4RZMA

Crystal structure of the lsd19-lasalocid a complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
274
Chain Sequence
GRHMPAETVRKEVALEYCRRVNAGELEGVLQLFAPDARLVDPLGTEPVVGRAALAARLAPALRGAVHEEPGRPYAAHDGTSVVLPATVTVRGRTRVMGVIEVGEDGLIREMRVMWGVTDSSWTARPAPDEERRKELAREHCLRINDGDVDGLLKLYSPRIRFEDPVGSWTRTGLEALRAHATMAVGSNVRETAGLTVAGQDGRHAAVTVSATMDYLPSGPLLARHHLMTLPAPADPHRALIGIEYVMVIGVDADGLIDEMRAYWGATDVSLLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Epoxide hydrolase LasB
publication title Epoxide hydrolase-lasalocid a structure provides mechanistic insight into polyether natural product biosynthesis.
pubmed doi rcsb
source organism Streptomyces lasaliensis
total genus 90
structure length 274
sequence length 283
chains with identical sequence B
ec nomenclature ec 5.5.1.-:
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rzmA01
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rzmA02
3B7CA 1O7PB 4HJLB 4U13A 3EQQB 5BVBA 2Z77A 3NV0B 4ORLA 3B4PA 4WYKA 3NHXA 1JB2A 3GZXB 1TP6A 3EX9A 3EN8A 4WYKB 4HM6B 1NU3A 2GEYA 5CLKA 2XRXB 5KP3A 3GZRA 3FKAA 2CHCA 4L7KA 4RZMA 1QMAA 1OF5A 1E3VA 3FGYA 3I0YA 3NM2A 1E97A 5IG0A 5IERA 1SJWA 1A2KA 4L8OA 5AEUB 1CQSA 2BMRB 3KZTA 3NBRA 1BUQA 4WWUC 5BXQA 2YFLB 3KSPA 4R9KA 4XBYA 3NXJA 2GXFA 5DRVA 3OXAA 1GS3A 3D9RA 3JUPA 5D82A 4PEJA 3SEDA 2UX0A 5IENA 5JPUA 1EA2A 3GRDA 4R9LA 3RGRA 1O7WB 3OX9A 3F9SA 5JPPA 2F86B 2OWPA 3HZPA 1JKGA 3OWYA 4CDLA 1OHPA 3F40A 1Q42A 2HMOB 3FF0A 2K54A 5D81A 3LYGA 1UUWB 1W6YA 3EN1B 1OGZA 3G8ZA 5AI1A 1DMNA 1JB5A 3OWSA 3A76A 5CF1A 5DREA 5D83A 3EJVA 3K0ZA 1K41A 1W00A 2JQ5A 5IF6A 8CHOA 5STDA 1OUNA 3DMCA 3NV0A 2HMLB 3FF2A 3MG1A 2BNGA 1DMQA 6STDA 4LMIA 3F7SA 2XSHB 4J8TA 3DZLA 1GY6A 3FZWA 4J9AA 2B1XB 3JUQA 3MG3A 3KE7A 2GBXB 3DXOA 4N3VA 1NDOB 5HGRA 3STDA 4HZBB 5CF2A 5IG5A 1E3RA 2Z7AA 3SOYA 3FLJA 4I4KA 1ULJB 1DMMA 2QGUA 3B4OA 1QJGA 4HKVB 3JUMA 3BB9A 3EBTA 2CKFB 4STDA 3UNLA 3MHEA 3MG2A 3F14A 2BMQB 1STDA 3SOAA 3OWUA 1GYBA 2A15A 3CPOA 1ISKA 2STDA 3MKIA 3B8LA 3EBYA 4OVMA 3GZBA 4HZ9B 2INXA 4KVHA 3VGNA 5IEPA 1ASKA 1O7NB 1JN5B 4XDVA 2B24B 2F98A 5IG3A 4XM4A 3GWRA 2HMMB 2XR8B 3CU3A 1JB4A 1OH0A 4GB5A 1C7HA 1O7MB 3H51A 4K1UA 4XBTA 4K1VA 5EVHA 3EF8A 5FW5A 5AEWB 3EC9A 3MYTA 4HVNA 3G0KA 1OHOA 3CNXA 4MJDA 2XSOB 2RGQA 3M8CA 3UJMA 2I9WA 1Q40A 5CXOA 1VZZA 1NWWA 4L8PA 2R4IA 1S5AA 1Q40B 1WQLB 4HM8B 4HM4B 1ZO2A 1GY5A 5AIIA 3KKGA 2F99A 2BMOB 2HMJB 3F8XA 1ZX2A 2GEXA 3RGAA 3FH1A 4HM5B 3T8NA 3CNMA 1W02A 5AIFA 3EHCA 4X2OA 4R1KA 4XB5A 1Z1SA 3IPTA 3JUOA 1OPYA 4H3UA 1UUVB 2RFRA 5KP4A 4Q53A 5AIHA 1OF5B 4LEHA 3Q90A 3HK4A 3OV4A 3T8UA 1HKXA 4FCJA 3K7CA 2YFJB 3F7XA 4HM1B 3ER7A 4X2HA 3S5CA 4XBXA 1W01A 1AR0A 3ROBA 2HMNB 1OGXA 3HX8A 3E99A 1JN5A 2GBWB 3GZYB 1EG9B 3MSOA 2RCDA 3DUKA 3F8HA 1OCVA 3JUNA 4IIAA 4LGQA 4HM7B 1TUHA 4XDWA 3WMDA 1IDPA 5AIGA 2YFIB 1OHSA 2PZVA 5IG4A 1JKGB 3ECFA 2HMKB 3LZAA 1O7HB 7STDA 3NUVA 2Z76A 5IEOA 4FCMA 1U5OA 5CK6A 1GY7A 3H3HA 4HM2B 3DM8A 3G16A 1O7GB 2IMJA 1ULIB 5TGNA 3BLZA 4WP5A 2W2CA 4OUQA 2QIYA 3FSDA 5G2GA 4HM3B 3VSYA 5KP1A 4HM0B
chains in the Genus database with same CATH superfamily
4MEIA 1NB5I 1FGTA 3CCQ3 1Y4KA 3B7CA 1O7PB 2CFGA 1VQN3 4HJLB 4U13A 3EQQB 2MC8A 1LVNA 3LMLA 1RGGA 1A2PA 1R4YA 3CME3 5BVBA 4JRFA 3BU4A 2Z77A 1FGMA 3NV0B 4ORLA 1HYFA 3B4PA 1VQ53 4WYKA 3NHXA 2RBIA 1EQKA 1FGOA 1JB2A 3GZXB 1TP6A 3EX9A 1BNRA 1GOUA 3EN8A 1R4CA 4WYKB 1WTHA 4HM6B 1NU3A 3CCU3 1N5HA 2GEYA 5CLKA 1UGHI 3URPA 2XRXB 5KP3A 2OTJ3 2E2TA 3GZRA 1D6YA 2CG0A 3FKAA 5M19A 1VQK3 2WO0A 2ML6A 2CHCA 3O8YA 2W04A 1C54A 4NREA 4LZIA 2AAEA 2W56B 1V58A 4IPBA 4L7KA 3U97A 2OOVA 3I553 2CX0A 2KF5A 4RZMA 2IUJA 4N6V0 3KIIA 1QMAA 1OF5A 1E3VA 3T0UA 3FGYA 2V1LA 1Q9EA 5RNTA 2ZA4A 4N6UA 4RNYA 1PY3A 1I2GA 3I0YA 1VQ83 5EEOA 2FGTA 3NM2A 1B21A 1RCKA 1G02A 1E97A 2IA7A 5IG0A 1W6CA 4I5QA 5IERA 1SJWA 2BO9B 1A2KA 4L8OA 5AEUB 5AYSC 1CQSA 3WOEB 1VQ63 4RBNA 2BMRB 3KZTA 3NBRA 1BUQA 2BIRA 1RGFA 4WWUC 5BXQA 4HYZA 3FG4A 3N54B 1IQYA 2YFLB 5M18A 1FGQA 3KSPA 4R9KA 1T2HA 1US1A 4XBYA 2WGQA 1RGKA 3CCL3 3NXJA 4EXRA 4N6TA 2GXFA 1X1WA 5LC7A 5DRVA 3OXAA 1UCKA 1BNEA 1GMRA 3OW22 1GS3A 1VQM3 1FGRA 2CFKA 3D9RA 3JUPA 5D82A 4PEJA 3SEDA 2UX0A 5IENA 5JPUA 1RHLA 1EA2A 3GRDA 4R9LA 3RGRA 1O7WB 3ALAA 3WHOA 4FMAA 1A67A 3OX9A 2F56A 2OOVC 3F9SA 2D1WA 4H61A 2CX1A 3CMA3 3NX0A 5JPPA 1QALA 2F86B 1W2B2 1RRHA 3CCE3 1YGEA 1IT8A 