2OWPA

Crystal structure of a cystatin-like fold protein (bxe_b1374) from burkholderia xenovorans lb400 at 2.00 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
GMEVNQPDIVAQVQAAFVEYERALVENDIEAMNALFWHTPETVRYGIAEVQHGGEAIRAWRERCEPVPKSRKLHRTVVTTFGTDFATVSTEFTSDATPLLGRQMQTWARLSPADGWKIVAAHVSLIAMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein Bxe_B1374
publication title Crystal structure of hypothetical protein Bxe_B1374 (YP_553940.1) from Burkholderia xenovorans LB400 at 2.00 A resolution
rcsb
source organism Burkholderia xenovorans
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11533 DUF3225 Protein of unknown function (DUF3225)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2owpA00
4J9AA 3G0KA 5CF2A 4ORLA 1K41A 2YFIB 3I0YA 4XBTA 3SOYA 3UJMA 3NUVA 4KVHA 1O7WB 3NXJA 4HVNA 4IIAA 3KZTA 5KP4A 1Q42A 4FCJA 4XM4A 1GYBA 3NV0B 2RFRA 4WYKB 5IG0A 1OHSA 5TGNA 2HMMB 1S5AA 3MG3A 1OHOA 1UUWB 3EJVA 5IENA 3A76A 3EBTA 2GBXB 3CPOA 3KKGA 4WWUC 4HM4B 1HKXA 3GRDA 3RGRA 5AEUB 3EC9A 3HX8A 3MYTA 1WQLB 2XSOB 5IG3A 5IEOA 3B4PA 3CNMA 2F99A 3GZBA 3B8LA 3MHEA 3OWSA 1OH0A 1BUQA 1NU3A 5STDA 4FCMA 7STDA 4HM6B 4CDLA 3FF2A 3MG1A 3BB9A 2B24B 3GZXB 3LYGA 1CQSA 2XRXB 2XR8B 1UUVB 4L7KA 3IPTA 1W02A 8CHOA 4GB5A 4HJLB 4XDVA 5BVBA 4R1KA 3FLJA 3FSDA 3G8ZA 1ULJB 4HM5B 3DZLA 3FGYA 1DMMA 3DUKA 5JPPA 3KE7A 3OV4A 3HZPA 3VSYA 2QGUA 5D83A 4WP5A 4L8PA 1JN5B 3CNXA 3ER7A 3GZRA 4J8TA 3F8XA 3EQQB 2OWPA 3HK4A 3NBRA 5AIIA 3DM8A 2CHCA 3EN1B 4XDWA 2IMJA 2INXA 3F8HA 4Q53A 4HM2B 5DRVA 1AR0A 1E3RA 4H3UA 2B1XB 2XSHB 1OGXA 2HMKB 4HM0B 4HM3B 1GS3A 3NV0A 3E99A 4WYKA 3OWYA 2YFLB 1W00A 1ZX2A 2YFJB 2F86B 4PEJA 5D82A 5AI1A 1OHPA 4HM7B 4XBXA 1QJGA 4X2HA 1E3VA 3RGAA 5JPUA 2HMLB 3SOAA 5IERA 2A15A 2QIYA 4STDA 5AIGA 3NHXA 1W6YA 5KP3A 5DREA 3DMCA 3MG2A 3EBYA 5BXQA 3ECFA 1TUHA 3JUPA 3FKAA 1W01A 1U5OA 1GY6A 1OF5B 2W2CA 3F14A 1JKGB 2Z76A 4HZBB 2STDA 3OWUA 3F7XA 3VGNA 3F9SA 4R9LA 4LEHA 1OPYA 4XB5A 2RGQA 5IEPA 2HMNB 1Q40B 1O7MB 1JB2A 2BMRB 3GZYB 2UX0A 2JQ5A 5CK6A 2GXFA 4OUQA 5KP1A 4HZ9B 3MKIA 2RCDA 2PZVA 4OVMA 1JB5A 3H3HA 4K1UA 1EG9B 4HM1B 5CLKA 5FW5A 5IG4A 3OX9A 3STDA 3EX9A 3F7SA 4HKVB 1JN5A 3K0ZA 1E97A 3BLZA 1JB4A 3MSOA 6STDA 4RZMA 4R9KA 1DMNA 3GWRA 3G16A 1ZO2A 3KSPA 4XBYA 1ISKA 4LMIA 1OCVA 3CU3A 3B7CA 4X2OA 5AEWB 5HGRA 1C7HA 1SJWA 2BMOB 1EA2A 3JUNA 1ULIB 3S5CA 4HM8B 1GY7A 