2OWPA

Crystal structure of a cystatin-like fold protein (bxe_b1374) from burkholderia xenovorans lb400 at 2.00 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'GMEVNQPDIVAQVQAAFVEYERALVENDIEAMNALFWHTPETVRYGIAEVQHGGEAIRAWRERCEPVPKSRKLHRTVVTTFGTDFATVSTEFTSDATPLLGRQMQTWARLSPADGWKIVAAHVSLIAMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Bxe_B1374
publication title Crystal structure of hypothetical protein Bxe_B1374 (YP_553940.1) from Burkholderia xenovorans LB400 at 2.00 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Unknown function
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11533 DUF3225 Protein of unknown function (DUF3225)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2owpA00
1JN5B 3G8ZA 5D82A 3F7XA 1E3RA 5JPPA 2W2CA 3MG1A 3H51A 3FF2A 1JB4A 3GZBA 3OWSA 4R9LA 1HKXA 3GWRA 2XSOB 1VZZA 1AR0A 3RGAA 4L8OA 5IG3A 1OHOA 3EBYA 3B4PA 4K1VA 3DM8A 3S5CA 4XB5A 4HM3B 1S5AA 3JUQA 3NBRA 3DZLA 2Z7AA 3UJMA 3MYTA 3BLZA 4XDWA 5HGRA 4J8TA 2XSHB 1GYBA 3VGNA 3CNMA 4MJDA 1OHPA 3KKGA 1Q42A 4WYKA 4LEHA 2QIYA 1TP6A 5KP3A 4HM8B 3RGRA 3STDA 1QMAA 4HM7B 1TUHA 1W6YA 3E99A 3EHCA 3F14A 5IERA 1JB2A 2BMRB 1WQLB 5DRVA 4I4KA 1K41A 2F86B 1E97A 5IG5A 4CDLA 5CLKA 1DMMA 1ULIB 2HMOB 3CNXA 3B4OA 4R1KA 4WP5A 2HMMB 3FLJA 4LMIA 1OH0A 1NWWA 3FSDA 2A15A 3EN8A 2JQ5A 4HM1B 3NV0A 4ORLA 5DREA 5G2GA 2YFIB 3F8HA 3ER7A 1GY7A 1O7PB 3SEDA 3CU3A 5CF2A 1JKGB 3FKAA 1O7GB 3OV4A 1Q40B 5AEWB 5BXQA 3I0YA 4HM0B 2GXFA 6STDA 1W02A 2YFJB 5D83A 3F7SA 3EX9A 5FW5A 2HMJB 4HM6B 2YFLB 4U13A 4XBYA 4HM4B 2QGUA 1OCVA 1GY5A 1OUNA 1EG9B 3T8UA 5CK6A 2K54A 4XM4A 2Z76A 3K0ZA 3EN1B 3H3HA 4OUQA 3FGYA 4HVNA 1C7HA 1OF5A 3MHEA 1JB5A 3HK4A 3OWYA 4LGQA 2HMLB 2RGQA 3A76A 1ASKA 2GBWB 3BB9A 3LYGA 4H3UA 3IPTA 5STDA 1O7NB 3G16A 2BMQB 3D9RA 3SOAA 1NU3A 3DUKA 3OXAA 3F9SA 2BMOB 2GEXA 2HMNB 5IG4A 1O7WB 5BVBA 5CXOA 1JN5A 5TGNA 1GY6A 5AIGA 3VSYA 3B7CA 3G0KA 1E3VA 4HM5B 3WMDA 3M8CA 3F8XA 5KP1A 2RFRA 3MG2A 3JUMA 4WYKB 1STDA 1W00A 1OPYA 2BNGA 2UX0A 3GRDA 4FCJA 3T8NA 3GZYB 1Z1SA 3KSPA 1ISKA 4OVMA 3FH1A 2INXA 4X2OA 4J9AA 3CPOA 4PEJA 5JPUA 4GB5A 1SJWA 3DXOA 4L7KA 4XBXA 2I9WA 4R9KA 5KP4A 1OGXA 3JUPA 1NDOB 1GS3A 5IENA 4HM2B 3UNLA 5AI1A 5IF6A 3EC9A 3MG3A 3NHXA 1EA2A 2F99A 3HZPA 1A2KA 4HJLB 3OX9A 3NV0B 4HZ9B 4N3VA 2CHCA 3KE7A 4IIAA 1UUVB 3NXJA 5IEOA 2IMJA 1BUQA 4Q53A 4RZMA 3EQQB 1ULJB 3OWUA 4FCMA 2B1XB 2PZVA 3K7CA 4STDA 4XBTA 3GZRA 5D81A 1O7HB 4XDVA 1DMNA 1QJGA 5IEPA 3EF8A 3JUOA 2RCDA 4WWUC 1OGZA 3MKIA 1JKGA 3FZWA 1U5OA 3NM2A 2R4IA 2B24B 1Q40A 8CHOA 1UUWB 3B8LA 5IG0A 3ECFA 3EBTA 3KZTA 3LZAA 5AIFA 1IDPA 5AEUB 4L8PA 3NUVA 1OF5B 5AIHA 4KVHA 3F40A 2GBXB 2OWPA 3DMCA 2CKFB 1W01A 3EJVA 2Z77A 1ZX2A 2XRXB 1O7MB 3MSOA 4HKVB 4HZBB 5EVHA 3JUNA 5CF1A 3Q90A 3GZXB 4X2HA 2GEYA 3HX8A 5AIIA 1OHSA 2F98A 1CQSA 2XR8B 3SOYA 2HMKB 3ROBA 7STDA 1DMQA 4K1UA 1ZO2A 2STDA 3FF0A
chains in the Genus database with same CATH superfamily
1PY3A 1JN5B 3Q3FA 1NJI4 3G8ZA 5D82A 1M904 3A5EA 1I2FA 3F7XA 5AYRB 1US1A 1E3RA 1Y4KA 1T5YA 5JPPA 1GMQA 2W2CA 1OACA 3MG1A 1BRGA 3H51A 1SIIA 2KRTA 2UGIA 1JB4A 3FF2A 1VQ43 3GZBA 2FNQA 3OWSA 1GMPA 1YJ93 3NQYA 1JJ22 1IQXA 1VQO3 4R9LA 1HKXA 3GWRA 2XSOB 1VZZA 1AR0A 3RGAA 4L8OA 1BRSA 5ELJA 5IG3A 2CWTA 1OHOA 3EBYA 1I0VA 4EXRA 4FCZA 3FCSB 2MF7A 1T2HA 2UUGC 2ZL8A 2XFSA 3CXC2 1DYUA 3B4PA 4K1VA 2KXGA 3EE1A 3DM8A 1VQ73 3D5GA 3S5CA 1MWTA 4TX4A 4XB5A 2CX1A 4HM3B 1BRHA 3KIIA 1D6UA 1MWRA 1S5AA 1FGRA 2Z6BA 1N9JA 3JUQA 4EW5A 1FGQA 3NBRA 3DZLA 2SARA 2Z7AA 3UJMA 2BO9B 2OQEA 3TDGA 3MWZA 2WOFA 3LT9A 3PZWA 2AAEA 1W2ZA 3D4AA 3BLZA 3MYTA 4XDWA 3GAXA 5HGRA 3X41A 3ZFZA 1VQP3 2F5MA 1IVWA 4J8TA 2XSHB 3BIRA 1GYBA 3VGNA 1BNGA 1RN7A 1YNVX 3CNMA 3BNDA 4MJDA 2F4YA 1ZGXA 2CFLA 3UL5A 1VQL3 1T3BA 4BTWA 1OHPA 3KKGA 3NBBA 5EEOA 1LOYA 1Q42A 2HOHA 1V57A 4WYKA 1RCLA 3PXMA 3L0RA 4LEHA 2QIYA 3VF1A 1BU4A 1AV4A 1TP6A 3DGNA 5KP3A 3K9MC 1TRPA 2BU4A 1DETA 3CCR3 1G0TA 3V92A 1X1XA 4HM8B 3RGRA 1LOWA 3STDA 3AGOA 5I97A 1QMAA 1RGLA 1IVUA 3CCM3 1MNLA 1TIJA 2PNCA 2XEPA 3ZG5A 2XFTA 3S27A 1Q864 4HM7B 1Q7Y4 3G6E3 5IW9A 1TUHA 5GSPA 1A67A 1BSCA 3AMOA 1IT7A 3IMAB 1W6YA 4EC6A 3DGOA 3E99A 1VQN3 3WOEB 4MMZB 4EV2A 3WHOA 3CCQ3 2O3OA 4FMDA 2RNTA 3X3ZA 3CMA3 1JZDA 1D6YA 3CCU3 1VQ83 2OTL3 1GOUA 3EHCA 3F14A 4I5QA 5IERA 1JB2A 2Y73A 1I2EA 2BMRB 2CH9A 5DRVA 5M1AA 4I4KA 3I553 2WGQA 2W04A 