4RZMA

Crystal structure of the lsd19-lasalocid a complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
274
Chain Sequence
GRHMPAETVRKEVALEYCRRVNAGELEGVLQLFAPDARLVDPLGTEPVVGRAALAARLAPALRGAVHEEPGRPYAAHDGTSVVLPATVTVRGRTRVMGVIEVGEDGLIREMRVMWGVTDSSWTARPAPDEERRKELAREHCLRINDGDVDGLLKLYSPRIRFEDPVGSWTRTGLEALRAHATMAVGSNVRETAGLTVAGQDGRHAAVTVSATMDYLPSGPLLARHHLMTLPAPADPHRALIGIEYVMVIGVDADGLIDEMRAYWGATDVSLLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxide hydrolase LasB
publication title Epoxide hydrolase-lasalocid a structure provides mechanistic insight into polyether natural product biosynthesis.
pubmed doi rcsb
source organism Streptomyces lasaliensis
molecule tags Isomerase
total genus 90
structure length 274
sequence length 283
chains with identical sequence B
ec nomenclature ec 5.5.1.-:
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rzmA01
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rzmA02
2GXFA 5D82A 1STDA 1ZO2A 5FW5A 2K54A 4PEJA 1Q42A 3CNMA 2BMQB 4XDWA 1EG9B 1DMQA 3KZTA 3MG3A 3I0YA 3GZBA 1HKXA 1OPYA 3FLJA 4XBTA 2XR8B 2CHCA 3FZWA 3WMDA 1CQSA 2A15A 2Z7AA 4K1UA 3JUOA 3D9RA 1NU3A 2OWPA 5CF1A 1O7PB 4RZMA 5IG3A 4L7KA 3JUQA 1JN5B 4I4KA 3MHEA 5JPPA 3DXOA 1QJGA 3ROBA 3DMCA 4FCJA 3NBRA 3KE7A 4HM0B 1W02A 2GEXA 3EX9A 3DZLA 2QGUA 5KP4A 1OHSA 3ECFA 1OF5B 3G16A 3JUPA 1W00A 5IG4A 2BMRB 2HMKB 5AIHA 3FSDA 1GY7A 3FGYA 3SEDA 5IEOA 3GWRA 3GRDA 3MSOA 3NXJA 4L8OA 5AIIA 2HMMB 1GYBA 3HK4A 3FF2A 3HZPA 1JN5A 1GY6A 3HX8A 1C7HA 3OWSA 3EBTA 5CLKA 2XSHB 3JUMA 3UNLA 1DMNA 4CDLA 1S5AA 1O7WB 2INXA 4L8PA 4Q53A 4J8TA 2XSOB 2HMNB 3S5CA 1OF5A 4HM8B 4LGQA 1OUNA 4HM4B 4K1VA 4R9LA 4WYKB 4HM7B 2YFIB 3EJVA 4KVHA 1W01A 3F8XA 3H3HA 3F14A 2XRXB 3F8HA 1GY5A 4H3UA 2CKFB 4WP5A 4XB5A 4ORLA 1E3RA 1JB5A 4HZBB 2F99A 4R9KA 3LZAA 4HM6B 5CK6A 3A76A 3CPOA 3M8CA 3F9SA 1QMAA 3FKAA 4HM5B 5CF2A 3EBYA 1O7NB 3B4OA 3VSYA 3STDA 5STDA 3GZRA 4HJLB 3EF8A 3CU3A 3UJMA 1O7MB 2BNGA 4HKVB 5AI1A 5KP3A 5CXOA 5AEUB 3DM8A 3K0ZA 1OH0A 3EN1B 4MJDA 3GZXB 4FCMA 3EQQB 2BMOB 4X2OA 1NWWA 4HZ9B 1Q40B 2B1XB 1OGXA 2PZVA 1WQLB 3CNXA 1JB2A 2Z76A 3BLZA 5HGRA 4IIAA 4OVMA 3G8ZA 4N3VA 2Z77A 2RCDA 5JPUA 3NHXA 5DREA 5BVBA 1K41A 1EA2A 1OHOA 3MG1A 2F86B 1GS3A 2HMOB 2IMJA 1A2KA 3NV0B 3RGRA 2HMLB 3KSPA 5IG0A 3MG2A 2RFRA 4STDA 3RGAA 1ULIB 7STDA 4X2HA 1TUHA 1Q40A 2HMJB 3DUKA 1ULJB 4LEHA 3B8LA 3OX9A 5IF6A 2JQ5A 3FH1A 4XBXA 3Q90A 3T8NA 1OHPA 3MYTA 1OGZA 3LYGA 1DMMA 3E99A 1AR0A 3FF0A 5TGNA 4LMIA 3NV0A 5BXQA 3K7CA 3EC9A 1ZX2A 3B7CA 4WYKA 3OWUA 3BB9A 4HM2B 5IERA 5EVHA 1SJWA 3F7SA 3SOYA 1UUVB 1O7HB 3B4PA 5AIGA 4XM4A 5KP1A 4HM1B 3IPTA 1U5OA 3KKGA 3OWYA 3T8UA 3VGNA 5AIFA 1VZZA 1JKGB 1IDPA 4OUQA 1ISKA 3OXAA 2UX0A 4U13A 2GBXB 3SOAA 1E97A 4R1KA 3NUVA 2W2CA 5D83A 5IENA 3H51A 3JUNA 4HVNA 4J9AA 2I9WA 4HM3B 2F98A 2RGQA 1Z1SA 4WWUC 1W6YA 1JB4A 1O7GB 2B24B 2STDA 5D81A 3G0KA 3ER7A 2YFLB 1TP6A 3F7XA 2QIYA 2R4IA 1BUQA 1ASKA 3OV4A 5IG5A 2YFJB 1JKGA 8CHOA 3GZYB 2GBWB 4XBYA 3EHCA 3EN8A 3NM2A 6STDA 1OCVA 5DRVA 4XDVA 5G2GA 4GB5A 5IEPA 1UUWB 1E3VA 1NDOB 5AEWB 2GEYA 3F40A 3MKIA
chains in the Genus database with same CATH superfamily
2GXFA 2OTJ3 2JDIH 1KC84 1UW1A 5D82A 2W03A 4MEIA 3PCRA 1STDA 1ZO2A 5FW5A 2K54A 3AHWA 4PEJA 3FG1A 1RJOA 2W0QA 1I2FA 1JZDA 1Q42A 2BHMA 2CFDA 3LTDA 3PGBA 1W5ZA 3X3ZA 1JJ22 1RGAA 3CNMA 2ML5A 1LOVA 2BMQB 2Y74A 1SIIA 4XDWA 2LQVA 3ZFZA 3BNCA 4ZM8A 4WHAA 1EG9B 1SIHA 3HIGA 3N54B 4FMCA 1N5PA 3NBJA 3WA3A 3DGMA 1DMQA 3KZTA 3AMOB 1IQYA 1CYVA 3MG3A 3I0YA 4BL2A 1BNFA 1X1UA 3EE1A 3GZBA 1SPUA 1VQM3 1HKXA 3T0UA 1OPYA 1KWIA 3FLJA 4XBTA 2KF6A 5LC7A 3U1WA 1DYUA 1X1YA 2XR8B 2CHCA 3FZWA 3WMDA 1RRLA 1CQSA 2A15A 2Z7AA 4CPKA 4K1UA 3JUOA 2CX1A 3D9RA 1NU3A 1RCKA 1LNHA 1Q7HA 5M18A 2OWPA 1B20A 4EC6A 2MC8A 5CF1A 1O7PB 1TRQA 4RZMA 5IG3A 4L7KA 1G96A 3IMAB 3JUQA 4FMAA 1RNTA 1JN5B 1UCKA 2J8XB 2M7OA 4I4KA 3MHEA 5JPPA 2IY2A 1B2UA 3CCM3 2CFLA 3IJEB 3DXOA 5G1LA 1Q864 3CCU3 1QJGA 4K61A 1RGLA 2CWVA 3D5GA 1ZGXA 4LZIA 1BVIA 1JNQA 1AY7A 3ROBA 2P0XA 2PNCA 3DMCA 4FCJA 3WOEB 1WMNA 2H0HA 7RNTA 1TU5A 3UL5A 3NBRA 3KE7A 3LTCA 4RNZA 4BU4A 1LQGC 3CC73 1IVWA 1YGWA 4HM0B 1W02A 2GEXA 3MKIA 4N6TA 3EX9A 2MF7A 3DZLA 2QGUA 5KP4A 3UL6A 1IVXA 1OHSA 3ECFA 3K5TA 5LC6A 1OF5B 1IVUA 5HOHA 3BIRA 3G16A 3JUPA 1W00A 1D6ZA 3SLUA 3WA2X 1B2SA 1T2IA 2BMRB 2HMKB 3AMOA 1BNEA 5IG4A 1I0XA 3CCS3 3D3LA 5M1AA 1NJI4 