3F7SA

Crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
GMSTAAESEIRQLIERWMQAVRDRDIPGIIAPYADDIVAFDAIQALQFKGKSAYTAHWEMCMGMCTGPMVFELAQLTVHAAGDLALAHWLNRCGPGDDESQCGFMRATVGYRRQGGQWQVIHEHWSAPFDMETQKALFDLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (NP_746665.1) from PSEUDOMONAS PUTIDA KT2440 at 2.11 A resolution
rcsb
source organism Pseudomonas putida kt2440
total genus 34
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f7sA00
5D81A 4WP5A 3A76A 4LGQA 2Z77A 7STDA 3KSPA 5AIHA 5KP4A 3JUNA 3S5CA 1OF5B 2STDA 1O7WB 5IERA 5CLKA 4CDLA 5CK6A 5FW5A 5D83A 3DXOA 3UNLA 1ZX2A 1EA2A 1U5OA 4L7KA 3NV0B 4H3UA 4HM5B 3OWSA 3SOAA 3B4PA 3G8ZA 2CKFB 1VZZA 3RGAA 1O7NB 1O7PB 3FF0A 3MHEA 3EC9A 3FSDA 2BMRB 1A2KA 4R9KA 1OGZA 1ULJB 3JUPA 1W6YA 3EJVA 3JUQA 3OWUA 5IG0A 3D9RA 3HZPA 3KE7A 4XM4A 2RGQA 4HM6B 4XDVA 3DUKA 1Q40A 4FCMA 1EG9B 2B1XB 5IG5A 1W02A 4XBYA 2YFIB 3GZRA 3DMCA 3EN8A 1C7HA 3F9SA 5KP3A 3BLZA 1GY5A 2B24B 2Z7AA 4WYKB 8CHOA 4HM1B 3HX8A 3GZYB 4R9LA 3NXJA 3FKAA 4K1UA 3LZAA 3UJMA 5TGNA 2OWPA 4OVMA 3CNXA 5AEWB 2QIYA 3FF2A 2XR8B 4HVNA 2QGUA 3SOYA 4ORLA 1OPYA 2R4IA 1OHSA 5BXQA 1NDOB 3NV0A 4K1VA 5JPUA 3EQQB 1ULIB 3OV4A 3ECFA 4I4KA 1Q42A 3SEDA 3FZWA 2HMKB 5JPPA 4HM7B 3JUMA 2HMLB 3E99A 5DREA 5AIIA 1DMNA 2I9WA 1GY7A 2GBWB 3MYTA 4HKVB 3BB9A 5DRVA 3I0YA 3F8XA 3H51A 4HM4B 1STDA 3OXAA 5IEPA 5IG4A 4U13A 3G0KA 4XBTA 1WQLB 3OWYA 4WWUC 3B4OA 3KKGA 3K0ZA 1E97A 2YFJB 4HJLB 3NUVA 1OCVA 3T8NA 3VSYA 3MG1A 1JN5A 1UUWB 4HM0B 4WYKA 4KVHA 5IF6A 4X2OA 4FCJA 4HM3B 2XSOB 4XB5A 4HZBB 5G2GA 1SJWA 4HM2B 2HMJB 1ASKA 3MKIA 3NM2A 3GZXB 1JKGB 1O7GB 1OH0A 2RFRA 3IPTA 3T8UA 1DMQA 5IENA 1E3VA 3Q90A 3ROBA 1ZO2A 2INXA 3FGYA 1GS3A 1TUHA 1Q40B 4OUQA 1ISKA 2HMNB 3CU3A 1IDPA 2YFLB 4J9AA 1W01A 4LMIA 4R1KA 4HZ9B 1OF5A 1Z1SA 5EVHA 5CF2A 5IEOA 3F7XA 1TP6A 2RCDA 3NBRA 1DMMA 1QJGA 3EX9A 3DM8A 1UUVB 3K7CA 3F7SA 3VGNA 1W00A 2HMMB 3GWRA 4GB5A 2F98A 3LYGA 4J8TA 4L8PA 2K54A 5CXOA 2UX0A 2PZVA 3F40A 1O7MB 3F14A 1K41A 1OGXA 5AIFA 4STDA 2XSHB 1OUNA 4XBXA 2Z76A 1CQSA 2IMJA 1GY6A 4LEHA 3MSOA 4L8OA 5AIGA 3FH1A 3EBYA 3CPOA 3HK4A 3KZTA 3EBTA 5BVBA 2JQ5A 1JB5A 1JKGA 5CF1A 3CNMA 1OHOA 2GBXB 3G16A 2BMQB 4HM8B 5IG3A 5AEUB 3FLJA 3JUOA 1S5AA 2HMOB 3ER7A 4IIAA 5STDA 1HKXA 2XRXB 1AR0A 2F86B 3F8HA 3B7CA 3EF8A 3M8CA 3B8LA 3NHXA 6STDA 2CHCA 3OX9A 3GZBA 1QMAA 1JN5B 1O7HB 3H3HA 5HGRA 1GYBA 5AI1A 3EN1B 4PEJA 2GEYA 4MJDA 3MG2A 3MG3A 5KP1A 2GXFA 2GEXA 2A15A 2BMOB 3RGRA 1JB2A 4N3VA 2W2CA 1BUQA 3WMDA 4XDWA 2F99A 3DZLA 3EHCA 4Q53A 1OHPA 4RZMA 1JB4A 2BNGA 1NWWA 4X2HA 3GRDA 1NU3A 3STDA 1E3RA 5D82A
chains in the Genus database with same CATH superfamily
1TIJA 3U97A 1JBTA 1A67A 1YHQ3 3AGOA 2D1WA 3MWZA 1RGCA 5D81A 4WP5A 1LVNA 1Q7HA 5BU4A 3I563 3A76A 4LGQA 2D42A 2Z77A 7STDA 1B2SA 1K734 4GL6A 3WOFB 3KSPA 5AIHA 1KSIA 5KP4A 3AMOA 5G1KA 3JUNA 3S5CA 1IV7A 3LH4A 1B2MA 1OF5B 3CCR3 2STDA 1O7WB 5IERA 4BL2A 5CLKA 4CDLA 4EC6A 1AVLA 3J7Yd 3BNBA 1QAFA 5CK6A 1KQS2 5FW5A 3X40A 2GU3A 1FGTA 4EYCA 3KCHA 2H0HA 1BU4A 2L4VA 3LMLA 5D83A 1IV9A 3DXOA 3PGBA 5RNTA 3SVAA 3SXXA 2W9PA 1ZX2A 3UNLA 3V98A 2W0QA 1NJI4 3PCRA 1EA2A 3ALAA 1U5OA 4L7KA 1YJW3 3NV0B 1SQWA 2IYJA 1YVSA 4K90B 4H3UA 4HM5B 3OWSA 3SOAA 3B4PA 4LZIA 3G8ZA 1FA3A 2CKFB 1FUWA 1A2PA 1VZZA 4EBGA 1R4YA 3RGAA 3CCV3 1O7NB 1O7PB 1QAKA 3SLUA 3U1WA 4KFEA 5LC7A 3DGLA 2CWUA 3LTCA 2CW9A 1QVF2 1SARA 3FF0A 3EC9A 3FSDA 2BMRB 3MHEA 2CG1A 1CYVA 1A2KA 3WA2X 1PY3A 2F5WA 1VQ93 4R9KA 1OGZA 3K5TA 4BTWA 1ULJB 1BRKA 2IUKA 2WOFA 3GAXA 3JUPA 1W6YA 3EJVA 2AADA 3JUQA 3OWUA 5IG0A 3D9RA 1IT7A 3HZPA 3KE7A 4RNYA 4XM4A 2ZHXB 2RGQA 3LOYA 2KF4A 1V57A 1K28A 6GSPA 1UGHI 1I3IA 1EKMA 1KD14 1N9EA 4HM6B 4XDVA 1K8A4 3DUKA 1Q40A 1I2FA 2GSPA 3NBBA 4FCMA 3S67A 3X41A 1Q824 1TRPA 1STFI 4MMXB 1Q814 4TX4A 2WOHA 2CFKA 1FUSA 1EG9B 2B1XB 1VQ53 2CFWA 5IG5A 1R4CA 1W02A 1VQQA 2P0XA 1X1WA 4HBRA 3CC43 2RBIA 4XBYA 1V74A 2CX1A 7GSPA 1EUIC 2P0MA 2YFIB 3GZRA 4MMZB 1AV4A 1GMRA 5M1AA 1LRAA 1DYUA 2LQVA 3DMCA 1C7HA 2XGLA 3EN8A 3NBJA 4O3VA 3F9SA 5KP3A 5JBSA 2XF3A 2K3DA 3CXC2 3Q1CA 4BIRA 3BLZA 1GY5A 1MWRA 2B24B 2P38A 2Z7AA 3PCSA 3LTBA 4WYKB 8CHOA 4HM1B 1QVG2 2E2UA 1RRLA 3HX8A 3KN4A 4K61A 1DE3A 2GU1A 2WGOA 1J2BA 3Q3FA 3GZYB 1UUGB 4R9LA 4AKZA 3NXJA 3FKAA 4K1UA 4ZM8A 3LZAA 1N5PA 3UJMA 2BT3A 2Y73A 1VQL3 1NO3A 5TGNA 3SX1A 2XFSA 3CC73 