1RJOA 1K41A 2F86B 1E97A 4KZ1A 1QVG2 3LTAA 4CDLA 5IG5A 2W9QA 1YIT3 4JF8A 4JRFA 5CLKA 1DMMA 1ULIB 2HMOB 3CNXA 1YI23 4KFEA 1BRKA 3B4OA 1DE3A 1YVSA 1JRQA 2OCTA 4R1KA 3IJEB 4KT3B 4AKYA 2IY2A 4WP5A 3SYUA 2HMMB 2KAAA 3FLJA 4IT7A 4LMIA 1OH0A 1NWWA 3FSDA 4CPKA 1STFI 4N6UA 1HZ1A 2OOVA 2A15A 1BRIA 2CG1A 3EN8A 2JQ5A 4HM1B 3NV0A 3U1WA 4N6MA 1I8VA 4ORLA 1M9GA 5DREA 1BSAA 2Q07A 1L5GB 3CPW2 5G2GA 2YFIB 1BGSA 1I0XA 3F8HA 4FMCA 4DKIA 3ER7A 1GY7A 1O7PB 1RCKA 3SEDA 1ROVA 2L1SA 3CU3A 2E2VA 1MGRA 2ZDJA 3NX0A 3CC23 3HI7A 2GSPA 1HU9A 1R4CA 3WODG 1B2UA 1JKGB 1GSPA 1YGWA 3WOFB 5CF2A 3FKAA 3NBJA 4RNTA 1RDSA 3N54B 1UUGB 1RKYA 1FGMA 1B21A 3DGLA 3N8BA 1O7GB 1I3IA 2ZHXB 3AMOB 4BTXA 8RNTA 3ZG0A 3OV4A 1Q40B 5AEWB 4FMBA 2E2UA 5BXQA 3G4S3 1NB5I 3I0YA 1LNIA 1GD4A 3X40A 4KFDA 5G1KA 1G02A 1PU4A 1WMNA 1BANA 1QAKA 2GU3A 3KN4A 4HM0B 4FR9A 1WNHA 1UI7A 1RMSA 2GXFA 5FGOA 4KFFA 1W02A 5LC6A 6STDA 2J8XB 2O9UX 2YFJB 3F7SA 5D83A 1UGHI 3QK9A 2WGOA 3EX9A 1IQYA 2Y74A 3BNEA 5FW5A 2HMJB 3SLUA 4HM6B 2YFLB 2P05A 4O8SA 4U13A 4RBNA 4CJNA 1B2ZA 2W56A 4XBYA 4HM4B 2CK3H 1GOYA 5M19A 1A90A 1SARA 4LYLB 1QAFA 4GL6A 1UDII 4O2HA 4RNYA 7RNTA 2QGUA 1EQKA 1OCVA 1GY5A 1I70A 1OUNA 1MOLA 1EG9B 3T8UA 5CK6A 1RLSA 1W2B2 2QA43 2E2TA 1N9EA 3V98A 1FUWA 3UL6A 3BNBA 2K54A 1RGEA 4XM4A 1JV2B 1KQS2 4BIRA 3I563 2IYJA 1N8R4 2Z76A 3KCHA 4H61A 3FG4A 5BU4A 3K0ZA 1GD3A 1RGHA 1Q814 1BSDA 2GU1A 1UCIA 3KFQC 3EN1B 3H3HA 4AKZA 9RNTA 3X3YA 1TFKA 4MMXB 4OUQA 3LOYA 1QVF2 2XGNA 1Q7HA 1RN4A 3FGYA 4HVNA 1C7HA 1VQK3 1OF5A 3MHEA 1FGOA 4FMAA 4GSPA 1JB5A 1LXEA 1UGIA 2CWVA 3HK4A 3OWYA 4LGQA 1IU7A 2HMLB 2RGQA 2OQEC 3LT8A 1KWIA 1BSEA 1V58A 2ML5A 3A76A 3U97A 1EUIC 3MPHA 4WHAA 1RGFA 1ASKA 1RGAA 2GBWB 2RSXA 1EKMA 4CCVA 1IK3A 4BL3A 4RNZA 3BB9A 3LYGA 1K28A 4O02B 4H3UA 1VQM3 3NQZA 1CH0A 2C11A 1A2PA 2KF5A 3IPTA 3JVCA 4NPBA 1U8CB 4N6TA 1ZS7A 3HIIA 5STDA 2P0MA 2CW9A 1O7NB 3G16A 3WDGB 3CME3 2BMQB 1X1YA 2W03A 2CFKA 1D6ZA 3D9RA 3SOAA 1NU3A 1B2SA 1X1UA 2F56A 3DUKA 3OXAA 4NHFA 1PYLA 1RGCA 3F9SA 4AEQA 2BMOB 2CFDA 4EBGA 1W7CA 4WFOA 1BIRA 5EQLA 2LQVA 2GEXA 1JZOA 1B3SA 1UCJA 1T2IA 2HMNB 2ZA4A 4ILFA 1O7WB 3RDEA 5BVBA 1N5PA 5IG4A 5CXOA 4BU4A 1JN5A 1RGGA 2V1LA 3DGYA 4NREA 5TGNA 2IUKA 3J7Yd 1GY6A 1NB3I 5AIGA 3VSYA 4N6V0 3B7CA 4G1MB 1K9M4 1KSIA 3G0KA 3NM7A 3O8YA 3LXUX 1E3VA 4HM5B 3WMDA 2FGTA 3M8CA 3F8XA 3CCS3 4LZIA 5KP1A 1WMOA 4OK0A 3D79A 1FGTA 1KD14 2RFRA 3FG1A 3MG2A 4HOHA 3JUMA 4WYKB 1JNQA 2KCDA 1R4YA 3FG3A 1BSBA 3LTCA 1STDA 1B2MA 2CX0A 1W00A 3X3XA 1FYSA 1BRNL 1OPYA 2BNGA 2UX0A 3X42A 2RBIA 4HYZA 1BNSA 3EB8A 2W9PA 4GHOA 4N6LA 3GRDA 4FCJA 2F5WA 5BIRA 2YX9A 3T8NA 1BNJA 4IPBA 3GZYB 1Z1SA 3KSPA 2OOVC 1ISKA 1RRLA 1EEJA 1N5HA 1C54A 4OVMA 1BNEA 3WA2X 3CCL3 1N8QA 3DY5A 3FH1A 1LQMB 2P38A 1I2GA 2INXA 5M18A 4X2OA 2L4VA 3S67A 4J9AA 4HBRA 3CPOA 1B2XA 4PEJA 1GMRA 3AHWA 2FXTA 5JPUA 4GB5A 1SJWA 1WMPA 1YVBI 2P09A 3DXOA 1ROAA 1UCLA 1BOXA 1YGEA 1CYVA 4L7KA 4XBXA 2I9WA 2CWUA 4R9KA 5KP4A 1OGXA 1RGKA 2BT3A 3JUPA 1SQWA 1NDOB 2IUJA 1GS3A 1BNRA 1W6GA 5IENA 4HM2B 1YIJ3 2D1WA 3BU4A 3UNLA 5AI1A 1MGWA 5IF6A 1DVCA 3EC9A 5JBSA 3URPA 3MG3A 1RSNA 2IA7A 1BNFA 1HYFA 3NHXA 1EA2A 2F99A 3HZPA 1BAOA 1KC84 1JBTA 1MWUA 3BNCA 1A2KA 5A0OB 2K0MA 3K5TA 3N9HA 4HJLB 3OX9A 5G1LA 2XGLA 3NV0B 4HZ9B 1LRAA 1SPUA 2MC8A 3S29A 1AQZA 1RRHA 1MWSA 1UI8A 1IT8A 4N3VA 1QALA 1NNVA 1RNTA 3DH2A 3CC43 3PYJA 2CHCA 3KE7A 2R41A 4IIAA 1UUVB 3NXJA 2OTJ3 2H0HA 1IV9A 3G713 5IEOA 1F8NA 1CEWI 2IMJA 1BUQA 1DVDA 1W6CA 3Q2PA 1LOXA 3UB1A 4Q53A 2WO0A 4RZMA 4R80A 2QEX3 3EQQB 3LH4A 2SBLA 1S723 2AADA 1ULJB 3KSED 3OWUA 4FCMA 1FZUA 4R4KA 1VQQA 2B1XB 1B27A 2PZVA 3LTDA 1IVXA 1AY7A 1UCKA 5AYSC 3SXXA 1GOVA 3K63A 3K7CA 3D5IA 1RN1A 4STDA 1K8A4 3CC73 3PCSA 4XBTA 3GZRA 5D81A 1TTOA 3PCRA 1O7HB 4N6OB 3ALAA 4XDVA 1DMNA 1LQGC 6GSPA 1PFPA 1QJGA 5IEPA 3EF8A 4BTYA 3HIGA 3JUOA 2RCDA 4K90B 3PGBA 4WWUC 3OW22 2BHMA 1OGZA 2P0XA 1AVKA 4K61A 1CYUA 5RNTA 2W56B 1BVIA 4J5KA 4N6NB 2KF3A 5HOHA 3MKIA 3WA3A 1FA3A 4MMYB 1JKGA 1BNIA 1U5OA 3FZWA 3D3LA 3NM2A 1IYYA 1I3FA 1TFOA 4O3VA 5ELUA 1TU5A 1YJN3 1W5ZA 1G96A 2R4IA 1YHQ3 2B24B 1Q40A 3PS8A 8CHOA 2D42A 5LC7A 1X1WA 1UUWB 3B8LA 5IG0A 3ECFA 1M1K4 2M7OA 1BRJA 2CFGA 3LTBA 3V99A 3HOHA 1RNBA 3EBTA 3KZTA 3LZAA 3WR2A 5AIFA 2KF6A 4EV5A 1LNHA 2JDIH 3GSPA 3LMLA 3SX1A 1IDPA 1LOVA 1JBSA 4MEIA 1TRQA 1BUJA 3RNTA 1VQ53 1IV7A 5AEUB 4L8PA 