4GL6A 3LOYA 2FNQA 4EYCA 1QVG2 1T5YA 3O8YA 2OQEC 4RNTA 5AIHA 3FSDA 3CCE3 1GY7A 3FGYA 4EW5A 1I3FA 4BTYA 3SEDA 3JVCA 2KF5A 2CG1A 1I8VA 2F4YA 4EBGA 1RN7A 1W4NA 5GSPA 5I97A 1KD14 2KXGA 4NHFA 2ZA4A 3D5IA 4KT3B 5IEOA 3X41A 3WDGB 5M19A 1AVLA 1FGMA 1N5HA 3CCR3 1FZUA 3GWRA 1RTUA 1MWUA 3I553 3GRDA 3MSOA 2BT3A 3NXJA 1N9JA 4L8OA 5AIIA 2HMMB 1GYBA 3HK4A 4BTXA 1Y4KA 3X3YA 3FF2A 3HZPA 3D4AA 1JN5A 1GY6A 3NX0A 4AKYA 3HX8A 3PZWA 6RNTA 1C7HA 3OWSA 3EBTA 5CLKA 2XSHB 3FG4A 4AEQA 3JUMA 3UNLA 1K8A4 1DMNA 4CDLA 1S5AA 1O7WB 1RGEA 3BNDA 1KQS2 2INXA 4L8PA 4Q53A 4J8TA 2C4BA 3UB1A 1QVF2 1B3SA 3L0RA 3LT8A 1BIRA 1HYFA 4FMDA 2CX0A 7GSPA 3NQZA 2XSOB 1YJN3 1A67A 2HMNB 3S5CA 4FCZA 3V98A 1OF5A 5JBSA 4KFDA 2WOFA 4HM8B 4LGQA 1VQL3 1BRSA 1OUNA 1M1K4 4HM4B 4R4KA 1SARA 3RNTA 1JZOA 2F5MA 4K1VA 4R9LA 4WYKB 2D42A 2GU3A 1M904 1Q9EA 4HM7B 2YFIB 3EJVA 4KVHA 4EV2A 1IK3A 4CJNA 1K28A 1W01A 3PXMA 3F8XA 1TFOA 3D79A 3F14A 3H3HA 3I563 2XRXB 3F8HA 3HIIA 1GY5A 1BRIA 2W04A 3WOFB 1RLSA 4H3UA 2CKFB 4WP5A 3ZG5A 4XB5A 4ORLA 1MNLA 1UI8A 1E3RA 1GD3A 2OOVC 1JB5A 3CME3 4EXRA 1WNHA 4HZBB 5G1KA 1YVBI 1D6YA 1BRKA 2F99A 2P0MA 1NO3A 4R9KA 1US1A 3LZAA 2IUKA 3S67A 3Q2PA 1BNRA 1B2XA 2D1WA 3S28A 1YNVX 2O9UX 3ZG0A 1YJW3 1QALA 1LOXA 4HM6B 2OQEA 5CK6A 3DGOA 3A76A 1UGIA 1VQ73 3CPOA 3M8CA 1A2PA 1BRJA 1MWSA 1QMAA 1VQQA 1W7CA 2KAAA 3F40A 3F9SA 4BIRA 1VQP3 3FKAA 3KSED 1KSIA 1VQ53 1EEJA 4HM5B 4IT7A 1Q824 1LOWA 2L4VA 3EBYA 5CF2A 3S29A 1BNJA 1O7NB 1B21A 1YHQ3 3B4OA 3VSYA 3QRDA 3STDA 3WR2A 5STDA 3GZRA 4HJLB 1UGHI 2CC3A 3AGOA 3CC23 2XFSA 4NPBA 1IQXA 4BTWA 3LMLA 3EF8A 3CU3A 3UJMA 2BU4A 1MGRA 1O7MB 2BNGA 4HKVB 4LYLB 5AI1A 2CWUA 1HU9A 5KP3A 2IYJA 1RNBA 2ZL8A 1UCIA 2CFKA 4J5KA 3HI7A 4LSOA 1EKMA 5CXOA 3NBBA 3CXC2 3A5EA 1NB3I 3KCHA 2FGTA 2H0GA 3RDEA 3CMA3 3S27A 1TFKA 1N9EA 1JRQA 2V1LA 2OTL3 5AEUB 1V57A 1YI23 3N8BA 3OW22 3SYUA 1Q814 1I2GA 1RGGA 4AKZA 3DM8A 2XGNA 3K0ZA 3KFQC 1OH0A 2XGLA 2H0IA 1VQ43 1IVVA 1RHLA 3PYJA 3EN1B 4N6OB 6GSPA 2GU1A 4MJDA 1JBRA 1ROVA 3GZXB 4FCMA 3EQQB 2BMOB 3SXXA 1GMRA 1K9M4 4X2OA 1RGFA 1YIT3 4GHOA 2W56B 2WGOA 1NWWA 1RDSA 4HZ9B 1Q40B 2B1XB 1W2B2 4WFOA 1OGXA 2PZVA 4RNYA 1WQLB 3HOHA 3CCL3 1S723 3CNXA 1JB2A 2RBIA 2Z76A 1YIJ3 5HGRA 4J5GA 1JV2B 1K734 4IIAA 4OVMA 3DGYA 1LQMB 1DE3A 3G8ZA 1A2VA 1PU4A 1DETA 2HOHA 4N3VA 2RSXA 4QWTA 2ML6A 2OOVA 1FW7A 1T3BA 2CIUA 2W9PA 2Z77A 2F5WA 1J2BA 2SBLA 3V92A 1QAFA 1BOXA 2W6JH 2ZDJA 1WMPA 1G02A 2RCDA 1IU7A 1FGTA 3LTBA 5JPUA 1BANA 1STFI 3NHXA 4KFFA 5DREA 5BVBA 1MOLA 1K41A 4MMXB 1A90A 1X1XA 1EA2A 1OHOA 3MG1A 3NM7A 2F86B 4OK0A 3SVAA 1B2MA 1M1XB 1GS3A 1BAOA 2HMOB 1CH0A 1UUGB 2IMJA 1RN4A 1GD4A 1WMOA 1A2KA 2AAEA 5FGOA 3NV0B 3RGRA 1W2ZA 2HMLB 1LOYA 2QEX3 2KF3A 4I5QA 5EEOA 3KSPA 4N6NB 1MWTA 5BU4A 5IG0A 2XEPA 3G713 3MG2A 2R41A 2RFRA 3CC43 2CG0A 4HAAA 4STDA 3RGAA 2CWTA 1TJDA 3EB8A 5ELUA 1I0VA 3VF1A 1ULIB 3CD63 7STDA 2W56A 1AQZA 4X2HA 1DVDA 1TIJA 1TUHA 1Q40A 1R4CA 1N8R4 2HMJB 3DUKA 1ULJB 2Z6BA 4R80A 2O3OA 3URPA 1FA3A 3K63A 1T2HA 1N8QA 4LEHA 5RNTA 1VQ93 1W6CA 1CEWI 4HYZA 3B8LA 2KCDA 1BSBA 3OX9A 5IF6A 2F56A 2E2TA 3X40A 1VQK3 3PCSA 2JQ5A 1RGKA 3LTAA 1GOUA 3FH1A 1BGSA 4XBXA 2W9QA 1AV4A 1I2EA 4N6LA 3Q90A 1JBSA 4O3VA 2IUJA 1OHPA 3T8NA 1BSDA 1GMQA 1GMPA 1IT8A 2UUGC 2AADA 3MYTA 1YJ93 1UI7A 1OGZA 3AHSA 3U97A 3LYGA 4BL3A 4JF8A 1DMMA 1SQWA 3LXUX 1FUSA 1B27A 3E99A 1AR0A 1DVCA 1FGOA 1CYUA 1F8NA 2CFWA 4DKIA 3MWZA 1QAKA 3FF0A 2UGIA 1B2ZA 5TGNA 5EQLA 2XH9A 2SARA 4LMIA 2P09A 3FCSB 3NQYA 3DGNA 3K7CA 3NV0A 5BXQA 3DY5A 2IA7A 3MPHA 4NREA 3EC9A 4EV5A 1TTOA 1BNSA 1GOVA 1AVKA 1R4YA 2ZHXB 1VQ63 3CCV3 2E2UA 3X3XA 1BSAA 1ZX2A 1BRNL 3B7CA 4TX4A 4WYKA 1M9GA 1PFPA 3DH2A 3OWUA 3AGNA 4JRFA 2RNTA 3BB9A 3K9MC 4HM2B 1BRGA 1BSEA 1V74A 5EVHA 4GSPA 5IERA 5IW9A 1SJWA 2LYXA 3SX1A 1FGRA 1LRAA 3F7SA 2QA43 1VQ83 3WODG 1YGEA 3BNBA 3TDGA 1RSNA 3SOYA 1UUVB 3GAXA 3KN4A 1O7HB 4N6UA 1MGWA 3B4PA 5AIGA 4XM4A 1VQO3 5BIRA 1BU4A 4HM1B 5KP1A 1GOYA 2E2VA 1UCLA 3IPTA 1W6GA 1ZS7A 3X42A 3LH4A 2KF4A 3WHOA 3V99A 1U5OA 4IPBA 3KKGA 3OWYA 2P38A 2K3DA 2OCTA 3T8UA 1V58A 3G6E3 2BIRA 3G4S3 3VGNA 3ALAA 5AIFA 1VQN3 1NB5I 1RKYA 1JBTA 1BNGA 1MWRA 1VZZA 1RRHA 4FR9A 2CK3H 1RCLA 1BUJA 1JKGB 4MMZB 2P05A 1NNVA 1I70A 1IDPA 2C10A 4OUQA 1ISKA 1FUTA 1RMSA 4H61A 4K90B 3OXAA 2UX0A 4U13A 1BNIA 1RGCA 1TRPA 2GBXB 4KFEA 3DGLA 4HBRA 1OACA 1GSPA 1I3IA 1HZ1A 1E97A 1LNIA 2C11A 2CW9A 3KIIA 4G1MB 3SOAA 