3NM7A 2OWPA 3HZPA 2QEX3 1MWRA 1KD14 3J7Yd 1M1XB 1NB3I 1JKGA 4RNTA 4FMBA 4O8SA 1MWUA 4R4KA 1IK3A 3S28A 3OWYA 3AMOB 4CDLA 1RGEA 1BUJA 1OHPA 4WFOA 3N8BA 2CFDA 2W0QA 1JBSA 1DVCA 2ZHXB 1Q42A 3F40A 1UW1A 1YNVX 2HMOB 3PXMA 4HBRA 1TJDA 1LQMB 4FMDA 1IU7A 3FF0A 2K54A 3G713 4FMCA 1TRQA 3X42A 2KCDA 1YVSA 3HI7A 4IT7A 3LTAA 5D81A 1BANA 3LYGA 1TFKA 1UUWB 3X41A 1W6YA 3D3LA 3EN1B 1OGZA 3G8ZA 3UB1A 2K0MA 5AI1A 1UUGB 1BNIA 3BNDA 1BNJA 1DMNA 1GOYA 1JB5A 1SIHA 3OWSA 1JBTA 2K3DA 3A76A 5CF1A 2L4VA 3Q3FA 1WNHA 5DREA 1B2MA 5D83A 1BU4A 4HOHA 2RSXA 2W9QA 1GD3A 3EJVA 3K0ZA 3CCJ3 2CH9A 1M1K4 2CFLA 1N9EA 1K41A 1W00A 2E2UA 2JQ5A 1Q7HA 5IF6A 8CHOA 4ZM8A 1IQXA 5STDA 1RKYA 1RLSA 3DGLA 1OUNA 3HIIA 3SVAA 1BRKA 3DMCA 1MWSA 3NV0A 4GSPA 2C11A 2JDIH 1UCIA 3LTCA 3V99A 2HMLB 3RNTA 2QA43 3FF2A 3MG1A 2BNGA 2J8XB 1FUWA 1DMQA 3LTDA 3RDEA 6STDA 1JNQA 4LMIA 4O3VA 1PFPA 4ILFA 1L5GB 2W6JH 3F7SA 1K8A4 2XSHB 4J8TA 1JZDA 3CC43 3WDGB 4BL3A 1BNSA 3DGNA 3DZLA 3AHWA 3SYUA 1BSAA 1RDSA 3AHSA 4HAAA 1GY6A 4EW5A 1UI7A 1TRPA 3FZWA 4J9AA 2W56A 1RNTA 4K61A 2B1XB 2YX9A 3JUQA 2H0GA 3MG3A 4JF8A 1YJ93 1RN4A 1ROAA 2PNCA 2GBXB 3KE7A 1K9M4 4MMZB 3EE1A 3LT8A 1VQP3 3DXOA 4N3VA 1LOYA 3LTBA 4K90B 1FUSA 3X3XA 3G6E3 3N9HA 1LRAA 1NDOB 5HGRA 3STDA 1FW7A 2CG1A 2XGNA 3EB8A 4G1MB 4HZBB 2GSPA 1B20A 5CF2A 9RNTA 2CWTA 5IG5A 1K28A 1E3RA 2Z7AA 3SOYA 2SARA 2XFTA 1BVIA 3FLJA 2WOFA 1RN7A 4I4KA 1Q814 1ULJB 2F5WA 2C4BA 1MWTA 5G1LA 2KF4A 1DMMA 3SLUA 2QGUA 1B2XA 3B4OA 3DGMA 3DH2A 4CCVA 1QJGA 1PYLA 4HKVB 2R41A 1VQQA 1RMSA 3JUMA 2P38A 1ZS7A 1FYSA 3BB9A 4QWTA 3EBTA 5I97A 3CPW2 1BRSA 4RNZA 1HZ1A 2CKFB 3DGYA 3LT9A 4STDA 4DKIA 1ZGXA 3UNLA 1BSEA 3MHEA 3MG2A 1YIJ3 2L1SA 3K9MC 3LXUX 1SQWA 3F14A 2P0XA 7GSPA 1BSDA 2BMQB 2KRTA 1STDA 3SOAA 1MNLA 3OWUA 1V74A 1TFOA 1GYBA 1JRQA 2A15A 2XFSA 3CPOA 4J5KA 1ISKA 1AV4A 3CCM3 2STDA 2UUGC 2WGOA 3UL6A 3KCHA 3MKIA 6RNTA 3B8LA 1DVDA 3EBYA 4KFDA 1RGLA 4OVMA 1N5PA 3GZBA 3Q2PA 4HZ9B 4O02B 3HOHA 3WODG 1M9GA 1T2IA 2D42A 2INXA 3AMOA 2Z6BA 3IJEB 4KVHA 4NPBA 3VGNA 5IEPA 1ASKA 1O7NB 1X1YA 1W7CA 2HOHA 1JN5B 3L0RA 4GHOA 1UCJA 4NHFA 2O9UX 4XDVA 4AKZA 2GU1A 2P0MA 1EUIC 1V57A 4AKYA 4MMXB 1A90A 3I563 2P09A 1AVLA 2B24B 2F98A 1T5YA 3CCV3 1QAKA 4BIRA 1NNVA 4N6LA 1RGHA 2P05A 4FR9A 5IG3A 2UGIA 3WR2A 4XM4A 1MOLA 3BIRA 4GL6A 1LNHA 1GMPA 1TU5A 5G1KA 3GWRA 1G96A 1EEJA 2HMMB 1B2SA 1N8R4 4TX4A 1J2BA 2XR8B 3A5EA 3CU3A 1CH0A 1G0TA 1W4NA 1JB4A 3PCSA 2FNQA 5JBSA 2W9PA 3X3ZA 1OH0A 4GB5A 1C7HA 1O7MB 3TDGA 2Y73A 3H51A 3V92A 3D5IA 4K1UA 5BU4A 1BOXA 3GAXA 1UGIA 2Y74A 4XBTA 3V98A 1BNGA 4K1VA 3LH4A 1BSCA 5EVHA 1KQS2 1W6GA 1GD4A 3EF8A 1B2UA 1BRNL 3K63A 1UI8A 5FW5A 2F4YA 5AEWB 1JV2B 3EC9A 1B27A 3FG3A 3MYTA 1IVUA 1GOVA 4HVNA 3G0KA 3S29A 2ZL8A 1N8QA 1OHOA 3HIGA 3IMAB 3S27A 3CNXA 4N6NB 1GSPA 4MJDA 1I0VA 1RJOA 3WOFB 1VQ93 5AYRB 2XSOB 1FUTA 1RGAA 2FXTA 3NQYA 2OQEA 2CWUA 3DY5A 4BTYA 2RGQA 2WOHA 1KWIA 3M8CA 4EV2A 3UJMA 4EYCA 1GMQA 2CIUA 3BNEA 1B2ZA 3FG1A 2I9WA 4EBGA 2OTL3 1Q40A 2H0HA 1YHQ3 5CXOA 4CJNA 4N6OB 1VZZA 1NWWA 3DGOA 2BU4A 4L8PA 2R4IA 5EQLA 1QAFA 1S5AA 2SBLA 1FA3A 1Q40B 2MF7A 2CWVA 1KSIA 1WQLB 1IVWA 1IYYA 4HM8B 4HM4B 1QVG2 1YIT3 1ZO2A 1CYVA 3PZWA 8RNTA 3LOYA 1GY5A 2H0IA 1RTUA 3AGNA 4MMYB 5AIIA 3KKGA 1X1UA 2F99A 2XH9A 1F8NA 3FCSB 3PGBA 2BMOB 1BNFA 2HMJB 1AQZA 3F8XA 2ML5A 1CEWI 1ZX2A 3QK9A 5M1AA 2GEXA 1NJI4 3FH1A 3RGAA 2CC3A 3G4S3 4HM5B 3T8NA 3CNMA 3PYJA 1W02A 1LXEA 1MGRA 3PCRA 3CD63 5AIFA 3EHCA 1DETA 4R1KA 3BNBA 4X2OA 4XB5A 1IV7A 3KN4A 1IT7A 5ELJA 3UL5A 2KAAA 1BIRA 1Z1SA 3IPTA 3JUOA 1D6ZA 1UDII 2CW9A 1OPYA 1NO3A 1A2VA 1Q824 1AY7A 1LNIA 4H3UA 1SIIA 1RRLA 1YJW3 3NQZA 2OQEC 3SX1A 4BTWA 2RNTA 1UUVB 2CFWA 3KFQC 2RFRA 1VQ73 3GSPA 1I70A 4Q53A 1W2ZA 5KP4A 2KF3A 5AIHA 1OF5B 4LEHA 3Q90A 1YJN3 4BL2A 3HK4A 1JJ22 1VQL3 1BSBA 1I0XA 1RCLA 3OV4A 1IVXA 1HKXA 5FGOA 2XGLA 3T8UA 3X40A 3BNCA 1WMNA 1JBRA 1D6UA 1W5ZA 4FCJA 4LYLB 2IUKA 3K7CA 3D4AA 1T3BA 1BAOA 2YFJB 1LQGC 3CCR3 1I3IA 3F7XA 4HM1B 3KSED 2LQVA 3VF1A 3ER7A 1UCLA 1LOXA 1DE3A 4X2HA 3NBBA 4XBXA 1I3FA 1W01A 3S5CA 1YI23 1BRHA 3X3YA 2GU3A 1AR0A 3ROBA 2KF6A 2AADA 2HMNB 2OCTA 1OGXA 3HX8A 1BRGA 2W03A 2BT3A 3E99A 1JN5A 1DYUA 4N6MA 1VQO3 5GSPA 1WMPA 4KZ1A 5HOHA 2GBWB 3GZYB 5ELUA 4O2HA 1IVVA 5A0OB 1BGSA 1EG9B 1EKMA 5LC6A 1S723 1I8VA 1OACA 1RNBA 2M7OA 3MSOA 1AVKA 2RCDA 1CYUA 1YGWA 1X1XA 3DUKA 3U1WA 2O3OA 1JZOA 2CK3H 3F8HA 3JVCA 6GSPA 