51A 1WMOA 5CLKA 1T5YA 1FUTA 2CX0A 3KCHA 1UUVB 1W5ZA 3T8UA 1UI8A 2CKFB 2P0XA 3LYGA 1BRSA 1IV9A 4HM7B 1RTUA 2SARA 3V92A 1Q40B 4EC6A 1UGHI 1X1WA 3STDA 4J9AA 3F8XA 4WYKA 1QVG2 3ZG0A 3B4PA 1RGAA 3CC73 3HX8A 3K0ZA 1JZOA 1UGIA 3S67A 5G1LA 1S5AA 2E2TA 3EF8A 1Q824 2OCTA 1GYBA 1WQLB 3QK9A 3SEDA 3GZXB 2W6JH 4JF8A 6STDA 3NQYA 5AIGA 1VQQA 1GOVA 4N6UA 3X3YA 1KC84 2RNTA 1LVNA 2Z7AA 9RNTA 1UCJA 5BVBA 3VSYA 1T2IA 5IEOA 4GSPA 2CK3H 2HMMB 2WGQA 1GY5A 1KSIA 5HGRA 4XBTA 4J8TA 3PZWA 4KFFA 1QJGA 1VQ93 2OTL3 1B3SA 1RHLA 2RCDA 2WOFA 3EHCA 4EYCA 1N9JA 3UJMA 2P09A 3CCV3 3HOHA 1FUWA 1A2KA 2RGQA 1JBTA 4Q53A 2KXGA 1MWRA 1HU9A 1AR0A 2YFIB 3FSDA 5ELJA 4O8SA 1FGRA 1IDPA 1X1XA 4N3VA 1PFPA 1LNHA 4K1VA 3U1WA 1EKMA 2CG1A 1BSAA 3PCRA 1GY6A 2F5WA 2RFRA 4ORLA 2IY2A 1W2B2 5FW5A 5JPUA 1N5PA 3DGNA 1FYSA 5JBSA 2O3OA 3BB9A 3CCQ3 1RDSA 3I563 3GZBA 1ULIB 3X40A 3CCM3 3D9RA 3SOYA 4BL2A 1IU7A 1VQK3 1W01A 1QALA 4WHAA 1RJOA 3CPW2 2F98A 1VQN3 4IT7A 1GOYA 1I3IA 4HM5B 1BGSA 4R9KA 5EEOA 4H3UA 1W7CA 1A2PA 2BMRB 1OGXA 2CHCA 1RCKA 3X3XA 4CPKA 1US1A 3V99A 1YJW3 1BSCA 2IMJA 4RNZA 1FA3A 4XM4A 1STFI 2GU3A 2IYJA 3AGOA 3EN1B 1W2ZA 4I5QA 2R41A 2D1WA 3DXOA 3CCR3 3ER7A 3AHWA 3EBTA 1W02A 1YGEA 2W9PA 3GAXA 1HZ1A 4GHOA 2JQ5A 5AEUB 2AAEA 2FGTA 2C10A 2F5MA 1QAFA 1SIHA 2F56A 4LYLB 3BNBA 3K63A 4OK0A 3M8CA 1OACA 2P05A 3D5GA 3FG1A 1I3FA 3MPHA 2F4YA 4BTXA 1R4YA 1YHQ3 4EV5A 1FGMA 4KT3B 1JB4A 1MWTA 2ZA4A 3OXAA 1IT8A 3DY5A 3F14A 3UB1A 1SPUA 4L7KA 1BOXA 1O7PB 1ZGXA 4HM1B 1HYFA 3G0KA 3G6E3 3V98A 1Q9EA 1TRPA 3CMA3 2MC8A 1Q7HA 4HZBB 1K8A4 3LT9A 4LGQA 1IV7A 3AMOA 1BNSA 2BIRA 2YFJB 5IW9A 1I70A 4MJDA 3OX9A 3S29A 2ZHXB 3SOAA 2XGNA 3OV4A 1AVLA 1TRQA 4KVHA 1VQL3 1UUGB 3NM7A 2BU4A 4AKZA 3JUQA 1GD4A 3H3HA 3URPA 4N6MA 1O7NB 1K9M4 2OOVA 1BUQA 1RGGA 1I2GA 1N5HA 3CCS3 2B1XB 2KAAA 3HIIA 5RNTA 4QWTA 1NU3A 2CWTA 3L0RA 3A5EA 4ZM8A 3RGRA 3S27A 2W9QA 1IK3A 3HI7A 1JRQA 1RSNA 4PEJA 1RNBA 2W03A 4R80A 1VZZA 2Z77A 3FGYA 3MWZA 4AKYA 1IQXA 4HM8B 4HAAA 1RGEA 3E99A 1MWUA 3CCE3 3WOFB 3F40A 4CDLA 5M19A 1A90A 5AI1A 3KFQC 1E97A 1B2ZA 4L8PA 1TU5A 1AVKA 2KRTA 1BANA 1SARA 5LC7A 2XH9A 3DUKA 2C11A 3IPTA 3RGAA 2BHMA 5D82A 4KFEA 2MF7A 1K28A 2K0MA 1V74A 2FNQA 5D83A 3EN8A 1DVDA 1JKGA 5M1AA 3PS8A 4CCVA 1TJDA 3EC9A 3NBJA 4CJNA 2ML6A 3G8ZA 5G1KA 1W6GA 1GMPA 7RNTA 2L1SA 1B2SA 3RDEA 1F8NA 4N6NB 3DGLA 3AMOB 2IA7A 3LTBA 3SX1A 3GRDA 2UGIA 1IVVA 3CU3A 2AADA 3CPOA 4OUQA 1FW7A 4K90B 5STDA 1LXEA 1OH0A 2C4BA 1U8CB 3NV0A 3X41A 1X1UA 1MGRA 1UCIA 2E2UA 3DMCA 3NQZA 3T8NA 3JUNA 1WMNA 4HM4B 3ECFA 2XR8B 5LC6A 1BNIA 1RGFA 1SIIA 3SVAA 2L4VA 1BNFA 1CH0A 2A15A 1IQYA 3PYJA 4HM0B 4ILFA 2PNCA 4KZ1A 3WODG 1IVUA 1UDII 3MG1A 4R1KA 4XB5A 3SYUA 5BU4A 5BXQA 2BMOB 2FXTA 3JUMA 3D4AA 1YNVX 3JVCA 2J8XB 2Q07A 4FMBA 1RN1A 1FGTA 2YFLB 5AYSC 4J5GA 2LYXA 3FZWA 2CX1A 4AEQA 2BO9B 4GL6A 3ZG5A 2INXA 3ROBA 2CW9A 4X2OA 2KF3A 3SLUA 1ROAA 1TIJA 4R4KA 3OW22 7GSPA 8RNTA 3GZRA 1LOXA 2CH9A 1BIRA 2RBIA 3AHSA 3I0YA 4WYKB 3D79A 4HM6B 1T3BA 1UI7A 1OUNA 2WOHA 1JKGB 1O7HB 1EG9B 2CG0A 2UX0A 3KN4A 1CEWI 2CFDA 3O8YA 1GD3A 2XGLA 3PGBA 4RBNA 5A0OB 3KZTA 5FGOA 8CHOA 5I97A 2Z6BA 1LRAA 4BL3A 1BNRA 3K7CA 1Q814 4KFDA 1JJ22 3F7XA 1GMQA 4MMYB 3LZAA 1A67A 1NDOB 1RGLA 1D6UA 1T2HA 2IUJA 1DVCA 3NV0B 2GU1A 3NBRA 1YIT3 1RGKA 1GS3A 1R4CA 5BIRA 2GBWB 1DMNA 1ZX2A 1FGOA 1YGWA 3LOYA 1FZUA 3SXXA 1NJI4 1C54A 3AGNA 2IUKA 3KSPA 3FF0A 1LOWA 1IVWA 4FCZA 2GXFA 2HOHA 4O3VA 3LTDA 1L5GB 4HM3B 4XBYA 4MMXB 1VQ53 3OWUA 4HM2B 2XFSA 4XBXA 1E3RA 3MHEA 1OHOA 1UUWB 1SQWA 2OOVC 1OCVA 2W2CA 3Q2PA 5AYRB 2BT3A 1BUJA 3HK4A 3UL6A 4HYZA 2UUGC 4IIAA 2V1LA 1RRHA 1YVSA 2KCDA 3WMDA 4MMZB 3BLZA 3RNTA 1DETA 3TDGA 3CC23 3NUVA 1VQ43 2XSHB 2HMNB 3OWSA 5M18A 4I4KA 4RNTA 1W6CA 3IMAB 1BRNL 1JN5A 4BU4A 1Q7Y4 1ULJB 3KSED 4BTYA 1I0XA 1MNLA 1M1K4 1N8QA 1DMQA 1DYUA 5ELUA 2CC3A 2K54A 2CFKA 3F9SA 3X3ZA 4N6OB 2QEX3 1CQSA 3N9HA 1UCLA 2XFTA 1RN4A 5IG3A 3QRDA 1Q40A 2Z76A 3D3LA 3B7CA 3F8HA 5G2GA 1WNHA 4EW5A 3BNEA 6GSPA 1B2MA 1RNTA 4FCJA 1BU4A 5KP3A 2RSXA 1ASKA 3LT8A 1OHSA 1AQZA 4U13A 5KP1A 2W56A 1NB5I 1QVF2 1G0TA 3KE7A 1N9EA 1BRHA 3U97A 4J5KA 3UL5A 4HVNA 4HZ9B 3FG4A 1RMSA 3WR2A 1W6YA 2QGUA 1RGCA