2O3OA 1MOLA 2OWPA 2BHMA 1TFKA 3OW22 2OTJ3 2QEX3 1BNJA 1BRGA 1GD4A 3BNDA 4FMCA 1YVBI 4OVMA 1IVXA 4FCZA 2SBLA 1BNEA 2Q07A 3CNXA 3LXUX 1VQM3 2KF3A 2E2VA 1D6UA 1BIRA 1TFOA 2LYXA 5AEWB 2KRTA 2QIYA 4AKYA 1KWIA 1RTUA 2R41A 1M1K4 1I3FA 1RSNA 3FF2A 2P05A 4BTXA 1YIJ3 2C10A 2XR8B 1B3SA 1T2IA 2F5MA 4BU4A 1MWSA 1BSDA 1RGAA 4HVNA 3PXMA 2QGUA 3SOYA 2WO0A 4WFOA 3WDGB 4ORLA 4WHAA 1OPYA 2XGNA 1ROAA 4N6V0 1SIIA 2OQEA 1VQP3 1BSBA 1RDSA 4HYZA 4LSOA 1LOVA 1WMPA 2R4IA 3WOEB 1OHSA 2KF6A 3D79A 4GHOA 1BOXA 5BXQA 1BNRA 5IW9A 1YGWA 1NDOB 3NV0A 3D4AA 4K1VA 5JPUA 3EQQB 1ULIB 3AHSA 1B2XA 3OV4A 1N5HA 5M19A 2C4BA 1A90A 2SARA 3ECFA 3CCU3 1RHLA 4I4KA 1Q42A 3SEDA 4BTYA 1BRJA 4G1MB 1IQ8A 1GSPA 1BRHA 1NB3I 1NNVA 3FZWA 3DH2A 1PU4A 4I5QA 1RGEA 1T2HA 1IK3A 2HMKB 2MF7A 5JPPA 1IVUA 4HM7B 4QWTA 3JUMA 4NHFA 1CEWI 1LQMB 1BRIA 4FMBA 2HMLB 3E99A 5DREA 9RNTA 1CYUA 1I0VA 3NQYA 5AIIA 1DMNA 2I9WA 2W9QA 3V99A 2CH9A 1GY7A 2GBWB 1BAOA 1JJ22 5LC6A 3HIGA 3MYTA 1NB5I 4HKVB 3BB9A 3QRDA 5DRVA 1HYFA 1BRSA 3D5GA 1ZGXA 3I0YA 4J5KA 1GOVA 5EEOA 1EEJA 3F8XA 2MC8A 1JBSA 1CH0A 1KC84 1BSEA 2JDIH 3BU4A 3H51A 3AHWA 2W6JH 4HM4B 1STDA 2HOHA 1LOYA 3OXAA 3G6E3 5IEPA 5IG4A 1RCLA 3G0KA 4U13A 5ELUA 4XBTA 3S29A 1WQLB 3OWYA 4WWUC 5ELJA 3B4OA 3KKGA 4N6MA 1I0XA 4KFDA 3HIIA 1YGEA 3K0ZA 3K63A 1BSCA 1JNQA 1E97A 2RNTA 1UI7A 1UI8A 1TRQA 2YFJB 4HJLB 1BNFA 2E2TA 3NUVA 4CJNA 1OCVA 3T8NA 3VSYA 3Q2PA 2ZDJA 3MG1A 3PYJA 2FXTA 3DGMA 1FGOA 1BRNL 1K9M4 1JN5A 1UUWB 4HM0B 4JF8A 3BNEA 4WYKA 1UW1A 1VQO3 4CCVA 4KVHA 1ROVA 2CFDA 4HOHA 4X2OA 4FCJA 5IF6A 4HM3B 1DVDA 2XSOB 3AGNA 4XB5A 1LOWA 4HZBB 3UB1A 5G2GA 1SJWA 4HM2B 2HMJB 1X1XA 1IVVA 3X3XA 1VQ43 2CWTA 1X1UA 1AQZA 1ASKA 3LT9A 3MKIA 3NM2A 4MEIA 1RN1A 1HU9A 3GZXB 1JKGB 1O7GB 1OH0A 1YJN3 2RFRA 3IPTA 3T8UA 1DMQA 2IA7A 3DGOA 5IENA 3LTAA 3LT8A 1E3VA 1BNSA 1JV2B 1YNVX 1RGGA 2XH9A 4N6NB 4FMAA 3N8BA 2CC3A 3Q90A 1GD3A 3RDEA 3ROBA 1AVKA 1ZO2A 2ML5A 1I70A 5I97A 2INXA 1L5GB 1RRHA 1N9JA 3D5IA 3WA3A 1C54A 3FGYA 1TJDA 2CFGA 2BO9B 1GS3A 1LNHA 1TUHA 1Q40B 4O8SA 4OUQA 3KFQC 1ISKA 2HMNB 2P09A 3N9HA 2CFLA 1WTHA 3CU3A 1IDPA 4MMYB 2YFLB 1D6YA 4J9AA 3MPHA 2Z6BA 1BVIA 2KAAA 1X1YA 3N54B 1RJOA 1AY7A 5G1LA 7RNTA 2PNCA 1FGRA 1FGQA 4N6UA 3FG3A 1RGHA 1W01A 4FMDA 2AAEA 3BNCA 2OOVC 4LMIA 2QA43 3NQZA 1B20A 4DKIA 4R1KA 3K9MC 4HZ9B 3A5EA 1OF5A 1HZ1A 3GSPA 1UCLA 1Z1SA 4KZ1A 5EVHA 1BGSA 4LYLB 2XFTA 1UGIA 2W56B 4N6LA 5D82A 3CME3 5CF2A 3EE1A 5IEOA 2K0MA 1IT8A 1RNBA 3F7XA 5AYSC 2XEPA 1IU7A 1LQGC 3PZWA 4EXRA 1RN4A 1TP6A 1VQ73 2RCDA 3CC23 3X3YA 1W6CA 3NBRA 4EV5A 5A0OB 2C11A 1JRQA 1DMMA 1PFPA 5BIRA 1G96A 1GMQA 3EX9A 2FGTA 3DM8A 1UUVB 2ZA4A 1RGFA 3K7CA 3IMAB 1YJ93 2OQEC 1BUJA 1VQK3 2FNQA 4ILFA 3F7SA 3VGNA 1IVWA 3O8YA 1W00A 3WHOA 2HMMB 1M9GA 2BIRA 4IT7A 3TDGA 1JBRA 1ZS7A 3WR2A 3GWRA 4GB5A 2F98A 1GMPA 2W04A 3LYGA 2K54A 4J8TA 4L8PA 4RBNA 1BANA 2CIUA 1RMSA 1FZUA 1LNIA 6RNTA 5CXOA 1S723 1EQKA 3G4S3 2UGIA 2UX0A 1BNIA 4OK0A 2PZVA 4RNZA 1DETA 3CD63 1N8QA 3CCL3 1FGMA 1RLSA 2CK3H 3NX0A 1SIHA 1WMOA 3F40A 1O7MB 1U8CB 3I553 3F14A 1K41A 1MGRA 1OGXA 3QK9A 4STDA 5AIFA 1A2VA 2J8XB 1YIT3 4EV2A 2O9UX 2XSHB 1OUNA 4CPKA 1YI23 1Q864 3X3ZA 4N6TA 4XBXA 3G713 2Z76A 1FUTA 1CQSA 2IMJA 1N8R4 2KF5A 3FG4A 3AMOB 1UDII 2KCDA 1GY6A 3KIIA 2V1LA 3MSOA 4LEHA 3S28A 4L8OA 4R4KA 5AIGA 3FH1A 1I2GA 1UCIA 2M7OA 2ZL8A 3EBYA 1QALA 1PYLA 3UL5A 5M18A 3CPOA 1I8VA 1MWUA 3HK4A 3KZTA 4KFFA 2OCTA 1I2EA 1T5YA 5EQLA 4J5GA 3CCS3 3EBTA 3DGNA 5GSPA 3IJEB 5BVBA 2JQ5A 1T3BA 4RNTA 1FYSA 1UCJA 1W7CA 1JB5A 4N6OB 1JKGA 2KXGA 1W5ZA 1RN7A 2L1SA 1UCKA 2IY2A 1DVCA 3DGYA 3V92A 2WGQA 1RCKA 3NM7A 4EW5A 5CF1A 1BNGA 3CCM3 1RGLA 3CNMA 1OHOA 3ZG5A 2GBXB 5AYRB 3FCSB 3G16A 2BMQB 4HM8B 5IG3A 5AEUB 4H61A 1B21A 1M1XB 4NREA 3FLJA 1VQ83 1V58A 2Y74A 1US1A 2H0IA 2CX0A 3FG1A 1TU5A 1Y4KA 3D3LA 3S27A 3X42A 3JUOA 1S5AA 2HMOB 3ER7A 3PS8A 4IIAA 5STDA 1HKXA 3EB8A 2H0GA 2UUGC 1M904 2XRXB 1AR0A 3WODG 1LXEA 2F86B 3F8HA 2F4YA 4O2HA 3B7CA 3EF8A 3M8CA 3ZFZA 1GOYA 1W2ZA 3B8LA 3BIRA 1MNLA 2YX9A 3NHXA 6STDA 3CPW2 5HOHA 1Q9EA 2CHCA 3CCQ3 3OX9A 1B27A 2W56A 1MGWA 8RNTA 3RNTA 1RKYA 3GZBA 1QMAA 1IQXA 1JN5B 1O7HB 3H3HA 5HGRA 1RNTA 3JVCA 2CWVA 1F8NA 1G02A 2BU4A 3T0UA 3VF1A 1GYBA 3LTDA 5AI1A 1B2UA 3EN1B 1G0TA 4PEJA 2GEYA 4MJDA 2OTL3 4GSPA 4R80A 3MG2A 1WNHA 1JZDA 1WMNA 1MWTA 3DY5A 3MG3A 1W2B2 1FW7A 2ML6A 4HAAA 4BL3A 5KP1A 2GXFA 2GEXA 4IPBA 2OOVA 2CG0A 2A15A 4AEQA 1IQYA 1D6ZA 2BMOB 3RGRA 1JB2A 3HI7A 4N3VA 2W2CA 1BUQA 1B2ZA 3L0RA 1W4NA 4XDWA 2F99A 3WMDA 3CMA3 1SPUA 1VQ63 1TTOA 3DZLA 3SYUA 3EHCA 1BSAA 3HOHA 1JZOA 4Q53A 1W6GA 4KT3B 1LOXA 1OHPA 3URPA 4RZMA 3ZG0A 3CCE3 1JB4A 1GOUA 4NPBA 5FGOA 2RSXA 4O02B 2BNGA 2IUJA 1NWWA 2F56A 1OACA 2W03A 1IYYA 4JRFA 4X2HA 3KSED 3GRDA 1NU3A 4FR9A 1RGKA 3UL6A 3CCJ3 1VQN3 3STDA 1E3RA 1QJGA 1Q7Y4