3QRDA 1OCVA 1BRJA 4LSOA 3JUNA 3SXXA 3S67A 4IIAA 3PS8A 4KT3B 4LGQA 3K5TA 3ZG5A 4HM7B 2ZDJA 3CCS3 1TUHA 1SPUA 3NBJA 3CC73 4J5GA 4XDWA 3WMDA 4EV5A 1IDPA 5AIGA 2YFIB 2IY2A 3ZFZA 1OHSA 2PZVA 1STFI 5IG4A 1JKGB 7RNTA 1N9JA 1M904 3ECFA 1RN1A 2BHMA 1HU9A 1RSNA 2HMKB 3LZAA 1O7HB 4CPKA 1Q7Y4 5IW9A 4EC6A 3MPHA 1QVF2 7STDA 3NUVA 1B3SA 1LOVA 2Z76A 1I2EA 1WMOA 2XF3A 4OK0A 2E2VA 5IEOA 1RGCA 2Q07A 2KXGA 2F5MA 4FCMA 1U5OA 1K734 4AEQA 1I2FA 2XEPA 1U8CB 1LOWA 1SARA 3Q1CA 4KFEA 5CK6A 1GY7A 1TTOA 3CC23 4KFFA 3H3HA 1MGWA 2IYJA 1FZUA 4HM2B 1BRIA 3DM8A 1Q864 3WA2X 2C10A 4BTXA 3CXC2 3ZG0A 1YVBI 1VQ43 3G16A 1PU4A 1O7GB 3AGOA 5BIRA 2IMJA 1ULIB 1TIJA 4FCZA 4WHAA 5TGNA 3BLZA 4WP5A 1IV9A 1KC84 1ROVA 2W2CA 3D5GA 4R80A 4BU4A 3WA3A 4OUQA 2QIYA 3FSDA 3MWZA 5G2GA 3D79A 4HM3B 3VSYA 5KP1A 1IQ8A 2LYXA 4HM0B
chains in the Genus database with same CATH topology
4MEIA 1NB5I 1FGTA 3CCQ3 1Y4KA 3B7CA 1O7PB 2CFGA 1VQN3 4HJLB 4U13A 3EQQB 2MC8A 1LVNA 3LMLA 3CME3 5BVBA 4JRFA 2Z77A 1FGMA 3NV0B 4ORLA 3B4PA 1VQ53 4WYKA 3NHXA 1EQKA 1FGOA 1JB2A 3GZXB 1TP6A 3EX9A 3EN8A 1R4CA 4WYKB 1WTHA 4HM6B 1NU3A 1N5HA 2GEYA 5CLKA 2XRXB 5KP3A 2OTJ3 2E2TA 3GZRA 1D6YA 2CG0A 3FKAA 1VQK3 2WO0A 2ML6A 2CHCA 3O8YA 2W04A 4NREA 4LZIA 2W56B 4L7KA 4IPBA 3U97A 2OOVA 3I553 4RZMA 2IUJA 4N6V0 3KIIA 1QMAA 1OF5A 1E3VA 3T0UA 3FGYA 2V1LA 4N6UA 4RNYA 3I0YA 1VQ83 5EEOA 2FGTA 3NM2A 1E97A 2IA7A 5IG0A 1W6CA 5IERA 1SJWA 2BO9B 1A2KA 4L8OA 5AEUB 5AYSC 1CQSA 3WOEB 1VQ63 4RBNA 2BMRB 3KZTA 3NBRA 1BUQA 4WWUC 5BXQA 4HYZA 3FG4A 3N54B 1IQYA 2YFLB 1FGQA 3KSPA 4R9KA 1US1A 4XBYA 2WGQA 3CCL3 3NXJA 4EXRA 4N6TA 2GXFA 5LC7A 5DRVA 3OXAA 3OW22 1GS3A 1VQM3 1FGRA 2CFKA 3D9RA 3JUPA 5D82A 4PEJA 3SEDA 2UX0A 5IENA 5JPUA 1EA2A 3GRDA 4R9LA 3RGRA 1O7WB 3ALAA 4FMAA 1A67A 3OX9A 2OOVC 3F9SA 2D1WA 4H61A 3CMA3 3NX0A 5JPPA 1QALA 2F86B 1W2B2 1RRHA 3CCE3 1YGEA 1IT8A 3NM7A 2OWPA 3HZPA 2QEX3 1KD14 3J7Yd 1M1XB 1NB3I 1JKGA 4FMBA 4O8SA 4R4KA 1IK3A 3S28A 3OWYA 3AMOB 4CDLA 1OHPA 4WFOA 3N8BA 2CFDA 2W0QA 1DVCA 3F40A 1Q42A 1UW1A 2HMOB 3PXMA 4HBRA 4FMDA 1IU7A 3FF0A 2K54A 3G713 4FMCA 3X42A 2KCDA 3HI7A 4IT7A 3LTAA 5D81A 3LYGA 1TFKA 1UUWB 3X41A 1W6YA 3D3LA 3EN1B 1OGZA 3G8ZA 3UB1A 2K0MA 5AI1A 3BNDA 1DMNA 1JB5A 1SIHA 3OWSA 3A76A 5CF1A 2L4VA 5DREA 1WNHA 5D83A 2RSXA 2W9QA 1GD3A 3EJVA 3K0ZA 3CCJ3 2CH9A 1M1K4 2CFLA 1N9EA 1K41A 1W00A 2E2UA 2JQ5A 5IF6A 8CHOA 4ZM8A 1IQXA 5STDA 1RKYA 3DGLA 1OUNA 3HIIA 3SVAA 3DMCA 3NV0A 2C11A 2JDIH 3LTCA 3V99A 2HMLB 2QA43 3FF2A 3MG1A 2BNGA 1FUWA 1DMQA 3LTDA 3RDEA 6STDA 1JNQA 4LMIA 4O3VA 1PFPA 1L5GB 2W6JH 3F7SA 1K8A4 2XSHB 4J8TA 3CC43 3WDGB 3DGNA 3DZLA 1GY6A 1UI7A 3FZWA 4J9AA 2W56A 4K61A 2B1XB 2YX9A 3JUQA 3MG3A 4JF8A 1YJ93 3KE7A 1ROAA 2PNCA 2GBXB 1K9M4 4MMZB 3EE1A 3LT8A 1VQP3 3DXOA 4N3VA 3LTBA 4K90B 3G6E3 3X3XA 3N9HA 1NDOB 5HGRA 3STDA 2CG1A 2XGNA 3EB8A 4G1MB 4HZBB 5CF2A 2CWTA 5IG5A 1K28A 1E3RA 2Z7AA 3SOYA 2XFTA 3FLJA 2WOFA 1RN7A 4I4KA 1Q814 1ULJB 1DMMA 3SLUA 2QGUA 3B4OA 3DGMA 4CCVA 1QJGA 4HKVB 3JUMA 2P38A 4QWTA 3BB9A 5I97A 3EBTA 3CPW2 4RNZA 2CKFB 3LT9A 4STDA 3UNLA 3MHEA 3MG2A 1YIJ3 3K9MC 3LXUX 1SQWA 3F14A 2P0XA 2KRTA 2BMQB 1STDA 3SOAA 1MNLA 3OWUA 1V74A 1TFOA 1GYBA 1JRQA 2A15A 2XFSA 3CPOA 1ISKA 1AV4A 3CCM3 2STDA 2WGOA 3UL6A 3MKIA 3B8LA 1DVDA 3EBYA 4KFDA 4OVMA 1N5PA 3GZBA 3Q2PA 4HZ9B 4O02B 3WODG 1M9GA 2D42A 2INXA 3AMOA 2Z6BA 3IJEB 4KVHA 3CCU3 3VGNA 5IEPA 1ASKA 1O7NB 1W7CA 1JN5B 3L0RA 4NHFA 4XDVA 2O9UX 4AKZA 2P0MA 4AKYA 4MMXB 1A90A 3I563 2P09A 1AVLA 2B24B 2F98A 1T5YA 3CCV3 1QAKA 4N6LA 2P05A 4FR9A 5IG3A 4XM4A 1MOLA 4GL6A 1LNHA 1TU5A 3GWRA 1G96A 2HMMB 1N8R4 4TX4A 1J2BA 2XR8B 3CU3A 1W4NA 1JB4A 3PCSA 2FNQA 5JBSA 2W9PA 3X3ZA 1OH0A 4GB5A 1C7HA 1O7MB 3TDGA 2Y73A 3H51A 3V92A 4K1UA 3GAXA 2Y74A 4XBTA 3V98A 4K1VA 3LH4A 1KQS2 5EVHA 1W6GA 1GD4A 3EF8A 3K63A 1UI8A 5FW5A 5AEWB 1JV2B 3EC9A 3FG3A 3MYTA 1IVUA 4HVNA 3S29A 3G0KA 2ZL8A 1N8QA 1OHOA 3HIGA 3IMAB 3S27A 3CNXA 4N6NB 4MJDA 3WOFB 1RJOA 1VQ93 5AYRB 2XSOB 2FXTA 3NQYA 2OQEA 2CWUA 3DY5A 4BTYA 2RGQA 2WOHA 1KWIA 3M8CA 4EV2A 3UJMA 4EYCA 2CIUA 3BNEA 3FG1A 2I9WA 4EBGA 2OTL3 1Q40A 1YHQ3 5CXOA 4N6OB 1VZZA 1NWWA 3DGOA 4L8PA 2R4IA 5EQLA 1QAFA 1S5AA 2SBLA 1FA3A 1Q40B 2MF7A 2CWVA 1KSIA 1WQLB 1IVWA 4HM8B 4HM4B 1QVG2 1YIT3 1ZO2A 1CYVA 3PZWA 3LOYA 1GY5A 4MMYB 5AIIA 3KKGA 2F99A 2XH9A 1F8NA 3FCSB 3PGBA 2BMOB 2HMJB 3F8XA 2ML5A 1CEWI 1ZX2A 3QK9A 2GEXA 1NJI4 3FH1A 