1Q7Y4 1BRHA 1IYYA 4HOHA 4O8SA 3QK9A 4R1KA 3NUVA 2W2CA 5D83A 5IENA 1LVNA 2WGQA 3H51A 3JUNA 4HVNA 1RN1A 1UDII 4J9AA 1FGQA 2CFGA 3CCJ3 2I9WA 2WOHA 5ELJA 3CCQ3 2Q07A 1BSCA 1EUIC 2F98A 4HM3B 5AYSC 2RGQA 3PS8A 1Z1SA 3GSPA 1W6YA 4WWUC 1JB4A 2XFTA 1O7GB 2B24B 1EQKA 4N6V0 2XF3A 1UCJA 2STDA 5D81A 3G0KA 4MMYB 1IQ8A 1RGHA 1C54A 3ER7A 3Q1CA 2FXTA 1WTHA 4KZ1A 2YFLB 1TP6A 3BU4A 1U8CB 4ILFA 2L1SA 3F7XA 1YVSA 1PY3A 2QIYA 3Q3FA 5AYRB 9RNTA 2R4IA 5A0OB 1BUQA 1FYSA 3CPW2 1IV9A 1ASKA 3N9HA 2CH9A 3OV4A 5IG5A 8RNTA 2YFJB 1JKGA 1L5GB 1PYLA 2GSPA 2K0MA 4O2HA 8CHOA 1IT7A 1D6UA 1X1WA 1G0TA 2Y73A 3GZYB 4FMBA 2GBWB 4N6MA 4XBYA 4CCVA 1LXEA 3EHCA 3EN8A 3NM2A 6STDA 1OCVA 4RBNA 5DRVA 4XDVA 5G2GA 3BNEA 4GB5A 1FUWA 3FG3A 3J7Yd 5IEPA 1UUWB 1E3VA 1ROAA 1IV7A 2KRTA 1NDOB 2YX9A 5AEWB 2WO0A 3LT9A 2GEYA 3BLZA 2BO9B 4O02B
chains in the Genus database with same CATH topology
2GXFA 2OTJ3 2JDIH 1KC84 1UW1A 5D82A 2W03A 4MEIA 3PCRA 1STDA 1ZO2A 5FW5A 2K54A 4PEJA 3FG1A 1RJOA 2W0QA 3PGBA 2CFDA 1Q42A 2BHMA 3LTDA 1W5ZA 3X3ZA 1JJ22 3CNMA 2ML5A 2BMQB 2Y74A 1SIIA 4XDWA 2LQVA 3BNCA 4ZM8A 4WHAA 1EG9B 1SIHA 3HIGA 3N54B 4FMCA 1N5PA 3NBJA 3WA3A 3DGMA 1DMQA 3KZTA 3AMOB 1IQYA 1CYVA 3MG3A 3I0YA 3EE1A 3GZBA 1SPUA 1VQM3 1HKXA 3T0UA 1OPYA 1KWIA 3FLJA 4XBTA 5LC7A 3U1WA 1DYUA 2XR8B 2CHCA 3FZWA 3WMDA 1RRLA 1CQSA 2A15A 2Z7AA 4K1UA 3JUOA 3D9RA 1NU3A 1LNHA 2OWPA 4EC6A 2MC8A 5CF1A 1O7PB 4RZMA 5IG3A 4L7KA 1G96A 3IMAB 3JUQA 4FMAA 1JN5B 2M7OA 4I4KA 3MHEA 5JPPA 3CCM3 2CFLA 3IJEB 3DXOA 1Q864 3CCU3 1QJGA 4K61A 2CWVA 4LZIA 1JNQA 3ROBA 2P0XA 2PNCA 3DMCA 4FCJA 3WOEB 1WMNA 1TU5A 3UL5A 3NBRA 3KE7A 3LTCA 4RNZA 3CC73 1IVWA 4HM0B 1W02A 2GEXA 3MKIA 4N6TA 3EX9A 2MF7A 3DZLA 2QGUA 5KP4A 3UL6A 1IVXA 1OHSA 3ECFA 3K5TA 5LC6A 1OF5B 1IVUA 3G16A 3JUPA 3SLUA 1W00A 1D6ZA 3WA2X 5IG4A 2BMRB 2HMKB 3AMOA 3CCS3 3D3LA 1NJI4 4GL6A 3LOYA 2FNQA 4EYCA 1QVG2 1T5YA 3O8YA 2OQEC 3CCE3 5AIHA 3FSDA 1GY7A 3FGYA 4BTYA 3SEDA 3JVCA 2CG1A 4EBGA 1RN7A 1W4NA 5I97A 1KD14 2KXGA 4NHFA 5IEOA 3X41A 3WDGB 1AVLA 1FGMA 1N5HA 3CCR3 3GWRA 3I553 3GRDA 3MSOA 2BT3A 3NXJA 1N9JA 4L8OA 5AIIA 2HMMB 1GYBA 3HK4A 4BTXA 1Y4KA 3X3YA 3FF2A 3HZPA 3NX0A 1JN5A 1GY6A 4AKYA 3HX8A 3PZWA 1C7HA 3OWSA 3EBTA 5CLKA 2XSHB 3FG4A 4AEQA 3JUMA 3UNLA 1K8A4 1DMNA 4CDLA 1S5AA 1O7WB 3BNDA 1KQS2 2INXA 4L8PA 4Q53A 4J8TA 3UB1A 1QVF2 3L0RA 3LT8A 4FMDA 3NQZA 2XSOB 1YJN3 1A67A 2HMNB 3S5CA 4FCZA 3V98A 1OF5A 5JBSA 4KFDA 2WOFA 4HM8B 4LGQA 1VQL3 1OUNA 1M1K4 4HM4B 4R4KA 4K1VA 4R9LA 4WYKB 2D42A 2GU3A 1M904 4HM7B 2YFIB 3EJVA 4KVHA 4EV2A 1IK3A 1K28A 1W01A 3PXMA 3F8XA 1TFOA 3H3HA 3F14A 3I563 2XRXB 3F8HA 3HIIA 1GY5A 2W04A 3WOFB 4H3UA 2CKFB 4WP5A 4XB5A 4ORLA 1MNLA 1UI8A 1E3RA 1GD3A 2OOVC 1JB5A 3CME3 4EXRA 1WNHA 4HZBB 1YVBI 1D6YA 2F99A 2P0MA 1NO3A 4R9KA 1US1A 3LZAA 2IUKA 3S67A 3Q2PA 2D1WA 3S28A 2O9UX 1YJW3 1QALA 1LOXA 4HM6B 2OQEA 5CK6A 3DGOA 3A76A 1VQ73 3CPOA 3M8CA 3F9SA 1QMAA 1W7CA 1VQP3 3F40A 3FKAA 3KSED 1KSIA 1VQ53 4HM5B 4IT7A 1Q824 2L4VA 3EBYA 5CF2A 3S29A 1O7NB 1YHQ3 3B4OA 3VSYA 3QRDA 3STDA 5STDA 3GZRA 4HJLB 2CC3A 3CC23 2XFSA 1IQXA 4BTWA 3LMLA 3EF8A 3CU3A 3UJMA 1O7MB 2BNGA 4HKVB 5AI1A 2CWUA 1HU9A 5KP3A 2ZL8A 2CFKA 3HI7A 4LSOA 1EKMA 5CXOA 3NBBA 3CXC2 1NB3I 2FGTA 3RDEA 3CMA3 3S27A 1TFKA 1N9EA 1JRQA 2V1LA 2OTL3 5AEUB 1YI23 3N8BA 3OW22 1Q814 4AKZA 3DM8A 2XGNA 3K0ZA 3KFQC 1OH0A 2XGLA 1VQ43 1IVVA 4N6OB 3PYJA 3EN1B 2GU1A 4MJDA 1ROVA 3GZXB 4FCMA 3EQQB 2BMOB 3SXXA 1K9M4 4X2OA 1YIT3 2W56B 2WGOA 1NWWA 4HZ9B 1Q40B 2B1XB 1W2B2 4WFOA 1OGXA 2PZVA 4RNYA 1WQLB 3CCL3 1S723 3CNXA 1JB2A 2Z76A 1YIJ3 5HGRA 1K734 1JV2B 4IIAA 4OVMA 3G8ZA 1A2VA 1PU4A 4N3VA 2RSXA 4QWTA 2ML6A 2OOVA 2CIUA 2W9PA 2Z77A 1J2BA 2SBLA 3V92A 1QAFA 2W6JH 2ZDJA 1WMPA 2RCDA 1IU7A 1FGTA 3LTBA 5JPUA 1STFI 3NHXA 4KFFA 5DREA 5BVBA 1MOLA 1K41A 4MMXB 1A90A 1EA2A 1OHOA 3MG1A 3NM7A 2F86B 4OK0A 3SVAA 1M1XB 1GS3A 2HMOB 2IMJA 1GD4A 1WMOA 1A2KA 5FGOA 3NV0B 3RGRA 1W2ZA 2HMLB 2QEX3 5EEOA 3KSPA 4N6NB 5IG0A 2XEPA 3G713 3MG2A 2RFRA 3CC43 2CG0A 4STDA 3RGAA 2CWTA 3EB8A 5ELUA 3VF1A 1ULIB 3CD63 7STDA 2W56A 4X2HA 1DVDA 1TIJA 1TUHA 1Q40A 1R4CA 1N8R4 2HMJB 3DUKA 1ULJB 2Z6BA 4R80A 2O3OA 1FA3A 3K63A 1N8QA 4LEHA 1VQ93 1W6CA 1CEWI 4HYZA 3B8LA 2KCDA 3OX9A 5IF6A 2E2TA 3X40A 1VQK3 3PCSA 2JQ5A 3LTAA 3FH1A 4XBXA 2W9QA 1AV4A 4N6LA 3Q90A 4O3VA 2IUJA 1OHPA 3T8NA 1IT8A 3MYTA 1YJ93 1UI7A 1OGZA 3U97A 3LYGA 4JF8A 1DMMA 1SQWA 