chains in the Genus database with same CATH topology
1TIJA 3U97A 1A67A 1YHQ3 3MWZA 2D1WA 5D81A 4WP5A 1LVNA 3I563 3A76A 4LGQA 2D42A 2Z77A 7STDA 4GL6A 3WOFB 3KSPA 5AIHA 1KSIA 5KP4A 3AMOA 3JUNA 3S5CA 1IV7A 3LH4A 1OF5B 3CCR3 2STDA 1O7WB 5IERA 5CLKA 4CDLA 4EC6A 1AVLA 3J7Yd 3BNBA 1QAFA 5CK6A 1KQS2 5FW5A 3X40A 2GU3A 1FGTA 4EYCA 2L4VA 3LMLA 5D83A 1IV9A 3DXOA 3PGBA 3SVAA 3SXXA 2W9PA 1ZX2A 3UNLA 3V98A 2W0QA 1NJI4 3PCRA 1EA2A 3ALAA 1U5OA 4L7KA 1YJW3 3NV0B 1SQWA 4K90B 4H3UA 4HM5B 3OWSA 3SOAA 3B4PA 4LZIA 3G8ZA 1FA3A 2CKFB 1FUWA 1VZZA 4EBGA 3RGAA 3CCV3 1O7NB 1O7PB 1QAKA 3SLUA 3U1WA 4KFEA 5LC7A 3DGLA 2CWUA 3LTCA 2CW9A 1QVF2 3FF0A 3MHEA 3EC9A 3FSDA 2BMRB 3WA2X 2CG1A 1CYVA 1A2KA 1VQ93 4R9KA 1OGZA 3K5TA 4BTWA 1ULJB 2WOFA 2IUKA 3GAXA 3JUPA 1W6YA 3EJVA 3JUQA 3OWUA 5IG0A 3D9RA 1IT7A 3HZPA 3KE7A 4RNYA 4XM4A 2RGQA 3LOYA 1K28A 1EKMA 1KD14 1N9EA 4HM6B 4XDVA 1K8A4 3DUKA 1Q40A 4FCMA 3NBBA 3X41A 3S67A 1Q824 1STFI 4MMXB 1Q814 4TX4A 2WOHA 2CFKA 1EG9B 2B1XB 1VQ53 2CFWA 5IG5A 1R4CA 1W02A 2P0XA 3CC43 4HBRA 4XBYA 1V74A 2P0MA 2YFIB 3GZRA 4MMZB 1AV4A 1DYUA 2LQVA 3DMCA 1C7HA 2XGLA 3EN8A 3NBJA 4O3VA 3F9SA 5KP3A 5JBSA 2XF3A 3CXC2 3Q1CA 3BLZA 1GY5A 2B24B 2P38A 2Z7AA 3PCSA 3LTBA 4WYKB 8CHOA 4HM1B 1QVG2 2E2UA 1RRLA 3HX8A 3KN4A 4K61A 2GU1A 2WGOA 1J2BA 3GZYB 4R9LA 4AKZA 3NXJA 3FKAA 4K1UA 4ZM8A 3LZAA 1N5PA 3UJMA 2BT3A 2Y73A 1VQL3 1NO3A 5TGNA 3SX1A 2XFSA 3CC73 2O3OA 1MOLA 2OWPA 2BHMA 1TFKA 3OW22 2OTJ3 2QEX3 3BNDA 1GD4A 4FMCA 1YVBI 4OVMA 1IVXA 4FCZA 2SBLA 2Q07A 3CNXA 3LXUX 1VQM3 2E2VA 1D6UA 1TFOA 2LYXA 5AEWB 2KRTA 2QIYA 4AKYA 1KWIA 1M1K4 3FF2A 2P05A 4BTXA 1YIJ3 2C10A 2XR8B 4HVNA 3PXMA 2QGUA 3SOYA 2WO0A 4WFOA 3WDGB 4ORLA 4WHAA 1OPYA 2XGNA 1ROAA 4N6V0 1SIIA 2OQEA 1VQP3 4HYZA 4LSOA 1WMPA 2R4IA 3WOEB 1OHSA 5BXQA 5IW9A 1NDOB 3NV0A 4K1VA 5JPUA 3EQQB 1ULIB 3OV4A 1N5HA 1A90A 3ECFA 3CCU3 4I4KA 1Q42A 3SEDA 4BTYA 4G1MB 1IQ8A 1NB3I 3FZWA 1PU4A 1IK3A 2HMKB 2MF7A 5JPPA 1IVUA 4HM7B 4QWTA 3JUMA 4NHFA 1CEWI 4FMBA 2HMLB 3E99A 5DREA 1CYUA 3NQYA 5AIIA 1DMNA 2I9WA 2W9QA 3V99A 2CH9A 1GY7A 2GBWB 1JJ22 5LC6A 3HIGA 3MYTA 1NB5I 4HKVB 3BB9A 3QRDA 5DRVA 3I0YA 2MC8A 5EEOA 3F8XA 1KC84 2JDIH 3H51A 2W6JH 4HM4B 1STDA 3OXAA 3G6E3 5IEPA 5IG4A 4U13A 3G0KA 5ELUA 4XBTA 3S29A 1WQLB 3OWYA 4WWUC 5ELJA 3B4OA 3KKGA 4N6MA 4KFDA 3HIIA 1YGEA 3K0ZA 3K63A 1JNQA 1E97A 1UI7A 1UI8A 2YFJB 4HJLB 2E2TA 3NUVA 1OCVA 3T8NA 3VSYA 3Q2PA 2ZDJA 3MG1A 3PYJA 2FXTA 3DGMA 1FGOA 1K9M4 1JN5A 1UUWB 4HM0B 4JF8A 3BNEA 4WYKA 1UW1A 1VQO3 4CCVA 4KVHA 1ROVA 2CFDA 5IF6A 4X2OA 4FCJA 1DVDA 4HM3B 2XSOB 4XB5A 4HZBB 3UB1A 5G2GA 1SJWA 4HM2B 2HMJB 1IVVA 3X3XA 1VQ43 2CWTA 1ASKA 3LT9A 3MKIA 3NM2A 4MEIA 3GZXB 1HU9A 1JKGB 1O7GB 1OH0A 1YJN3 2RFRA 3IPTA 3T8UA 1DMQA 2IA7A 3DGOA 5IENA 3LTAA 3LT8A 1E3VA 1JV2B 2XH9A 4N6NB 4FMAA 3N8BA 2CC3A 3Q90A 1GD3A 3RDEA 3ROBA 1AVKA 1ZO2A 2ML5A 5I97A 2INXA 1L5GB 1RRHA 1N9JA 3WA3A 3FGYA 2CFGA 2BO9B 1GS3A 1LNHA 1TUHA 1Q40B 4O8SA 4OUQA 3KFQC 1ISKA 2HMNB 2P09A 3N9HA 2CFLA 1WTHA 3CU3A 1IDPA 4MMYB 2YFLB 1D6YA 4J9AA 3MPHA 2Z6BA 3N54B 1RJOA 2PNCA 1FGRA 1FGQA 4N6UA 3FG3A 1W01A 4FMDA 3BNCA 2OOVC 4LMIA 2QA43 3NQZA 4R1KA 3K9MC 4HZ9B 1OF5A 1Z1SA 4KZ1A 1K734 5EVHA 3CME3 2XFTA 5D82A 2W56B 4N6LA 5CF2A 3EE1A 5IEOA 2K0MA 1IT8A 3F7XA 5AYSC 2XEPA 1IU7A 3PZWA 4EXRA 1TP6A 1VQ73 2RCDA 3CC23 3X3YA 1W6CA 3NBRA 4EV5A 5A0OB 2C11A 1JRQA 1DMMA 1PFPA 1G96A 3EX9A 2FGTA 3DM8A 1UUVB 3K7CA 1YJ93 3IMAB 2OQEC 1VQK3 2FNQA 3F7SA 3VGNA 1IVWA 3O8YA 1W00A 2HMMB 1M9GA 4IT7A 3TDGA 3GWRA 4GB5A 2F98A 2W04A 3LYGA 4J8TA 2K54A 4L8PA 4RBNA 1M904 2CIUA 5CXOA 1S723 1EQKA 3G4S3 2UX0A 4OK0A 2PZVA 4RNZA 3CD63 1N8QA 3CCL3 1FGMA 2CK3H 3NX0A 1SIHA 1WMOA 3F40A 1O7MB 1U8CB 3I553 3F14A 1K41A 1OGXA 5AIFA 3QK9A 4STDA 1A2VA 1YIT3 4EV2A 2O9UX 2XSHB 1OUNA 1YI23 1Q864 3X3ZA 4N6TA 4XBXA 3G713 2Z76A 1CQSA 2IMJA 1N8R4 3KIIA 3FG4A 3AMOB 2KCDA 