3RGAA 2CC3A 3G4S3 4HM5B 3T8NA 3CNMA 3PYJA 1W02A 1LXEA 3PCRA 3CD63 5AIFA 3EHCA 4R1KA 3BNBA 4X2OA 4XB5A 1IV7A 3KN4A 1IT7A 5ELJA 3UL5A 1Z1SA 3IPTA 3JUOA 1D6ZA 2CW9A 1OPYA 1NO3A 1A2VA 1Q824 4H3UA 1SIIA 1RRLA 1YJW3 3NQZA 2OQEC 3SX1A 4BTWA 1UUVB 2CFWA 3KFQC 2RFRA 1VQ73 5KP4A 4Q53A 1W2ZA 5AIHA 1OF5B 4LEHA 3Q90A 1YJN3 3HK4A 1JJ22 1VQL3 3OV4A 1IVXA 1HKXA 5FGOA 2XGLA 3T8UA 3X40A 3BNCA 1WMNA 1D6UA 1IQ8A 1W5ZA 4FCJA 2IUKA 3K7CA 2YFJB 3CCR3 3F7XA 4HM1B 3KSED 2LQVA 3VF1A 3ER7A 1LOXA 4X2HA 3NBBA 4XBXA 3S5CA 1W01A 1YI23 3X3YA 2GU3A 1AR0A 3ROBA 2HMNB 2OCTA 1OGXA 3HX8A 2W03A 2BT3A 3E99A 1JN5A 1DYUA 4N6MA 1VQO3 1WMPA 4KZ1A 2GBWB 3GZYB 5ELUA 4O2HA 1IVVA 5A0OB 1EKMA 1EG9B 5LC6A 1S723 1OACA 2M7OA 3MSOA 1AVKA 2RCDA 1CYUA 3DUKA 3U1WA 2O3OA 2CK3H 3F8HA 3JVCA 3QRDA 1OCVA 4LSOA 3SXXA 3JUNA 3S67A 4IIAA 3PS8A 4LGQA 3K5TA 4HM7B 2ZDJA 3CCS3 1TUHA 1SPUA 3NBJA 3CC73 4XDWA 3WMDA 4EV5A 1IDPA 5AIGA 2YFIB 1OHSA 2PZVA 1STFI 5IG4A 1JKGB 1N9JA 1M904 3ECFA 2HMKB 2BHMA 1HU9A 3LZAA 1Q7Y4 1O7HB 5IW9A 4EC6A 3MPHA 1QVF2 7STDA 3NUVA 2Z76A 4OK0A 1WMOA 2XF3A 2E2VA 5IEOA 2Q07A 2KXGA 4FCMA 1U5OA 1K734 4AEQA 2XEPA 1U8CB 4KFEA 3Q1CA 5CK6A 1GY7A 3CC23 4KFFA 3H3HA 4HM2B 3DM8A 1Q864 3WA2X 2C10A 4BTXA 3CXC2 1YVBI 1VQ43 3G16A 1PU4A 1O7GB 2IMJA 1ULIB 1TIJA 4FCZA 4WHAA 5TGNA 3BLZA 4WP5A 1IV9A 1KC84 1ROVA 2W2CA 4R80A 3WA3A 4OUQA 2QIYA 3FSDA 3MWZA 5G2GA 4HM3B 3VSYA 5KP1A 2GU1A 2LYXA 4HM0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7C A;  1O7P B;  4HJL B;  4U13 A;  3EQQ B;  5BVB A;  2Z77 A;  3NV0 B;  4ORL A;  3B4P A;  4WYK A;  3NHX A;  1JB2 A;  3GZX B;  1TP6 A;  3EX9 A;  3EN8 A;  4WYK B;  4HM6 B;  1NU3 A;  2GEY A;  5CLK A;  2XRX B;  5KP3 A;  3GZR A;  3FKA A;  2CHC A;  4L7K A;  4RZM A;  1QMA A;  1OF5 A;  1E3V A;  3FGY A;  3I0Y A;  3NM2 A;  1E97 A;  5IG0 A;  5IER A;  1SJW A;  1A2K A;  4L8O A;  5AEU B;  1CQS A;  2BMR B;  3KZT A;  3NBR A;  1BUQ A;  4WWU C;  5BXQ A;  2YFL B;  3KSP A;  4R9K A;  4XBY A;  3NXJ A;  2GXF A;  5DRV A;  3OXA A;  1GS3 A;  3D9R A;  3JUP A;  5D82 A;  4PEJ A;  3SED A;  2UX0 A;  5IEN A;  5JPU A;  1EA2 A;  3GRD A;  4R9L A;  3RGR A;  1O7W B;  3OX9 A;  3F9S A;  5JPP A;  2F86 B;  2OWP A;  3HZP A;  1JKG A;  3OWY A;  4CDL A;  1OHP A;  3F40 A;  1Q42 A;  2HMO B;  3FF0 A;  2K54 A;  5D81 A;  3LYG A;  1UUW B;  1W6Y A;  3EN1 B;  1OGZ A;  3G8Z A;  5AI1 A;  1DMN A;  1JB5 A;  3OWS A;  3A76 A;  5CF1 A;  5DRE A;  5D83 A;  3EJV A;  3K0Z A;  1K41 A;  1W00 A;  2JQ5 A;  5IF6 A;  8CHO A;  5STD A;  1OUN A;  3DMC A;  3NV0 A;  2HML B;  3FF2 A;  3MG1 A;  2BNG A;  1DMQ A;  6STD A;  4LMI A;  3F7S A;  2XSH B;  4J8T A;  3DZL A;  1GY6 A;  3FZW A;  4J9A A;  2B1X B;  3JUQ A;  3MG3 A;  3KE7 A;  2GBX B;  3DXO A;  4N3V A;  1NDO B;  5HGR A;  3STD A;  4HZB B;  5CF2 A;  5IG5 A;  1E3R A;  2Z7A A;  3SOY A;  3FLJ A;  4I4K A;  1ULJ B;  1DMM A;  2QGU A;  3B4O A;  1QJG A;  4HKV B;  3JUM A;  3BB9 A;  3EBT A;  2CKF B;  4STD A;  3UNL A;  3MHE A;  3MG2 A;  3F14 A;  2BMQ B;  1STD A;  3SOA A;  3OWU A;  1GYB A;  2A15 A;  3CPO A;  1ISK A;  2STD A;  3MKI A;  3B8L A;  3EBY A;  4OVM A;  3GZB A;  4HZ9 B;  2INX A;  4KVH A;  3VGN A;  5IEP A;  1ASK A;  1O7N B;  1JN5 B;  4XDV A;  2B24 B;  2F98 A;  5IG3 A;  4XM4 A;  3GWR A;  2HMM B;  2XR8 B;  3CU3 A;  1JB4 A;  1OH0 A;  4GB5 A;  1C7H A;  1O7M B;  3H51 A;  4K1U A;  4XBT A;  4K1V A;  5EVH A;  3EF8 A;  5FW5 A;  5AEW B;  3EC9 A;  3MYT A;  4HVN A;  3G0K A;  1OHO A;  3CNX A;  4MJD A;  2XSO B;  2RGQ A;  3M8C A;  3UJM A;  2I9W A;  1Q40 A;  5CXO A;  1VZZ A;  1NWW A;  4L8P A;  2R4I A;  1S5A A;  1Q40 B;  1WQL B;  4HM8 B;  4HM4 B;  1ZO2 A;  1GY5 A;  5AII A;  3KKG A;  2F99 A;  2BMO B;  2HMJ B;  3F8X A;  1ZX2 A;  2GEX A;  3RGA A;  3FH1 A;  4HM5 B;  3T8N A;  3CNM A;  1W02 A;  5AIF A;  3EHC A;  4X2O A;  4R1K A;  4XB5 A;  1Z1S A;  3IPT A;  3JUO A;  1OPY A;  4H3U A;  1UUV B;  2RFR A;  5KP4 A;  4Q53 A;  5AIH A;  1OF5 B;  4LEH A;  3Q90 A;  3HK4 A;  3OV4 A;  3T8U A;  1HKX A;  4FCJ A;  3K7C A;  2YFJ B;  3F7X A;  4HM1 B;  3ER7 A;  4X2H A;  3S5C A;  4XBX A;  1W01 A;  1AR0 A;  3ROB A;  2HMN B;  1OGX A;  3HX8 A;  3E99 A;  1JN5 A;  2GBW B;  3GZY B;  1EG9 B;  3MSO A;  2RCD A;  3DUK A;  3F8H A;  1OCV A;  3JUN A;  4IIA A;  4LGQ A;  4HM7 B;  1TUH A;  4XDW A;  3WMD A;  1IDP A;  5AIG A;  2YFI B;  1OHS A;  2PZV A;  5IG4 A;  1JKG B;  3ECF A;  2HMK B;  3LZA A;  1O7H B;  7STD A;  3NUV A;  2Z76 A;  5IEO A;  4FCM A;  1U5O A;  5CK6 A;  1GY7 A;  3H3H A;  4HM2 B;  3DM8 A;  3G16 A;  1O7G B;  2IMJ A;  1ULI B;  5TGN A;  3BLZ A;  4WP5 A;  2W2C A;  4OUQ A;  2QIY A;  3FSD A;  5G2G A;  4HM3 B;  3VSY A;  5KP1 A;  4HM0 B; 