5D81A 1O7HB 5AIHA 3WMDA 5AIFA 3ROBA 3D9RA 2BNGA 1GY5A 1NDOB 3F40A 3M8CA 1DMQA 3JUQA 1O7NB 3Q90A 3EN8A 2BMQB 1TP6A 2I9WA 2CKFB 2GBWB 1VZZA 3K7CA 2Z7AA 2HMOB 3LZAA 3B4OA 3JUOA 2R4IA 5CXOA 1Z1SA 1STDA 4U13A 5G2GA 3OXAA 3FF0A 1OF5A 1JKGA 2F98A 1QMAA 1IDPA 3T8NA 3EF8A 2Z77A 4I4KA 1A2KA 1Q40A 3NM2A 4N3VA 5IG5A 1NWWA 3EHCA 4MJDA 1O7PB 1OUNA 3H51A 2K54A 3JUMA 4K1VA 1OGZA 4LGQA 4L8OA 3T8UA 3FZWA 1O7GB 3DXOA 3UNLA 3FH1A 5CF1A 2GEYA 1ASKA 2GEXA 2HMJB 5IF6A 5EVHA 3SEDA
chains in the Genus database with same CATH superfamily
4J9AA 3G0KA 3T0UA 1RGLA 1TIJA 5CF2A 1LQGC 3DGYA 4ORLA 1K41A 1STFI 2YFIB 3I0YA 4XBTA 4RNZA 3SOYA 3UJMA 3CXC2 3NUVA 3X3ZA 1W6GA 4KVHA 1O7WB 3NXJA 4HVNA 1AY7A 3X3YA 1B20A 3K63A 4IIAA 1GOYA 3KZTA 5KP4A 1MOLA 1BNRA 1FUTA 7GSPA 3S67A 1Q42A 1VQ83 4FCJA 1B2XA 2CX1A 2CWTA 1LOWA 2L4VA 5EEOA 4LZIA 1YVSA 2F4YA 2OOVA 4XM4A 1GYBA 1N9JA 4RBNA 4NPBA 3NV0B 3CME3 2RFRA 1UCIA 4WYKB 5IG0A 1UI8A 3D4AA 3UL5A 1K734 4NHFA 4ILFA 1OHSA 5TGNA 2HMMB 1VQK3 1BNIA 1S5AA 1BVIA 3MG3A 1OHOA 1RDSA 5A0OB 1UUWB 2H0GA 3CC23 1Q864 3EJVA 1VQO3 2RSXA 5IENA 3KIIA 3A76A 1U8CB 1SIIA 1X1UA 3EBTA 3CD63 5LC6A 2GBXB 3CPOA 8RNTA 3KKGA 4WWUC 1EKMA 1AQZA 3D5IA 4HM4B 1HKXA 1PY3A 3GRDA 2MC8A 3RGRA 1ROAA 5AEUB 1VQM3 3EC9A 1IVXA 2W56A 1FA3A 1FGQA 2FNQA 4N6V0 1US1A 3HX8A 2E2TA 1BRHA 3MYTA 1WQLB 1SQWA 2XFTA 2XSOB 3ZFZA 2CFWA 5IG3A 1N9EA 3QRDA 5IEOA 3B4PA 1YHQ3 3CNMA 2F56A 1BUJA 5BU4A 2F99A 3NQYA 1MNLA 1MGRA 3GZBA 1X1WA 2O3OA 3B8LA 3DGMA 1BNSA 1RGHA 5GSPA 6GSPA 1YJN3 3MHEA 1RGKA 2D42A 3FCSB 1QVF2 4O02B 1BRIA 2AADA 1WNHA 1JBTA 3OWSA 1VQL3 3CCM3 1OH0A 1BUQA 1NU3A 5STDA 4FCMA 3JVCA 4HYZA 3ZG5A 2KAAA 2ML6A 2P0MA 4HM6B 7STDA 2F5MA 3CPW2 2GSPA 1Q814 1T2IA 2FXTA 1BRNL 1AV4A 4CDLA 6RNTA 2CG1A 1WMNA 1KC84 2W04A 2BIRA 3FF2A 2BHMA 3MG1A 4N6OB 4O8SA 2UUGC 3BB9A 4O2HA 2P09A 3BNBA 2B24B 3GZXB 3KSED 3LYGA 1G96A 1CQSA 1B2MA 2BO9B 2XRXB 1FUSA 3CCQ3 2XR8B 2CFKA 3HIGA 4N6TA 1VQ73 1UUVB 1BOXA 1BNFA 1M9GA 1T2HA 5M19A 2FGTA 2OQEA 2IY2A 4JF8A 4L7KA 3IPTA 4BIRA 1DE3A 4JRFA 2LQVA 1B3SA 3DY5A 4BTYA 2RNTA 1Q824 1UI7A 1W02A 1KD14 1FGRA 5RNTA 8CHOA 1BNEA 4MMZB 2AAEA 4GB5A 4HJLB 2ML5A 4XDVA 2QA43 4LYLB 9RNTA 3WA3A 3BNCA 3OW22 3G6E3 5BVBA 2P38A 1EEJA 4R1KA 5I97A 1BU4A 1IV7A 3FLJA 2P05A 2PNCA 2OOVC 3FSDA 4N6MA 3G8ZA 5G1LA 1ULJB 4HM5B 3DZLA 3FGYA 3WA2X 7RNTA 1ZS7A 4J5GA 2C4BA 2KF4A 3RDEA 2CW9A 1DMMA 