chains in the Genus database with same CATH topology
3DZLA 1IQ8A 1UW1A 3X42A 4FMCA 3A76A 5AIFA 3CME3 1EA2A 2W0QA 2F99A 3K5TA 1ROVA 3PCSA 5IG0A 2ML5A 3HZPA 1RKYA 3LXUX 1JN5B 3MSOA 4FR9A 5CF2A 5IENA 2CWVA 4WWUC 1C7HA 2CFGA 2OWPA 4FMDA 1D6ZA 3FCSB 1YJ93 4H61A 2OTJ3 2CIUA 2STDA 5CXOA 3DM8A 2WO0A 4NREA 5DREA 3FG3A 1S723 4JRFA 1G96A 3F7SA 5AIIA 2M7OA 1Y4KA 1D6YA 2P38A 2YX9A 3LMLA 5D81A 3S5CA 3S28A 1KQS2 2QA43 2BNGA 2OQEA 3EB8A 3JUPA 3CNXA 1JB2A 1ISKA 4L8OA 3KKGA 1VQ83 1RRLA 1TFKA 3GZYB 3WDGB 2W56B 3CNMA 4N6V0 5DRVA 3VGNA 5AEWB 1NB3I 2XRXB 1VQP3 1IVXA 2B24B 1WTHA 2Y73A 2ZDJA 4K61A 2QIYA 1O7WB 4EXRA 3EJVA 4FCMA 1GY7A 4OVMA 2GEYA 2P0MA 3MG3A 1N8R4 5IG5A 1HKXA 1KWIA 3NBBA 1O7MB 1CYUA 3HIGA 3JUOA 5CK6A 4HJLB 1NO3A 1U5OA 1W00A 2LQVA 3Q1CA 3VF1A 1K41A 4R9LA 4LSOA 3IJEB 3CXC2 1VQO3 1W4NA 3LTCA 3DGOA 4X2HA 3FKAA 4WFOA 1Q864 1YI23 1YIJ3 1TP6A 1ZO2A 2F86B 2I9WA 2JDIH 5CF1A 3WA3A 2Y74A 4O2HA 4WP5A 2D42A 1OHPA 4N6TA 1FGQA 2E2VA 3MKIA 1KD14 2CFLA 4BTWA 1OF5A 5IERA 3G16A 3MG2A 4RNYA 4LEHA 1JB5A 3MYTA 3K9MC 5JPPA 4NHFA 3Q90A 1TFOA 3CCJ3 1VQM3 3G713 1Q42A 3B8LA 5EVHA 2W04A 1DMMA 2XEPA 4EV2A 5KP4A 2CWUA 4G1MB 3LH4A 4GB5A 4TX4A 1STDA 3EE1A 4FMAA 3N8BA 2HMKB 1JNQA 1M1XB 2GEXA 3EX9A 3ALAA 3B4OA 1WMPA 4O02B 1TUHA 4HKVB 1M904 5IEPA 3CC43 2R4IA 1EQKA 4N6LA 3NM2A 3WA2X 4LMIA 1VQ63 1OPYA 2HMLB 1MOLA 4RZMA 1A2VA 2BMQB 2XSOB 2CFWA 5EQLA 3CD63 5TGNA 3CCU3 1IT7A 4K1UA 3FH1A 3LTAA 1QAKA 3CCL3 1Z1SA 5AIHA 3PXMA 1AV4A 1E3VA 3N54B 7STDA 1YVBI 1RN7A 2SBLA 4XDWA 3WOEB 1QMAA 3NX0A 1JV2B 4XDVA 2PZVA 1NWWA 3I553 3G4S3 4HBRA 3KIIA 1OF5B 4LZIA 4EBGA 3DGMA 5IF6A 3NXJA 3FLJA 5IG4A 3EBYA 2WGOA 1O7GB 3BNDA 3GWRA 3UNLA 1CYVA 1OGZA 2OQEC 2O9UX 3NHXA 1M9GA 4IPBA 4STDA 2GBXB 2ZL8A 3T0UA 3J7Yd 3EQQB 1PU4A 1YJN3 3FF2A 2HMOB 1SJWA 4MEIA 1VQ73 1K734 2HMJB 2XF3A 3OWYA 1J2BA 3BNCA 3H51A 1WMOA 5CLKA 1T5YA 1UUVB 1W5ZA 3T8UA 1UI8A 2CKFB 2P0XA 3LYGA 1IV9A 4HM7B 3V92A 1Q40B 4EC6A 3STDA 4J9AA 3F8XA 4WYKA 1QVG2 3B4PA 3CC73 3HX8A 3K0ZA 3S67A 1S5AA 2E2TA 3EF8A 1Q824 2OCTA 1GYBA 1WQLB 3QK9A 3SEDA 3GZXB 2W6JH 4JF8A 6STDA 3NQYA 5AIGA 4N6UA 1KC84 3X3YA 1LVNA 2Z7AA 5BVBA 3VSYA 5IEOA 2CK3H 2HMMB 2WGQA 1GY5A 1KSIA 5HGRA 4XBTA 4J8TA 3PZWA 4KFFA 1QJGA 1VQ93 2OTL3 2RCDA 4EYCA 2WOFA 3EHCA 1N9JA 3UJMA 2P09A 3CCV3 1FUWA 1A2KA 2RGQA 4Q53A 2KXGA 1HU9A 1AR0A 2YFIB 3FSDA 5ELJA 4O8SA 1FGRA 1IDPA 4N3VA 1PFPA 1LNHA 4K1VA 3U1WA 1EKMA 2CG1A 3PCRA 1GY6A 2RFRA 4ORLA 1W2B2 5FW5A 5JPUA 1N5PA 3DGNA 5JBSA 2O3OA 3BB9A 3CCQ3 3I563 3GZBA 1ULIB 3X40A 3CCM3 3D9RA 3SOYA 1IU7A 1VQK3 1W01A 1QALA 4WHAA 1RJOA 3CPW2 2F98A 1VQN3 4IT7A 4HM5B 4R9KA 5EEOA 4H3UA 1W7CA 2BMRB 1OGXA 2CHCA 3X3XA 1US1A 3V99A 1YJW3 2IMJA 4RNZA 1FA3A 4XM4A 1STFI 2GU3A 3EN1B 1W2ZA 2D1WA 3DXOA 3CCR3 3ER7A 3EBTA 1W02A 1YGEA 2W9PA 3GAXA 2JQ5A 5AEUB 2FGTA 2C10A 1QAFA 1SIHA 3BNBA 3K63A 4OK0A 3M8CA 1OACA 2P05A 3FG1A 3MPHA 4BTXA 1YHQ3 4EV5A 1FGMA 1JB4A 3OXAA 1IT8A 3DY5A 3F14A 3UB1A 1SPUA 4L7KA 1O7PB 4HM1B 3G0KA 3G6E3 3V98A 3CMA3 2MC8A 4HZBB 1K8A4 3LT9A 4LGQA 1IV7A 3AMOA 2YFJB 5IW9A 4MJDA 3OX9A 3S29A 3SOAA 2XGNA 3OV4A 1AVLA 4KVHA 1VQL3 3NM7A 4AKZA 3JUQA 1GD4A 3H3HA 4N6MA 1O7NB 1K9M4 2OOVA 1BUQA 1N5HA 3CCS3 2B1XB 3HIIA 4QWTA 1NU3A 2CWTA 3L0RA 4ZM8A 3RGRA 