3NUVA 4LSOA 3FF0A 2CIUA 3CCV3 1Q824 2CG0A 3CCJ3 1OF5B 2CC3A 3AGNA 3DGMA 1NO3A 5AIHA 2H0IA 4KVHA 3F40A 4QWTA 2GBXB 1Q9EA 1RTUA 2OWPA 3DMCA 1WTHA 2H0GA 2C4BA 2CKFB 3AHSA 1W01A 2WOHA 3EJVA 2W6JH 4J5GA 2Z77A 1ZX2A 1IQ8A 2W0QA 1K734 2CFWA 2XRXB 3SVAA 7GSPA 1O7MB 1J2BA 3MSOA 4HKVB 4HZBB 1VQ63 5EVHA 1W4NA 3QRDA 1YJW3 1JBRA 3JUNA 3CD63 6RNTA 5CF1A 1M1XB 3GZXB 3Q90A 1RHLA 4X2HA 2GEYA 3T0UA 1FW7A 3S28A 2C10A 3HX8A 1IVVA 1SIHA 2BIRA 5AIIA 1LVNA 1OHSA 2F98A 1CQSA 2XH9A 2XR8B 2LYXA 4BL2A 1V74A 3SOYA 2HMKB 3ROBA 1TJDA 7STDA 1B20A 1DMQA 4K1UA 2K3DA 4ZM8A 4EYCA 1AVLA 3CCE3 2ML6A 1ZO2A 2XF3A 1FUTA 4HAAA 3Q1CA 1UW1A 2KF4A 1VQ93 1A2VA 2STDA 1FUSA 1WQLB
chains in the Genus database with same CATH topology
1NJI4 1JN5B 3G8ZA 5D82A 1M904 3F7XA 5AYRB 1US1A 1E3RA 1Y4KA 1T5YA 5JPPA 2W2CA 1OACA 3MG1A 3H51A 1SIIA 2KRTA 3FF2A 1JB4A 1VQ43 3GZBA 2FNQA 3OWSA 1YJ93 3NQYA 1JJ22 1IQXA 1VQO3 4R9LA 1HKXA 3GWRA 2XSOB 1VZZA 1AR0A 3RGAA 4L8OA 5ELJA 5IG3A 2CWTA 1OHOA 3EBYA 4EXRA 4FCZA 3FCSB 2MF7A 2ZL8A 2XFSA 3CXC2 1DYUA 3B4PA 4K1VA 2KXGA 3EE1A 3DM8A 1VQ73 3S5CA 4XB5A 4TX4A 4HM3B 3KIIA 1D6UA 1S5AA 1FGRA 2Z6BA 1N9JA 3JUQA 1FGQA 3NBRA 3DZLA 2Z7AA 3UJMA 2BO9B 2OQEA 3TDGA 3MWZA 2WOFA 3LT9A 3PZWA 1S723 1W2ZA 3MYTA 3BLZA 4XDWA 5HGRA 3GAXA 3X41A 1VQP3 4J8TA 1IVWA 2XSHB 1GYBA 3VGNA 1RN7A 3CNMA 3BNDA 4MJDA 2CFLA 3UL5A 1VQL3 4BTWA 1OHPA 3KKGA 3NBBA 5EEOA 1Q42A 4WYKA 3VF1A 3PXMA 3L0RA 4LEHA 2QIYA 1AV4A 1TP6A 3DGNA 5KP3A 3K9MC 3CCR3 3V92A 4HM8B 3RGRA 3STDA 5I97A 1QMAA 1IVUA 3CCM3 1MNLA 1TIJA 2PNCA 2XEPA 2XFTA 3S27A 1Q864 4HM7B 1Q7Y4 3G6E3 5IW9A 1TUHA 1A67A 3AMOA 1IT7A 3IMAB 1W6YA 4EC6A 3DGOA 3E99A 1VQN3 3WOEB 4MMZB 4EV2A 3CCQ3 2O3OA 4FMDA 3X3ZA 3CMA3 1VQ83 1D6YA 3CCU3 2OTL3 3EHCA 3F14A 5IERA 1JB2A 2Y73A 2BMRB 2CH9A 5DRVA 3I553 4I4KA 2WGQA 2W04A 1RJOA 1K41A 2F86B 1E97A 4KZ1A 1QVG2 3LTAA 4CDLA 5IG5A 2W9QA 1YIT3 4JF8A 4JRFA 5CLKA 1DMMA 1ULIB 2HMOB 3CNXA 1YI23 4KFEA 3B4OA 1JRQA 2OCTA 4R1KA 3IJEB 4AKYA 4WP5A 2HMMB 4IT7A 3FLJA 4LMIA 1OH0A 1NWWA 3FSDA 1STFI 4N6UA 2OOVA 2A15A 2CG1A 3EN8A 2JQ5A 4HM1B 3NV0A 3U1WA 4N6MA 4ORLA 1M9GA 5DREA 2Q07A 1L5GB 3CPW2 5G2GA 2YFIB 4FMCA 3F8HA 3ER7A 1GY7A 1O7PB 3SEDA 1ROVA 3CU3A 2E2VA 2ZDJA 3NX0A 3CC23 3HI7A 1HU9A 1R4CA 3WODG 1JKGB 3WOFB 5CF2A 3FKAA 3NBJA 3N54B 1RKYA 1FGMA 3N8BA 3DGLA 1O7GB 3AMOB 4BTXA 3OV4A 1Q40B 5AEWB 4FMBA 2E2UA 5BXQA 3G4S3 1NB5I 3I0YA 1GD4A 3X40A 4KFDA 1PU4A 1WMNA 1QAKA 2GU3A 3KN4A 4HM0B 4FR9A 1WNHA 1UI7A 2GXFA 5FGOA 6STDA 4KFFA 1W02A 5LC6A 2O9UX 2YFJB 3F7SA 5D83A 3QK9A 2WGOA 3EX9A 1IQYA 2Y74A 3BNEA 5FW5A 2HMJB 3SLUA 4HM6B 2YFLB 2P05A 4O8SA 4U13A 4RBNA 2W56A 4XBYA 4HM4B 2CK3H 1A90A 1QAFA 4GL6A 4O2HA 4RNYA 2QGUA 1EQKA 1OCVA 1GY5A 1OUNA 1MOLA 1EG9B 3T8UA 5CK6A 1W2B2 2QA43 2E2TA 1N9EA 3V98A 1FUWA 3UL6A 3BNBA 2K54A 4XM4A 1JV2B 1KQS2 3I563 1N8R4 2Z76A 4H61A 3FG4A 3K0ZA 1GD3A 1Q814 2GU1A 4AKZA 3KFQC 3EN1B 3H3HA 3X3YA 1TFKA 4MMXB 4OUQA 3LOYA 1QVF2 2XGNA 3FGYA 4HVNA 1C7HA 1VQK3 1OF5A 3MHEA 1FGOA 4FMAA 1JB5A 1LXEA 2CWVA 3HK4A 3OWYA 4LGQA 1IU7A 2HMLB 2RGQA 2OQEC 3LT8A 1KWIA 2ML5A 3A76A 3U97A 3MPHA 4WHAA 1ASKA 2GBWB 2RSXA 1EKMA 4CCVA 1IK3A 4RNZA 3BB9A 3LYGA 1K28A 4O02B 4H3UA 1VQM3 3NQZA 2C11A 3IPTA 3JVCA 1U8CB 4N6TA 3HIIA 5STDA 2P0MA 2CW9A 1O7NB 3G16A 3WDGB 3CME3 2BMQB 2W03A 2CFKA 1D6ZA 3D9RA 3SOAA 1NU3A 3DUKA 4NHFA 3OXAA 3F9SA 4AEQA 4EBGA 2BMOB 2CFDA 1W7CA 4WFOA 5EQLA 2LQVA 2GEXA 2HMNB 5IG4A 1O7WB 3RDEA 5BVBA 1N5PA 5CXOA 1JN5A 2V1LA 4NREA 5TGNA 2IUKA 3J7Yd 1GY6A 1NB3I 5AIGA 3VSYA 4N6V0 3B7CA 4G1MB 1K9M4 1KSIA 3G0KA 3NM7A 3O8YA 3LXUX 1E3VA 4HM5B 3WMDA 2FGTA 3M8CA 3F8XA 3CCS3 4LZIA 5KP1A 1WMOA 4OK0A 1FGTA 1KD14 2RFRA 3FG1A 3MG2A 3JUMA 4WYKB 1JNQA 2KCDA 3FG3A 3LTCA 1STDA 1W00A 3X3XA 1OPYA 2BNGA 2UX0A 3X42A 4HYZA 3EB8A 2W9PA 4N6LA 3GRDA 4FCJA 2YX9A 3T8NA 4IPBA 3GZYB 1Z1SA 3KSPA 2OOVC 1ISKA 1RRLA 1N5HA 4OVMA 3WA2X 3CCL3 1N8QA 3DY5A 3FH1A 2P38A 2INXA 4X2OA 2L4VA 3S67A 4J9AA 4HBRA 3CPOA 4PEJA 5JPUA 2FXTA 4GB5A 1SJWA 1WMPA 1YVBI 2P09A 3DXOA 1ROAA 1YGEA 4L7KA 1CYVA 4XBXA 2I9WA 2CWUA 4R9KA 5KP4A 1OGXA 2BT3A 3JUPA 1SQWA 1NDOB 2IUJA 1GS3A 1W6GA 5IENA 4HM2B 1YIJ3 2D1WA 3UNLA 5AI1A 5IF6A 1DVCA 3EC9A 5JBSA 3MG3A 3NHXA 2IA7A 1EA2A 2F99A 3HZPA 1KC84 3BNCA 1A2KA 5A0OB 2K0MA 3K5TA 3N9HA 4HJLB 3OX9A 2XGLA 3NV0B 4HZ9B 3S29A 1SPUA 2MC8A 1RRHA 1UI8A 1IT8A 4N3VA 1QALA 3CC43 