#chains in the Genus database with same CATH topology
 4MEI A;  1NB5 I;  1FGT A;  3CCQ 3;  1Y4K A;  3B7C A;  1O7P B;  2CFG A;  1VQN 3;  4HJL B;  4U13 A;  3EQQ B;  2MC8 A;  1LVN A;  3LML A;  1RGG A;  1A2P A;  1R4Y A;  3CME 3;  5BVB A;  4JRF A;  3BU4 A;  2Z77 A;  1FGM A;  3NV0 B;  4ORL A;  1HYF A;  3B4P A;  1VQ5 3;  4WYK A;  3NHX A;  2RBI A;  1EQK A;  1FGO A;  1JB2 A;  3GZX B;  1TP6 A;  3EX9 A;  1BNR A;  1GOU A;  3EN8 A;  1R4C A;  4WYK B;  1WTH A;  4HM6 B;  1NU3 A;  3CCU 3;  1N5H A;  2GEY A;  5CLK A;  1UGH I;  3URP A;  2XRX B;  5KP3 A;  2OTJ 3;  2E2T A;  3GZR A;  1D6Y A;  2CG0 A;  3FKA A;  5M19 A;  1VQK 3;  2WO0 A;  2ML6 A;  2CHC A;  3O8Y A;  2W04 A;  1C54 A;  4NRE A;  4LZI A;  2AAE A;  2W56 B;  1V58 A;  4IPB A;  4L7K A;  3U97 A;  2OOV A;  3I55 3;  2CX0 A;  2KF5 A;  4RZM A;  2IUJ A;  4N6V 0;  3KII A;  1QMA A;  1OF5 A;  1E3V A;  3T0U A;  3FGY A;  2V1L A;  1Q9E A;  5RNT A;  2ZA4 A;  4N6U A;  4RNY A;  1PY3 A;  1I2G A;  3I0Y A;  1VQ8 3;  5EEO A;  2FGT A;  3NM2 A;  1B21 A;  1RCK A;  1G02 A;  1E97 A;  2IA7 A;  5IG0 A;  1W6C A;  4I5Q A;  5IER A;  1SJW A;  2BO9 B;  1A2K A;  4L8O A;  5AEU B;  5AYS C;  1CQS A;  3WOE B;  1VQ6 3;  4RBN A;  2BMR B;  3KZT A;  3NBR A;  1BUQ A;  2BIR A;  1RGF A;  4WWU C;  5BXQ A;  4HYZ A;  3FG4 A;  3N54 B;  1IQY A;  2YFL B;  5M18 A;  1FGQ A;  3KSP A;  4R9K A;  1T2H A;  1US1 A;  4XBY A;  2WGQ A;  1RGK A;  3CCL 3;  3NXJ A;  4EXR A;  4N6T A;  2GXF A;  1X1W A;  5LC7 A;  5DRV A;  3OXA A;  1UCK A;  1BNE A;  1GMR A;  3OW2 2;  1GS3 A;  1VQM 3;  1FGR A;  2CFK A;  3D9R A;  3JUP A;  5D82 A;  4PEJ A;  3SED A;  2UX0 A;  5IEN A;  5JPU A;  1RHL A;  1EA2 A;  3GRD A;  4R9L A;  3RGR A;  1O7W B;  3ALA A;  3WHO A;  4FMA A;  1A67 A;  3OX9 A;  2F56 A;  2OOV C;  3F9S A;  2D1W A;  4H61 A;  2CX1 A;  3CMA 3;  3NX0 A;  5JPP A;  1QAL A;  2F86 B;  1W2B 2;  1RRH A;  3CCE 3;  1YGE A;  1IT8 A;  3NM7 A;  2OWP A;  3HZP A;  2QEX 3;  1MWR A;  1KD1 4;  3J7Y d;  1M1X B;  1NB3 I;  1JKG A;  4RNT A;  4FMB A;  4O8S A;  1MWU A;  4R4K A;  1IK3 A;  3S28 A;  3OWY A;  3AMO B;  4CDL A;  1RGE A;  1BUJ A;  1OHP A;  4WFO A;  3N8B A;  2CFD A;  2W0Q A;  1JBS A;  1DVC A;  2ZHX B;  1Q42 A;  3F40 A;  1UW1 A;  1YNV X;  2HMO B;  3PXM A;  4HBR A;  1TJD A;  1LQM B;  4FMD A;  1IU7 A;  3FF0 A;  2K54 A;  3G71 3;  4FMC A;  1TRQ A;  3X42 A;  2KCD A;  1YVS A;  3HI7 A;  4IT7 A;  3LTA A;  5D81 A;  1BAN A;  3LYG A;  1TFK A;  1UUW B;  3X41 A;  1W6Y A;  3D3L A;  3EN1 B;  1OGZ A;  3G8Z A;  3UB1 A;  2K0M A;  5AI1 A;  1UUG B;  1BNI A;  3BND A;  1BNJ A;  1DMN A;  1GOY A;  1JB5 A;  1SIH A;  3OWS A;  1JBT A;  2K3D A;  3A76 A;  5CF1 A;  2L4V A;  3Q3F A;  1WNH A;  5DRE A;  1B2M A;  5D83 A;  1BU4 A;  4HOH A;  2RSX A;  2W9Q A;  1GD3 A;  3EJV A;  3K0Z A;  3CCJ 3;  2CH9 A;  1M1K 4;  2CFL A;  1N9E A;  1K41 A;  1W00 A;  2E2U A;  2JQ5 A;  1Q7H A;  5IF6 A;  8CHO A;  4ZM8 A;  1IQX A;  5STD A;  1RKY A;  1RLS A;  3DGL A;  1OUN A;  3HII A;  3SVA A;  1BRK A;  3DMC A;  1MWS A;  3NV0 A;  4GSP A;  2C11 A;  2JDI H;  1UCI A;  3LTC A;  3V99 A;  2HML B;  3RNT A;  2QA4 3;  3FF2 A;  3MG1 A;  2BNG A;  2J8X B;  1FUW A;  1DMQ A;  3LTD A;  3RDE A;  6STD A;  1JNQ A;  4LMI A;  4O3V A;  1PFP A;  4ILF A;  1L5G B;  2W6J H;  3F7S A;  1K8A 4;  2XSH B;  4J8T A;  1JZD A;  3CC4 3;  3WDG B;  4BL3 A;  1BNS A;  3DGN A;  3DZL A;  3AHW A;  3SYU A;  1BSA A;  1RDS A;  3AHS A;  4HAA A;  1GY6 A;  4EW5 A;  1UI7 A;  1TRP A;  3FZW A;  4J9A A;  2W56 A;  1RNT A;  4K61 A;  2B1X B;  2YX9 A;  3JUQ A;  2H0G A;  3MG3 A;  4JF8 A;  1YJ9 3;  1RN4 A;  1ROA A;  2PNC A;  2GBX B;  3KE7 A;  1K9M 4;  4MMZ B;  3EE1 A;  3LT8 A;  1VQP 3;  3DXO A;  4N3V A;  1LOY A;  3LTB A;  4K90 B;  1FUS A;  3X3X A;  3G6E 3;  3N9H A;  1LRA A;  1NDO B;  5HGR A;  3STD A;  1FW7 A;  2CG1 A;  2XGN A;  3EB8 A;  4G1M B;  4HZB B;  2GSP A;  1B20 A;  5CF2 A;  9RNT A;  2CWT A;  5IG5 A;  1K28 A;  1E3R A;  2Z7A A;  3SOY A;  2SAR A;  2XFT A;  1BVI A;  3FLJ A;  2WOF A;  1RN7 A;  4I4K A;  1Q81 4;  1ULJ B;  2F5W A;  2C4B A;  1MWT A;  5G1L A;  2KF4 