3Q1CA 3DUKA 5JPPA 4EC6A 1RCKA 3FG3A 1V74A 1EUIC 1FGMA 1UCJA 3KE7A 3OV4A 4BL3A 1IVVA 3NBBA 4G1MB 3HZPA 3VSYA 1Y4KA 4EV2A 1M904 2KF3A 2QGUA 2Y73A 4OK0A 5D83A 1K9M4 4WP5A 1D6ZA 4L8PA 1MWTA 3Q3FA 5AYRB 3URPA 1JN5B 1BRJA 2M7OA 3CNXA 3ER7A 1YGEA 1J2BA 1I2EA 1LOXA 1ZGXA 3GZRA 4J8TA 3BNEA 3ZG0A 1SPUA 4MEIA 1MWUA 1JZDA 1I0VA 3EQQB 2OWPA 3F8XA 3HK4A 3NBRA 4MMYB 5AIIA 3MPHA 3GSPA 1GOUA 1I70A 2W6JH 3DM8A 4R80A 3TDGA 2CHCA 4FMDA 3EN1B 1I3IA 1C54A 4KFDA 1DVCA 3V92A 1TU5A 4XDWA 5M18A 2IMJA 1IK3A 2INXA 4HOHA 1UCKA 3CCV3 1MGWA 1TJDA 3F8HA 3HOHA 4Q53A 1QAKA 1DYUA 4HM2B 3NX0A 4AEQA 2KF6A 2R41A 1JRQA 5DRVA 3I563 1NB5I 3CCR3 1HU9A 1RNBA 1MWSA 1AR0A 4N6NB 1F8NA 1E3RA 1D6YA 4H3UA 2B1XB 2XSHB 1OGXA 1WTHA 3AHSA 1WMOA 2HMKB 3RNTA 4HM0B 5LC7A 3D79A 1UUGB 4HM3B 2IA7A 3O8YA 1UGIA 3LXUX 1GS3A 4AKYA 5FGOA 1K8A4 4GL6A 1BRSA 1Q9EA 2H0HA 2K3DA 3LOYA 3NV0A 3X40A 1YNVX 3E99A 1UDII 4WYKA 3G4S3 3KN4A 1Q7Y4 3OWYA 3X3XA 2YFLB 1VQ93 1JJ22 2LYXA 3K5TA 1W00A 1ZX2A 3PCSA 5IW9A 3LTBA 2YFJB 2F86B 4PEJA 3SXXA 3GAXA 2CIUA 4WHAA 5D82A 1RN7A 3AMOB 5AI1A 1OHPA 2F5WA 1LXEA 3D5GA 2HOHA 1FGTA 4EW5A 4FMAA 4HM7B 2OQEC 4XBXA 1N5PA 1KQS2 1BAOA 4BTWA 1QJGA 3DGLA 5HOHA 1YIJ3 4X2HA 1E3VA 1JZOA 3LTDA 4FMBA 3RGAA 3UB1A 1X1YA 2XF3A 2CX0A 2HMLB 3DH2A 4WFOA 3SOAA 2SBLA 5IERA 1RLSA 5JPUA 1PU4A 5BIRA 1N8R4 2OCTA 2A15A 3LH4A 2QIYA 1GOVA 2CK3H 1A2VA 3NHXA 4STDA 1JV2B 5AIGA 3U97A 3X42A 2E2VA 2XEPA 1W6YA 5KP3A 1BSDA 3DMCA 5DREA 3MG2A 1IT7A 1T5YA 3EBYA 1RJOA 5BXQA 1S723 3ECFA 1TUHA 2L1SA 3JUPA 3FKAA 4I5QA 1K28A 1LNIA 1B27A 5EQLA 1RGFA 1GSPA 1YGWA 2C10A 3PS8A 2OTL3 1SARA 1IV9A 3MWZA 4ZM8A 2WGQA 1W01A 1U5OA 1BRKA 1GY6A 1OF5B 2W2CA 3F14A 1JKGB 2Z76A 4HZBB 1A67A 2STDA 3OWUA 3WR2A 1QALA 3AHWA 3BNDA 3F7XA 3WHOA 3VGNA 3J7Yd 3F9SA 2XGLA 2GU3A 1V58A 4R9LA 1DVDA 3N54B 1BRGA 2CFLA 2IUKA 1KWIA 3CMA3 2BU4A 3SLUA 4LEHA 1OPYA 3A5EA 4XB5A 1JBRA 2UGIA 2RGQA 4BU4A 1BGSA 1HZ1A 5IEPA 4MMXB 2HMNB 3IJEB 1Q40B 2KF5A 3CCS3 1O7MB 1CEWI 3U1WA 1JB2A 3WOEB 2BMRB 3GZYB 2UX0A 2C11A 1VQ53 4BTXA 4QWTA 2W9QA 2JQ5A 2P0XA 2CC3A 4KFFA 1IT8A 2H0IA 5CK6A 2W03A 2GXFA 4OUQA 5KP1A 1RKYA 2OTJ3 1G0TA 2Z6BA 4HZ9B 3MKIA 3S27A 1Q7HA 2RCDA 2PZVA 3N8BA 4J5KA 3CCU3 4NREA 3V98A 3CC73 4OVMA 1JB5A 2IUJA 1A90A 2CH9A 2ZA4A 3ALAA 4LSOA 3H3HA 4K1UA 1EG9B 2K0MA 2O9UX 4HM1B 1FZUA 1BNJA 1GD3A 5CLKA 3EE1A 1RMSA 1RTUA 1PYLA 1LVNA 2XGNA 5FW5A 