3PYJA 2CHCA 3KE7A 4IIAA 2OTJ3 1UUVB 3NXJA 1IV9A 3G713 5IEOA 1F8NA 1CEWI 2IMJA 1BUQA 1DVDA 1W6CA 3Q2PA 1LOXA 3UB1A 4Q53A 2WO0A 4RZMA 4R80A 2QEX3 3EQQB 3LH4A 2SBLA 1ULJB 3KSED 3OWUA 4FCMA 4R4KA 2B1XB 2PZVA 3LTDA 1IVXA 5AYSC 3SXXA 3K63A 3K7CA 4STDA 1K8A4 3CC73 3PCSA 4XBTA 3GZRA 5D81A 3PCRA 1O7HB 4N6OB 3ALAA 4XDVA 1DMNA 1PFPA 1QJGA 5IEPA 3EF8A 4BTYA 3HIGA 3JUOA 2RCDA 4K90B 3PGBA 4WWUC 3OW22 2BHMA 1OGZA 2P0XA 1AVKA 4K61A 1CYUA 2W56B 4N6NB 3MKIA 3WA3A 1FA3A 4MMYB 1JKGA 3FZWA 1U5OA 3D3LA 3NM2A 1TFOA 4O3VA 5ELUA 1TU5A 1YJN3 1W5ZA 1G96A 2R4IA 1YHQ3 2B24B 1Q40A 3PS8A 8CHOA 2D42A 5LC7A 1UUWB 3B8LA 5IG0A 3ECFA 1M1K4 2M7OA 3V99A 2CFGA 3LTBA 3EBTA 3KZTA 3LZAA 5AIFA 4EV5A 1LNHA 2JDIH 3LMLA 3SX1A 1IDPA 4MEIA 1VQ53 1IV7A 5AEUB 4L8PA 3NUVA 4LSOA 3FF0A 2CIUA 3CCV3 1Q824 2CG0A 3CCJ3 1OF5B 2CC3A 3DGMA 1NO3A 5AIHA 4KVHA 3F40A 4QWTA 2GBXB 2OWPA 3DMCA 1WTHA 2CKFB 1W01A 2WOHA 3EJVA 2W6JH 2Z77A 1ZX2A 1IQ8A 2W0QA 1K734 2CFWA 2XRXB 3SVAA 1O7MB 1J2BA 3MSOA 4HKVB 4HZBB 1VQ63 5EVHA 1W4NA 3QRDA 1YJW3 3JUNA 3CD63 5CF1A 1M1XB 3GZXB 3Q90A 4X2HA 2GEYA 3T0UA 3S28A 2C10A 3HX8A 1IVVA 1SIHA 5AIIA 1LVNA 1OHSA 2F98A 1CQSA 2XH9A 2XR8B 2LYXA 1V74A 3SOYA 2HMKB 3ROBA 7STDA 1DMQA 4K1UA 4ZM8A 4EYCA 1AVLA 3CCE3 2ML6A 1ZO2A 2XF3A 3Q1CA 1UW1A 1VQ93 1A2VA 2STDA 1WQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN5 B;  3G8Z A;  5D82 A;  3F7X A;  1E3R A;  5JPP A;  2W2C A;  3MG1 A;  3H51 A;  3FF2 A;  1JB4 A;  3GZB A;  3OWS A;  4R9L A;  1HKX A;  3GWR A;  2XSO B;  1VZZ A;  1AR0 A;  3RGA A;  4L8O A;  5IG3 A;  1OHO A;  3EBY A;  3B4P A;  4K1V A;  3DM8 A;  3S5C A;  4XB5 A;  4HM3 B;  1S5A A;  3JUQ A;  3NBR A;  3DZL A;  2Z7A A;  3UJM A;  3MYT A;  3BLZ A;  4XDW A;  5HGR A;  4J8T A;  2XSH B;  1GYB A;  3VGN A;  3CNM A;  4MJD A;  1OHP A;  3KKG A;  1Q42 A;  4WYK A;  4LEH A;  2QIY A;  1TP6 A;  5KP3 A;  4HM8 B;  3RGR A;  3STD A;  1QMA A;  4HM7 B;  1TUH A;  1W6Y A;  3E99 A;  3EHC A;  3F14 A;  5IER A;  1JB2 A;  2BMR B;  1WQL B;  5DRV A;  4I4K A;  1K41 A;  2F86 B;  1E97 A;  5IG5 A;  4CDL A;  5CLK A;  1DMM A;  1ULI B;  2HMO B;  3CNX A;  3B4O A;  4R1K A;  4WP5 A;  2HMM B;  3FLJ A;  4LMI A;  1OH0 A;  1NWW A;  3FSD A;  2A15 A;  3EN8 A;  2JQ5 A;  4HM1 B;  3NV0 A;  4ORL A;  5DRE A;  5G2G A;  2YFI B;  3F8H A;  3ER7 A;  1GY7 A;  1O7P B;  3SED A;  3CU3 A;  5CF2 A;  1JKG B;  3FKA A;  1O7G B;  3OV4 A;  1Q40 B;  5AEW B;  5BXQ A;  3I0Y A;  4HM0 B;  2GXF A;  6STD A;  1W02 A;  2YFJ B;  5D83 A;  3F7S A;  3EX9 A;  5FW5 A;  2HMJ B;  4HM6 B;  2YFL B;  4U13 A;  4XBY A;  4HM4 B;  2QGU A;  1OCV A;  1GY5 A;  1OUN A;  1EG9 B;  3T8U A;  5CK6 A;  2K54 A;  4XM4 A;  2Z76 A;  3K0Z A;  3EN1 B;  3H3H A;  4OUQ A;  3FGY A;  4HVN A;  1C7H A;  1OF5 A;  3MHE A;  1JB5 A;  3HK4 A;  3OWY A;  4LGQ A;  2HML B;  2RGQ A;  3A76 A;  1ASK A;  2GBW B;  3BB9 A;  3LYG A;  4H3U A;  3IPT A;  5STD A;  1O7N B;  3G16 A;  2BMQ B;  3D9R A;  3SOA A;  1NU3 A;  3DUK A;  3OXA A;  3F9S A;  2BMO B;  2GEX A;  2HMN B;  5IG4 A;  1O7W B;  5BVB A;  5CXO A;  1JN5 A;  5TGN A;  1GY6 A;  5AIG A;  3VSY A;  3B7C A;  3G0K A;  1E3V A;  4HM5 B;  3WMD A;  3M8C A;  3F8X A;  5KP1 A;  2RFR A;  3MG2 A;  3JUM A;  4WYK B;  1STD A;  1W00 A;  1OPY A;  2BNG A;  2UX0 A;  3GRD A;  4FCJ A;  3T8N A;  3GZY B;  1Z1S A;  3KSP A;  1ISK A;  4OVM A;  3FH1 A;  2INX A;  4X2O A;  4J9A A;  3CPO A;  4PEJ A;  5JPU A;  4GB5 A;  1SJW A;  3DXO A;  4L7K A;  4XBX A;  2I9W A;  4R9K A;  5KP4 A;  1OGX A;  3JUP A;  1NDO B;  1GS3 A;  5IEN A;  4HM2 B;  3UNL A;  5AI1 A;  5IF6 A;  3EC9 A;  3MG3 A;  3NHX A;  1EA2 A;  2F99 A;  3HZP A;  1A2K A;  4HJL B;  3OX9 A;  3NV0 B;  4HZ9 B;  4N3V A;  2CHC A;  3KE7 A;  4IIA A;  1UUV B;  3NXJ A;  5IEO A;  2IMJ A;  1BUQ A;  4Q53 A;  4RZM A;  3EQQ B;  1ULJ B;  3OWU A;  4FCM A;  2B1X B;  2PZV A;  3K7C A;  4STD A;  4XBT A;  3GZR A;  5D81 A;  1O7H B;  4XDV A;  1DMN A;  1QJG A;  5IEP A;  3EF8 A;  3JUO A;  2RCD A;  4WWU C;  1OGZ A;  3MKI A;  1JKG A;  3FZW A;  1U5O A;  3NM2 A;  2R4I A;  2B24 B;  1Q40 A;  8CHO A;  1UUW B;  3B8L A;  5IG0 A;  3ECF A;  3EBT A;  3KZT A;  3LZA A;  5AIF A;  1IDP A;  5AEU B;  4L8P A;  3NUV A;  1OF5 B;  5AIH A;  4KVH A;  3F40 A;  2GBX B;  2OWP A;  3DMC A;  2CKF B;  1W01 A;  3EJV A;  2Z77 A;  1ZX2 A;  2XRX B;  1O7M B;  3MSO A;  4HKV B;  4HZB B;  5EVH A;  3JUN A;  5CF1 A;  3Q90 A;  3GZX B;  4X2H A;  2GEY A;  3HX8 A;  5AII A;  1OHS A;  2F98 A;  1CQS A;  2XR8 B;  3SOY A;  2HMK B;  3ROB A;  7STD A;  1DMQ A;  4K1U A;  1ZO2 A;  2STD A;  3FF0 A; 