3LXUX 3E99A 1AR0A 1DVCA 1FGOA 1CYUA 1F8NA 2CFWA 3MWZA 1QAKA 3FF0A 5TGNA 5EQLA 2XH9A 4LMIA 2P09A 3FCSB 3NQYA 3DGNA 3K7CA 3NV0A 5BXQA 3DY5A 2IA7A 3MPHA 4NREA 3EC9A 4EV5A 1VQ63 1AVKA 3CCV3 2E2UA 3X3XA 1ZX2A 3B7CA 4TX4A 4WYKA 1M9GA 1PFPA 3OWUA 4JRFA 3BB9A 3K9MC 4HM2B 1V74A 5EVHA 5IERA 5IW9A 1SJWA 2LYXA 3SX1A 1FGRA 3F7SA 2QA43 1VQ83 3WODG 1YGEA 3BNBA 3TDGA 3SOYA 1UUVB 3GAXA 3KN4A 1O7HB 4N6UA 3B4PA 5AIGA 4XM4A 1VQO3 5KP1A 4HM1B 2E2VA 3IPTA 1W6GA 3X42A 3LH4A 3V99A 1U5OA 4IPBA 3KKGA 3OWYA 2P38A 2OCTA 3T8UA 3G6E3 3G4S3 3VGNA 3ALAA 5AIFA 1VQN3 1NB5I 1RKYA 1VZZA 1RRHA 4FR9A 2CK3H 1JKGB 4MMZB 2P05A 1IDPA 2C10A 4OUQA 1ISKA 4H61A 4K90B 3OXAA 2UX0A 4U13A 2GBXB 4KFEA 3DGLA 4HBRA 1OACA 2C11A 3KIIA 3SOAA 1E97A 1Q7Y4 2CW9A 4G1MB 4O8SA 3QK9A 4R1KA 3NUVA 2W2CA 5D83A 5IENA 1LVNA 2WGQA 3H51A 3JUNA 4HVNA 4J9AA 1FGQA 2CFGA 3CCJ3 2I9WA 2WOHA 5ELJA 3CCQ3 2Q07A 4HM3B 2F98A 5AYSC 2RGQA 3PS8A 1Z1SA 4WWUC 1W6YA 1JB4A 2XFTA 1O7GB 2B24B 1EQKA 4N6V0 2XF3A 2STDA 5D81A 3G0KA 4MMYB 1IQ8A 3ER7A 3Q1CA 2FXTA 1WTHA 4KZ1A 2YFLB 1TP6A 1U8CB 5AYRB 3F7XA 2QIYA 2R4IA 5A0OB 1BUQA 3CPW2 1IV9A 1ASKA 3N9HA 2CH9A 3OV4A 5IG5A 2YFJB 1JKGA 1L5GB 2K0MA 4O2HA 8CHOA 1IT7A 1D6UA 2Y73A 4FMBA 3GZYB 2GBWB 4N6MA 4XBYA 4CCVA 1LXEA 3EHCA 3EN8A 3NM2A 6STDA 1OCVA 4RBNA 5DRVA 4XDVA 5G2GA 3BNEA 4GB5A 1FUWA 3FG3A 3J7Yd 5IEPA 1UUWB 1E3VA 1ROAA 1IV7A 2KRTA 1NDOB 2YX9A 5AEWB 2WO0A 3LT9A 2GEYA 3BLZA 2BO9B 4O02B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GXF A;  5D82 A;  1STD A;  1ZO2 A;  5FW5 A;  2K54 A;  4PEJ A;  1Q42 A;  3CNM A;  2BMQ B;  4XDW A;  1EG9 B;  1DMQ A;  3KZT A;  3MG3 A;  3I0Y A;  3GZB A;  1HKX A;  1OPY A;  3FLJ A;  4XBT A;  2XR8 B;  2CHC A;  3FZW A;  3WMD A;  1CQS A;  2A15 A;  2Z7A A;  4K1U A;  3JUO A;  3D9R A;  1NU3 A;  2OWP A;  5CF1 A;  1O7P B;  4RZM A;  5IG3 A;  4L7K A;  3JUQ A;  1JN5 B;  4I4K A;  3MHE A;  5JPP A;  3DXO A;  1QJG A;  3ROB A;  3DMC A;  4FCJ A;  3NBR A;  3KE7 A;  4HM0 B;  1W02 A;  2GEX A;  3EX9 A;  3DZL A;  2QGU A;  5KP4 A;  1OHS A;  3ECF A;  1OF5 B;  3G16 A;  3JUP A;  1W00 A;  5IG4 A;  2BMR B;  2HMK B;  5AIH A;  3FSD A;  1GY7 A;  3FGY A;  3SED A;  5IEO A;  3GWR A;  3GRD A;  3MSO A;  3NXJ A;  4L8O A;  5AII A;  2HMM B;  1GYB A;  3HK4 A;  3FF2 A;  3HZP A;  1JN5 A;  1GY6 A;  3HX8 A;  1C7H A;  3OWS A;  3EBT A;  5CLK A;  2XSH B;  3JUM A;  3UNL A;  1DMN A;  4CDL A;  1S5A A;  1O7W B;  2INX A;  4L8P A;  4Q53 A;  4J8T A;  2XSO B;  2HMN B;  3S5C A;  1OF5 A;  4HM8 B;  4LGQ A;  1OUN A;  4HM4 B;  4K1V A;  4R9L A;  4WYK B;  4HM7 B;  2YFI B;  3EJV A;  4KVH A;  1W01 A;  3F8X A;  3H3H A;  3F14 A;  2XRX B;  3F8H A;  1GY5 A;  4H3U A;  2CKF B;  4WP5 A;  4XB5 A;  4ORL A;  1E3R A;  1JB5 A;  4HZB B;  2F99 A;  4R9K A;  3LZA A;  4HM6 B;  5CK6 A;  3A76 A;  3CPO A;  3M8C A;  3F9S A;  1QMA A;  3FKA A;  4HM5 B;  5CF2 A;  3EBY A;  1O7N B;  3B4O A;  3VSY A;  3STD A;  5STD A;  3GZR A;  4HJL B;  3EF8 A;  3CU3 A;  3UJM A;  1O7M B;  2BNG A;  4HKV B;  5AI1 A;  5KP3 A;  5CXO A;  5AEU B;  3DM8 A;  3K0Z A;  1OH0 A;  3EN1 B;  4MJD A;  3GZX B;  4FCM A;  3EQQ B;  2BMO B;  4X2O A;  1NWW A;  4HZ9 B;  1Q40 B;  2B1X B;  1OGX A;  2PZV A;  1WQL B;  3CNX A;  1JB2 A;  2Z76 A;  3BLZ A;  5HGR A;  4IIA A;  4OVM A;  3G8Z A;  4N3V A;  2Z77 A;  2RCD A;  5JPU A;  3NHX A;  5DRE A;  5BVB A;  1K41 A;  1EA2 A;  1OHO A;  3MG1 A;  2F86 B;  1GS3 A;  2HMO B;  2IMJ A;  1A2K A;  3NV0 B;  3RGR A;  2HML B;  3KSP A;  5IG0 A;  3MG2 A;  2RFR A;  4STD A;  3RGA A;  1ULI B;  7STD A;  4X2H A;  1TUH A;  1Q40 A;  2HMJ B;  3DUK A;  1ULJ B;  4LEH A;  3B8L A;  3OX9 A;  5IF6 A;  2JQ5 A;  3FH1 A;  4XBX A;  3Q90 A;  3T8N A;  1OHP A;  3MYT A;  1OGZ A;  3LYG A;  1DMM A;  3E99 A;  1AR0 A;  3FF0 A;  5TGN A;  4LMI A;  3NV0 A;  5BXQ A;  3K7C A;  3EC9 A;  1ZX2 A;  3B7C A;  4WYK A;  3OWU A;  3BB9 A;  4HM2 B;  5IER A;  5EVH A;  1SJW A;  3F7S A;  3SOY A;  1UUV B;  1O7H B;  3B4P A;  5AIG A;  4XM4 A;  5KP1 A;  4HM1 B;  3IPT A;  1U5O A;  3KKG A;  3OWY A;  3T8U A;  3VGN A;  5AIF A;  1VZZ A;  1JKG B;  1IDP A;  4OUQ A;  1ISK A;  3OXA A;  2UX0 A;  4U13 A;  2GBX B;  3SOA A;  1E97 A;  4R1K A;  3NUV A;  2W2C A;  5D83 A;  5IEN A;  3H51 A;  3JUN A;  4HVN A;  4J9A A;  2I9W A;  4HM3 B;  2F98 A;  2RGQ A;  1Z1S A;  4WWU C;  1W6Y A;  1JB4 A;  1O7G B;  2B24 B;  2STD A;  5D81 A;  3G0K A;  3ER7 A;  2YFL B;  1TP6 A;  3F7X A;  2QIY A;  2R4I A;  1BUQ A;  1ASK A;  3OV4 A;  5IG5 A;  2YFJ B;  1JKG A;  8CHO A;  3GZY B;  2GBW B;  4XBY A;  3EHC A;  3EN8 A;  3NM2 A;  6STD A;  1OCV A;  5DRV A;  4XDV A;  5G2G A;  4GB5 A;  5IEP A;  1UUW B;  1E3V A;  1NDO B;  5AEW B;  2GEY A;  3F40 A;  3MKI A; 