5IG4A 3IMAB 1NB3I 3OX9A 3STDA 3LTAA 2V1LA 2WOHA 2XFSA 3EX9A 3F7SA 1SIHA 2KXGA 4HKVB 3X41A 4EBGA 4KZ1A 2ZHXB 3PYJA 1TFOA 1JN5A 3K0ZA 4K90B 3K9MC 1CYVA 1E97A 3BLZA 1JB4A 1I2GA 3MSOA 6STDA 1I0XA 4RZMA 1BSEA 1FW7A 4R9KA 1DMNA 3GWRA 3G16A 1CYUA 1GMQA 1ZO2A 4CJNA 4CCVA 3CCJ3 1B2SA 4GSPA 1IVUA 3LTCA 3VF1A 2W0QA 1M1K4 3KSPA 1PFPA 3N9HA 5G1KA 1NO3A 4HBRA 3V99A 4HAAA 4AKZA 3QK9A 5ELJA 2CG0A 4XBYA 1EQKA 4N6UA 1ISKA 4KT3B 2IYJA 4LMIA 1OCVA 1L5GB 4K61A 3CU3A 3SVAA 2Q07A 3B7CA 4FCZA 4IPBA 3WOFB 1IVWA 1AVKA 4N6LA 1LQMB 4X2OA 1A2PA 2ZL8A 1W6CA 3PGBA 5AEWB 4H61A 5HGRA 1C7HA 1YIT3 1SJWA 4EV5A 1JNQA 2BMOB 1EA2A 3SX1A 1T3BA 4O3VA 1QVG2 2GU1A 1FGOA 1NNVA 2WO0A 2SARA 1YI23 2W56B 3JUNA 1RNTA 1ULIB 1NJI4 3S5CA 2KRTA 3CC43 1RSNA 4HM8B 1GY7A 3WDGB 1IYYA 3LMLA 3NBJA 5D81A 1RN1A 1O7HB 2E2UA 2CWUA 3AMOA 5AIHA 1N5HA 1MWRA 3WMDA 3D3LA 1YVBI 3AGNA 3BU4A 3AGOA 3KCHA 4R4KA 1I3FA 1OACA 2CFDA 3FG4A 5AIFA 4KFEA 3ROBA 3D9RA 2BNGA 1GY5A 1NDOB 2MF7A 3F40A 3M8CA 1YJ93 1DMQA 3JUQA 1O7NB 3Q90A 1RGCA 3EN8A 1TRPA 2BMQB 1LNHA 4FMCA 3HI7A 1TP6A 2I9WA 2CKFB 2GBWB 3S29A 1RRHA 1G02A 1RGGA 3BIRA 3LT8A 4CPKA 1W2B2 1VZZA 1FUWA 1I8VA 1N8QA 1RCLA 5JBSA 1VQN3 1IQ8A 1LRAA 1R4CA 3K7CA 1V57A 1YJW3 3CCE3 2Z7AA 1TRQA 2HMOB 1I2FA 1BSAA 3LZAA 5M1AA 4GHOA 1BIRA 3B4OA 2Y74A 3JUOA 2R4IA 3G713 2D1WA 3L0RA 5CXOA 1RRLA 1Z1SA 1STDA 4U13A 5G2GA 1GD4A 1RGAA 1VQP3 3UL6A 1W2ZA 2JDIH 3OXAA 3FF0A 1OF5A 4RNTA 2ZDJA 1JKGA 2QEX3 1B21A 2F98A 1QMAA 3NM7A 3SYUA 3DGOA 1CH0A 1UW1A 3PXMA 3NQZA 1IDPA 1BANA 3FG1A 3S28A 2J8XB 3T8NA 3EF8A 2RBIA 2Z77A 1HYFA 1JBSA 1B2ZA 5ELUA 1AVLA 3HIIA 3WODG 1W7CA 2WOFA 3EB8A 4I4KA 1A2KA 1TFKA 1RGEA 1Q40A 1X1XA 1LOVA 3PZWA 2BT3A 3NM2A 1W5ZA 4N3VA 1IU7A 5IG5A 1BNGA 1WMPA 1NWWA 1BSCA 2W9PA 3EHCA 4MJDA 5AYSC 1TTOA 1KSIA 2CWVA 1O7PB 1OUNA 4EXRA 1RN4A 1M1XB 2K54A 3H51A 4TX4A 1GMPA 2KCDA 4DKIA 3JUMA 4K1VA 1OGZA 4LGQA 4L8OA 1IQXA 1LOYA 1BSBA 3T8UA 1R4YA 4IT7A 1VQ43 1UCLA 1ROVA 3PCRA 3FZWA 4BL2A 1VQQA 2YX9A 3I553 1O7GB 2XH9A 3DXOA 3DGNA 1W4NA 1GMRA 3UNLA 3KFQC 1D6UA 3FH1A 2WGOA 3Q2PA 4FR9A 1VQ63 5CF1A 1QAFA 1FYSA 2GEYA 2CFGA 1UGHI 3LT9A 1ASKA 1IQYA 2GEXA 2HMJB 4EYCA 5IF6A 3CCL3 1RHLA 1B2UA 5EVHA 1DETA 4RNYA 3SEDA
chains in the Genus database with same CATH topology