#chains in the Genus database with same CATH topology
 1PY3 A;  1JN5 B;  3Q3F A;  1NJI 4;  3G8Z A;  5D82 A;  1M90 4;  3A5E A;  1I2F A;  3F7X A;  5AYR B;  1US1 A;  1E3R A;  1Y4K A;  1T5Y A;  5JPP A;  1GMQ A;  2W2C A;  1OAC A;  3MG1 A;  1BRG A;  3H51 A;  1SII A;  2KRT A;  2UGI A;  1JB4 A;  3FF2 A;  1VQ4 3;  3GZB A;  2FNQ A;  3OWS A;  1GMP A;  1YJ9 3;  3NQY A;  1JJ2 2;  1IQX A;  1VQO 3;  4R9L A;  1HKX A;  3GWR A;  2XSO B;  1VZZ A;  1AR0 A;  3RGA A;  4L8O A;  1BRS A;  5ELJ A;  5IG3 A;  2CWT A;  1OHO A;  3EBY A;  1I0V A;  4EXR A;  4FCZ A;  3FCS B;  2MF7 A;  1T2H A;  2UUG C;  2ZL8 A;  2XFS A;  3CXC 2;  1DYU A;  3B4P A;  4K1V A;  2KXG A;  3EE1 A;  3DM8 A;  1VQ7 3;  3D5G A;  3S5C A;  1MWT A;  4TX4 A;  4XB5 A;  2CX1 A;  4HM3 B;  1BRH A;  3KII A;  1D6U A;  1MWR A;  1S5A A;  1FGR A;  2Z6B A;  1N9J A;  3JUQ A;  4EW5 A;  1FGQ A;  3NBR A;  3DZL A;  2SAR A;  2Z7A A;  3UJM A;  2BO9 B;  2OQE A;  3TDG A;  3MWZ A;  2WOF A;  3LT9 A;  3PZW A;  2AAE A;  1W2Z A;  3D4A A;  3BLZ A;  3MYT A;  4XDW A;  3GAX A;  5HGR A;  3X41 A;  3ZFZ A;  1VQP 3;  2F5M A;  1IVW A;  4J8T A;  2XSH B;  3BIR A;  1GYB A;  3VGN A;  1BNG A;  1RN7 A;  1YNV X;  3CNM A;  3BND A;  4MJD A;  2F4Y A;  1ZGX A;  2CFL A;  3UL5 A;  1VQL 3;  1T3B A;  4BTW A;  1OHP A;  3KKG A;  3NBB A;  5EEO A;  1LOY A;  1Q42 A;  2HOH A;  1V57 A;  4WYK A;  1RCL A;  3PXM A;  3L0R A;  4LEH A;  2QIY A;  3VF1 A;  1BU4 A;  1AV4 A;  1TP6 A;  3DGN A;  5KP3 A;  3K9M C;  1TRP A;  2BU4 A;  1DET A;  3CCR 3;  1G0T A;  3V92 A;  1X1X A;  4HM8 B;  3RGR A;  1LOW A;  3STD A;  3AGO A;  5I97 A;  1QMA A;  1RGL A;  1IVU A;  3CCM 3;  1MNL A;  1TIJ A;  2PNC A;  2XEP A;  3ZG5 A;  2XFT A;  3S27 A;  1Q86 4;  4HM7 B;  1Q7Y 4;  3G6E 3;  5IW9 A;  1TUH A;  5GSP A;  1A67 A;  1BSC A;  3AMO A;  1IT7 A;  3IMA B;  1W6Y A;  4EC6 A;  3DGO A;  3E99 A;  1VQN 3;  3WOE B;  4MMZ B;  4EV2 A;  3WHO A;  3CCQ 3;  2O3O A;  4FMD A;  2RNT A;  3X3Z A;  3CMA 3;  1JZD A;  1D6Y A;  3CCU 3;  1VQ8 3;  2OTL 3;  1GOU A;  3EHC A;  3F14 A;  4I5Q A;  5IER A;  1JB2 A;  2Y73 A;  1I2E A;  2BMR B;  2CH9 A;  5DRV A;  5M1A A;  4I4K A;  3I55 3;  2WGQ A;  2W04 A;  1RJO A;  1K41 A;  2F86 B;  1E97 A;  4KZ1 A;  1QVG 2;  3LTA A;  4CDL A;  5IG5 A;  2W9Q A;  1YIT 3;  4JF8 A;  4JRF A;  5CLK A;  1DMM A;  1ULI B;  2HMO B;  3CNX A;  1YI2 3;  4KFE A;  1BRK A;  3B4O A;  1DE3 A;  1YVS A;  1JRQ A;  2OCT A;  4R1K A;  3IJE B;  4KT3 B;  4AKY A;  2IY2 A;  4WP5 A;  3SYU A;  2HMM B;  2KAA A;  3FLJ A;  4IT7 A;  4LMI A;  1OH0 A;  1NWW A;  3FSD A;  4CPK A;  1STF I;  4N6U A;  1HZ1 A;  2OOV A;  2A15 A;  1BRI A;  2CG1 A;  3EN8 A;  2JQ5 A;  4HM1 B;  3NV0 A;  3U1W A;  4N6M A;  1I8V A;  4ORL A;  1M9G A;  5DRE A;  1BSA A;  2Q07 A;  1L5G B;  3CPW 2;  5G2G A;  2YFI B;  1BGS A;  1I0X A;  3F8H A;  4FMC A;  4DKI A;  3ER7 A;  1GY7 A;  1O7P B;  1RCK A;  3SED A;  1ROV A;  2L1S A;  3CU3 A;  2E2V A;  1MGR A;  2ZDJ A;  3NX0 A;  3CC2 3;  3HI7 A;  2GSP A;  1HU9 A;  1R4C A;  3WOD G;  1B2U A;  1JKG B;  1GSP A;  1YGW A;  3WOF B;  5CF2 A;  3FKA A;  3NBJ A;  4RNT A;  1RDS A;  3N54 B;  1UUG B;  1RKY A;  1FGM A;  1B21 A;  3DGL A;  3N8B A;  1O7G B;  1I3I A;  2ZHX B;  3AMO B;  4BTX A;  8RNT A;  3ZG0 A;  3OV4 A;  1Q40 B;  5AEW B;  4FMB A;  2E2U A;  5BXQ A;  3G4S 3;  1NB5 I;  3I0Y A;  1LNI A;  1GD4 A;  3X40 A;  4KFD A;  5G1K A;  1G02 A;  1PU4 A;  1WMN A;  1BAN A;  1QAK A;  2GU3 A;  3KN4 A;  4HM0 B;  4FR9 A;  1WNH A;  1UI7 A;  1RMS A;  2GXF A;  5FGO A;  4KFF A;  1W02 A;  5LC6 A;  6STD A;  2J8X B;  2O9U X;  2YFJ B;  3F7S A;  5D83 A;  1UGH I;  3QK9 A;  2WGO A;  3EX9 A;  1IQY A;  2Y74 A;  3BNE A;  5FW5 A;  2HMJ B;  3SLU A;  4HM6 B;  2YFL B;  2P05 A;  4O8S A;  4U13 A;  4RBN A;  4CJN A;  1B2Z A;  2W56 A;  4XBY A;  4HM4 B;  2CK3 H;  1GOY A;  5M19 A;  1A90 A;  1SAR A;  4LYL B;  1QAF A;  4GL6 A;  1UDI I;  4O2H A;  4RNY A;  7RNT A;  2QGU A;  1EQK A;  1OCV A;  1GY5 A;  1I70 A;  1OUN A;  1MOL A;  1EG9 B;  3T8U A;  5CK6 A;  1RLS A;  1W2B 2;  2QA4 3;  2E2T A;  1N9E A;  3V98 A;  1FUW A;  3UL6 A;  3BNB A;  2K54 A;  1RGE A;  4XM4 A;  1JV2 B;  1KQS 2;  4BIR A;  3I56 3;  