#chains in the Genus database with same CATH topology
 2GXF A;  2OTJ 3;  2JDI H;  1KC8 4;  1UW1 A;  5D82 A;  2W03 A;  4MEI A;  3PCR A;  1STD A;  1ZO2 A;  5FW5 A;  2K54 A;  3AHW A;  4PEJ A;  3FG1 A;  1RJO A;  2W0Q A;  1I2F A;  1JZD A;  1Q42 A;  2BHM A;  2CFD A;  3LTD A;  3PGB A;  1W5Z A;  3X3Z A;  1JJ2 2;  1RGA A;  3CNM A;  2ML5 A;  1LOV A;  2BMQ B;  2Y74 A;  1SII A;  4XDW A;  2LQV A;  3ZFZ A;  3BNC A;  4ZM8 A;  4WHA A;  1EG9 B;  1SIH A;  3HIG A;  3N54 B;  4FMC A;  1N5P A;  3NBJ A;  3WA3 A;  3DGM A;  1DMQ A;  3KZT A;  3AMO B;  1IQY A;  1CYV A;  3MG3 A;  3I0Y A;  4BL2 A;  1BNF A;  1X1U A;  3EE1 A;  3GZB A;  1SPU A;  1VQM 3;  1HKX A;  3T0U A;  1OPY A;  1KWI A;  3FLJ A;  4XBT A;  2KF6 A;  5LC7 A;  3U1W A;  1DYU A;  1X1Y A;  2XR8 B;  2CHC A;  3FZW A;  3WMD A;  1RRL A;  1CQS A;  2A15 A;  2Z7A A;  4CPK A;  4K1U A;  3JUO A;  2CX1 A;  3D9R A;  1NU3 A;  1RCK A;  1LNH A;  1Q7H A;  5M18 A;  2OWP A;  1B20 A;  4EC6 A;  2MC8 A;  5CF1 A;  1O7P B;  1TRQ A;  4RZM A;  5IG3 A;  4L7K A;  1G96 A;  3IMA B;  3JUQ A;  4FMA A;  1RNT A;  1JN5 B;  1UCK A;  2J8X B;  2M7O A;  4I4K A;  3MHE A;  5JPP A;  2IY2 A;  1B2U A;  3CCM 3;  2CFL A;  3IJE B;  3DXO A;  5G1L A;  1Q86 4;  3CCU 3;  1QJG A;  4K61 A;  1RGL A;  2CWV A;  3D5G A;  1ZGX A;  4LZI A;  1BVI A;  1JNQ A;  1AY7 A;  3ROB A;  2P0X A;  2PNC A;  3DMC A;  4FCJ A;  3WOE B;  1WMN A;  2H0H A;  7RNT A;  1TU5 A;  3UL5 A;  3NBR A;  3KE7 A;  3LTC A;  4RNZ A;  4BU4 A;  1LQG C;  3CC7 3;  1IVW A;  1YGW A;  4HM0 B;  1W02 A;  2GEX A;  3MKI A;  4N6T A;  3EX9 A;  2MF7 A;  3DZL A;  2QGU A;  5KP4 A;  3UL6 A;  1IVX A;  1OHS A;  3ECF A;  3K5T A;  5LC6 A;  1OF5 B;  1IVU A;  5HOH A;  3BIR A;  3G16 A;  3JUP A;  1W00 A;  1D6Z A;  3SLU A;  3WA2 X;  1B2S A;  1T2I A;  2BMR B;  2HMK B;  3AMO A;  1BNE A;  5IG4 A;  1I0X A;  3CCS 3;  3D3L A;  5M1A A;  1NJI 4;  4GL6 A;  3LOY A;  2FNQ A;  4EYC A;  1QVG 2;  1T5Y A;  3O8Y A;  2OQE C;  4RNT A;  5AIH A;  3FSD A;  3CCE 3;  1GY7 A;  3FGY A;  4EW5 A;  1I3F A;  4BTY A;  3SED A;  3JVC A;  2KF5 A;  2CG1 A;  1I8V A;  2F4Y A;  4EBG A;  1RN7 A;  1W4N A;  5GSP A;  5I97 A;  1KD1 4;  2KXG A;  4NHF A;  2ZA4 A;  3D5I A;  4KT3 B;  5IEO A;  3X41 A;  3WDG B;  5M19 A;  1AVL A;  1FGM A;  1N5H A;  3CCR 3;  1FZU A;  3GWR A;  1RTU A;  1MWU A;  3I55 3;  3GRD A;  3MSO A;  2BT3 A;  3NXJ A;  1N9J A;  4L8O A;  5AII A;  2HMM B;  1GYB A;  3HK4 A;  4BTX A;  1Y4K A;  3X3Y A;  3FF2 A;  3HZP A;  3D4A A;  1JN5 A;  1GY6 A;  3NX0 A;  4AKY A;  3HX8 A;  3PZW A;  6RNT A;  1C7H A;  3OWS A;  3EBT A;  5CLK A;  2XSH B;  3FG4 A;  4AEQ A;  3JUM A;  3UNL A;  1K8A 4;  1DMN A;  4CDL A;  1S5A A;  1O7W B;  1RGE A;  3BND A;  1KQS 2;  2INX A;  4L8P A;  4Q53 A;  4J8T A;  2C4B A;  3UB1 A;  1QVF 2;  1B3S A;  3L0R A;  3LT8 A;  1BIR A;  1HYF A;  4FMD A;  2CX0 A;  7GSP A;  3NQZ A;  2XSO B;  1YJN 3;  1A67 A;  2HMN B;  3S5C A;  4FCZ A;  3V98 A;  1OF5 A;  5JBS A;  4KFD A;  2WOF A;  4HM8 B;  4LGQ A;  1VQL 3;  1BRS A;  1OUN A;  1M1K 4;  4HM4 B;  4R4K A;  1SAR A;  3RNT A;  1JZO A;  2F5M A;  4K1V A;  4R9L A;  4WYK B;  2D42 A;  2GU3 A;  1M90 4;  1Q9E A;  4HM7 B;  2YFI B;  3EJV A;  4KVH A;  4EV2 A;  1IK3 A;  4CJN A;  1K28 A;  1W01 A;  3PXM A;  3F8X A;  1TFO A;  3D79 A;  3F14 A;  3H3H A;  3I56 3;  2XRX B;  3F8H A;  3HII A;  1GY5 A;  1BRI A;  2W04 A;  3WOF B;  1RLS A;  4H3U A;  2CKF B;  4WP5 A;  3ZG5 A;  4XB5 A;  4ORL A;  1MNL A;  1UI8 A;  1E3R A;  1GD3 A;  2OOV C;  1JB5 A;  3CME 3;  4EXR A;  1WNH A;  4HZB B;  5G1K A;  1YVB I;  1D6Y A;  1BRK A;  2F99 A;  2P0M A;  1NO3 A;  4R9K A;  1US1 A;  3LZA A;  2IUK A;  3S67 A;  3Q2P A;  1BNR A;  1B2X A;  2D1W A;  3S28 A;  1YNV X;  2O9U X;  3ZG0 A;  1YJW 3;  1QAL A;  1LOX A;  4HM6 B;  2OQE A;  5CK6 A;  3DGO A;  3A76 A;  1UGI A;  1VQ7 3;  3CPO A;  3M8C A;  1A2P A;  1BRJ A;  1MWS A;  1QMA A;  1VQQ A;  1W7C A;  2KAA A;  3F40 A;  3F9S A;  4BIR A;  1VQP 3;  3FKA A;  3KSE D;  1KSI A;  1VQ5 3;  1EEJ A;  4HM5 B;  4IT7 A;  1Q82 4;  1LOW A;  2L4V A;  3EBY A;  5CF2 A;  3S29 A;  1BNJ A;  1O7N B;  1B21 A;  1YHQ 3;  3B4O A;  3VSY A;  3QRD A;  3STD A;  3WR2 A;  5STD A;  3GZR A;  4HJL B;  1UGH I;  2CC3 A;  3AGO A;  3CC2 3;  2XFS A;  4NPB A;  1IQX A;  4BTW A;  3LML A;  3EF8 A;  3CU3 A;  3UJM A;  2BU4 A;  1MGR A;  1O7M B;  2BNG A;  4HKV B;  4LYL B;  5AI1 A;  2CWU A;  1HU9 A;  5KP3 A;  2IYJ A;  1RNB A;  2ZL8 A;  1UCI A;  2CFK A;  4J5K A;  3HI7 A;  4LSO A;  1EKM A;  5CXO A;  3NBB A;  3CXC 2;  3A5E A;  1NB3 I;  3KCH A;  2FGT A;  2H0G A;  3RDE A;  3CMA 3;  3S27 A;  1TFK A;  1N9E A;  1JRQ A;  2V1L A;  2OTL 3;  5AEU B;  1V57 A;  1YI2 3;  3N8B A;  3OW2 2;  3SYU A;  1Q81 4;  1I2G A;  1RGG A;  4AKZ A;  3DM8 A;  2XGN A;  3K0Z A;  3KFQ C;  1OH0 A;  2XGL A;  2H0I A;  1VQ4 3;  1IVV A;  1RHL A;  3PYJ A;  3EN1 B;  4N6O B;  6GSP A;  2GU1 A;  4MJD A;  1JBR A;  1ROV A;  3GZX B;  4FCM A;  3EQQ B;  2BMO B;  3SXX A;  1GMR A;  1K9M 4;  4X2O A;  1RGF A;  1YIT 3;  4GHO A;  2W56 B;  2WGO A;  1NWW A;  1RDS A;  4HZ9 B;  1Q40 B;  2B1X B;  1W2B 2;  4WFO A;  1OGX A;  2PZV A;  4RNY A;  1WQL B;  3HOH A;  3CCL 3;  1S72 3;  3CNX A;  1JB2 A;  2RBI A;  2Z76 A;  1YIJ 3;  5HGR A;  4J5G A;  1JV2 B;  1K73 4;  4IIA A;  4OVM A;  3DGY A;  1LQM B;  1DE3 A;  3G8Z A;  1A2V A;  1PU4 A;  1DET A;  2HOH A;  4N3V A;  2RSX A;  4QWT A;  2ML6 A;  2OOV A;  1FW7 A;  1T3B A;  2CIU A;  2W9P A;  2Z77 A;  2F5W A;  1J2B A;  2SBL A;  3V92 A;  1QAF A;  1BOX A;  2W6J H;  2ZDJ A;  1WMP A;  1G02 A;  2RCD A;  1IU7 A;  1FGT A;  3LTB A;  5JPU A;  1BAN A;  1STF I;  3NHX A;  4KFF A;  5DRE A;  5BVB A;  1MOL A;  1K41 A;  4MMX B;  1A90 A;  1X1X A;  1EA2 A;  1OHO A;  3MG1 A;  3NM7 A;  2F86 B;  4OK0 A;  3SVA A;  1B2M A;  1M1X B;  1GS3 A;  1BAO A;  2HMO B;  1CH0 A;  1UUG B;  2IMJ A;  1RN4 A;  1GD4 A;  1WMO A;  1A2K A;  2AAE A;  5FGO A;  3NV0 B;  3RGR A;  1W2Z A;  2HML B;  1LOY A;  2QEX 3;  2KF3 A;  4I5Q A;  5EEO A;  3KSP A;  4N6N B;  1MWT A;  5BU4 A;  5IG0 A;  2XEP A;  3G71 3;  3MG2 A;  2R41 A;  2RFR A;  3CC4 3;  2CG0 A;  4HAA A;  4STD A;  3RGA A;  2CWT A;  1TJD A;  3EB8 A;  5ELU A;  1I0V A;  3VF1 A;  1ULI B;  3CD6 3;  7STD A;  2W56 A;  1AQZ A;  4X2H A;  1DVD A;  1TIJ A;  1TUH A;  1Q40 A;  1R4C A;  1N8R 4;  2HMJ B;  3DUK A;  1ULJ B;  2Z6B A;  4R80 A;  2O3O A;  3URP A;  1FA3 A;  3K63 A;  1T2H A;  1N8Q A;  4LEH A;  5RNT A;  1VQ9 3;  1W6C A;  1CEW I;  4HYZ A;  3B8L A;  2KCD A;  1BSB A;  3OX9 A;  5IF6 A;  2F56 A;  2E2T A;  3X40 A;  1VQK 3;  3PCS A;  2JQ5 A;  1RGK A;  3LTA A;  1GOU A;  3FH1 A;  1BGS A;  4XBX A;  2W9Q A;  1AV4 A;  1I2E A;  4N6L A;  3Q90 A;  1JBS A;  4O3V A;  2IUJ A;  1OHP A;  3T8N A;  1BSD A;  1GMQ A;  1GMP A;  1IT8 A;  2UUG C;  2AAD A;  3MYT A;  1YJ9 3;  1UI7 A;  1OGZ A;  3AHS A;  3U97 A;  3LYG A;  4BL3 A;  4JF8 A;  1DMM A;  1SQW A;  3LXU X;  1FUS A;  1B27 A;  3E99 A;  1AR0 A;  1DVC A;  1FGO A;  1CYU A;  1F8N A;  2CFW A;  4DKI A;  3MWZ A;  1QAK A;  3FF0 A;  2UGI A;  1B2Z A;  5TGN A;  5EQL A;  2XH9 A;  2SAR A;  4LMI A;  2P09 A;  3FCS B;  3NQY A;  3DGN A;  3K7C A;  3NV0 A;  5BXQ A;  3DY5 A;  2IA7 A;  3MPH A;  4NRE A;  3EC9 A;  4EV5 A;  1TTO A;  1BNS A;  1GOV A;  1AVK A;  1R4Y A;  2ZHX B;  1VQ6 3;  3CCV 3;  2E2U A;  3X3X A;  1BSA A;  1ZX2 A;  1BRN L;  3B7C A;  4TX4 A;  4WYK A;  1M9G A;  1PFP A;  3DH2 A;  3OWU A;  3AGN A;  4JRF A;  2RNT A;  3BB9 A;  3K9M C;  4HM2 B;  1BRG A;  1BSE A;  1V74 A;  5EVH A;  4GSP A;  5IER A;  5IW9 A;  1SJW A;  2LYX A;  3SX1 A;  1FGR A;  1LRA A;  3F7S A;  2QA4 3;  1VQ8 3;  3WOD G;  1YGE A;  3BNB A;  3TDG A;  1RSN A;  3SOY A;  1UUV B;  3GAX A;  3KN4 A;  1O7H B;  4N6U A;  1MGW A;  3B4P A;  5AIG A;  4XM4 A;  1VQO 3;  5BIR A;  1BU4 A;  4HM1 B;  5KP1 A;  1GOY A;  2E2V A;  1UCL A;  3IPT A;  1W6G A;  1ZS7 A;  3X42 A;  3LH4 A;  2KF4 A;  3WHO A;  3V99 A;  1U5O A;  4IPB A;  3KKG A;  3OWY A;  2P38 A;  2K3D A;  2OCT A;  3T8U A;  1V58 A;  3G6E 3;  2BIR A;  3G4S 3;  3VGN A;  3ALA A;  5AIF A;  1VQN 3;  1NB5 I;  1RKY A;  1JBT A;  1BNG A;  1MWR A;  1VZZ A;  1RRH A;  4FR9 A;  2CK3 H;  1RCL A;  1BUJ A;  1JKG B;  4MMZ B;  2P05 A;  1NNV A;  1I70 A;  1IDP A;  2C10 A;  4OUQ A;  1ISK A;  1FUT A;  1RMS A;  4H61 A;  4K90 B;  3OXA A;  2UX0 A;  4U13 A;  1BNI A;  1RGC A;  1TRP A;  2GBX B;  4KFE A;  3DGL A;  4HBR A;  1OAC A;  1GSP A;  1I3I A;  1HZ1 A;  1E97 A;  1LNI A;  2C11 A;  2CW9 A;  3KII A;  4G1M B;  3SOA A;  