A;  1DMM A;  3SLU A;  2QGU A;  1B2X A;  3B4O A;  3DGM A;  3DH2 A;  4CCV A;  1QJG A;  1PYL A;  4HKV B;  2R41 A;  1VQQ A;  1RMS A;  3JUM A;  2P38 A;  1ZS7 A;  1FYS A;  3BB9 A;  4QWT A;  3EBT A;  5I97 A;  3CPW 2;  1BRS A;  4RNZ A;  1HZ1 A;  2CKF B;  3DGY A;  3LT9 A;  4STD A;  4DKI A;  1ZGX A;  3UNL A;  1BSE A;  3MHE A;  3MG2 A;  1YIJ 3;  2L1S A;  3K9M C;  3LXU X;  1SQW A;  3F14 A;  2P0X A;  7GSP A;  1BSD A;  2BMQ B;  2KRT A;  1STD A;  3SOA A;  1MNL A;  3OWU A;  1V74 A;  1TFO A;  1GYB A;  1JRQ A;  2A15 A;  2XFS A;  3CPO A;  4J5K A;  1ISK A;  1AV4 A;  3CCM 3;  2STD A;  2UUG C;  2WGO A;  3UL6 A;  3KCH A;  3MKI A;  6RNT A;  3B8L A;  1DVD A;  3EBY A;  4KFD A;  1RGL A;  4OVM A;  1N5P A;  3GZB A;  3Q2P A;  4HZ9 B;  4O02 B;  3HOH A;  3WOD G;  1M9G A;  1T2I A;  2D42 A;  2INX A;  3AMO A;  2Z6B A;  3IJE B;  4KVH A;  4NPB A;  3VGN A;  5IEP A;  1ASK A;  1O7N B;  1X1Y A;  1W7C A;  2HOH A;  1JN5 B;  3L0R A;  4GHO A;  1UCJ A;  4NHF A;  2O9U X;  4XDV A;  4AKZ A;  2GU1 A;  2P0M A;  1EUI C;  1V57 A;  4AKY A;  4MMX B;  1A90 A;  3I56 3;  2P09 A;  1AVL A;  2B24 B;  2F98 A;  1T5Y A;  3CCV 3;  1QAK A;  4BIR A;  1NNV A;  4N6L A;  1RGH A;  2P05 A;  4FR9 A;  5IG3 A;  2UGI A;  3WR2 A;  4XM4 A;  1MOL A;  3BIR A;  4GL6 A;  1LNH A;  1GMP A;  1TU5 A;  5G1K A;  3GWR A;  1G96 A;  1EEJ A;  2HMM B;  1B2S A;  1N8R 4;  4TX4 A;  1J2B A;  2XR8 B;  3A5E A;  3CU3 A;  1CH0 A;  1G0T A;  1W4N A;  1JB4 A;  3PCS A;  2FNQ A;  5JBS A;  2W9P A;  3X3Z A;  1OH0 A;  4GB5 A;  1C7H A;  1O7M B;  3TDG A;  2Y73 A;  3H51 A;  3V92 A;  3D5I A;  4K1U A;  5BU4 A;  1BOX A;  3GAX A;  1UGI A;  2Y74 A;  4XBT A;  3V98 A;  1BNG A;  4K1V A;  3LH4 A;  1BSC A;  5EVH A;  1KQS 2;  1W6G A;  1GD4 A;  3EF8 A;  1B2U A;  1BRN L;  3K63 A;  1UI8 A;  5FW5 A;  2F4Y A;  5AEW B;  1JV2 B;  3EC9 A;  1B27 A;  3FG3 A;  3MYT A;  1IVU A;  1GOV A;  4HVN A;  3G0K A;  3S29 A;  2ZL8 A;  1N8Q A;  1OHO A;  3HIG A;  3IMA B;  3S27 A;  3CNX A;  4N6N B;  1GSP A;  4MJD A;  1I0V A;  1RJO A;  3WOF B;  1VQ9 3;  5AYR B;  2XSO B;  1FUT A;  1RGA A;  2FXT A;  3NQY A;  2OQE A;  2CWU A;  3DY5 A;  4BTY A;  2RGQ A;  2WOH A;  1KWI A;  3M8C A;  4EV2 A;  3UJM A;  4EYC A;  1GMQ A;  2CIU A;  3BNE A;  1B2Z A;  3FG1 A;  2I9W A;  4EBG A;  2OTL 3;  1Q40 A;  2H0H A;  1YHQ 3;  5CXO A;  4CJN A;  4N6O B;  1VZZ A;  1NWW A;  3DGO A;  2BU4 A;  4L8P A;  2R4I A;  5EQL A;  1QAF A;  1S5A A;  2SBL A;  1FA3 A;  1Q40 B;  2MF7 A;  2CWV A;  1KSI A;  1WQL B;  1IVW A;  1IYY A;  4HM8 B;  4HM4 B;  1QVG 2;  1YIT 3;  1ZO2 A;  1CYV A;  3PZW A;  8RNT A;  3LOY A;  1GY5 A;  2H0I A;  1RTU A;  3AGN A;  4MMY B;  5AII A;  3KKG A;  1X1U A;  2F99 A;  2XH9 A;  1F8N A;  3FCS B;  3PGB A;  2BMO B;  1BNF A;  2HMJ B;  1AQZ A;  3F8X A;  2ML5 A;  1CEW I;  1ZX2 A;  3QK9 A;  5M1A A;  2GEX A;  1NJI 4;  3FH1 A;  3RGA A;  2CC3 A;  3G4S 3;  4HM5 B;  3T8N A;  3CNM A;  3PYJ A;  1W02 A;  1LXE A;  1MGR A;  3PCR A;  3CD6 3;  5AIF A;  3EHC A;  1DET A;  4R1K A;  3BNB A;  4X2O A;  4XB5 A;  1IV7 A;  3KN4 A;  1IT7 A;  5ELJ A;  3UL5 A;  2KAA A;  1BIR A;  1Z1S A;  3IPT A;  3JUO A;  1D6Z A;  1UDI I;  2CW9 A;  1OPY A;  1NO3 A;  1A2V A;  1Q82 4;  1AY7 A;  1LNI A;  4H3U A;  1SII A;  1RRL A;  1YJW 3;  3NQZ A;  2OQE C;  3SX1 A;  4BTW A;  2RNT A;  1UUV B;  2CFW A;  3KFQ C;  2RFR A;  1VQ7 3;  3GSP A;  1I70 A;  4Q53 A;  1W2Z A;  5KP4 A;  2KF3 A;  5AIH A;  1OF5 B;  4LEH A;  3Q90 A;  1YJN 3;  4BL2 A;  3HK4 A;  1JJ2 2;  1VQL 3;  1BSB A;  1I0X A;  1RCL A;  3OV4 A;  1IVX A;  1HKX A;  5FGO A;  2XGL A;  3T8U A;  3X40 A;  3BNC A;  1WMN A;  1JBR A;  1D6U A;  1W5Z A;  4FCJ A;  4LYL B;  2IUK A;  3K7C A;  3D4A A;  1T3B A;  1BAO A;  2YFJ B;  1LQG C;  3CCR 3;  1I3I A;  3F7X A;  4HM1 B;  3KSE D;  2LQV A;  3VF1 A;  3ER7 A;  1UCL A;  1LOX A;  1DE3 A;  4X2H A;  3NBB A;  4XBX A;  1I3F A;  1W01 A;  3S5C A;  1YI2 3;  1BRH A;  3X3Y A;  2GU3 A;  1AR0 A;  3ROB A;  2KF6 A;  2AAD A;  2HMN B;  2OCT A;  1OGX A;  3HX8 A;  1BRG A;  2W03 A;  2BT3 A;  3E99 A;  1JN5 A;  1DYU A;  4N6M A;  1VQO 3;  5GSP A;  1WMP A;  4KZ1 A;  5HOH A;  2GBW B;  3GZY B;  5ELU A;  4O2H A;  1IVV A;  5A0O B;  1BGS A;  1EG9 B;  1EKM A;  5LC6 A;  1S72 3;  1I8V A;  1OAC A;  1RNB A;  2M7O A;  3MSO A;  1AVK A;  2RCD A;  1CYU A;  1YGW A;  1X1X A;  3DUK A;  3U1W A;  2O3O A;  1JZO A;  2CK3 H;  3F8H A;  3JVC