4J9AA 3G0KA 3T0UA 5CF2A 1TIJA 4ORLA 1K41A 1STFI 2YFIB 3I0YA 4XBTA 4RNZA 3SOYA 3UJMA 3CXC2 3NUVA 3X3ZA 1W6GA 4KVHA 1O7WB 3NXJA 4HVNA 3X3YA 3K63A 4IIAA 3KZTA 5KP4A 1MOLA 3S67A 1Q42A 1VQ83 4FCJA 2CWTA 5EEOA 2L4VA 4LZIA 2OOVA 4XM4A 1GYBA 1N9JA 4RBNA 3NV0B 3CME3 2RFRA 4WYKB 5IG0A 1UI8A 3UL5A 1K734 4NHFA 1OHSA 5TGNA 2HMMB 1VQK3 1S5AA 3MG3A 1OHOA 3CC23 5A0OB 1UUWB 1Q864 3EJVA 1VQO3 2RSXA 5IENA 3KIIA 3A76A 1U8CB 1SIIA 3EBTA 3CD63 5LC6A 2GBXB 3CPOA 3KKGA 4WWUC 1EKMA 4HM4B 1HKXA 3GRDA 2MC8A 3RGRA 1ROAA 5AEUB 1VQM3 3EC9A 1IVXA 2W56A 1FA3A 1FGQA 2FNQA 4N6V0 1US1A 3HX8A 2E2TA 3MYTA 1WQLB 1SQWA 2XFTA 2XSOB 2CFWA 5IG3A 1N9EA 3QRDA 5IEOA 3B4PA 1YHQ3 3CNMA 2F99A 3NQYA 1MNLA 3GZBA 2O3OA 3DGMA 3B8LA 1YJN3 3MHEA 2D42A 3FCSB 1QVF2 4O02B 1WNHA 3OWSA 1VQL3 3CCM3 1OH0A 1BUQA 1NU3A 5STDA 4FCMA 3JVCA 4HYZA 7STDA 2ML6A 2P0MA 4HM6B 3CPW2 1Q814 2FXTA 1AV4A 4CDLA 2CG1A 1WMNA 1KC84 2W04A 3FF2A 2BHMA 3MG1A 4N6OB 4O8SA 3BB9A 4O2HA 2P09A 3BNBA 2B24B 3GZXB 3KSED 3LYGA 1G96A 1CQSA 2BO9B 2XRXB 3CCQ3 2XR8B 2CFKA 3HIGA 4N6TA 1VQ73 1M9GA 1UUVB 2FGTA 2OQEA 4JF8A 4L7KA 3IPTA 4JRFA 2LQVA 3DY5A 4BTYA 1Q824 1UI7A 1W02A 1KD14 1FGRA 8CHOA 4MMZB 4GB5A 4HJLB 2ML5A 4XDVA 2QA43 3WA3A 3BNCA 3OW22 3G6E3 5BVBA 2P38A 4R1KA 5I97A 1IV7A 3FLJA 2P05A 2PNCA 2OOVC 3FSDA 4N6MA 3G8ZA 1ULJB 4HM5B 3DZLA 3FGYA 3WA2X 3RDEA 2CW9A 1DMMA 3Q1CA 3DUKA 5JPPA 4EC6A 3FG3A 1V74A 3KE7A 1FGMA 3OV4A 1IVVA 3NBBA 4G1MB 3HZPA 3VSYA 1Y4KA 4EV2A 1M904 2QGUA 2Y73A 5D83A 4OK0A 1K9M4 4WP5A 1D6ZA 4L8PA 5AYRB 1JN5B 2M7OA 3CNXA 3ER7A 1YGEA 1J2BA 1LOXA 3GZRA 4J8TA 3BNEA 1SPUA 4MEIA 3F8XA 3EQQB 2OWPA 3HK4A 3NBRA 4MMYB 5AIIA 3MPHA 3DM8A 4R80A 2W6JH 3TDGA 2CHCA 4FMDA 3EN1B 4KFDA 1DVCA 1TU5A 4XDWA 2IMJA 1IK3A 2INXA 3CCV3 3F8HA 4Q53A 1QAKA 1DYUA 4HM2B 3NX0A 4AEQA 1NB5I 3I563 1JRQA 5DRVA 3CCR3 1HU9A 1AR0A 4N6NB 1F8NA 1E3RA 1D6YA 4H3UA 2B1XB 2XSHB 1OGXA 1WTHA 1WMOA 2HMKB 4HM0B 5LC7A 4HM3B 2IA7A 3O8YA 3LXUX 1GS3A 4AKYA 5FGOA 1K8A4 4GL6A 3LOYA 3NV0A 3X40A 1Q7Y4 3E99A 4WYKA 3G4S3 1VQ93 3KN4A 3OWYA 3X3XA 2YFLB 1JJ22 2LYXA 3K5TA 1W00A 1ZX2A 3PCSA 5IW9A 3LTBA 2YFJB 2F86B 4PEJA 3SXXA 3GAXA 2CIUA 4WHAA 5D82A 1RN7A 3AMOB 5AI1A 1OHPA 1LXEA 1FGTA 4FMAA 4HM7B 2OQEC 4XBXA 1N5PA 1KQS2 4BTWA 1QJGA 3DGLA 1YIJ3 4X2HA 1E3VA 3UB1A 3LTDA 4FMBA 3RGAA 2XF3A 5JPUA 2HMLB 1PU4A 4WFOA 3SOAA 2SBLA 5IERA 1N8R4 2OCTA 2A15A 3LH4A 2QIYA 2CK3H 1A2VA 3NHXA 4STDA 1JV2B 5AIGA 3U97A 3X42A 2E2VA 2XEPA 1W6YA 5KP3A 5DREA 3DMCA 3MG2A 1IT7A 1T5YA 3EBYA 1RJOA 5BXQA 