2IYJ A;  1N8R 4;  2Z76 A;  3KCH A;  4H61 A;  3FG4 A;  5BU4 A;  3K0Z A;  1GD3 A;  1RGH A;  1Q81 4;  1BSD A;  2GU1 A;  1UCI A;  3KFQ C;  3EN1 B;  3H3H A;  4AKZ A;  9RNT A;  3X3Y A;  1TFK A;  4MMX B;  4OUQ A;  3LOY A;  1QVF 2;  2XGN A;  1Q7H A;  1RN4 A;  3FGY A;  4HVN A;  1C7H A;  1VQK 3;  1OF5 A;  3MHE A;  1FGO A;  4FMA A;  4GSP A;  1JB5 A;  1LXE A;  1UGI A;  2CWV A;  3HK4 A;  3OWY A;  4LGQ A;  1IU7 A;  2HML B;  2RGQ A;  2OQE C;  3LT8 A;  1KWI A;  1BSE A;  1V58 A;  2ML5 A;  3A76 A;  3U97 A;  1EUI C;  3MPH A;  4WHA A;  1RGF A;  1ASK A;  1RGA A;  2GBW B;  2RSX A;  1EKM A;  4CCV A;  1IK3 A;  4BL3 A;  4RNZ A;  3BB9 A;  3LYG A;  1K28 A;  4O02 B;  4H3U A;  1VQM 3;  3NQZ A;  1CH0 A;  2C11 A;  1A2P A;  2KF5 A;  3IPT A;  3JVC A;  4NPB A;  1U8C B;  4N6T A;  1ZS7 A;  3HII A;  5STD A;  2P0M A;  2CW9 A;  1O7N B;  3G16 A;  3WDG B;  3CME 3;  2BMQ B;  1X1Y A;  2W03 A;  2CFK A;  1D6Z A;  3D9R A;  3SOA A;  1NU3 A;  1B2S A;  1X1U A;  2F56 A;  3DUK A;  3OXA A;  4NHF A;  1PYL A;  1RGC A;  3F9S A;  4AEQ A;  2BMO B;  2CFD A;  4EBG A;  1W7C A;  4WFO A;  1BIR A;  5EQL A;  2LQV A;  2GEX A;  1JZO A;  1B3S A;  1UCJ A;  1T2I A;  2HMN B;  2ZA4 A;  4ILF A;  1O7W B;  3RDE A;  5BVB A;  1N5P A;  5IG4 A;  5CXO A;  4BU4 A;  1JN5 A;  1RGG A;  2V1L A;  3DGY A;  4NRE A;  5TGN A;  2IUK A;  3J7Y d;  1GY6 A;  1NB3 I;  5AIG A;  3VSY A;  4N6V 0;  3B7C A;  4G1M B;  1K9M 4;  1KSI A;  3G0K A;  3NM7 A;  3O8Y A;  3LXU X;  1E3V A;  4HM5 B;  3WMD A;  2FGT A;  3M8C A;  3F8X A;  3CCS 3;  4LZI A;  5KP1 A;  1WMO A;  4OK0 A;  3D79 A;  1FGT A;  1KD1 4;  2RFR A;  3FG1 A;  3MG2 A;  4HOH A;  3JUM A;  4WYK B;  1JNQ A;  2KCD A;  1R4Y A;  3FG3 A;  1BSB A;  3LTC A;  1STD A;  1B2M A;  2CX0 A;  1W00 A;  3X3X A;  1FYS A;  1BRN L;  1OPY A;  2BNG A;  2UX0 A;  3X42 A;  2RBI A;  4HYZ A;  1BNS A;  3EB8 A;  2W9P A;  4GHO A;  4N6L A;  3GRD A;  4FCJ A;  2F5W A;  5BIR A;  2YX9 A;  3T8N A;  1BNJ A;  4IPB A;  3GZY B;  1Z1S A;  3KSP A;  2OOV C;  1ISK A;  1RRL A;  1EEJ A;  1N5H A;  1C54 A;  4OVM A;  1BNE A;  3WA2 X;  3CCL 3;  1N8Q A;  3DY5 A;  3FH1 A;  1LQM B;  2P38 A;  1I2G A;  2INX A;  5M18 A;  4X2O A;  2L4V A;  3S67 A;  4J9A A;  4HBR A;  3CPO A;  1B2X A;  4PEJ A;  1GMR A;  3AHW A;  2FXT A;  5JPU A;  4GB5 A;  1SJW A;  1WMP A;  1YVB I;  2P09 A;  3DXO A;  1ROA A;  1UCL A;  1BOX A;  1YGE A;  1CYV A;  4L7K A;  4XBX A;  2I9W A;  2CWU A;  4R9K A;  5KP4 A;  1OGX A;  1RGK A;  2BT3 A;  3JUP A;  1SQW A;  1NDO B;  2IUJ A;  1GS3 A;  1BNR A;  1W6G A;  5IEN A;  4HM2 B;  1YIJ 3;  2D1W A;  3BU4 A;  3UNL A;  5AI1 A;  1MGW A;  5IF6 A;  1DVC A;  3EC9 A;  5JBS A;  3URP A;  3MG3 A;  1RSN A;  2IA7 A;  1BNF A;  1HYF A;  3NHX A;  1EA2 A;  2F99 A;  3HZP A;  1BAO A;  1KC8 4;  1JBT A;  1MWU A;  3BNC A;  1A2K A;  5A0O B;  2K0M A;  3K5T A;  3N9H A;  4HJL B;  3OX9 A;  5G1L A;  2XGL A;  3NV0 B;  4HZ9 B;  1LRA A;  1SPU A;  2MC8 A;  3S29 A;  1AQZ A;  1RRH A;  1MWS A;  1UI8 A;  1IT8 A;  4N3V A;  1QAL A;  1NNV A;  1RNT A;  3DH2 A;  3CC4 3;  3PYJ A;  2CHC A;  3KE7 A;  2R41 A;  4IIA A;  1UUV B;  3NXJ A;  2OTJ 3;  2H0H A;  1IV9 A;  3G71 3;  5IEO A;  1F8N A;  1CEW I;  2IMJ A;  1BUQ A;  1DVD A;  1W6C A;  3Q2P A;  1LOX A;  3UB1 A;  4Q53 A;  2WO0 A;  4RZM A;  4R80 A;  2QEX 3;  3EQQ B;  3LH4 A;  2SBL A;  1S72 3;  2AAD A;  1ULJ B;  3KSE D;  3OWU A;  4FCM A;  1FZU A;  4R4K A;  1VQQ A;  2B1X B;  1B27 A;  2PZV A;  3LTD A;  1IVX A;  1AY7 A;  1UCK A;  5AYS C;  3SXX A;  1GOV A;  3K63 A;  3K7C A;  3D5I A;  1RN1 A;  4STD A;  1K8A 4;  3CC7 3;  3PCS A;  4XBT A;  3GZR A;  5D81 A;  1TTO A;  3PCR A;  1O7H B;  4N6O B;  3ALA A;  4XDV A;  1DMN A;  1LQG C;  6GSP A;  1PFP A;  1QJG A;  5IEP A;  3EF8 A;  4BTY A;  3HIG A;  3JUO A;  2RCD A;  4K90 B;  3PGB A;  4WWU C;  3OW2 2;  2BHM A;  1OGZ A;  2P0X A;  1AVK A;  4K61 A;  1CYU A;  5RNT A;  2W56 B;  1BVI A;  4J5K A;  4N6N B;  2KF3 A;  5HOH A;  3MKI A;  3WA3 A;  1FA3 A;  4MMY B;  1JKG A;  1BNI A;  1U5O A;  3FZW A;  3D3L A;  3NM2 A;  1IYY A;  1I3F A;  1TFO A;  4O3V A;  5ELU A;  1TU5 A;  1YJN 3;  1W5Z A;  1G96 A;  2R4I A;  1YHQ 3;  2B24 B;  1Q40 A;  3PS8 A;  8CHO A;  2D42 A;  5LC7 A;  1X1W A;  1UUW B;  3B8L A;  5IG0 A;  3ECF A;  1M1K 4;  2M7O A;  1BRJ A;  2CFG A;  3LTB A;  3V99 A;  3HOH A;  1RNB A;  3EBT A;  3KZT A;  3LZA A;  3WR2 