A;  6GSP A;  3QRD A;  1OCV A;  1BRJ A;  4LSO A;  3JUN A;  3SXX A;  3S67 A;  4IIA A;  3PS8 A;  4KT3 B;  4LGQ A;  3K5T A;  3ZG5 A;  4HM7 B;  2ZDJ A;  3CCS 3;  1TUH A;  1SPU A;  3NBJ A;  3CC7 3;  4J5G A;  4XDW A;  3WMD A;  4EV5 A;  1IDP A;  5AIG A;  2YFI B;  2IY2 A;  3ZFZ A;  1OHS A;  2PZV A;  1STF I;  5IG4 A;  1JKG B;  7RNT A;  1N9J A;  1M90 4;  3ECF A;  1RN1 A;  2BHM A;  1HU9 A;  1RSN A;  2HMK B;  3LZA A;  1O7H B;  4CPK A;  1Q7Y 4;  5IW9 A;  4EC6 A;  3MPH A;  1QVF 2;  7STD A;  3NUV A;  1B3S A;  1LOV A;  2Z76 A;  1I2E A;  1WMO A;  2XF3 A;  4OK0 A;  2E2V A;  5IEO A;  1RGC A;  2Q07 A;  2KXG A;  2F5M A;  4FCM A;  1U5O A;  1K73 4;  4AEQ A;  1I2F A;  2XEP A;  1U8C B;  1LOW A;  1SAR A;  3Q1C A;  4KFE A;  5CK6 A;  1GY7 A;  1TTO A;  3CC2 3;  4KFF A;  3H3H A;  1MGW A;  2IYJ A;  1FZU A;  4HM2 B;  1BRI A;  3DM8 A;  1Q86 4;  3WA2 X;  2C10 A;  4BTX A;  3CXC 2;  3ZG0 A;  1YVB I;  1VQ4 3;  3G16 A;  1PU4 A;  1O7G B;  3AGO A;  5BIR A;  2IMJ A;  1ULI B;  1TIJ A;  4FCZ A;  4WHA A;  5TGN A;  3BLZ A;  4WP5 A;  1IV9 A;  1KC8 4;  1ROV A;  2W2C A;  3D5G A;  4R80 A;  4BU4 A;  3WA3 A;  4OUQ A;  2QIY A;  3FSD A;  3MWZ A;  5G2G A;  3D79 A;  4HM3 B;  3VSY A;  5KP1 A;  1IQ8 A;  2LYX A;  4HM0 B; 
#chains in the Genus database with same CATH homology
 4MEI A;  1NB5 I;  1FGT A;  3CCQ 3;  1Y4K A;  3B7C A;  1O7P B;  2CFG A;  1VQN 3;  4HJL B;  4U13 A;  3EQQ B;  2MC8 A;  1LVN A;  3LML A;  3CME 3;  5BVB A;  4JRF A;  2Z77 A;  1FGM A;  3NV0 B;  4ORL A;  3B4P A;  1VQ5 3;  4WYK A;  3NHX A;  1EQK A;  1FGO A;  1JB2 A;  3GZX B;  1TP6 A;  3EX9 A;  3EN8 A;  1R4C A;  4WYK B;  1WTH A;  4HM6 B;  1NU3 A;  1N5H A;  2GEY A;  5CLK A;  2XRX B;  5KP3 A;  2OTJ 3;  2E2T A;  3GZR A;  1D6Y A;  2CG0 A;  3FKA A;  1VQK 3;  2WO0 A;  2ML6 A;  2CHC A;  3O8Y A;  2W04 A;  4NRE A;  4LZI A;  2W56 B;  4L7K A;  4IPB A;  3U97 A;  2OOV A;  3I55 3;  4RZM A;  2IUJ A;  4N6V 0;  3KII A;  1QMA A;  1OF5 A;  1E3V A;  3T0U A;  3FGY A;  2V1L A;  4N6U A;  4RNY A;  3I0Y A;  1VQ8 3;  5EEO A;  2FGT A;  3NM2 A;  1E97 A;  2IA7 A;  5IG0 A;  1W6C A;  5IER A;  1SJW A;  2BO9 B;  1A2K A;  4L8O A;  5AEU B;  5AYS C;  1CQS A;  3WOE B;  1VQ6 3;  4RBN A;  2BMR B;  3KZT A;  3NBR A;  1BUQ A;  4WWU C;  5BXQ A;  4HYZ A;  3FG4 A;  3N54 B;  1IQY A;  2YFL B;  1FGQ A;  3KSP A;  4R9K A;  1US1 A;  4XBY A;  2WGQ A;  3CCL 3;  3NXJ A;  4EXR A;  4N6T A;  2GXF A;  5LC7 A;  5DRV A;  3OXA A;  3OW2 2;  1GS3 A;  1VQM 3;  1FGR A;  2CFK A;  3D9R A;  3JUP A;  5D82 A;  4PEJ A;  3SED A;  2UX0 A;  5IEN A;  5JPU A;  1EA2 A;  3GRD A;  4R9L A;  3RGR A;  1O7W B;  3ALA A;  4FMA A;  1A67 A;  3OX9 A;  2OOV C;  3F9S A;  2D1W A;  4H61 A;  3CMA 3;  3NX0 A;  5JPP A;  1QAL A;  2F86 B;  1W2B 2;  1RRH A;  3CCE 3;  1YGE A;  1IT8 A;  3NM7 A;  2OWP A;  3HZP A;  2QEX 3;  1KD1 4;  3J7Y d;  1M1X B;  1NB3 I;  1JKG A;  4FMB A;  4O8S A;  4R4K A;  1IK3 A;  3S28 A;  3OWY A;  3AMO B;  4CDL A;  1OHP A;  4WFO A;  3N8B A;  2CFD A;  2W0Q A;  1DVC A;  3F40 A;  1Q42 A;  1UW1 A;  2HMO B;  3PXM A;  4HBR A;  4FMD A;  1IU7 A;  3FF0 A;  2K54 A;  3G71 3;  4FMC A;  3X42 A;  2KCD A;  3HI7 A;  4IT7 A;  3LTA A;  5D81 A;  3LYG A;  1TFK A;  1UUW B;  3X41 A;  1W6Y A;  3D3L A;  3EN1 B;  1OGZ A;  3G8Z A;  3UB1 A;  2K0M A;  5AI1 A;  3BND A;  1DMN A;  1JB5 A;  1SIH A;  3OWS A;  3A76 A;  5CF1 A;  2L4V A;  5DRE A;  1WNH A;  5D83 A;  2RSX A;  2W9Q A;  1GD3 A;  3EJV A;  3K0Z A;  3CCJ 3;  2CH9 A;  1M1K 4;  2CFL A;  1N9E A;  1K41 A;  1W00 A;  2E2U A;  2JQ5 A;  5IF6 A;  8CHO A;  4ZM8 A;  1IQX A;  5STD A;  1RKY A;  3DGL A;  1OUN A;  3HII A;  3SVA A;  3DMC A;  3NV0 A;  2C11 A;  2JDI H;  3LTC A;  3V99 A;  2HML B;  2QA4 3;  3FF2 A;  3MG1 A;  2BNG A;  1FUW A;  1DMQ A;  3LTD A;  3RDE A;  6STD A;  1JNQ A;  4LMI A;  4O3V A;  1PFP A;  1L5G B;  2W6J H;  3F7S A;  1K8A 4;  2XSH B;  4J8T A;  3CC4 3;  3WDG B;  3DGN A;  3DZL A;  1GY6 A;  1UI7 A;  3FZW A;  4J9A A;  2W56 A;  4K61 A;  2B1X B;  2YX9 A;  3JUQ A;  3MG3 A;  4JF8 A;  1YJ9 3;  3KE7 A;  1ROA A;  2PNC A;  2GBX B;  1K9M 4;  4MMZ B;  3EE1 A;  3LT8 A;  1VQP 3;  3DXO A;  4N3V A;  3LTB A;  4K90 B;  3G6E 3;  3X3X A;  3N9H A;  1NDO B;  5HGR A;  3STD A;  2CG1 A;  2XGN A;  3EB8 A;  4G1M B;  4HZB B;  5CF2 A;  2CWT A;  5IG5 A;  1K28 A;  1E3R A;  2Z7A A;  3SOY A;  2XFT A;  3FLJ A;  2WOF A;  1RN7 A;  4I4K