1Q7Y 4;  1BRH A;  1IYY A;  4HOH A;  4O8S A;  3QK9 A;  4R1K A;  3NUV A;  2W2C A;  5D83 A;  5IEN A;  1LVN A;  2WGQ A;  3H51 A;  3JUN A;  4HVN A;  1RN1 A;  1UDI I;  4J9A A;  1FGQ A;  2CFG A;  3CCJ 3;  2I9W A;  2WOH A;  5ELJ A;  3CCQ 3;  2Q07 A;  1BSC A;  1EUI C;  2F98 A;  4HM3 B;  5AYS C;  2RGQ A;  3PS8 A;  1Z1S A;  3GSP A;  1W6Y A;  4WWU C;  1JB4 A;  2XFT A;  1O7G B;  2B24 B;  1EQK A;  4N6V 0;  2XF3 A;  1UCJ A;  2STD A;  5D81 A;  3G0K A;  4MMY B;  1IQ8 A;  1RGH A;  1C54 A;  3ER7 A;  3Q1C A;  2FXT A;  1WTH A;  4KZ1 A;  2YFL B;  1TP6 A;  3BU4 A;  1U8C B;  4ILF A;  2L1S A;  3F7X A;  1YVS A;  1PY3 A;  2QIY A;  3Q3F A;  5AYR B;  9RNT A;  2R4I A;  5A0O B;  1BUQ A;  1FYS A;  3CPW 2;  1IV9 A;  1ASK A;  3N9H A;  2CH9 A;  3OV4 A;  5IG5 A;  8RNT A;  2YFJ B;  1JKG A;  1L5G B;  1PYL A;  2GSP A;  2K0M A;  4O2H A;  8CHO A;  1IT7 A;  1D6U A;  1X1W A;  1G0T A;  2Y73 A;  3GZY B;  4FMB A;  2GBW B;  4N6M A;  4XBY A;  4CCV A;  1LXE A;  3EHC A;  3EN8 A;  3NM2 A;  6STD A;  1OCV A;  4RBN A;  5DRV A;  4XDV A;  5G2G A;  3BNE A;  4GB5 A;  1FUW A;  3FG3 A;  3J7Y d;  5IEP A;  1UUW B;  1E3V A;  1ROA A;  1IV7 A;  2KRT A;  1NDO B;  2YX9 A;  5AEW B;  2WO0 A;  3LT9 A;  2GEY A;  3BLZ A;  2BO9 B;  4O02 B; 
#chains in the Genus database with same CATH homology
 2GXF A;  2OTJ 3;  2JDI H;  1KC8 4;  1UW1 A;  5D82 A;  2W03 A;  4MEI A;  3PCR A;  1STD A;  1ZO2 A;  5FW5 A;  2K54 A;  4PEJ A;  3FG1 A;  1RJO A;  2W0Q A;  3PGB A;  2CFD A;  1Q42 A;  2BHM A;  3LTD A;  1W5Z A;  3X3Z A;  1JJ2 2;  3CNM A;  2ML5 A;  2BMQ B;  2Y74 A;  1SII A;  4XDW A;  2LQV A;  3BNC A;  4ZM8 A;  4WHA A;  1EG9 B;  1SIH A;  3HIG A;  3N54 B;  4FMC A;  1N5P A;  3NBJ A;  3WA3 A;  3DGM A;  1DMQ A;  3KZT A;  3AMO B;  1IQY A;  1CYV A;  3MG3 A;  3I0Y A;  3EE1 A;  3GZB A;  1SPU A;  1VQM 3;  1HKX A;  3T0U A;  1OPY A;  1KWI A;  3FLJ A;  4XBT A;  5LC7 A;  3U1W A;  1DYU A;  2XR8 B;  2CHC A;  3FZW A;  3WMD A;  1RRL A;  1CQS A;  2A15 A;  2Z7A A;  4K1U A;  3JUO A;  3D9R A;  1NU3 A;  1LNH A;  2OWP A;  4EC6 A;  2MC8 A;  5CF1 A;  1O7P B;  4RZM A;  5IG3 A;  4L7K A;  1G96 A;  3IMA B;  3JUQ A;  4FMA A;  1JN5 B;  2M7O A;  4I4K A;  3MHE A;  5JPP A;  3CCM 3;  2CFL A;  3IJE B;  3DXO A;  1Q86 4;  3CCU 3;  1QJG A;  4K61 A;  2CWV A;  4LZI A;  1JNQ A;  3ROB A;  2P0X A;  2PNC A;  3DMC A;  4FCJ A;  3WOE B;  1WMN A;  1TU5 A;  3UL5 A;  3NBR A;  3KE7 A;  3LTC A;  4RNZ A;  3CC7 3;  1IVW A;  4HM0 B;  1W02 A;  2GEX A;  3MKI A;  4N6T A;  3EX9 A;  2MF7 A;  3DZL A;  2QGU A;  5KP4 A;  3UL6 A;  1IVX A;  1OHS A;  3ECF A;  3K5T A;  5LC6 A;  1OF5 B;  1IVU A;  3G16 A;  3JUP A;  3SLU A;  1W00 A;  1D6Z A;  3WA2 X;  5IG4 A;  2BMR B;  2HMK B;  3AMO A;  3CCS 3;  3D3L A;  1NJI 4;  4GL6 A;  3LOY A;  2FNQ A;  4EYC A;  1QVG 2;  1T5Y A;  3O8Y A;  2OQE C;  3CCE 3;  5AIH A;  3FSD A;  1GY7 A;  3FGY A;  4BTY A;  3SED A;  3JVC A;  2CG1 A;  4EBG A;  1RN7 A;  1W4N A;  5I97 A;  1KD1 4;  2KXG A;  4NHF A;  5IEO A;  3X41 A;  3WDG B;  1AVL A;  1FGM A;  1N5H A;  3CCR 3;  3GWR A;  3I55 3;  3GRD A;  3MSO A;  2BT3 A;  3NXJ A;  1N9J A;  4L8O A;  5AII A;  2HMM B;  1GYB A;  3HK4 A;  4BTX A;  1Y4K A;  3X3Y A;  3FF2 A;  3HZP A;  3NX0 A;  1JN5 A;  1GY6 A;  4AKY A;  3HX8 A;  3PZW A;  1C7H A;  3OWS A;  3EBT A;  5CLK A;  2XSH B;  3FG4 A;  4AEQ A;  3JUM A;  3UNL A;  1K8A 4;  1DMN A;  4CDL A;  1S5A A;  1O7W B;  3BND A;  1KQS 2;  2INX A;  4L8P A;  4Q53 A;  4J8T A;  3UB1 A;  1QVF 2;  3L0R A;  3LT8 A;  4FMD A;  3NQZ A;  2XSO B;  1YJN 3;  1A67 A;  2HMN B;  3S5C A;  4FCZ A;  3V98 A;  1OF5 A;  5JBS A;  4KFD A;  2WOF A;  4HM8 B;  4LGQ A;  1VQL 3;  1OUN A;  1M1K 4;  4HM4 B;  4R4K A;  4K1V A;  4R9L A;  4WYK B;  2D42 A;  2GU3 A;  1M90 4;  4HM7 B;  2YFI B;  3EJV A;  4KVH A;  4EV2 A;  1IK3 A;  1K28 A;  1W01 A;  3PXM A;  3F8X A;  1TFO A;  3H3H A;  3F14 A;  3I56 3;  2XRX B;  3F8H A;  3HII A;  1GY5 A;  2W04 A;  3WOF B;  4H3U A;  2CKF B;  4WP5 A;  4XB5 A;  4ORL A;  1MNL A;  1UI8 A;  1E3R A;  1GD3 A;  2OOV C;  1JB5 A;  3CME 3;  4EXR A;  1WNH A;  4HZB B;  1YVB I;  1D6Y A;  2F99 A;  2P0M A;  1NO3 A;  4R9K A;  1US1 A;  3LZA A;  2IUK A;  3S67 A;  3Q2P A;  2D1W A;  3S28 A;  2O9U X;  1YJW 3;  1QAL A;  1LOX A;  4HM6 B;  2OQE A;  5CK6 A;  3DGO A;  3A76 A;  1VQ7 3;  3CPO A;  3M8C A;  3F9S A;  1QMA A;  1W7C A;  1VQP 3;  3F40 A;  3FKA A;  3KSE