A;  5AIF A;  2KF6 A;  4EV5 A;  1LNH A;  2JDI H;  3GSP A;  3LML A;  3SX1 A;  1IDP A;  1LOV A;  1JBS A;  4MEI A;  1TRQ A;  1BUJ A;  3RNT A;  1VQ5 3;  1IV7 A;  5AEU B;  4L8P A;  3NUV A;  4LSO A;  3FF0 A;  2CIU A;  3CCV 3;  1Q82 4;  2CG0 A;  3CCJ 3;  1OF5 B;  2CC3 A;  3AGN A;  3DGM A;  1NO3 A;  5AIH A;  2H0I A;  4KVH A;  3F40 A;  4QWT A;  2GBX B;  1Q9E A;  1RTU A;  2OWP A;  3DMC A;  1WTH A;  2H0G A;  2C4B A;  2CKF B;  3AHS A;  1W01 A;  2WOH A;  3EJV A;  2W6J H;  4J5G A;  2Z77 A;  1ZX2 A;  1IQ8 A;  2W0Q A;  1K73 4;  2CFW A;  2XRX B;  3SVA A;  7GSP A;  1O7M B;  1J2B A;  3MSO A;  4HKV B;  4HZB B;  1VQ6 3;  5EVH A;  1W4N A;  3QRD A;  1YJW 3;  1JBR A;  3JUN A;  3CD6 3;  6RNT A;  5CF1 A;  1M1X B;  3GZX B;  3Q90 A;  1RHL A;  4X2H A;  2GEY A;  3T0U A;  1FW7 A;  3S28 A;  2C10 A;  3HX8 A;  1IVV A;  1SIH A;  2BIR A;  5AII A;  1LVN A;  1OHS A;  2F98 A;  1CQS A;  2XH9 A;  2XR8 B;  2LYX A;  4BL2 A;  1V74 A;  3SOY A;  2HMK B;  3ROB A;  1TJD A;  7STD A;  1B20 A;  1DMQ A;  4K1U A;  2K3D A;  4ZM8 A;  4EYC A;  1AVL A;  3CCE 3;  2ML6 A;  1ZO2 A;  2XF3 A;  1FUT A;  4HAA A;  3Q1C A;  1UW1 A;  2KF4 A;  1VQ9 3;  1A2V A;  2STD A;  1FUS A;  1WQL B; 
#chains in the Genus database with same CATH homology
 1NJI 4;  1JN5 B;  3G8Z A;  5D82 A;  1M90 4;  3F7X A;  5AYR B;  1US1 A;  1E3R A;  1Y4K A;  1T5Y A;  5JPP A;  2W2C A;  1OAC A;  3MG1 A;  3H51 A;  1SII A;  2KRT A;  3FF2 A;  1JB4 A;  1VQ4 3;  3GZB A;  2FNQ A;  3OWS A;  1YJ9 3;  3NQY A;  1JJ2 2;  1IQX A;  1VQO 3;  4R9L A;  1HKX A;  3GWR A;  2XSO B;  1VZZ A;  1AR0 A;  3RGA A;  4L8O A;  5ELJ A;  5IG3 A;  2CWT A;  1OHO A;  3EBY A;  4EXR A;  4FCZ A;  3FCS B;  2MF7 A;  2ZL8 A;  2XFS A;  3CXC 2;  1DYU A;  3B4P A;  4K1V A;  2KXG A;  3EE1 A;  3DM8 A;  1VQ7 3;  3S5C A;  4XB5 A;  4TX4 A;  4HM3 B;  3KII A;  1D6U A;  1S5A A;  1FGR A;  2Z6B A;  1N9J A;  3JUQ A;  1FGQ A;  3NBR A;  3DZL A;  2Z7A A;  3UJM A;  2BO9 B;  2OQE A;  3TDG A;  3MWZ A;  2WOF A;  3LT9 A;  3PZW A;  1S72 3;  1W2Z A;  3MYT A;  3BLZ A;  4XDW A;  5HGR A;  3GAX A;  3X41 A;  1VQP 3;  4J8T A;  1IVW A;  2XSH B;  1GYB A;  3VGN A;  1RN7 A;  3CNM A;  3BND A;  4MJD A;  2CFL A;  3UL5 A;  1VQL 3;  4BTW A;  1OHP A;  3KKG A;  3NBB A;  5EEO A;  1Q42 A;  4WYK A;  3VF1 A;  3PXM A;  3L0R A;  4LEH A;  2QIY A;  1AV4 A;  1TP6 A;  3DGN A;  5KP3 A;  3K9M C;  3CCR 3;  3V92 A;  4HM8 B;  3RGR A;  3STD A;  5I97 A;  1QMA A;  1IVU A;  3CCM 3;  1MNL A;  1TIJ A;  2PNC A;  2XEP A;  2XFT A;  3S27 A;  1Q86 4;  4HM7 B;  1Q7Y 4;  3G6E 3;  5IW9 A;  1TUH A;  1A67 A;  3AMO A;  1IT7 A;  3IMA B;  1W6Y A;  4EC6 A;  3DGO A;  3E99 A;  1VQN 3;  3WOE B;  4MMZ B;  4EV2 A;  3CCQ 3;  2O3O A;  4FMD A;  3X3Z A;  3CMA 3;  1VQ8 3;  1D6Y A;  3CCU 3;  2OTL 3;  3EHC A;  3F14 A;  5IER A;  1JB2 A;  2Y73 A;  2BMR B;  2CH9 A;  5DRV A;  3I55 3;  4I4K A;  2WGQ A;  2W04 A;  1RJO A;  1K41 A;  2F86 B;  1E97 A;  4KZ1 A;  1QVG 2;  3LTA A;  4CDL A;  5IG5 A;  2W9Q A;  1YIT 3;  4JF8 A;  4JRF A;  5CLK A;  1DMM A;  1ULI B;  2HMO B;  3CNX A;  1YI2 3;  4KFE A;  3B4O A;  1JRQ A;  2OCT A;  4R1K A;  3IJE B;  4AKY A;  4WP5 A;  2HMM B;  4IT7 A;  3FLJ A;  4LMI A;  1OH0 A;  1NWW A;  3FSD A;  1STF I;  4N6U A;  2OOV A;  2A15 A;  2CG1 A;  3EN8 A;  2JQ5 A;  4HM1 B;  3NV0 A;  3U1W A;  4N6M A;  4ORL A;  1M9G A;  5DRE A;  2Q07 A;  1L5G B;  3CPW 2;  5G2G A;  2YFI B;  4FMC A;  3F8H A;  3ER7 A;  1GY7 A;  1O7P B;  3SED A;  1ROV A;  3CU3 A;  2E2V A;  2ZDJ A;  3NX0 A;  3CC2 3;  3HI7 A;  1HU9 A;  1R4C A;  3WOD G;  1JKG B;  3WOF B;  5CF2 A;  3FKA A;  3NBJ A;  3N54 B;  1RKY A;  1FGM A;  3N8B A;  3DGL A;  1O7G B;  3AMO B;  4BTX A;  3OV4 A;  1Q40 B;  5AEW B;  4FMB A;  2E2U A;  5BXQ A;  3G4S 3;  1NB5 I;  3I0Y A;  1GD4 A;  3X40 A;  4KFD A;  1PU4 A;  1WMN A;  1QAK A;  2GU3 A;  3KN4 A;  4HM0 B;  4FR9 A;  1WNH A;  1UI7 A;  2GXF A;  5FGO A;  6STD A;  4KFF A;  1W02 A;  5LC6 A;  2O9U X;  2YFJ B;  3F7S A;  5D83 A;  3QK9 A;  2WGO A;  3EX9 A;  1IQY A;  2Y74 A;  3BNE A;  5FW5 A;  2HMJ B;  3SLU A;  4HM6 B;  2YFL B;  2P05 A;  4O8S A;  4U13 A;  4RBN A;  2W56 A;  4XBY A;  4HM4 B;  2CK3 H;  1A90 A;  1QAF A;  4GL6 A;  4O2H A;  4RNY A;  2QGU A;  1EQK A;  1OCV A;  1GY5 A;  1OUN A;  1MOL A;  1EG9 B;  3T8U A;  5CK6 A;  1W2B 2;  2QA4 3;  2E2T A;  1N9E A;  3V98 A;  1FUW A;  3UL6 A;  