A;  1Q81 4;  1ULJ B;  1DMM A;  3SLU A;  2QGU A;  3B4O A;  3DGM A;  4CCV A;  1QJG A;  4HKV B;  3JUM A;  2P38 A;  4QWT A;  3BB9 A;  5I97 A;  3EBT A;  3CPW 2;  4RNZ A;  2CKF B;  3LT9 A;  4STD A;  3UNL A;  3MHE A;  3MG2 A;  1YIJ 3;  3K9M C;  3LXU X;  1SQW A;  3F14 A;  2P0X A;  2KRT A;  2BMQ B;  1STD A;  3SOA A;  1MNL A;  3OWU A;  1V74 A;  1TFO A;  1GYB A;  1JRQ A;  2A15 A;  2XFS A;  3CPO A;  1ISK A;  1AV4 A;  3CCM 3;  2STD A;  2WGO A;  3UL6 A;  3MKI A;  3B8L A;  1DVD A;  3EBY A;  4KFD A;  4OVM A;  1N5P A;  3GZB A;  3Q2P A;  4HZ9 B;  4O02 B;  3WOD G;  1M9G A;  2D42 A;  2INX A;  3AMO A;  2Z6B A;  3IJE B;  4KVH A;  3CCU 3;  3VGN A;  5IEP A;  1ASK A;  1O7N B;  1W7C A;  1JN5 B;  3L0R A;  4NHF A;  4XDV A;  2O9U X;  4AKZ A;  2P0M A;  4AKY A;  4MMX B;  1A90 A;  3I56 3;  2P09 A;  1AVL A;  2B24 B;  2F98 A;  1T5Y A;  3CCV 3;  1QAK A;  4N6L A;  2P05 A;  4FR9 A;  5IG3 A;  4XM4 A;  1MOL A;  4GL6 A;  1LNH A;  1TU5 A;  3GWR A;  1G96 A;  2HMM B;  1N8R 4;  4TX4 A;  1J2B A;  2XR8 B;  3CU3 A;  1W4N A;  1JB4 A;  3PCS A;  2FNQ A;  5JBS A;  2W9P A;  3X3Z A;  1OH0 A;  4GB5 A;  1C7H A;  1O7M B;  3TDG A;  2Y73 A;  3H51 A;  3V92 A;  4K1U A;  3GAX A;  2Y74 A;  4XBT A;  3V98 A;  4K1V A;  3LH4 A;  1KQS 2;  5EVH A;  1W6G A;  1GD4 A;  3EF8 A;  3K63 A;  1UI8 A;  5FW5 A;  5AEW B;  1JV2 B;  3EC9 A;  3FG3 A;  3MYT A;  1IVU A;  4HVN A;  3S29 A;  3G0K A;  2ZL8 A;  1N8Q A;  1OHO A;  3HIG A;  3IMA B;  3S27 A;  3CNX A;  4N6N B;  4MJD A;  3WOF B;  1RJO A;  1VQ9 3;  5AYR B;  2XSO B;  2FXT A;  3NQY A;  2OQE A;  2CWU A;  3DY5 A;  4BTY A;  2RGQ A;  2WOH A;  1KWI A;  3M8C A;  4EV2 A;  3UJM A;  4EYC A;  2CIU A;  3BNE A;  3FG1 A;  2I9W A;  4EBG A;  2OTL 3;  1Q40 A;  1YHQ 3;  5CXO A;  4N6O B;  1VZZ A;  1NWW A;  3DGO A;  4L8P A;  2R4I A;  5EQL A;  1QAF A;  1S5A A;  2SBL A;  1FA3 A;  1Q40 B;  2MF7 A;  2CWV A;  1KSI A;  1WQL B;  1IVW A;  4HM8 B;  4HM4 B;  1QVG 2;  1YIT 3;  1ZO2 A;  1CYV A;  3PZW A;  3LOY A;  1GY5 A;  4MMY B;  5AII A;  3KKG A;  2F99 A;  2XH9 A;  1F8N A;  3FCS B;  3PGB A;  2BMO B;  2HMJ B;  3F8X A;  2ML5 A;  1CEW I;  1ZX2 A;  3QK9 A;  2GEX A;  1NJI 4;  3FH1 A;  3RGA A;  2CC3 A;  3G4S 3;  4HM5 B;  3T8N A;  3CNM A;  3PYJ A;  1W02 A;  1LXE A;  3PCR A;  3CD6 3;  5AIF A;  3EHC A;  4R1K A;  3BNB A;  4X2O A;  4XB5 A;  1IV7 A;  3KN4 A;  1IT7 A;  5ELJ A;  3UL5 A;  1Z1S A;  3IPT A;  3JUO A;  1D6Z A;  2CW9 A;  1OPY A;  1NO3 A;  1A2V A;  1Q82 4;  4H3U A;  1SII A;  1RRL A;  1YJW 3;  3NQZ A;  2OQE C;  3SX1 A;  4BTW A;  1UUV B;  2CFW A;  3KFQ C;  2RFR A;  1VQ7 3;  5KP4 A;  4Q53 A;  1W2Z A;  5AIH A;  1OF5 B;  4LEH A;  3Q90 A;  1YJN 3;  3HK4 A;  1JJ2 2;  1VQL 3;  3OV4 A;  1IVX A;  1HKX A;  5FGO A;  2XGL A;  3T8U A;  3X40 A;  3BNC A;  1WMN A;  1D6U A;  1IQ8 A;  1W5Z A;  4FCJ A;  2IUK A;  3K7C A;  2YFJ B;  3CCR 3;  3F7X A;  4HM1 B;  3KSE D;  2LQV A;  3VF1 A;  3ER7 A;  1LOX A;  4X2H A;  3NBB A;  4XBX A;  3S5C A;  1W01 A;  1YI2 3;  3X3Y A;  2GU3 A;  1AR0 A;  3ROB A;  2HMN B;  2OCT A;  1OGX A;  3HX8 A;  2W03 A;  2BT3 A;  3E99 A;  1JN5 A;  1DYU A;  4N6M A;  1VQO 3;  1WMP A;  4KZ1 A;  2GBW B;  3GZY B;  5ELU A;  4O2H A;  1IVV A;  5A0O B;  1EKM A;  1EG9 B;  5LC6 A;  1S72 3;  1OAC A;  2M7O A;  3MSO A;  1AVK A;  2RCD A;  1CYU A;  3DUK A;  3U1W A;  2O3O A;  2CK3 H;  3F8H A;  3JVC A;  3QRD A;  1OCV A;  4LSO A;  3SXX A;  3JUN A;  3S67 A;  4IIA A;  3PS8 A;  4LGQ A;  3K5T A;  4HM7 B;  2ZDJ A;  3CCS 3;  1TUH A;  1SPU A;  3NBJ A;  3CC7 3;  4XDW A;  3WMD A;  4EV5 A;  1IDP A;  5AIG A;  2YFI B;  1OHS A;  2PZV A;  1STF I;  5IG4 A;  1JKG B;  1N9J A;  1M90 4;  3ECF A;  2HMK B;  2BHM A;  1HU9 A;  3LZA A;  1Q7Y 4;  1O7H B;  5IW9 A;  4EC6 A;  3MPH A;  1QVF 2;  7STD A;  3NUV A;  2Z76 A;  4OK0 A;  1WMO A;  2XF3 A;  2E2V A;  5IEO A;  2Q07 A;  2KXG A;  4FCM A;  1U5O A;  1K73 4;  4AEQ A;  2XEP A;  1U8C B;  4KFE A;  3Q1C A;  5CK6 A;  1GY7 A;  3CC2 3;  4KFF A;  3H3H A;  4HM2 B;  3DM8 A;  1Q86 4;  3WA2 X;  2C10 A;  4BTX A;  3CXC 2;  1YVB I;  1VQ4 3;  3G16 A;  1PU4 A;  1O7G B;  2IMJ A;  1ULI B;  1TIJ A;  4FCZ A;  4WHA A;  5TGN A;  3BLZ A;  4WP5 A;  1IV9 A;  1KC8 4;  1ROV A;  2W2C A;  4R80 A;  3WA3 A;  4OUQ A;  2QIY A;  3FSD A;  3MWZ A;  5G2G A;  4HM3 B;  3VSY A;  5KP1 A;  2GU1 A;  2LYX A;  4HM0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...