3S27A 2W9QA 1IK3A 3HI7A 1JRQA 4PEJA 2W03A 4R80A 1VZZA 2Z77A 3FGYA 3MWZA 4AKYA 1IQXA 4HM8B 3E99A 3CCE3 1A90A 3WOFB 3F40A 4CDLA 5AI1A 3KFQC 1E97A 4L8PA 1TU5A 2KRTA 5LC7A 2XH9A 3DUKA 2C11A 3IPTA 3RGAA 2BHMA 5D82A 4KFEA 2MF7A 1K28A 2K0MA 1V74A 2FNQA 5D83A 3EN8A 1DVDA 1JKGA 3PS8A 4CCVA 3EC9A 3NBJA 2ML6A 3G8ZA 1W6GA 3RDEA 1F8NA 4N6NB 3DGLA 3AMOB 2IA7A 3LTBA 3SX1A 3GRDA 3CU3A 1IVVA 3CPOA 4OUQA 4K90B 5STDA 1LXEA 1OH0A 1U8CB 3NV0A 3X41A 2E2UA 3DMCA 3NQZA 3T8NA 3JUNA 1WMNA 4HM4B 3ECFA 2XR8B 5LC6A 1SIIA 3SVAA 2L4VA 2A15A 1IQYA 3PYJA 4HM0B 4KZ1A 2PNCA 3WODG 1IVUA 4R1KA 3MG1A 4XB5A 5BXQA 2BMOB 2FXTA 3JUMA 3JVCA 2Q07A 4FMBA 1FGTA 2YFLB 5AYSC 2LYXA 3FZWA 4AEQA 2BO9B 4GL6A 2INXA 3ROBA 2CW9A 4X2OA 3SLUA 1ROAA 1TIJA 4R4KA 3OW22 3GZRA 1LOXA 2CH9A 3I0YA 4WYKB 4HM6B 2WOHA 1UI7A 1OUNA 3KN4A 1JKGB 1O7HB 1EG9B 2CG0A 2UX0A 1CEWI 2CFDA 3O8YA 1GD3A 2XGLA 3PGBA 4RBNA 5A0OB 3KZTA 5FGOA 8CHOA 5I97A 2Z6BA 3K7CA 1Q814 4KFDA 1JJ22 3F7XA 4MMYB 3LZAA 1A67A 1NDOB 1D6UA 2IUJA 1DVCA 3NV0B 2GU1A 3NBRA 1YIT3 1GS3A 1R4CA 2GBWB 1DMNA 1ZX2A 1FGOA 3LOYA 3SXXA 1NJI4 3KSPA 2IUKA 3FF0A 4FCZA 1IVWA 2GXFA 4O3VA 3LTDA 1L5GB 4HM3B 4XBYA 4MMXB 1VQ53 3OWUA 4HM2B 2XFSA 4XBXA 1E3RA 3MHEA 1OHOA 1UUWB 1SQWA 2OOVC 1OCVA 2W2CA 3Q2PA 5AYRB 2BT3A 3HK4A 3UL6A 4HYZA 4IIAA 2V1LA 1RRHA 2KCDA 3WMDA 4MMZB 3BLZA 3TDGA 3CC23 3NUVA 1VQ43 2XSHB 2HMNB 3OWSA 4I4KA 1W6CA 3IMAB 1JN5A 1Q7Y4 1ULJB 3KSED 4BTYA 1MNLA 1M1K4 1N8QA 1DMQA 1DYUA 5ELUA 2CC3A 2K54A 2CFKA 3F9SA 3X3ZA 4N6OB 2QEX3 1CQSA 3N9HA 2XFTA 5IG3A 3QRDA 1Q40A 2Z76A 3D3LA 3B7CA 3F8HA 5G2GA 1WNHA 3BNEA 4FCJA 5KP3A 2RSXA 1ASKA 3LT8A 1OHSA 4U13A 5KP1A 2W56A 1NB5I 1QVF2 3KE7A 1N9EA 3U97A 3UL5A 4HVNA 4HZ9B 3FG4A 1W6YA 2QGUA 1AVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZL A;  3A76 A;  5AIF A;  1EA2 A;  2F99 A;  5IG0 A;  3HZP A;  1JN5 B;  3MSO A;  5CF2 A;  5IEN A;  4WWU C;  1C7H A;  2OWP A;  2STD A;  5CXO A;  3DM8 A;  5DRE A;  3F7S A;  5AII A;  5D81 A;  3S5C A;  2BNG A;  3JUP A;  3CNX A;  1JB2 A;  1ISK A;  4L8O A;  3KKG A;  3GZY B;  3CNM A;  5DRV A;  3VGN A;  5AEW B;  2XRX B;  2B24 B;  2QIY A;  1O7W B;  3EJV A;  4FCM A;  1GY7 A;  4OVM A;  2GEY A;  3MG3 A;  5IG5 A;  1HKX A;  1O7M B;  3JUO A;  5CK6 A;  4HJL B;  1U5O A;  1W00 A;  1K41 A;  4R9L A;  4X2H A;  3FKA A;  1TP6 A;  1ZO2 A;  2F86 B;  2I9W A;  5CF1 A;  4WP5 A;  1OHP A;  3MKI A;  1OF5 A;  5IER A;  3G16 A;  3MG2 A;  4LEH A;  1JB5 A;  3MYT A;  5JPP A;  3Q90 A;  1Q42 A;  3B8L A;  5EVH A;  5KP4 A;  1DMM A;  4GB5 A;  1STD A;  2HMK B;  2GEX A;  3EX9 A;  3B4O A;  1TUH A;  4HKV B;  5IEP A;  2R4I A;  3NM2 A;  4LMI A;  1OPY A;  2HML B;  4RZM A;  2XSO B;  2BMQ B;  5TGN A;  4K1U A;  3FH1 A;  1Z1S A;  5AIH A;  1E3V A;  7STD A;  4XDW A;  1QMA A;  4XDV A;  2PZV A;  1NWW A;  1OF5 B;  5IF6 A;  3NXJ A;  3FLJ A;  5IG4 A;  3EBY A;  1O7G B;  3GWR A;  3UNL A;  1OGZ A;  3NHX A;  4STD A;  2GBX B;  3EQQ B;  3FF2 A;  2HMO B;  1SJW A;  2HMJ B;  3OWY A;  3H51 A;  5CLK A;  1UUV B;  3T8U A;  2CKF B;  3LYG A;  4HM7 B;  1Q40 B;  3STD A;  4J9A A;  3F8X A;  4WYK A;  3B4P A;  3HX8 A;  3K0Z A;  1S5A A;  3EF8 A;  1GYB A;  1WQL B;  3SED A;  3GZX B;  6STD A;  5AIG A;  2Z7A A;  5BVB A;  3VSY A;  5IEO A;  2HMM B;  1GY5 A;  5HGR A;  4XBT A;  4J8T A;  1QJG A;  2RCD A;  3EHC A;  3UJM A;  1A2K A;  2RGQ A;  4Q53 A;  1AR0 A;  2YFI B;  3FSD A;  1IDP A;  4N3V A;  4K1V A;  4ORL A;  1GY6 A;  2RFR A;  5FW5 A;  5JPU A;  3BB9 A;  3GZB A;  1ULI B;  3D9R A;  3SOY A;  1W01 A;  2F98 A;  4HM5 B;  4R9K A;  4H3U A;  2BMR B;  1OGX A;  2CHC A;  2IMJ A;  4XM4 A;  3EN1 B;  3DXO A;  3ER7 A;  3EBT A;  1W02 A;  2JQ5 A;  5AEU B;  3M8C A;  1JB4 A;  3OXA