3BNB A;  2K54 A;  4XM4 A;  1JV2 B;  1KQS 2;  3I56 3;  1N8R 4;  2Z76 A;  4H61 A;  3FG4 A;  3K0Z A;  1GD3 A;  1Q81 4;  2GU1 A;  4AKZ A;  3KFQ C;  3EN1 B;  3H3H A;  3X3Y A;  1TFK A;  4MMX B;  4OUQ A;  3LOY A;  1QVF 2;  2XGN A;  3FGY A;  4HVN A;  1C7H A;  1VQK 3;  1OF5 A;  3MHE A;  1FGO A;  4FMA A;  1JB5 A;  1LXE A;  2CWV A;  3HK4 A;  3OWY A;  4LGQ A;  1IU7 A;  2HML B;  2RGQ A;  2OQE C;  3LT8 A;  1KWI A;  2ML5 A;  3A76 A;  3U97 A;  3MPH A;  4WHA A;  1ASK A;  2GBW B;  2RSX A;  1EKM A;  4CCV A;  1IK3 A;  4RNZ A;  3BB9 A;  3LYG A;  1K28 A;  4O02 B;  4H3U A;  1VQM 3;  3NQZ A;  2C11 A;  3IPT A;  3JVC A;  1U8C B;  4N6T A;  3HII A;  5STD A;  2P0M A;  2CW9 A;  1O7N B;  3G16 A;  3WDG B;  3CME 3;  2BMQ B;  2W03 A;  2CFK A;  1D6Z A;  3D9R A;  3SOA A;  1NU3 A;  3DUK A;  4NHF A;  3OXA A;  3F9S A;  4AEQ A;  4EBG A;  2BMO B;  2CFD A;  1W7C A;  4WFO A;  5EQL A;  2LQV A;  2GEX A;  2HMN B;  5IG4 A;  1O7W B;  3RDE A;  5BVB A;  1N5P A;  5CXO A;  1JN5 A;  2V1L A;  4NRE A;  5TGN A;  2IUK A;  3J7Y d;  1GY6 A;  1NB3 I;  5AIG A;  3VSY A;  4N6V 0;  3B7C A;  4G1M B;  1K9M 4;  1KSI A;  3G0K A;  3NM7 A;  3O8Y A;  3LXU X;  1E3V A;  4HM5 B;  3WMD A;  2FGT A;  3M8C A;  3F8X A;  3CCS 3;  4LZI A;  5KP1 A;  1WMO A;  4OK0 A;  1FGT A;  1KD1 4;  2RFR A;  3FG1 A;  3MG2 A;  3JUM A;  4WYK B;  1JNQ A;  2KCD A;  3FG3 A;  3LTC A;  1STD A;  1W00 A;  3X3X A;  1OPY A;  2BNG A;  2UX0 A;  3X42 A;  4HYZ A;  3EB8 A;  2W9P A;  4N6L A;  3GRD A;  4FCJ A;  2YX9 A;  3T8N A;  4IPB A;  3GZY B;  1Z1S A;  3KSP A;  2OOV C;  1ISK A;  1RRL A;  1N5H A;  4OVM A;  3WA2 X;  3CCL 3;  1N8Q A;  3DY5 A;  3FH1 A;  2P38 A;  2INX A;  4X2O A;  2L4V A;  3S67 A;  4J9A A;  4HBR A;  3CPO A;  4PEJ A;  5JPU A;  2FXT A;  4GB5 A;  1SJW A;  1WMP A;  1YVB I;  2P09 A;  3DXO A;  1ROA A;  1YGE A;  4L7K A;  1CYV A;  4XBX A;  2I9W A;  2CWU A;  4R9K A;  5KP4 A;  1OGX A;  2BT3 A;  3JUP A;  1SQW A;  1NDO B;  2IUJ A;  1GS3 A;  1W6G A;  5IEN A;  4HM2 B;  1YIJ 3;  2D1W A;  3UNL A;  5AI1 A;  5IF6 A;  1DVC A;  3EC9 A;  5JBS A;  3MG3 A;  3NHX A;  2IA7 A;  1EA2 A;  2F99 A;  3HZP A;  1KC8 4;  3BNC A;  1A2K A;  5A0O B;  2K0M A;  3K5T A;  3N9H A;  4HJL B;  3OX9 A;  2XGL A;  3NV0 B;  4HZ9 B;  3S29 A;  1SPU A;  2MC8 A;  1RRH A;  1UI8 A;  1IT8 A;  4N3V A;  1QAL A;  3CC4 3;  3PYJ A;  2CHC A;  3KE7 A;  4IIA A;  2OTJ 3;  1UUV B;  3NXJ A;  1IV9 A;  3G71 3;  5IEO A;  1F8N A;  1CEW I;  2IMJ A;  1BUQ A;  1DVD A;  1W6C A;  3Q2P A;  1LOX A;  3UB1 A;  4Q53 A;  2WO0 A;  4RZM A;  4R80 A;  2QEX 3;  3EQQ B;  3LH4 A;  2SBL A;  1ULJ B;  3KSE D;  3OWU A;  4FCM A;  4R4K A;  2B1X B;  2PZV A;  3LTD A;  1IVX A;  5AYS C;  3SXX A;  3K63 A;  3K7C A;  4STD A;  1K8A 4;  3CC7 3;  3PCS A;  4XBT A;  3GZR A;  5D81 A;  3PCR A;  1O7H B;  4N6O B;  3ALA A;  4XDV A;  1DMN A;  1PFP A;  1QJG A;  5IEP A;  3EF8 A;  4BTY A;  3HIG A;  3JUO A;  2RCD A;  4K90 B;  3PGB A;  4WWU C;  3OW2 2;  2BHM A;  1OGZ A;  2P0X A;  1AVK A;  4K61 A;  1CYU A;  2W56 B;  4N6N B;  3MKI A;  3WA3 A;  1FA3 A;  4MMY B;  1JKG A;  3FZW A;  1U5O A;  3D3L A;  3NM2 A;  1TFO A;  4O3V A;  5ELU A;  1TU5 A;  1YJN 3;  1W5Z A;  1G96 A;  2R4I A;  1YHQ 3;  2B24 B;  1Q40 A;  3PS8 A;  8CHO A;  2D42 A;  5LC7 A;  1UUW B;  3B8L A;  5IG0 A;  3ECF A;  1M1K 4;  2M7O A;  3V99 A;  2CFG A;  3LTB A;  3EBT A;  3KZT A;  3LZA A;  5AIF A;  4EV5 A;  1LNH A;  2JDI H;  3LML A;  3SX1 A;  1IDP A;  4MEI A;  1VQ5 3;  1IV7 A;  5AEU B;  4L8P A;  3NUV A;  4LSO A;  3FF0 A;  2CIU A;  3CCV 3;  1Q82 4;  2CG0 A;  3CCJ 3;  1OF5 B;  2CC3 A;  3DGM A;  1NO3 A;  5AIH A;  4KVH A;  3F40 A;  4QWT A;  2GBX B;  2OWP A;  3DMC A;  1WTH A;  2CKF B;  1W01 A;  2WOH A;  3EJV A;  2W6J H;  2Z77 A;  1ZX2 A;  1IQ8 A;  2W0Q A;  1K73 4;  2CFW A;  2XRX B;  3SVA A;  1O7M B;  1J2B A;  3MSO A;  4HKV B;  4HZB B;  1VQ6 3;  5EVH A;  1W4N A;  3QRD A;  1YJW 3;  3JUN A;  3CD6 3;  5CF1 A;  1M1X B;  3GZX B;  3Q90 A;  4X2H A;  2GEY A;  3T0U A;  3S28 A;  2C10 A;  3HX8 A;  1IVV A;  1SIH A;  5AII A;  1LVN A;  1OHS A;  2F98 A;  1CQS A;  2XH9 A;  2XR8 B;  2LYX A;  1V74 A;  3SOY A;  2HMK B;  3ROB A;  7STD A;  1DMQ A;  4K1U A;  4ZM8 A;  4EYC A;  1AVL A;  3CCE 3;  2ML6 A;  1ZO2 A;  2XF3 A;  3Q1C A;  1UW1 A;  1VQ9 3;  1A2V A;  2STD A;  1WQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...