D;  1KSI A;  1VQ5 3;  4HM5 B;  4IT7 A;  1Q82 4;  2L4V A;  3EBY A;  5CF2 A;  3S29 A;  1O7N B;  1YHQ 3;  3B4O A;  3VSY A;  3QRD A;  3STD A;  5STD A;  3GZR A;  4HJL B;  2CC3 A;  3CC2 3;  2XFS A;  1IQX A;  4BTW A;  3LML A;  3EF8 A;  3CU3 A;  3UJM A;  1O7M B;  2BNG A;  4HKV B;  5AI1 A;  2CWU A;  1HU9 A;  5KP3 A;  2ZL8 A;  2CFK A;  3HI7 A;  4LSO A;  1EKM A;  5CXO A;  3NBB A;  3CXC 2;  1NB3 I;  2FGT A;  3RDE A;  3CMA 3;  3S27 A;  1TFK A;  1N9E A;  1JRQ A;  2V1L A;  2OTL 3;  5AEU B;  1YI2 3;  3N8B A;  3OW2 2;  1Q81 4;  4AKZ A;  3DM8 A;  2XGN A;  3K0Z A;  3KFQ C;  1OH0 A;  2XGL A;  1VQ4 3;  1IVV A;  4N6O B;  3PYJ A;  3EN1 B;  2GU1 A;  4MJD A;  1ROV A;  3GZX B;  4FCM A;  3EQQ B;  2BMO B;  3SXX A;  1K9M 4;  4X2O A;  1YIT 3;  2W56 B;  2WGO A;  1NWW A;  4HZ9 B;  1Q40 B;  2B1X B;  1W2B 2;  4WFO A;  1OGX A;  2PZV A;  4RNY A;  1WQL B;  3CCL 3;  1S72 3;  3CNX A;  1JB2 A;  2Z76 A;  1YIJ 3;  5HGR A;  1K73 4;  1JV2 B;  4IIA A;  4OVM A;  3G8Z A;  1A2V A;  1PU4 A;  4N3V A;  2RSX A;  4QWT A;  2ML6 A;  2OOV A;  2CIU A;  2W9P A;  2Z77 A;  1J2B A;  2SBL A;  3V92 A;  1QAF A;  2W6J H;  2ZDJ A;  1WMP A;  2RCD A;  1IU7 A;  1FGT A;  3LTB A;  5JPU A;  1STF I;  3NHX A;  4KFF A;  5DRE A;  5BVB A;  1MOL A;  1K41 A;  4MMX B;  1A90 A;  1EA2 A;  1OHO A;  3MG1 A;  3NM7 A;  2F86 B;  4OK0 A;  3SVA A;  1M1X B;  1GS3 A;  2HMO B;  2IMJ A;  1GD4 A;  1WMO A;  1A2K A;  5FGO A;  3NV0 B;  3RGR A;  1W2Z A;  2HML B;  2QEX 3;  5EEO A;  3KSP A;  4N6N B;  5IG0 A;  2XEP A;  3G71 3;  3MG2 A;  2RFR A;  3CC4 3;  2CG0 A;  4STD A;  3RGA A;  2CWT A;  3EB8 A;  5ELU A;  3VF1 A;  1ULI B;  3CD6 3;  7STD A;  2W56 A;  4X2H A;  1DVD A;  1TIJ A;  1TUH A;  1Q40 A;  1R4C A;  1N8R 4;  2HMJ B;  3DUK A;  1ULJ B;  2Z6B A;  4R80 A;  2O3O A;  1FA3 A;  3K63 A;  1N8Q A;  4LEH A;  1VQ9 3;  1W6C A;  1CEW I;  4HYZ A;  3B8L A;  2KCD A;  3OX9 A;  5IF6 A;  2E2T A;  3X40 A;  1VQK 3;  3PCS A;  2JQ5 A;  3LTA A;  3FH1 A;  4XBX A;  2W9Q A;  1AV4 A;  4N6L A;  3Q90 A;  4O3V A;  2IUJ A;  1OHP A;  3T8N A;  1IT8 A;  3MYT A;  1YJ9 3;  1UI7 A;  1OGZ A;  3U97 A;  3LYG A;  4JF8 A;  1DMM A;  1SQW A;  3LXU X;  3E99 A;  1AR0 A;  1DVC A;  1FGO A;  1CYU A;  1F8N A;  2CFW A;  3MWZ A;  1QAK A;  3FF0 A;  5TGN A;  5EQL A;  2XH9 A;  4LMI A;  2P09 A;  3FCS B;  3NQY A;  3DGN A;  3K7C A;  3NV0 A;  5BXQ A;  3DY5 A;  2IA7 A;  3MPH A;  4NRE A;  3EC9 A;  4EV5 A;  1VQ6 3;  1AVK A;  3CCV 3;  2E2U A;  3X3X A;  1ZX2 A;  3B7C A;  4TX4 A;  4WYK A;  1M9G A;  1PFP A;  3OWU A;  4JRF A;  3BB9 A;  3K9M C;  4HM2 B;  1V74 A;  5EVH A;  5IER A;  5IW9 A;  1SJW A;  2LYX A;  3SX1 A;  1FGR A;  3F7S A;  2QA4 3;  1VQ8 3;  3WOD G;  1YGE A;  3BNB A;  3TDG A;  3SOY A;  1UUV B;  3GAX A;  3KN4 A;  1O7H B;  4N6U A;  3B4P A;  5AIG A;  4XM4 A;  1VQO 3;  5KP1 A;  4HM1 B;  2E2V A;  3IPT A;  1W6G A;  3X42 A;  3LH4 A;  3V99 A;  1U5O A;  4IPB A;  3KKG A;  3OWY A;  2P38 A;  2OCT A;  3T8U A;  3G6E 3;  3G4S 3;  3VGN A;  3ALA A;  5AIF A;  1VQN 3;  1NB5 I;  1RKY A;  1VZZ A;  1RRH A;  4FR9 A;  2CK3 H;  1JKG B;  4MMZ B;  2P05 A;  1IDP A;  2C10 A;  4OUQ A;  1ISK A;  4H61 A;  4K90 B;  3OXA A;  2UX0 A;  4U13 A;  2GBX B;  4KFE A;  3DGL A;  4HBR A;  1OAC A;  2C11 A;  3KII A;  3SOA A;  1E97 A;  1Q7Y 4;  2CW9 A;  4G1M B;  4O8S A;  3QK9 A;  4R1K A;  3NUV A;  2W2C A;  5D83 A;  5IEN A;  1LVN A;  2WGQ A;  3H51 A;  3JUN A;  4HVN A;  4J9A A;  1FGQ A;  2CFG A;  3CCJ 3;  2I9W A;  2WOH A;  5ELJ A;  3CCQ 3;  2Q07 A;  4HM3 B;  2F98 A;  5AYS C;  2RGQ A;  3PS8 A;  1Z1S A;  4WWU C;  1W6Y A;  1JB4 A;  2XFT A;  1O7G B;  2B24 B;  1EQK A;  4N6V 0;  2XF3 A;  2STD A;  5D81 A;  3G0K A;  4MMY B;  1IQ8 A;  3ER7 A;  3Q1C A;  2FXT A;  1WTH A;  4KZ1 A;  2YFL B;  1TP6 A;  1U8C B;  5AYR B;  3F7X A;  2QIY A;  2R4I A;  5A0O B;  1BUQ A;  3CPW 2;  1IV9 A;  1ASK A;  3N9H A;  2CH9 A;  3OV4 A;  5IG5 A;  2YFJ B;  1JKG A;  1L5G B;  2K0M A;  4O2H A;  8CHO A;  1IT7 A;  1D6U A;  2Y73 A;  4FMB A;  3GZY B;  2GBW B;  4N6M A;  4XBY A;  4CCV A;  1LXE A;  3EHC A;  3EN8 A;  3NM2 A;  6STD A;  1OCV A;  4RBN A;  5DRV A;  4XDV A;  5G2G A;  3BNE A;  4GB5 A;  1FUW A;  3FG3 A;  3J7Y d;  5IEP A;  1UUW B;  1E3V A;  1ROA A;  1IV7 A;  2KRT A;  1NDO B;  2YX9 A;  5AEW B;  2WO0 A;  3LT9 A;  2GEY A;  3BLZ A;  2BO9 B;  4O02 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...