A;  3F14 A;  4L7K A;  1O7P B;  4HM1 B;  3G0K A;  4HZB B;  4LGQ A;  2YFJ B;  4MJD A;  3OX9 A;  3SOA A;  3OV4 A;  4KVH A;  3JUQ A;  3H3H A;  1O7N B;  1BUQ A;  2B1X B;  1NU3 A;  3RGR A;  4PEJ A;  1VZZ A;  2Z77 A;  3FGY A;  4HM8 B;  3E99 A;  3F40 A;  4CDL A;  5AI1 A;  1E97 A;  4L8P A;  3IPT A;  3DUK A;  3RGA A;  5D82 A;  5D83 A;  3EN8 A;  1JKG A;  3EC9 A;  3G8Z A;  3GRD A;  3CU3 A;  3CPO A;  4OUQ A;  5STD A;  1OH0 A;  3NV0 A;  3DMC A;  3T8N A;  3JUN A;  4HM4 B;  3ECF A;  2XR8 B;  2A15 A;  4HM0 B;  4R1K A;  4XB5 A;  3MG1 A;  5BXQ A;  2BMO B;  3JUM A;  2YFL B;  3FZW A;  2INX A;  3ROB A;  4X2O A;  3GZR A;  3I0Y A;  4WYK B;  4HM6 B;  1OUN A;  1JKG B;  1O7H B;  1EG9 B;  2UX0 A;  8CHO A;  3KZT A;  3K7C A;  3F7X A;  3LZA A;  1NDO B;  3NV0 B;  3NBR A;  1GS3 A;  2GBW B;  1DMN A;  1ZX2 A;  3KSP A;  3FF0 A;  2GXF A;  4HM3 B;  4XBY A;  3OWU A;  4HM2 B;  4XBX A;  1E3R A;  3MHE A;  1OHO A;  1UUW B;  1OCV A;  2W2C A;  3HK4 A;  4IIA A;  3WMD A;  3BLZ A;  3NUV A;  2XSH B;  2HMN B;  3OWS A;  4I4K A;  1JN5 A;  1ULJ B;  1DMQ A;  2K54 A;  3F9S A;  1CQS A;  5IG3 A;  1Q40 A;  2Z76 A;  3B7C A;  3F8H A;  5G2G A;  4FCJ A;  5KP3 A;  1ASK A;  1OHS A;  4U13 A;  5KP1 A;  3KE7 A;  4HVN A;  4HZ9 B;  1W6Y A;  2QGU A; 
#chains in the Genus database with same CATH topology
 3DZL A;  1IQ8 A;  1UW1 A;  1PY3 A;  1TTO A;  4FMC A;  3X42 A;  3A76 A;  5AIF A;  1B21 A;  1I0V A;  3CME 3;  1EA2 A;  2H0I A;  2F99 A;  2W0Q A;  1BSB A;  1EEJ A;  3K5T A;  1ROV A;  1I2E A;  3BU4 A;  3PCS A;  1RGH A;  5IG0 A;  2ML5 A;  3HZP A;  1JBR A;  1RKY A;  3LXU X;  1JBS A;  1JN5 B;  3D5I A;  3MSO A;  4FR9 A;  1MGW A;  5CF2 A;  5IEN A;  2CWV A;  4WWU C;  1C7H A;  2CFG A;  2OWP A;  4FMD A;  1D6Z A;  3FCS B;  1YJ9 3;  4H61 A;  2OTJ 3;  2CIU A;  2STD A;  5CXO A;  3DM8 A;  2WO0 A;  4NRE A;  3DGY A;  5DRE A;  3FG3 A;  1S72 3;  2GSP A;  1G96 A;  4JRF A;  3F7S A;  5AII A;  2M7O A;  1Y4K A;  1D6Y A;  1I8V A;  1G02 A;  2P38 A;  2YX9 A;  3LML A;  5D81 A;  3DH2 A;  3S5C A;  3S28 A;  1KQS 2;  2QA4 3;  2BNG A;  2OQE A;  3EB8 A;  1FUS A;  3JUP A;  3CNX A;  1JB2 A;  1ISK A;  1LQG C;  4L8O A;  3KKG A;  1BRI A;  1VQ8 3;  1NNV A;  1RRL A;  1B2X A;  1TFK A;  3GZY B;  3WDG B;  1GSP A;  2W56 B;  1DE3 A;  3CNM A;  4N6V 0;  4NPB A;  1GOU A;  5DRV A;  1AY7 A;  2KF5 A;  3VGN A;  1NB3 I;  5AEW B;  2XRX B;  1VQP 3;  1IVX A;  2B24 B;  1WTH A;  2Y73 A;  2ZDJ A;  1V57 A;  4K61 A;  2QIY A;  1O7W B;  4EXR A;  3EJV A;  1BNE A;  4FCM A;  1GY7 A;  4OVM A;  2GEY A;  2P0M A;  3WHO A;  3MG3 A;  1ZS7 A;  1N8R 4;  5IG5 A;  1HKX A;  1KWI A;  3NBB A;  1LOY A;  5GSP A;  1O7M B;  1BSE A;  1CYU A;  3HIG A;  3JUO A;  5CK6 A;  4HJL B;  1NO3 A;  1U5O A;  1W00 A;  2LQV A;  3Q1C A;  3VF1 A;  1K41 A;  4R9L A;  4LSO A;  3IJE B;  3CXC 2;  1VQO 3;  1W4N A;  3LTC A;  3DGO A;  4X2H A;  3FKA A;  1BRK A;  4WFO A;  1Q86 4;  1YI2 3;  1YIJ 3;  1TP6 A;  1ZO2 A;  2F86 B;  2I9W A;  2JDI H;  5CF1 A;  3WA3 A;  2Y74 A;  3Q3F A;  4O2H A;  4WP5 A;  1BNG A;  2D42 A;  1OHP A;  3BIR A;  1FGQ A;  2E2V A;  4N6T A;  3MKI A;  1KD1 4;  2CFL A;  4BTW A;  1OF5 A;  1LNI A;  5IER A;  3G16 A;  3MG2 A;  4RNY A;  1BRG A;  2KF4 A;  4LEH A;  1JB5 A;  3MYT A;  3K9M C;  5JPP A;  4NHF A;  3Q90 A;  1B27 A;  1TFO A;  3CCJ 3;  1VQM 3;  3G71 3;  1Q42 A;  3B8L A;  5EVH A;  2W04 A;  1DMM A;  2XEP A;  4EV2 A;  5KP4 A;  1V58 A;  2CWU A;  1B2U A;  3LH4 A;  4G1M B;  4GB5 A;  1STD A;  3EE1 A;  4TX4 A;  4FMA A;  3N8B A;  2HMK B;  1JNQ A;  1M1X B;  2GEX A;  3EX9 A;  3ALA A;  3B4O A;  3ZFZ A;  1WMP A;  4O02 B;  1TUH A;  4HKV B;  1M90 4;  5IEP A;  3GSP A;  2R4I A;  3CC4 3;  1EQK A;  4N6L A;  