1GY6A 2V1LA 3MSOA 4LEHA 3S28A 4L8OA 4R4KA 5AIGA 3FH1A 2M7OA 2ZL8A 3EBYA 1QALA 3UL5A 3CPOA 3HK4A 3KZTA 4KFFA 2OCTA 1T5YA 5EQLA 3CCS3 3EBTA 3DGNA 3IJEB 5BVBA 2JQ5A 1W7CA 4N6OB 1JB5A 1JKGA 2KXGA 1W5ZA 1RN7A 3V92A 1DVCA 2WGQA 5CF1A 3NM7A 3CCM3 3CNMA 1OHOA 2GBXB 5AYRB 3FCSB 3G16A 2BMQB 4HM8B 5IG3A 5AEUB 4H61A 1M1XB 4NREA 3FLJA 1VQ83 2Y74A 1US1A 3FG1A 1TU5A 1Y4KA 3D3LA 3S27A 3X42A 3JUOA 1S5AA 2HMOB 3ER7A 3PS8A 4IIAA 5STDA 1HKXA 3EB8A 2XRXB 1AR0A 3WODG 1LXEA 2F86B 3F8HA 4O2HA 3B7CA 3EF8A 3M8CA 1W2ZA 3B8LA 1MNLA 2YX9A 3NHXA 6STDA 3CPW2 2CHCA 3CCQ3 3OX9A 2W56A 1RKYA 3GZBA 1QMAA 1IQXA 1JN5B 1O7HB 3H3HA 5HGRA 3JVCA 2CWVA 1F8NA 3T0UA 3VF1A 1GYBA 3LTDA 5AI1A 3EN1B 4PEJA 2GEYA 4MJDA 2OTL3 4R80A 3MG2A 1WNHA 1WMNA 3DY5A 3MG3A 1W2B2 2ML6A 5KP1A 2GXFA 2GEXA 4IPBA 2OOVA 2CG0A 2A15A 4AEQA 1IQYA 1D6ZA 2BMOB 3RGRA 1JB2A 3HI7A 4N3VA 2W2CA 1BUQA 3L0RA 1W4NA 4XDWA 2F99A 3WMDA 3CMA3 1SPUA 1VQ63 3DZLA 3EHCA 4Q53A 1W6GA 1LOXA 1OHPA 4RZMA 3CCE3 1JB4A 5FGOA 2RSXA 4O02B 2BNGA 2IUJA 1NWWA 2W03A 1OACA 4JRFA 4X2HA 3KSED 3GRDA 1NU3A 4FR9A 3CCJ3 3UL6A 1VQN3 3STDA 1E3RA 1QJGA 1Q7Y4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D81 A;  4WP5 A;  3A76 A;  4LGQ A;  2Z77 A;  7STD A;  3KSP A;  5AIH A;  5KP4 A;  3JUN A;  3S5C A;  1OF5 B;  2STD A;  1O7W B;  5IER A;  5CLK A;  4CDL A;  5CK6 A;  5FW5 A;  5D83 A;  3DXO A;  3UNL A;  1ZX2 A;  1EA2 A;  1U5O A;  4L7K A;  3NV0 B;  4H3U A;  4HM5 B;  3OWS A;  3SOA A;  3B4P A;  3G8Z A;  2CKF B;  1VZZ A;  3RGA A;  1O7N B;  1O7P B;  3FF0 A;  3MHE A;  3EC9 A;  3FSD A;  2BMR B;  1A2K A;  4R9K A;  1OGZ A;  1ULJ B;  3JUP A;  1W6Y A;  3EJV A;  3JUQ A;  3OWU A;  5IG0 A;  3D9R A;  3HZP A;  3KE7 A;  4XM4 A;  2RGQ A;  4HM6 B;  4XDV A;  3DUK A;  1Q40 A;  4FCM A;  1EG9 B;  2B1X B;  5IG5 A;  1W02 A;  4XBY A;  2YFI B;  3GZR A;  3DMC A;  3EN8 A;  1C7H A;  3F9S A;  5KP3 A;  3BLZ A;  1GY5 A;  2B24 B;  2Z7A A;  4WYK B;  8CHO A;  4HM1 B;  3HX8 A;  3GZY B;  4R9L A;  3NXJ A;  3FKA A;  4K1U A;  3LZA A;  3UJM A;  5TGN A;  2OWP A;  4OVM A;  3CNX A;  5AEW B;  2QIY A;  3FF2 A;  2XR8 B;  4HVN A;  2QGU A;  3SOY A;  4ORL A;  1OPY A;  2R4I A;  1OHS A;  5BXQ A;  1NDO B;  3NV0 A;  4K1V A;  5JPU A;  3EQQ B;  1ULI B;  3OV4 A;  3ECF A;  4I4K A;  1Q42 A;  3SED A;  3FZW A;  2HMK B;  5JPP A;  4HM7 B;  3JUM A;  2HML B;  3E99 A;  5DRE A;  5AII A;  1DMN A;  2I9W A;  1GY7 A;  2GBW B;  3MYT A;  4HKV B;  3BB9 A;  5DRV A;  3I0Y A;  3F8X A;  3H51 A;  4HM4 B;  1STD A;  3OXA A;  5IEP A;  5IG4 A;  4U13 A;  3G0K A;  4XBT A;  1WQL B;  3OWY A;  4WWU C;  3B4O A;  3KKG A;  3K0Z A;  1E97 A;  2YFJ B;  4HJL B;  3NUV A;  1OCV A;  3T8N A;  3VSY A;  3MG1 A;  1JN5 A;  1UUW B;  4HM0 B;  4WYK A;  4KVH A;  5IF6 A;  4X2O A;  4FCJ A;  4HM3 B;  2XSO B;  4XB5 A;  4HZB B;  5G2G A;  1SJW A;  4HM2 B;  2HMJ B;  1ASK A;  3MKI A;  3NM2 A;  3GZX B;  1JKG B;  1O7G B;  1OH0 A;  2RFR A;  3IPT A;  3T8U A;  1DMQ A;  5IEN A;  1E3V A;  3Q90 A;  3ROB A;  1ZO2 A;  2INX A;  3FGY A;  1GS3 A;  1TUH A;  1Q40 B;  4OUQ A;  1ISK A;  2HMN B;  3CU3 A;  1IDP A;  2YFL B;  4J9A A;  1W01 A;  4LMI A;  4R1K A;  4HZ9 B;  1OF5 A;  1Z1S A;  5EVH A;  5CF2 A;  5IEO A;  3F7X A;  1TP6 A;  2RCD A;  3NBR A;  1DMM A;  1QJG A;  3EX9 A;  3DM8 A;  1UUV B;  3K7C A;  3F7S A;  3VGN A;  1W00 A;  2HMM B;  3GWR A;  4GB5 A;  2F98 A;  3LYG A;  4J8T A;  4L8P A;  2K54 A;  5CXO A;  2UX0 A;  2PZV A;  3F40 A;  1O7M B;  3F14 A;  1K41 A;  1OGX A;  5AIF A;  4STD A;  2XSH B;  1OUN A;  4XBX A;  2Z76 A;  1CQS A;  2IMJ A;  1GY6 A;  4LEH A;  3MSO A;  4L8O A;  5AIG A;  3FH1 A;  3EBY A;  3CPO A;  3HK4 A;  3KZT A;  3EBT A;  5BVB A;  2JQ5 A;  1JB5 A;  1JKG A;  5CF1 A;  3CNM A;  1OHO A;  2GBX B;  3G16 A;  2BMQ B;  4HM8 B;  5IG3 A;  5AEU B;  3FLJ A;  3JUO A;  1S5A A;  2HMO B;  3ER7 A;  4IIA A;  5STD A;  1HKX A;  2XRX B;  1AR0 A;  2F86 B;  3F8H A;  3B7C A;  3EF8 A;  3M8C A;  3B8L A;  3NHX A;  6STD A;  2CHC A;  3OX9 A;  3GZB A;  1QMA A;  1JN5 B;  1O7H B;  3H3H A;  5HGR A;  1GYB A;  5AI1 A;  3EN1 B;  4PEJ A;  2GEY A;  4MJD A;  3MG2 A;  3MG3 A;  5KP1 A;  2GXF A;  2GEX A;  2A15 A;  2BMO B;  3RGR A;  1JB2 A;  4N3V A;  2W2C A;  1BUQ A;  3WMD A;  4XDW A;  2F99 A;  3DZL A;  3EHC A;  4Q53 A;  1OHP A;  4RZM A;  1JB4 A;  2BNG A;  1NWW A;  4X2H A;  3GRD A;  1NU3 A;  3STD A;  1E3R A;  5D82 A; 