1S723 3ECFA 1TUHA 3JUPA 3FKAA 1K28A 5EQLA 2C10A 3PS8A 2OTL3 1IV9A 3MWZA 4ZM8A 2WGQA 1W01A 1U5OA 1GY6A 1OF5B 2W2CA 3F14A 1JKGB 2Z76A 4HZBB 1A67A 2STDA 3OWUA 1QALA 3BNDA 3F7XA 3J7Yd 3VGNA 3F9SA 2XGLA 2GU3A 4R9LA 1DVDA 3N54B 2CFLA 2IUKA 1KWIA 3CMA3 3SLUA 4LEHA 1OPYA 4XB5A 2RGQA 5IEPA 4MMXB 2HMNB 3IJEB 1Q40B 3CCS3 1O7MB 1CEWI 3U1WA 1JB2A 3WOEB 2BMRB 3GZYB 2UX0A 2C11A 1VQ53 4BTXA 4QWTA 2W9QA 2JQ5A 2P0XA 2CC3A 4KFFA 1IT8A 5CK6A 2W03A 2GXFA 4OUQA 5KP1A 1RKYA 2OTJ3 2Z6BA 4HZ9B 3MKIA 3S27A 3N8BA 2RCDA 2PZVA 3CCU3 4NREA 3V98A 3CC73 4OVMA 1JB5A 2IUJA 1A90A 2CH9A 3ALAA 4LSOA 3H3HA 4K1UA 1EG9B 2K0MA 2O9UX 4HM1B 1GD3A 5CLKA 3EE1A 1LVNA 2XGNA 5FW5A 5IG4A 3IMAB 1NB3I 3OX9A 3STDA 3LTAA 2V1LA 2WOHA 2XFSA 3EX9A 3F7SA 1SIHA 2KXGA 4HKVB 3X41A 4EBGA 4KZ1A 3PYJA 1TFOA 1JN5A 3K0ZA 4K90B 3K9MC 1CYVA 1E97A 3BLZA 1JB4A 3MSOA 6STDA 4RZMA 4R9KA 1DMNA 3GWRA 3G16A 1CYUA 1ZO2A 3CCJ3 4CCVA 1IVUA 3LTCA 3VF1A 2W0QA 1M1K4 3KSPA 1PFPA 3N9HA 1NO3A 4HBRA 3V99A 4AKZA 3QK9A 5ELJA 2CG0A 4XBYA 1EQKA 4N6UA 1ISKA 4LMIA 1OCVA 1L5GB 4K61A 3CU3A 3SVAA 2Q07A 3B7CA 4FCZA 4IPBA 3WOFB 1IVWA 1AVKA 4N6LA 4X2OA 2ZL8A 1W6CA 3PGBA 5AEWB 4H61A 5HGRA 1C7HA 1YIT3 1SJWA 4EV5A 1JNQA 2BMOB 1EA2A 3SX1A 4O3VA 1QVG2 2GU1A 1FGOA 2WO0A 1YI23 2W56B 3JUNA 1ULIB 1NJI4 3S5CA 2KRTA 3CC43 4HM8B 1GY7A 3WDGB 3LMLA 3NBJA 5D81A 1O7HB 2E2UA 2CWUA 3AMOA 5AIHA 1N5HA 3WMDA 3D3LA 1YVBI 4R4KA 5AIFA 3V92A 1OACA 2CFDA 3FG4A 3ROBA 4KFEA 3D9RA 2BNGA 1GY5A 1NDOB 2MF7A 3F40A 3M8CA 1YJ93 1DMQA 3JUQA 1O7NB 3Q90A 3EN8A 2BMQB 1LNHA 4FMCA 3HI7A 1TP6A 2I9WA 2CKFB 2GBWB 3S29A 1RRHA 3LT8A 1W2B2 1VZZA 1FUWA 1N8QA 5JBSA 1VQN3 1IQ8A 1R4CA 3K7CA 1YJW3 3CCE3 2Z7AA 2HMOB 3LZAA 3B4OA 2Y74A 3JUOA 2R4IA 3G713 2D1WA 3L0RA 5CXOA 1RRLA 1Z1SA 1STDA 4U13A 5G2GA 1GD4A 1VQP3 3UL6A 1W2ZA 2JDIH 3OXAA 3FF0A 1OF5A 2ZDJA 1JKGA 2QEX3 2F98A 1QMAA 3NM7A 3DGOA 1UW1A 3PXMA 3NQZA 1IDPA 3FG1A 3S28A 3T8NA 3EF8A 2Z77A 5ELUA 3WODG 1AVLA 3HIIA 1W7CA 2WOFA 3EB8A 4I4KA 1A2KA 1TFKA 1Q40A 3PZWA 2BT3A 3NM2A 1W5ZA 4N3VA 1IU7A 5IG5A 1WMPA 1NWWA 2W9PA 3EHCA 4MJDA 5AYSC 1KSIA 2CWVA 1O7PB 1OUNA 4EXRA 3H51A 1M1XB 2K54A 4TX4A 2KCDA 3JUMA 4K1VA 1OGZA 4LGQA 4L8OA 1IQXA 3T8UA 4IT7A 1VQ43 1ROVA 3PCRA 3FZWA 2YX9A 3I553 1O7GB 2XH9A 3DXOA 3DGNA 1W4NA 3UNLA 3KFQC 1D6UA 3FH1A 2WGOA 3Q2PA 4FR9A 1VQ63 5CF1A 1QAFA 4EYCA 2GEYA 2CFGA 3LT9A 1ASKA 1IQYA 2GEXA 2HMJB 5IF6A 3CCL3 5EVHA 4RNYA 3SEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9A A;  3G0K A;  5CF2 A;  4ORL A;  1K41 A;  2YFI B;  3I0Y A;  4XBT A;  3SOY A;  3UJM A;  3NUV A;  4KVH A;  1O7W B;  3NXJ A;  4HVN A;  4IIA A;  3KZT A;  5KP4 A;  1Q42 A;  4FCJ A;  4XM4 A;  1GYB A;  3NV0 B;  2RFR A;  4WYK B;  5IG0 A;  1OHS A;  5TGN A;  2HMM B;  1S5A A;  3MG3 A;  1OHO A;  1UUW B;  3EJV A;  5IEN A;  3A76 A;  3EBT A;  2GBX B;  3CPO A;  3KKG A;  4WWU C;  4HM4 B;  1HKX A;  3GRD A;  3RGR A;  5AEU B;  3EC9 A;  3HX8 A;  3MYT A;  1WQL B;  2XSO B;  5IG3 A;  5IEO A;  3B4P A;  3CNM A;  2F99 A;  3GZB A;  3B8L A;  3MHE A;  3OWS A;  1OH0 A;  1BUQ A;  1NU3 A;  5STD A;  4FCM A;  7STD A;  4HM6 B;  4CDL A;  3FF2 A;  3MG1 A;  3BB9 A;  2B24 B;  3GZX B;  3LYG A;  1CQS A;  2XRX B;  2XR8 B;  1UUV B;  4L7K A;  3IPT A;  1W02 A;  8CHO A;  4GB5 A;  4HJL B;  4XDV A;  5BVB A;  4R1K A;  3FLJ A;  3FSD A;  3G8Z A;  1ULJ B;  4HM5 B;  3DZL A;  3FGY A;  1DMM A;  3DUK A;  5JPP A;  3KE7 A;  3OV4 A;  3HZP A;  3VSY A;  2QGU A;  5D83 A;  4WP5 A;  4L8P A;  1JN5 B;  3CNX A;  3ER7 A;  3GZR A;  4J8T A;  3F8X A;  3EQQ B;  2OWP A;  3HK4 A;  3NBR A;  5AII A;  3DM8 A;  2CHC A;  3EN1 B;  4XDW A;  2IMJ A;  2INX A;  3F8H A;  4Q53 A;  4HM2 B;  5DRV A;  1AR0 A;  1E3R A;  4H3U A;  2B1X B;  2XSH B;  1OGX A;  2HMK B;  4HM0 B;  4HM3 B;  1GS3 A;  3NV0 A;  3E99 A;  4WYK A;  3OWY A;  2YFL B;  1W00 A;  1ZX2 A;  2YFJ B;  2F86 B;  4PEJ A;  5D82 A;  5AI1 A;  1OHP A;  4HM7 B;  4XBX A;  1QJG A;  4X2H A;  1E3V A;  3RGA A;  5JPU A;  2HML B;  3SOA A;  5IER A;  2A15 A;  2QIY A;  4STD A;  5AIG A;  3NHX A;  1W6Y A;  5KP3 A;  5DRE A;  3DMC A;  3MG2 A;  3EBY A;  5BXQ A;  3ECF A;  1TUH A;  3JUP A;  3FKA A;  1W01 A;  1U5O A;  1GY6 A;  1OF5 B;  2W2C A;  3F14 A;  1JKG B;  2Z76 A;  4HZB B;  2STD A;  3OWU A;  3F7X A;  3VGN A;  3F9S A;  4R9L A;  4LEH A;  1OPY A;  4XB5 A;  2RGQ A;  5IEP A;  2HMN B;  1Q40 B;  1O7M B;  1JB2 A;  2BMR B;  3GZY B;  2UX0 A;  2JQ5 A;  5CK6 A;  2GXF A;  4OUQ A;  5KP1 A;  4HZ9 B;  3MKI A;  2RCD A;  2PZV A;  4OVM A;  1JB5 A;  3H3H A;  4K1U A;  1EG9 B;  4HM1 B;  5CLK A;  5FW5 A;  5IG4 A;  3OX9 A;  3STD A;  3EX9 A;  3F7S A;  4HKV B;  1JN5 A;  3K0Z A;  1E97 A;  3BLZ A;  1JB4 A;  3MSO A;  6STD A;  4RZM A;  4R9K A;  1DMN A;  3GWR A;  3G16 A;  1ZO2 A;  3KSP A;  4XBY A;  1ISK A;  4LMI A;  