3NM2 A;  3WA2 X;  4LMI A;  1VQ6 3;  5HOH A;  1OPY A;  2HML B;  1MOL A;  1IYY A;  4RZM A;  1A2V A;  2BMQ B;  2XSO B;  2CFW A;  5EQL A;  1I2F A;  1LOV A;  1JZD A;  1X1Y A;  1IT7 A;  5TGN A;  3CCU 3;  4K1U A;  3FH1 A;  3CD6 3;  4DKI A;  1RCL A;  2H0G A;  1BAO A;  3LTA A;  1QAK A;  3CCL 3;  1Z1S A;  5AIH A;  2H0H A;  3PXM A;  1AV4 A;  1E3V A;  3N54 B;  7STD A;  4HOH A;  1YVB I;  1RN7 A;  2SBL A;  4XDW A;  3WOE B;  1QMA A;  3NX0 A;  6RNT A;  1JV2 B;  4XDV A;  2PZV A;  1MWS A;  1NWW A;  3I55 3;  3G4S 3;  4HBR A;  3KII A;  1OF5 B;  4LZI A;  4EBG A;  1EUI C;  3DGM A;  3NXJ A;  5IF6 A;  3FLJ A;  5IG4 A;  1UCK A;  3EBY A;  1BNJ A;  2WGO A;  1O7G B;  1PYL A;  3BND A;  3GWR A;  3UNL A;  1CYV A;  2KF6 A;  1OGZ A;  1BRJ A;  2O9U X;  2OQE C;  1M9G A;  3NHX A;  4IPB A;  4STD A;  2GBX B;  2ZL8 A;  3T0U A;  4BIR A;  3J7Y d;  1BSD A;  3EQQ B;  1BVI A;  1PU4 A;  1YJN 3;  3FF2 A;  2K3D A;  1LQM B;  2HMO B;  1SJW A;  4MEI A;  1VQ7 3;  1K73 4;  2HMJ B;  1RLS A;  2XF3 A;  3OWY A;  1J2B A;  1B20 A;  1GMR A;  3BNC A;  3H51 A;  1WMO A;  5CLK A;  1T5Y A;  1FUT A;  2CX0 A;  3KCH A;  1UUV B;  1W5Z A;  3T8U A;  1UI8 A;  2CKF B;  2P0X A;  3LYG A;  1BRS A;  1IV9 A;  4HM7 B;  1RTU A;  2SAR A;  3V92 A;  1Q40 B;  4EC6 A;  1UGH I;  1X1W A;  3STD A;  4J9A A;  3F8X A;  4WYK A;  1QVG 2;  3ZG0 A;  3B4P A;  1RGA A;  3CC7 3;  3HX8 A;  3K0Z A;  1JZO A;  1UGI A;  3S67 A;  5G1L A;  1S5A A;  2E2T A;  3EF8 A;  1Q82 4;  2OCT A;  1GYB A;  1WQL B;  3QK9 A;  3SED A;  3GZX B;  2W6J H;  4JF8 A;  6STD A;  3NQY A;  5AIG A;  1VQQ A;  1GOV A;  4N6U A;  3X3Y A;  1KC8 4;  2RNT A;  1LVN A;  2Z7A A;  9RNT A;  1UCJ A;  5BVB A;  3VSY A;  1T2I A;  5IEO A;  4GSP A;  2CK3 H;  2HMM B;  2WGQ A;  1GY5 A;  1KSI A;  5HGR A;  4XBT A;  4J8T A;  3PZW A;  4KFF A;  1QJG A;  1VQ9 3;  2OTL 3;  1B3S A;  1RHL A;  2RCD A;  2WOF A;  3EHC A;  4EYC A;  1N9J A;  3UJM A;  2P09 A;  3CCV 3;  3HOH A;  1FUW A;  1A2K A;  2RGQ A;  1JBT A;  4Q53 A;  2KXG A;  1MWR A;  1HU9 A;  1AR0 A;  2YFI B;  3FSD A;  5ELJ A;  4O8S A;  1FGR A;  1IDP A;  1X1X A;  4N3V A;  1PFP A;  1LNH A;  4K1V A;  3U1W A;  1EKM A;  2CG1 A;  1BSA A;  3PCR A;  1GY6 A;  2F5W A;  2RFR A;  4ORL A;  2IY2 A;  1W2B 2;  5FW5 A;  5JPU A;  1N5P A;  3DGN A;  1FYS A;  5JBS A;  2O3O A;  3BB9 A;  3CCQ 3;  1RDS A;  3I56 3;  3GZB A;  1ULI B;  3X40 A;  3CCM 3;  3D9R A;  3SOY A;  4BL2 A;  1IU7 A;  1VQK 3;  1W01 A;  1QAL A;  4WHA A;  1RJO A;  3CPW 2;  2F98 A;  1VQN 3;  4IT7 A;  1GOY A;  1I3I A;  4HM5 B;  1BGS A;  4R9K A;  5EEO A;  4H3U A;  1W7C A;  1A2P A;  2BMR B;  1OGX A;  2CHC A;  1RCK A;  3X3X A;  4CPK A;  1US1 A;  3V99 A;  1YJW 3;  1BSC A;  2IMJ A;  4RNZ A;  1FA3 A;  4XM4 A;  1STF I;  2GU3 A;  2IYJ A;  3AGO A;  3EN1 B;  1W2Z A;  4I5Q A;  2R41 A;  2D1W A;  3DXO A;  3CCR 3;  3ER7 A;  3AHW A;  3EBT A;  1W02 A;  1YGE A;  2W9P A;  3GAX A;  1HZ1 A;  4GHO A;  2JQ5 A;  5AEU B;  2AAE A;  2FGT A;  2C10 A;  2F5M A;  1QAF A;  1SIH A;  2F56 A;  4LYL B;  3BNB A;  3K63 A;  4OK0 A;  3M8C A;  1OAC A;  2P05 A;  3D5G A;  3FG1 A;  1I3F A;  3MPH A;  2F4Y A;  4BTX A;  1R4Y A;  1YHQ 3;  4EV5 A;  1FGM A;  4KT3 B;  1JB4 A;  1MWT A;  2ZA4 A;  3OXA A;  1IT8 A;  3DY5 A;  3F14 A;  3UB1 A;  1SPU A;  4L7K A;  1BOX A;  1O7P B;  1ZGX A;  4HM1 B;  1HYF A;  3G0K A;  3G6E 3;  3V98 A;  1Q9E A;  1TRP A;  3CMA 3;  2MC8 A;  1Q7H A;  4HZB B;  1K8A 4;  3LT9 A;  4LGQ A;  1IV7 A;  3AMO A;  1BNS A;  2BIR A;  2YFJ B;  5IW9 A;  1I70 A;  4MJD A;  3OX9 A;  3S29 A;  2ZHX B;  3SOA A;  2XGN A;  3OV4 A;  1AVL A;  1TRQ A;  4KVH A;  1VQL 3;  1UUG B;  3NM7 A;  2BU4 A;  4AKZ A;  3JUQ A;  1GD4 A;  3H3H A;  3URP A;  4N6M A;  