#chains in the Genus database with same CATH topology
 1TIJ A;  3U97 A;  1JBT A;  1A67 A;  1YHQ 3;  3AGO A;  2D1W A;  3MWZ A;  1RGC A;  5D81 A;  4WP5 A;  1LVN A;  1Q7H A;  5BU4 A;  3I56 3;  3A76 A;  4LGQ A;  2D42 A;  2Z77 A;  7STD A;  1B2S A;  1K73 4;  4GL6 A;  3WOF B;  3KSP A;  5AIH A;  1KSI A;  5KP4 A;  3AMO A;  5G1K A;  3JUN A;  3S5C A;  1IV7 A;  3LH4 A;  1B2M A;  1OF5 B;  3CCR 3;  2STD A;  1O7W B;  5IER A;  4BL2 A;  5CLK A;  4CDL A;  4EC6 A;  1AVL A;  3J7Y d;  3BNB A;  1QAF A;  5CK6 A;  1KQS 2;  5FW5 A;  3X40 A;  2GU3 A;  1FGT A;  4EYC A;  3KCH A;  2H0H A;  1BU4 A;  2L4V A;  3LML A;  5D83 A;  1IV9 A;  3DXO A;  3PGB A;  5RNT A;  3SVA A;  3SXX A;  2W9P A;  1ZX2 A;  3UNL A;  3V98 A;  2W0Q A;  1NJI 4;  3PCR A;  1EA2 A;  3ALA A;  1U5O A;  4L7K A;  1YJW 3;  3NV0 B;  1SQW A;  2IYJ A;  1YVS A;  4K90 B;  4H3U A;  4HM5 B;  3OWS A;  3SOA A;  3B4P A;  4LZI A;  3G8Z A;  1FA3 A;  2CKF B;  1FUW A;  1A2P A;  1VZZ A;  4EBG A;  1R4Y A;  3RGA A;  3CCV 3;  1O7N B;  1O7P B;  1QAK A;  3SLU A;  3U1W A;  4KFE A;  5LC7 A;  3DGL A;  2CWU A;  3LTC A;  2CW9 A;  1QVF 2;  1SAR A;  3FF0 A;  3EC9 A;  3FSD A;  2BMR B;  3MHE A;  2CG1 A;  1CYV A;  1A2K A;  3WA2 X;  1PY3 A;  2F5W A;  1VQ9 3;  4R9K A;  1OGZ A;  3K5T A;  4BTW A;  1ULJ B;  1BRK A;  2IUK A;  2WOF A;  3GAX A;  3JUP A;  1W6Y A;  3EJV A;  2AAD A;  3JUQ A;  3OWU A;  5IG0 A;  3D9R A;  1IT7 A;  3HZP A;  3KE7 A;  4RNY A;  4XM4 A;  2ZHX B;  2RGQ A;  3LOY A;  2KF4 A;  1V57 A;  1K28 A;  6GSP A;  1UGH I;  1I3I A;  1EKM A;  1KD1 4;  1N9E A;  4HM6 B;  4XDV A;  1K8A 4;  3DUK A;  1Q40 A;  1I2F A;  2GSP A;  3NBB A;  4FCM A;  3S67 A;  3X41 A;  1Q82 4;  1TRP A;  1STF I;  4MMX B;  1Q81 4;  4TX4 A;  2WOH A;  2CFK A;  1FUS A;  1EG9 B;  2B1X B;  1VQ5 3;  2CFW A;  5IG5 A;  1R4C A;  1W02 A;  1VQQ A;  2P0X A;  1X1W A;  4HBR A;  3CC4 3;  2RBI A;  4XBY A;  1V74 A;  2CX1 A;  7GSP A;  1EUI C;  2P0M A;  2YFI B;  3GZR A;  4MMZ B;  1AV4 A;  1GMR A;  5M1A A;  1LRA A;  1DYU A;  2LQV A;  3DMC A;  1C7H A;  2XGL A;  3EN8 A;  3NBJ A;  4O3V A;  3F9S A;  5KP3 A;  5JBS A;  2XF3 A;  2K3D A;  3CXC 2;  3Q1C A;  4BIR A;  3BLZ A;  1GY5 A;  1MWR A;  2B24 B;  2P38 A;  2Z7A A;  3PCS A;  3LTB A;  4WYK B;  8CHO A;  4HM1 B;  1QVG 2;  2E2U A;  1RRL A;  3HX8 A;  3KN4 A;  4K61 A;  1DE3 A;  2GU1 A;  2WGO A;  1J2B A;  3Q3F A;  3GZY B;  1UUG B;  4R9L A;  4AKZ A;  3NXJ A;  3FKA A;  4K1U A;  4ZM8 A;  3LZA A;  1N5P A;  3UJM A;  2BT3 A;  2Y73 A;  1VQL 3;  1NO3 A;  5TGN A;  3SX1 A;  2XFS A;  3CC7 3;  2O3O A;  1MOL A;  2OWP A;  2BHM A;  1TFK A;  3OW2 2;  2OTJ 3;  2QEX 3;  1BNJ A;  1BRG A;  1GD4 A;  3BND A;  4FMC A;  1YVB I;  4OVM A;  1IVX A;  4FCZ A;  2SBL A;  1BNE A;  2Q07 A;  3CNX A;  3LXU X;  1VQM 3;  2KF3 A;  2E2V A;  1D6U A;  1BIR A;  1TFO A;  2LYX A;  5AEW B;  2KRT A;  2QIY A;  4AKY A;  1KWI A;  1RTU A;  2R41 A;  1M1K 4;  1I3F A;  1RSN A;  3FF2 A;  2P05 A;  4BTX A;  1YIJ 3;  2C10 A;  2XR8 B;  1B3S A;  1T2I A;  2F5M A;  4BU4 A;  1MWS A;  1BSD A;  1RGA A;  4HVN A;  3PXM A;  2QGU A;  3SOY A;  2WO0 A;  4WFO A;  3WDG B;  4ORL A;  4WHA A;  1OPY A;  2XGN A;  1ROA A;  4N6V 0;  1SII A;  2OQE A;  1VQP 3;  1BSB A;  1RDS A;  4HYZ A;  4LSO A;  1LOV A;  1WMP A;  2R4I A;  3WOE B;  1OHS A;  2KF6 A;  3D79 A;  4GHO A;  1BOX A;  5BXQ A;  1BNR A;  5IW9 A;  1YGW A;  1NDO B;  3NV0 A;  3D4A A;  4K1V A;  5JPU A;  3EQQ B;  1ULI B;  3AHS A;  1B2X A;  3OV4 A;  1N5H A;  5M19 A;  2C4B A;  1A90 A;  2SAR A;  3ECF A;  3CCU 3;  1RHL A;  4I4K A;  1Q42 A;  3SED A;  4BTY A;  1BRJ A;  4G1M B;  1IQ8 A;  1GSP A;  1BRH A;  1NB3 I;  1NNV A;  3FZW A;  3DH2 A;  1PU4 A;  4I5Q A;  1RGE A;  1T2H A;  1IK3 A;  2HMK B;  2MF7 A;  5JPP A;  1IVU A;  4HM7 B;  4QWT A;  3JUM A;  4NHF A;  1CEW I;  1LQM B;  1BRI A;  4FMB A;  2HML B;  3E99 A;  5DRE A;  9RNT A;  1CYU A;  1I0V A;  3NQY A;  5AII A;  1DMN A;  2I9W A;  2W9Q A;  3V99 A;  2CH9 A;  1GY7 A;  2GBW B;  1BAO A;  1JJ2 2;  5LC6 A;  3HIG A;  3MYT A;  1NB5 I;  4HKV B;  3BB9 A;  3QRD A;  5DRV A;  1HYF A;  1BRS A;  3D5G A;  1ZGX A;  3I0Y A;  4J5K A;  1GOV A;  5EEO A;  1EEJ A;  3F8X A;  2MC8 A;  1JBS A;  1CH0 A;  1KC8 4;  1BSE A;  2JDI H;  3BU4 A;  3H51 A;  3AHW A;  2W6J H;  4HM4 B;  1STD