1O7N B;  1K9M 4;  2OOV A;  1BUQ A;  1RGG A;  1I2G A;  1N5H A;  3CCS 3;  2B1X B;  2KAA A;  3HII A;  5RNT A;  4QWT A;  1NU3 A;  2CWT A;  3L0R A;  3A5E A;  4ZM8 A;  3RGR A;  3S27 A;  2W9Q A;  1IK3 A;  3HI7 A;  1JRQ A;  1RSN A;  4PEJ A;  1RNB A;  2W03 A;  4R80 A;  1VZZ A;  2Z77 A;  3FGY A;  3MWZ A;  4AKY A;  1IQX A;  4HM8 B;  4HAA A;  1RGE A;  3E99 A;  1MWU A;  3CCE 3;  3WOF B;  3F40 A;  4CDL A;  5M19 A;  1A90 A;  5AI1 A;  3KFQ C;  1E97 A;  1B2Z A;  4L8P A;  1TU5 A;  1AVK A;  2KRT A;  1BAN A;  1SAR A;  5LC7 A;  2XH9 A;  3DUK A;  2C11 A;  3IPT A;  3RGA A;  2BHM A;  5D82 A;  4KFE A;  2MF7 A;  1K28 A;  2K0M A;  1V74 A;  2FNQ A;  5D83 A;  3EN8 A;  1DVD A;  1JKG A;  5M1A A;  3PS8 A;  4CCV A;  1TJD A;  3EC9 A;  3NBJ A;  4CJN A;  2ML6 A;  3G8Z A;  5G1K A;  1W6G A;  1GMP A;  7RNT A;  2L1S A;  1B2S A;  3RDE A;  1F8N A;  4N6N B;  3DGL A;  3AMO B;  2IA7 A;  3LTB A;  3SX1 A;  3GRD A;  2UGI A;  1IVV A;  3CU3 A;  2AAD A;  3CPO A;  4OUQ A;  1FW7 A;  4K90 B;  5STD A;  1LXE A;  1OH0 A;  2C4B A;  1U8C B;  3NV0 A;  3X41 A;  1X1U A;  1MGR A;  1UCI A;  2E2U A;  3DMC A;  3NQZ A;  3T8N A;  3JUN A;  1WMN A;  4HM4 B;  3ECF A;  2XR8 B;  5LC6 A;  1BNI A;  1RGF A;  1SII A;  3SVA A;  2L4V A;  1BNF A;  1CH0 A;  2A15 A;  1IQY A;  3PYJ A;  4HM0 B;  4ILF A;  2PNC A;  4KZ1 A;  3WOD G;  1IVU A;  1UDI I;  3MG1 A;  4R1K A;  4XB5 A;  3SYU A;  5BU4 A;  5BXQ A;  2BMO B;  2FXT A;  3JUM A;  3D4A A;  1YNV X;  3JVC A;  2J8X B;  2Q07 A;  4FMB A;  1RN1 A;  1FGT A;  2YFL B;  5AYS C;  4J5G A;  2LYX A;  3FZW A;  2CX1 A;  4AEQ A;  2BO9 B;  4GL6 A;  3ZG5 A;  2INX A;  3ROB A;  2CW9 A;  4X2O A;  2KF3 A;  3SLU A;  1ROA A;  1TIJ A;  4R4K A;  3OW2 2;  7GSP A;  8RNT A;  3GZR A;  1LOX A;  2CH9 A;  1BIR A;  2RBI A;  3AHS A;  3I0Y A;  4WYK B;  3D79 A;  4HM6 B;  1T3B A;  1UI7 A;  1OUN A;  2WOH A;  1JKG B;  1O7H B;  1EG9 B;  2CG0 A;  2UX0 A;  3KN4 A;  1CEW I;  2CFD A;  3O8Y A;  1GD3 A;  2XGL A;  3PGB A;  4RBN A;  5A0O B;  3KZT A;  5FGO A;  8CHO A;  5I97 A;  2Z6B A;  1LRA A;  4BL3 A;  1BNR A;  3K7C A;  1Q81 4;  4KFD A;  1JJ2 2;  3F7X A;  1GMQ A;  4MMY B;  3LZA A;  1A67 A;  1NDO B;  1RGL A;  1D6U A;  1T2H A;  2IUJ A;  1DVC A;  3NV0 B;  2GU1 A;  3NBR A;  1YIT 3;  1RGK A;  1GS3 A;  1R4C A;  5BIR A;  2GBW B;  1DMN A;  1ZX2 A;  1FGO A;  1YGW A;  3LOY A;  1FZU A;  3SXX A;  1NJI 4;  1C54 A;  3AGN A;  2IUK A;  3KSP A;  3FF0 A;  1LOW A;  1IVW A;  4FCZ A;  2GXF A;  2HOH A;  4O3V A;  3LTD A;  1L5G B;  4HM3 B;  4XBY A;  4MMX B;  1VQ5 3;  3OWU A;  4HM2 B;  2XFS A;  4XBX A;  1E3R A;  3MHE A;  1OHO A;  1UUW B;  1SQW A;  2OOV C;  1OCV A;  2W2C A;  3Q2P A;  5AYR B;  2BT3 A;  1BUJ A;  3HK4 A;  3UL6 A;  4HYZ A;  2UUG C;  4IIA A;  2V1L A;  1RRH A;  1YVS A;  2KCD A;  3WMD A;  4MMZ B;  3BLZ A;  3RNT A;  1DET A;  3TDG A;  3CC2 3;  3NUV A;  1VQ4 3;  2XSH B;  2HMN B;  3OWS A;  5M18 A;  4I4K A;  4RNT A;  1W6C A;  3IMA B;  1BRN L;  1JN5 A;  4BU4 A;  1Q7Y 4;  1ULJ B;  3KSE D;  4BTY A;  1I0X A;  1MNL A;  1M1K 4;  1N8Q A;  1DMQ A;  1DYU A;  5ELU A;  2CC3 A;  2K54 A;  2CFK A;  3F9S A;  3X3Z A;  4N6O B;  2QEX 3;  1CQS A;  3N9H A;  1UCL A;  2XFT A;  1RN4 A;  5IG3 A;  3QRD A;  1Q40 A;  2Z76 A;  3D3L A;  3B7C A;  3F8H A;  5G2G A;  1WNH A;  4EW5 A;  3BNE A;  6GSP A;  1B2M A;  1RNT A;  4FCJ A;  1BU4 A;  5KP3 A;  2RSX A;  1ASK A;  3LT8 A;  1OHS A;  1AQZ A;  4U13 A;  5KP1 A;  2W56 A;  1NB5 I;  1QVF 2;  1G0T A;  3KE7 A;  1N9E A;  1BRH A;  3U97 A;  4J5K A;  3UL5 A;  4HVN A;  4HZ9 B;  3FG4 A;  1RMS A;  3WR2 A;  1W6Y A;  2QGU A;  1RGC A; 
#chains in the Genus database with same CATH homology
 3DZL A;  1IQ8 A;  1UW1 A;  3X42 A;  4FMC A;  3A76 A;  5AIF A;  3CME 3;  1EA2 A;  2W0Q A;  2F99 A;  3K5T A;  1ROV A;  3PCS A;  5IG0 A;  2ML5 A;  3HZP A;  1RKY A;  3LXU X;  1JN5 B;  3MSO A;  4FR9 A;  5CF2 A;  5IEN A;  2CWV A;  4WWU C;  1C7H A;  2CFG A;  2OWP A;  4FMD A;  1D6Z A;  3FCS B;  1YJ9 3;  4H61 A;  2OTJ 3;  2CIU A;  2STD A;  5CXO A;  3DM8 A;  2WO0 A;  4NRE A;  5DRE A;  3FG3 A;  1S72 3;  4JRF A;  1G96 A;  3F7S A;  5AII A;  2M7O A;  1Y4K A;  1D6Y A;  2P38 A;  2YX9 A;  3LML A;  5D81 A;  3S5C A;  3S28 A;  1KQS 2;  2QA4 3;  2BNG A;  2OQE A;  3EB8 A;  3JUP A;  3CNX A;  1JB2 A;  1ISK A;  4L8O A;  3KKG A;  1VQ8 3;  1RRL A;  1TFK A;  3GZY B;  3WDG B;  2W56 B;  3CNM A;  4N6V 0;  5DRV A;  3VGN A;  5AEW B;  1NB3 I;  2XRX B;  1VQP 3;  1IVX A;  2B24 B;  1WTH A;  2Y73 A;  2ZDJ A;  4K61 A;  2QIY A;  1O7W B;  4EXR A;  3EJV A;  4FCM A;  1GY7 A;  4OVM A;  2GEY A;  2P0M A;  3MG3 A;  1N8R 4;  5IG5 A;  1HKX A;  1KWI A;  3NBB A;  1O7M B;  1CYU A;  3HIG A;  3JUO A;  5CK6 A;  4HJL B;  1NO3 A;  1U5O A;  1W00 A;  2LQV A;  3Q1C A;  3VF1 A;  1K41 A;  4R9L A;  4LSO A;  3IJE B;  3CXC 2;  1VQO 3;  1W4N A;  3LTC A;  3DGO A;  4X2H A;  3FKA A;  4WFO A;  1Q86 4;  1YI2 3;  1YIJ 3;  1TP6 A;  1ZO2 A;  2F86 B;  2I9W A;  2JDI H;  5CF1 A;  3WA3 A;  2Y74 A;  4O2H A;  4WP5 A;  2D42 A;  1OHP A;  4N6T A;  1FGQ A;  2E2V A;  3MKI A;  1KD1 4;  2CFL A;  4BTW A;  1OF5 A;  5IER A;  3G16 A;  3MG2 A;  4RNY A;  4LEH A;  1JB5 A;  3MYT A;  3K9M C;  5JPP A;  4NHF A;  3Q90 A;  1TFO A;  3CCJ 3;  1VQM 3;  3G71 3;  1Q42 A;  3B8L A;  5EVH A;  2W04 A;  1DMM A;  2XEP A;  4EV2 A;  5KP4 A;  2CWU A;  4G1M B;  3LH4 A;  4GB5 A;  4TX4 A;  1STD A;  3EE1 A;  4FMA A;  3N8B A;  2HMK B;  1JNQ A;  1M1X B;  2GEX A;  3EX9 A;  3ALA A;  3B4O A;  1WMP A;  4O02 B;  1TUH A;  4HKV B;  1M90 4;  5IEP A;  3CC4 3;  2R4I A;  1EQK A;  4N6L A;  3NM2 A;  3WA2 X;  4LMI A;  1VQ6 3;  1OPY A;  2HML B;  1MOL A;  4RZM A;  1A2V A;  2BMQ B;  2XSO B;  2CFW A;  5EQL A;  3CD6 3;  5TGN A;  3CCU 3;  1IT7 A;  4K1U A;  3FH1 A;  3LTA A;  1QAK A;  3CCL 3;  1Z1S A;  5AIH A;  3PXM A;  1AV4 A;  1E3V A;  3N54 B;  7STD A;  1YVB I;  1RN7 A;  2SBL A;  4XDW A;  3WOE B;  1QMA A;  3NX0 A;  1JV2 B;  4XDV A;  2PZV A;  1NWW A;  3I55 3;  3G4S 3;  4HBR A;  3KII A;  1OF5 B;  4LZI A;  4EBG A;  3DGM A;  5IF6 A;  3NXJ A;  3FLJ A;  5IG4 A;  3EBY A;  2WGO A;  1O7G B;  3BND A;  3GWR A;  3UNL A;  1CYV A;  1OGZ A;  2OQE C;  2O9U X;  3NHX A;  1M9G A;  4IPB A;  4STD A;  2GBX B;  2ZL8 A;  3T0U A;  3J7Y d;  3EQQ B;  1PU4 A;  1YJN 3;  3FF2 A;  2HMO B;  1SJW A;  4MEI A;  1VQ7 3;  1K73 4;  2HMJ B;  2XF3 A;  3OWY A;  1J2B A;  3BNC A;  3H51 A;  1WMO A;  5CLK A;  1T5Y A;  1UUV B;  1W5Z A;  3T8U A;  1UI8 A;  2CKF B;  2P0X A;  3LYG A;  1IV9 A;  4HM7 B;  3V92 A;  1Q40 B;  4EC6 A;  3STD A;  4J9A A;  3F8X A;  4WYK A;  1QVG 2;  3B4P A;  3CC7 3;  3HX8 A;  3K0Z A;  3S67 A;  1S5A A;  2E2T A;  3EF8 A;  1Q82 4;  2OCT A;  1GYB A;  1WQL B;  3QK9 A;  3SED A;  3GZX B;  2W6J H;  4JF8 A;  6STD A;  3NQY A;  5AIG A;  4N6U A;  1KC8 4;  3X3Y A;  1LVN A;  2Z7A A;  5BVB A;  3VSY A;  5IEO A;  2CK3 H;  2HMM B;  2WGQ A;  1GY5 A;  1KSI A;  5HGR A;  4XBT A;  4J8T A;  3PZW A;  4KFF A;  1QJG A;  1VQ9 3;  2OTL 3;  2RCD A;  4EYC A;  2WOF A;  3EHC A;  1N9J A;  3UJM A;  2P09 A;  3CCV 3;  1FUW A;  1A2K A;  2RGQ A;  4Q53 A;  2KXG A;  1HU9 A;  1AR0 A;  2YFI B;  3FSD A;  5ELJ A;  4O8S A;  1FGR A;  1IDP A;  4N3V A;  1PFP A;  1LNH A;  4K1V A;  3U1W A;  1EKM A;  2CG1 A;  3PCR A;  1GY6 A;  2RFR A;  4ORL A;  1W2B 2;  5FW5 A;  5JPU A;  1N5P A;  3DGN A;  5JBS A;  2O3O A;  3BB9 A;  3CCQ 3;  3I56 3;  3GZB A;  1ULI B;  3X40 A;  3CCM 3;  3D9R A;  3SOY