A;  2HOH A;  1LOY A;  3OXA A;  3G6E 3;  5IEP A;  5IG4 A;  1RCL A;  3G0K A;  4U13 A;  5ELU A;  4XBT A;  3S29 A;  1WQL B;  3OWY A;  4WWU C;  5ELJ A;  3B4O A;  3KKG A;  4N6M A;  1I0X A;  4KFD A;  3HII A;  1YGE A;  3K0Z A;  3K63 A;  1BSC A;  1JNQ A;  1E97 A;  2RNT A;  1UI7 A;  1UI8 A;  1TRQ A;  2YFJ B;  4HJL B;  1BNF A;  2E2T A;  3NUV A;  4CJN A;  1OCV A;  3T8N A;  3VSY A;  3Q2P A;  2ZDJ A;  3MG1 A;  3PYJ A;  2FXT A;  3DGM A;  1FGO A;  1BRN L;  1K9M 4;  1JN5 A;  1UUW B;  4HM0 B;  4JF8 A;  3BNE A;  4WYK A;  1UW1 A;  1VQO 3;  4CCV A;  4KVH A;  1ROV A;  2CFD A;  4HOH A;  4X2O A;  4FCJ A;  5IF6 A;  4HM3 B;  1DVD A;  2XSO B;  3AGN A;  4XB5 A;  1LOW A;  4HZB B;  3UB1 A;  5G2G A;  1SJW A;  4HM2 B;  2HMJ B;  1X1X A;  1IVV A;  3X3X A;  1VQ4 3;  2CWT A;  1X1U A;  1AQZ A;  1ASK A;  3LT9 A;  3MKI A;  3NM2 A;  4MEI A;  1RN1 A;  1HU9 A;  3GZX B;  1JKG B;  1O7G B;  1OH0 A;  1YJN 3;  2RFR A;  3IPT A;  3T8U A;  1DMQ A;  2IA7 A;  3DGO A;  5IEN A;  3LTA A;  3LT8 A;  1E3V A;  1BNS A;  1JV2 B;  1YNV X;  1RGG A;  2XH9 A;  4N6N B;  4FMA A;  3N8B A;  2CC3 A;  3Q90 A;  1GD3 A;  3RDE A;  3ROB A;  1AVK A;  1ZO2 A;  2ML5 A;  1I70 A;  5I97 A;  2INX A;  1L5G B;  1RRH A;  1N9J A;  3D5I A;  3WA3 A;  1C54 A;  3FGY A;  1TJD A;  2CFG A;  2BO9 B;  1GS3 A;  1LNH A;  1TUH A;  1Q40 B;  4O8S A;  4OUQ A;  3KFQ C;  1ISK A;  2HMN B;  2P09 A;  3N9H A;  2CFL A;  1WTH A;  3CU3 A;  1IDP A;  4MMY B;  2YFL B;  1D6Y A;  4J9A A;  3MPH A;  2Z6B A;  1BVI A;  2KAA A;  1X1Y A;  3N54 B;  1RJO A;  1AY7 A;  5G1L A;  7RNT A;  2PNC A;  1FGR A;  1FGQ A;  4N6U A;  3FG3 A;  1RGH A;  1W01 A;  4FMD A;  2AAE A;  3BNC A;  2OOV C;  4LMI A;  2QA4 3;  3NQZ A;  1B20 A;  4DKI A;  4R1K A;  3K9M C;  4HZ9 B;  3A5E A;  1OF5 A;  1HZ1 A;  3GSP A;  1UCL A;  1Z1S A;  4KZ1 A;  5EVH A;  1BGS A;  4LYL B;  2XFT A;  1UGI A;  2W56 B;  4N6L A;  5D82 A;  3CME 3;  5CF2 A;  3EE1 A;  5IEO A;  2K0M A;  1IT8 A;  1RNB A;  3F7X A;  5AYS C;  2XEP A;  1IU7 A;  1LQG C;  3PZW A;  4EXR A;  1RN4 A;  1TP6 A;  1VQ7 3;  2RCD A;  3CC2 3;  3X3Y A;  1W6C A;  3NBR A;  4EV5 A;  5A0O B;  2C11 A;  1JRQ A;  1DMM A;  1PFP A;  5BIR A;  1G96 A;  1GMQ A;  3EX9 A;  2FGT A;  3DM8 A;  1UUV B;  2ZA4 A;  1RGF A;  3K7C A;  3IMA B;  1YJ9 3;  2OQE C;  1BUJ A;  1VQK 3;  2FNQ A;  4ILF A;  3F7S A;  3VGN A;  1IVW A;  3O8Y A;  1W00 A;  3WHO A;  2HMM B;  1M9G A;  2BIR A;  4IT7 A;  3TDG A;  1JBR A;  1ZS7 A;  3WR2 A;  3GWR A;  4GB5 A;  2F98 A;  1GMP A;  2W04 A;  3LYG A;  2K54 A;  4J8T A;  4L8P A;  4RBN A;  1BAN A;  2CIU A;  1RMS A;  1FZU A;  1LNI A;  6RNT A;  5CXO A;  1S72 3;  1EQK A;  3G4S 3;  2UGI A;  2UX0 A;  1BNI A;  4OK0 A;  2PZV A;  4RNZ A;  1DET A;  3CD6 3;  1N8Q A;  3CCL 3;  1FGM A;  1RLS A;  2CK3 H;  3NX0 A;  1SIH A;  1WMO A;  3F40 A;  1O7M B;  1U8C B;  3I55 3;  3F14 A;  1K41 A;  1MGR A;  1OGX A;  3QK9 A;  4STD A;  5AIF A;  1A2V A;  2J8X B;  1YIT 3;  4EV2 A;  2O9U X;  2XSH B;  1OUN A;  4CPK A;  1YI2 3;  1Q86 4;  3X3Z A;  4N6T A;  4XBX A;  3G71 3;  2Z76 A;  1FUT A;  1CQS A;  2IMJ A;  1N8R 4;  2KF5 A;  3FG4 A;  3AMO B;  1UDI I;  2KCD A;  1GY6 A;  3KII A;  2V1L A;  3MSO A;  4LEH A;  3S28 A;  4L8O A;  4R4K A;  5AIG A;  3FH1 A;  1I2G A;  1UCI A;  2M7O A;  2ZL8 A;  3EBY A;  1QAL A;  1PYL A;  3UL5 A;  5M18 A;  3CPO A;  1I8V A;  1MWU A;  3HK4 A;  3KZT A;  4KFF A;  2OCT A;  1I2E A;  1T5Y A;  5EQL A;  4J5G A;  3CCS 3;  3EBT A;  3DGN A;  5GSP A;  3IJE B;  5BVB A;  2JQ5 A;  1T3B A;  4RNT A;  1FYS A;  1UCJ A;  1W7C A;  1JB5 A;  4N6O B;  1JKG A;  2KXG A;  1W5Z A;  1RN7 A;  2L1S A;  1UCK A;  2IY2 A;  1DVC A;  3DGY A;  3V92 A;  2WGQ A;  1RCK A;  3NM7 A;  4EW5 A;  5CF1 A;  1BNG A;  3CCM 3;  1RGL A;  3CNM A;  1OHO A;  3ZG5 A;  2GBX B;  5AYR B;  3FCS B;  3G16 A;  2BMQ B;  4HM8 B;  5IG3 A;  5AEU B;  4H61 A;  1B21 A;  1M1X B;  4NRE A;  3FLJ A;  1VQ8 3;  1V58 A;  2Y74 A;  1US1 A;  2H0I A;  2CX0 A;  3FG1 A;  1TU5 A;  1Y4K A;  3D3L A;  3S27 A;  3X42 A;  3JUO A;  1S5A A;  2HMO B;  3ER7 A;  3PS8 A;  4IIA A;  5STD A;  1HKX A;  3EB8 A;  2H0G A;  2UUG C;  1M90 4;  2XRX B;  1AR0 A;  3WOD G;  1LXE A;  2F86 B;  3F8H A;  2F4Y A;  4O2H A;  3B7C A;  3EF8 A;  3M8C A;  3ZFZ A;  1GOY A;  1W2Z A;  3B8L A;  3BIR A;  1MNL A;  2YX9 A;  3NHX A;  6STD A;  3CPW 2;  5HOH