A;  1IU7 A;  1VQK 3;  1W01 A;  1QAL A;  4WHA A;  1RJO A;  3CPW 2;  2F98 A;  1VQN 3;  4IT7 A;  4HM5 B;  4R9K A;  5EEO A;  4H3U A;  1W7C A;  2BMR B;  1OGX A;  2CHC A;  3X3X A;  1US1 A;  3V99 A;  1YJW 3;  2IMJ A;  4RNZ A;  1FA3 A;  4XM4 A;  1STF I;  2GU3 A;  3EN1 B;  1W2Z A;  2D1W A;  3DXO A;  3CCR 3;  3ER7 A;  3EBT A;  1W02 A;  1YGE A;  2W9P A;  3GAX A;  2JQ5 A;  5AEU B;  2FGT A;  2C10 A;  1QAF A;  1SIH A;  3BNB A;  3K63 A;  4OK0 A;  3M8C A;  1OAC A;  2P05 A;  3FG1 A;  3MPH A;  4BTX A;  1YHQ 3;  4EV5 A;  1FGM A;  1JB4 A;  3OXA A;  1IT8 A;  3DY5 A;  3F14 A;  3UB1 A;  1SPU A;  4L7K A;  1O7P B;  4HM1 B;  3G0K A;  3G6E 3;  3V98 A;  3CMA 3;  2MC8 A;  4HZB B;  1K8A 4;  3LT9 A;  4LGQ A;  1IV7 A;  3AMO A;  2YFJ B;  5IW9 A;  4MJD A;  3OX9 A;  3S29 A;  3SOA A;  2XGN A;  3OV4 A;  1AVL A;  4KVH A;  1VQL 3;  3NM7 A;  4AKZ A;  3JUQ A;  1GD4 A;  3H3H A;  4N6M A;  1O7N B;  1K9M 4;  2OOV A;  1BUQ A;  1N5H A;  3CCS 3;  2B1X B;  3HII A;  4QWT A;  1NU3 A;  2CWT A;  3L0R A;  4ZM8 A;  3RGR A;  3S27 A;  2W9Q A;  1IK3 A;  3HI7 A;  1JRQ A;  4PEJ A;  2W03 A;  4R80 A;  1VZZ A;  2Z77 A;  3FGY A;  3MWZ A;  4AKY A;  1IQX A;  4HM8 B;  3E99 A;  3CCE 3;  1A90 A;  3WOF B;  3F40 A;  4CDL A;  5AI1 A;  3KFQ C;  1E97 A;  4L8P A;  1TU5 A;  2KRT A;  5LC7 A;  2XH9 A;  3DUK A;  2C11 A;  3IPT A;  3RGA A;  2BHM A;  5D82 A;  4KFE A;  2MF7 A;  1K28 A;  2K0M A;  1V74 A;  2FNQ A;  5D83 A;  3EN8 A;  1DVD A;  1JKG A;  3PS8 A;  4CCV A;  3EC9 A;  3NBJ A;  2ML6 A;  3G8Z A;  1W6G A;  3RDE A;  1F8N A;  4N6N B;  3DGL A;  3AMO B;  2IA7 A;  3LTB A;  3SX1 A;  3GRD A;  3CU3 A;  1IVV A;  3CPO A;  4OUQ A;  4K90 B;  5STD A;  1LXE A;  1OH0 A;  1U8C B;  3NV0 A;  3X41 A;  2E2U A;  3DMC A;  3NQZ A;  3T8N A;  3JUN A;  1WMN A;  4HM4 B;  3ECF A;  2XR8 B;  5LC6 A;  1SII A;  3SVA A;  2L4V A;  2A15 A;  1IQY A;  3PYJ A;  4HM0 B;  4KZ1 A;  2PNC A;  3WOD G;  1IVU A;  4R1K A;  3MG1 A;  4XB5 A;  5BXQ A;  2BMO B;  2FXT A;  3JUM A;  3JVC A;  2Q07 A;  4FMB A;  1FGT A;  2YFL B;  5AYS C;  2LYX A;  3FZW A;  4AEQ A;  2BO9 B;  4GL6 A;  2INX A;  3ROB A;  2CW9 A;  4X2O A;  3SLU A;  1ROA A;  1TIJ A;  4R4K A;  3OW2 2;  3GZR A;  1LOX A;  2CH9 A;  3I0Y A;  4WYK B;  4HM6 B;  2WOH A;  1UI7 A;  1OUN A;  3KN4 A;  1JKG B;  1O7H B;  1EG9 B;  2CG0 A;  2UX0 A;  1CEW I;  2CFD A;  3O8Y A;  1GD3 A;  2XGL A;  3PGB A;  4RBN A;  5A0O B;  3KZT A;  5FGO A;  8CHO A;  5I97 A;  2Z6B A;  3K7C A;  1Q81 4;  4KFD A;  1JJ2 2;  3F7X A;  4MMY B;  3LZA A;  1A67 A;  1NDO B;  1D6U A;  2IUJ A;  1DVC A;  3NV0 B;  2GU1 A;  3NBR A;  1YIT 3;  1GS3 A;  1R4C A;  2GBW B;  1DMN A;  1ZX2 A;  1FGO A;  3LOY A;  3SXX A;  1NJI 4;  3KSP A;  2IUK A;  3FF0 A;  4FCZ A;  1IVW A;  2GXF A;  4O3V A;  3LTD A;  1L5G B;  4HM3 B;  4XBY A;  4MMX B;  1VQ5 3;  3OWU A;  4HM2 B;  2XFS A;  4XBX A;  1E3R A;  3MHE A;  1OHO A;  1UUW B;  1SQW A;  2OOV C;  1OCV A;  2W2C A;  3Q2P A;  5AYR B;  2BT3 A;  3HK4 A;  3UL6 A;  4HYZ A;  4IIA A;  2V1L A;  1RRH A;  2KCD A;  3WMD A;  4MMZ B;  3BLZ A;  3TDG A;  3CC2 3;  3NUV A;  1VQ4 3;  2XSH B;  2HMN B;  3OWS A;  4I4K A;  1W6C A;  3IMA B;  1JN5 A;  1Q7Y 4;  1ULJ B;  3KSE D;  4BTY A;  1MNL A;  1M1K 4;  1N8Q A;  1DMQ A;  1DYU A;  5ELU A;  2CC3 A;  2K54 A;  2CFK A;  3F9S A;  3X3Z A;  4N6O B;  2QEX 3;  1CQS A;  3N9H A;  2XFT A;  5IG3 A;  3QRD A;  1Q40 A;  2Z76 A;  3D3L A;  3B7C A;  3F8H A;  5G2G A;  1WNH A;  3BNE A;  4FCJ A;  5KP3 A;  2RSX A;  1ASK A;  3LT8 A;  1OHS A;  4U13 A;  5KP1 A;  2W56 A;  1NB5 I;  1QVF 2;  3KE7 A;  1N9E A;  3U97 A;  3UL5 A;  4HVN A;  4HZ9 B;  3FG4 A;  1W6Y A;  2QGU A;  1AVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...