A;  1Q9E A;  2CHC A;  3CCQ 3;  3OX9 A;  1B27 A;  2W56 A;  1MGW A;  8RNT A;  3RNT A;  1RKY A;  3GZB A;  1QMA A;  1IQX A;  1JN5 B;  1O7H B;  3H3H A;  5HGR A;  1RNT A;  3JVC A;  2CWV A;  1F8N A;  1G02 A;  2BU4 A;  3T0U A;  3VF1 A;  1GYB A;  3LTD A;  5AI1 A;  1B2U A;  3EN1 B;  1G0T A;  4PEJ A;  2GEY A;  4MJD A;  2OTL 3;  4GSP A;  4R80 A;  3MG2 A;  1WNH A;  1JZD A;  1WMN A;  1MWT A;  3DY5 A;  3MG3 A;  1W2B 2;  1FW7 A;  2ML6 A;  4HAA A;  4BL3 A;  5KP1 A;  2GXF A;  2GEX A;  4IPB A;  2OOV A;  2CG0 A;  2A15 A;  4AEQ A;  1IQY A;  1D6Z A;  2BMO B;  3RGR A;  1JB2 A;  3HI7 A;  4N3V A;  2W2C A;  1BUQ A;  1B2Z A;  3L0R A;  1W4N A;  4XDW A;  2F99 A;  3WMD A;  3CMA 3;  1SPU A;  1VQ6 3;  1TTO A;  3DZL A;  3SYU A;  3EHC A;  1BSA A;  3HOH A;  1JZO A;  4Q53 A;  1W6G A;  4KT3 B;  1LOX A;  1OHP A;  3URP A;  4RZM A;  3ZG0 A;  3CCE 3;  1JB4 A;  1GOU A;  4NPB A;  5FGO A;  2RSX A;  4O02 B;  2BNG A;  2IUJ A;  1NWW A;  2F56 A;  1OAC A;  2W03 A;  1IYY A;  4JRF A;  4X2H A;  3KSE D;  3GRD A;  1NU3 A;  4FR9 A;  1RGK A;  3UL6 A;  3CCJ 3;  1VQN 3;  3STD A;  1E3R A;  1QJG A;  1Q7Y 4; 
#chains in the Genus database with same CATH homology
 1TIJ A;  3U97 A;  1A67 A;  1YHQ 3;  3MWZ A;  2D1W A;  5D81 A;  4WP5 A;  1LVN A;  3I56 3;  3A76 A;  4LGQ A;  2D42 A;  2Z77 A;  7STD A;  4GL6 A;  3WOF B;  3KSP A;  5AIH A;  1KSI A;  5KP4 A;  3AMO A;  3JUN A;  3S5C A;  1IV7 A;  3LH4 A;  1OF5 B;  3CCR 3;  2STD A;  1O7W B;  5IER A;  5CLK A;  4CDL A;  4EC6 A;  1AVL A;  3J7Y d;  3BNB A;  1QAF A;  5CK6 A;  1KQS 2;  5FW5 A;  3X40 A;  2GU3 A;  1FGT A;  4EYC A;  2L4V A;  3LML A;  5D83 A;  1IV9 A;  3DXO A;  3PGB A;  3SVA A;  3SXX A;  2W9P A;  1ZX2 A;  3UNL A;  3V98 A;  2W0Q A;  1NJI 4;  3PCR A;  1EA2 A;  3ALA A;  1U5O A;  4L7K A;  1YJW 3;  3NV0 B;  1SQW A;  4K90 B;  4H3U A;  4HM5 B;  3OWS A;  3SOA A;  3B4P A;  4LZI A;  3G8Z A;  1FA3 A;  2CKF B;  1FUW A;  1VZZ A;  4EBG A;  3RGA A;  3CCV 3;  1O7N B;  1O7P B;  1QAK A;  3SLU A;  3U1W A;  4KFE A;  5LC7 A;  3DGL A;  2CWU A;  3LTC A;  2CW9 A;  1QVF 2;  3FF0 A;  3MHE A;  3EC9 A;  3FSD A;  2BMR B;  3WA2 X;  2CG1 A;  1CYV A;  1A2K A;  1VQ9 3;  4R9K A;  1OGZ A;  3K5T A;  4BTW A;  1ULJ B;  2WOF A;  2IUK A;  3GAX A;  3JUP A;  1W6Y A;  3EJV A;  3JUQ A;  3OWU A;  5IG0 A;  3D9R A;  1IT7 A;  3HZP A;  3KE7 A;  4RNY A;  4XM4 A;  2RGQ A;  3LOY A;  1K28 A;  1EKM A;  1KD1 4;  1N9E A;  4HM6 B;  4XDV A;  1K8A 4;  3DUK A;  1Q40 A;  4FCM A;  3NBB A;  3X41 A;  3S67 A;  1Q82 4;  1STF I;  4MMX B;  1Q81 4;  4TX4 A;  2WOH A;  2CFK A;  1EG9 B;  2B1X B;  1VQ5 3;  2CFW A;  5IG5 A;  1R4C A;  1W02 A;  2P0X A;  3CC4 3;  4HBR A;  4XBY A;  1V74 A;  2P0M A;  2YFI B;  3GZR A;  4MMZ B;  1AV4 A;  1DYU A;  2LQV A;  3DMC A;  1C7H A;  2XGL A;  3EN8 A;  3NBJ A;  4O3V A;  3F9S A;  5KP3 A;  5JBS A;  2XF3 A;  3CXC 2;  3Q1C A;  3BLZ A;  1GY5 A;  2B24 B;  2P38 A;  2Z7A A;  3PCS A;  3LTB A;  4WYK B;  8CHO A;  4HM1 B;  1QVG 2;  2E2U A;  1RRL A;  3HX8 A;  3KN4 A;  4K61 A;  2GU1 A;  2WGO A;  1J2B A;  3GZY B;  4R9L A;  4AKZ A;  3NXJ A;  3FKA A;  4K1U A;  4ZM8 A;  3LZA A;  1N5P A;  3UJM A;  2BT3 A;  2Y73 A;  1VQL 3;  1NO3 A;  5TGN A;  3SX1 A;  2XFS A;  3CC7 3;  2O3O A;  1MOL A;  2OWP A;  2BHM A;  1TFK A;  3OW2 2;  2OTJ 3;  2QEX 3;  3BND A;  1GD4 A;  4FMC A;  1YVB I;  4OVM A;  1IVX A;  4FCZ A;  2SBL A;  2Q07 A;  3CNX A;  3LXU X;  1VQM 3;  2E2V A;  1D6U A;  1TFO A;  2LYX A;  5AEW B;  2KRT A;  2QIY A;  4AKY A;  1KWI A;  1M1K 4;  3FF2 A;  2P05 A;  4BTX A;  1YIJ 3;  2C10 A;  2XR8 B;  4HVN A;  3PXM A;  2QGU A;  3SOY A;  2WO0 A;  4WFO A;  3WDG B;  4ORL A;  4WHA A;  1OPY A;  2XGN A;  1ROA A;  4N6V 0;  1SII A;  2OQE A;  1VQP 3;  4HYZ A;  4LSO A;  1WMP A;  2R4I A;  3WOE B;  1OHS A;  5BXQ A;  5IW9 A;  1NDO B;  3NV0 A;  4K1V A;  5JPU A;  3EQQ B;  1ULI B;  3OV4 A;  1N5H A;  1A90 A;  3ECF A;  3CCU 3;  4I4K A;  1Q42 A;  3SED A;  4BTY A;  4G1M B;  1IQ8 A;  1NB3 I;  3FZW A;  1PU4 A;  1IK3 A;  2HMK B;  2MF7 A;  5JPP A;  1IVU A;  4HM7 B;  4QWT A;  3JUM A;  4NHF A;  1CEW I;  4FMB A;  2HML B;  3E99 A;  5DRE A;  1CYU A;  3NQY A;  5AII A;  1DMN A;  2I9W A;  2W9Q A;  3V99 A;  2CH9 A;  1GY7 A;  2GBW B;  1JJ2 2;  5LC6 A;  3HIG A;  3MYT A;  1NB5 I;  4HKV B;  3BB9 A;  3QRD A;  5DRV A;  3I0Y A;  2MC8 A;  5EEO A;  3F8X A;  1KC8 4;  2JDI H;  3H51 A;  2W6J H;  4HM4 B;  1STD A;  3OXA A;  3G6E 3;  5IEP A;  5IG4 A;  4U13 A;  3G0K A;  5ELU A;  4XBT A;  3S29 A;  1WQL B;  3OWY A;  4WWU C;  5ELJ A;  3B4O A;  3KKG A;  4N6M A;  4KFD A;  3HII A;  1YGE A;  3K0Z A;  3K63 A;  1JNQ A;  1E97 A;  1UI7 A;  1UI8 A;  2YFJ B;  4HJL B;  2E2T A;  3NUV A;  1OCV A;  3T8N A;  3VSY A;  3Q2P A;  2ZDJ A;  3MG1 A;  3PYJ A;  2FXT A;  3DGM A;  1FGO A;  1K9M 4;  1JN5 A;  1UUW B;  4HM0 B;  4JF8 A;  3BNE A;  4WYK A;  1UW1 A;  1VQO 3;  4CCV A;  4KVH A;  1ROV A;  2CFD A;  5IF6 A;  4X2O A;  4FCJ A;  1DVD A;  4HM3 B;  2XSO B;  4XB5 A;  4HZB B;  3UB1 A;  5G2G A;  1SJW A;  4HM2 B;  2HMJ B;  1IVV A;  3X3X A;  1VQ4 3;  2CWT A;  1ASK A;  3LT9 A;  3MKI A;  3NM2 A;  4MEI A;  3GZX B;  1HU9 A;  1JKG B;  1O7G B;  1OH0 A;  1YJN 3;  2RFR A;  3IPT A;  3T8U A;  1DMQ A;  2IA7 A;  3DGO A;  5IEN A;  3LTA A;  3LT8 A;  1E3V A;  1JV2 B;  2XH9 A;  4N6N B;  4FMA A;  3N8B A;  2CC3 A;  3Q90 A;  1GD3 A;  3RDE A;  3ROB A;  1AVK A;  1ZO2 A;  2ML5 A;  5I97 A;  2INX A;  1L5G B;  1RRH A;  1N9J A;  3WA3 A;  3FGY A;  2CFG A;  2BO9 B;  1GS3 A;  1LNH A;  1TUH A;  1Q40 B;  4O8S A;  4OUQ A;  3KFQ C;  1ISK A;  2HMN B;  2P09 A;  3N9H A;  2CFL A;  1WTH A;  3CU3 A;  1IDP A;  4MMY B;  2YFL B;  1D6Y A;  4J9A A;  3MPH A;  2Z6B A;  3N54 B;  1RJO A;  2PNC A;  1FGR A;  1FGQ A;  4N6U A;  3FG3 A;  1W01 A;  4FMD A;  3BNC A;  2OOV C;  4LMI A;  2QA4 3;  3NQZ A;  4R1K A;  3K9M C;  4HZ9 B;  1OF5 A;  1Z1S A;  4KZ1 A;  1K73 4;  5EVH A;  3CME 3;  2XFT A;  5D82 A;  2W56 B;  4N6L A;  5CF2 A;  3EE1 A;  5IEO A;  2K0M A;  1IT8 A;  3F7X A;  5AYS C;  2XEP A;  1IU7 A;  3PZW A;  4EXR A;  1TP6 A;  1VQ7 3;  2RCD A;  3CC2 3;  3X3Y A;  1W6C A;  3NBR A;  4EV5 A;  5A0O B;  2C11 A;  1JRQ A;  1DMM A;  1PFP A;  1G96 A;  3EX9 A;  2FGT A;  3DM8 A;  1UUV B;  3K7C A;  1YJ9 3;  3IMA B;  2OQE C;  1VQK 3;  2FNQ A;  3F7S A;  3VGN A;  1IVW A;  3O8Y A;  1W00 A;  2HMM B;  1M9G A;  4IT7 A;  3TDG A;  3GWR A;  4GB5 A;  2F98 A;  2W04 A;  3LYG A;  4J8T A;  2K54 A;  4L8P A;  4RBN A;  1M90 4;  2CIU A;  5CXO A;  1S72 3;  1EQK A;  3G4S 3;  2UX0 A;  4OK0 A;  2PZV A;  4RNZ A;  3CD6 3;  1N8Q A;  3CCL 3;  1FGM A;  2CK3 H;  3NX0 A;  1SIH A;  1WMO A;  3F40 A;  1O7M B;  1U8C B;  3I55 3;  3F14 A;  1K41 A;  1OGX A;  5AIF A;  3QK9 A;  4STD A;  1A2V A;  1YIT 3;  4EV2 A;  2O9U X;  2XSH B;  1OUN A;  1YI2 3;  1Q86 4;  3X3Z A;  4N6T A;  4XBX A;  3G71 3;  2Z76 A;  1CQS A;  2IMJ A;  1N8R 4;  3KII A;  3FG4 A;  3AMO B;  2KCD A;  1GY6 A;  2V1L A;  3MSO A;  4LEH A;  3S28 A;  4L8O A;  4R4K A;  5AIG A;  3FH1 A;  2M7O A;  2ZL8 A;  3EBY A;  1QAL A;  3UL5 A;  3CPO A;  3HK4 A;  3KZT A;  4KFF A;  2OCT A;  1T5Y A;  5EQL A;  3CCS 3;  3EBT A;  3DGN A;  3IJE B;  5BVB A;  2JQ5 A;  1W7C A;  4N6O B;  1JB5 A;  1JKG A;  2KXG A;  1W5Z A;  1RN7 A;  3V92 A;  1DVC A;  2WGQ A;  5CF1 A;  3NM7 A;  3CCM 3;  3CNM A;  1OHO A;  2GBX B;  5AYR B;  3FCS B;  3G16 A;  2BMQ B;  4HM8 B;  5IG3 A;  5AEU B;  4H61 A;  1M1X B;  4NRE A;  3FLJ A;  1VQ8 3;  2Y74 A;  1US1 A;  3FG1 A;  1TU5 A;  1Y4K A;  3D3L A;  3S27 A;  3X42 A;  3JUO A;  1S5A A;  2HMO B;  3ER7 A;  3PS8 A;  4IIA A;  5STD A;  1HKX A;  3EB8 A;  2XRX B;  1AR0 A;  3WOD G;  1LXE A;  2F86 B;  3F8H A;  4O2H A;  3B7C A;  3EF8 A;  3M8C A;  1W2Z A;  3B8L A;  1MNL A;  2YX9 A;  3NHX A;  6STD A;  3CPW 2;  2CHC A;  3CCQ 3;  3OX9 A;  2W56 A;  1RKY A;  3GZB A;  1QMA A;  1IQX A;  1JN5 B;  1O7H B;  3H3H A;  5HGR A;  3JVC A;  2CWV A;  1F8N A;  3T0U A;  3VF1 A;  1GYB A;  3LTD A;  5AI1 A;  3EN1 B;  4PEJ A;  2GEY A;  4MJD A;  2OTL 3;  4R80 A;  3MG2 A;  1WNH A;  1WMN A;  3DY5 A;  3MG3 A;  1W2B 2;  2ML6 A;  5KP1 A;  2GXF A;  2GEX A;  4IPB A;  2OOV A;  2CG0 A;  2A15 A;  4AEQ A;  1IQY A;  1D6Z A;  2BMO B;  3RGR A;  1JB2 A;  3HI7 A;  4N3V A;  2W2C A;  1BUQ A;  3L0R A;  1W4N A;  4XDW A;  2F99 A;  3WMD A;  3CMA 3;  1SPU A;  1VQ6 3;  3DZL A;  3EHC A;  4Q53 A;  1W6G A;  1LOX A;  1OHP A;  4RZM A;  3CCE 3;  1JB4 A;  5FGO A;  2RSX A;  4O02 B;  2BNG A;  2IUJ A;  1NWW A;  2W03 A;  1OAC A;  4JRF A;  4X2H A;  3KSE D;  3GRD A;  1NU3 A;  4FR9 A;  3CCJ 3;  3UL6 A;  1VQN 3;  3STD A;  1E3R A;  1QJG A;  1Q7Y 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...