1OCV A;  3CU3 A;  3B7C A;  4X2O A;  5AEW B;  5HGR A;  1C7H A;  1SJW A;  2BMO B;  1EA2 A;  3JUN A;  1ULI B;  3S5C A;  4HM8 B;  1GY7 A;  5D81 A;  1O7H B;  5AIH A;  3WMD A;  5AIF A;  3ROB A;  3D9R A;  2BNG A;  1GY5 A;  1NDO B;  3F40 A;  3M8C A;  1DMQ A;  3JUQ A;  1O7N B;  3Q90 A;  3EN8 A;  2BMQ B;  1TP6 A;  2I9W A;  2CKF B;  2GBW B;  1VZZ A;  3K7C A;  2Z7A A;  2HMO B;  3LZA A;  3B4O A;  3JUO A;  2R4I A;  5CXO A;  1Z1S A;  1STD A;  4U13 A;  5G2G A;  3OXA A;  3FF0 A;  1OF5 A;  1JKG A;  2F98 A;  1QMA A;  1IDP A;  3T8N A;  3EF8 A;  2Z77 A;  4I4K A;  1A2K A;  1Q40 A;  3NM2 A;  4N3V A;  5IG5 A;  1NWW A;  3EHC A;  4MJD A;  1O7P B;  1OUN A;  3H51 A;  2K54 A;  3JUM A;  4K1V A;  1OGZ A;  4LGQ A;  4L8O A;  3T8U A;  3FZW A;  1O7G B;  3DXO A;  3UNL A;  3FH1 A;  5CF1 A;  2GEY A;  1ASK A;  2GEX A;  2HMJ B;  5IF6 A;  5EVH A;  3SED A; 
#chains in the Genus database with same CATH topology
 4J9A A;  3G0K A;  3T0U A;  1RGL A;  1TIJ A;  5CF2 A;  1LQG C;  3DGY A;  4ORL A;  1K41 A;  1STF I;  2YFI B;  3I0Y A;  4XBT A;  4RNZ A;  3SOY A;  3UJM A;  3CXC 2;  3NUV A;  3X3Z A;  1W6G A;  4KVH A;  1O7W B;  3NXJ A;  4HVN A;  1AY7 A;  3X3Y A;  1B20 A;  3K63 A;  4IIA A;  1GOY A;  3KZT A;  5KP4 A;  1MOL A;  1BNR A;  1FUT A;  7GSP A;  3S67 A;  1Q42 A;  1VQ8 3;  4FCJ A;  1B2X A;  2CX1 A;  2CWT A;  1LOW A;  2L4V A;  5EEO A;  4LZI A;  1YVS A;  2F4Y A;  2OOV A;  4XM4 A;  1GYB A;  1N9J A;  4RBN A;  4NPB A;  3NV0 B;  3CME 3;  2RFR A;  1UCI A;  4WYK B;  5IG0 A;  1UI8 A;  3D4A A;  3UL5 A;  1K73 4;  4NHF A;  4ILF A;  1OHS A;  5TGN A;  2HMM B;  1VQK 3;  1BNI A;  1S5A A;  1BVI A;  3MG3 A;  1OHO A;  1RDS A;  5A0O B;  1UUW B;  2H0G A;  3CC2 3;  1Q86 4;  3EJV A;  1VQO 3;  2RSX A;  5IEN A;  3KII A;  3A76 A;  1U8C B;  1SII A;  1X1U A;  3EBT A;  3CD6 3;  5LC6 A;  2GBX B;  3CPO A;  8RNT A;  3KKG A;  4WWU C;  1EKM A;  1AQZ A;  3D5I A;  4HM4 B;  1HKX A;  1PY3 A;  3GRD A;  2MC8 A;  3RGR A;  1ROA A;  5AEU B;  1VQM 3;  3EC9 A;  1IVX A;  2W56 A;  1FA3 A;  1FGQ A;  2FNQ A;  4N6V 0;  1US1 A;  3HX8 A;  2E2T A;  1BRH A;  3MYT A;  1WQL B;  1SQW A;  2XFT A;  2XSO B;  3ZFZ A;  2CFW A;  5IG3 A;  1N9E A;  3QRD A;  5IEO A;  3B4P A;  1YHQ 3;  3CNM A;  2F56 A;  1BUJ A;  5BU4 A;  2F99 A;  3NQY A;  1MNL A;  1MGR A;  3GZB A;  1X1W A;  2O3O A;  3B8L A;  3DGM A;  1BNS A;  1RGH A;  5GSP A;  6GSP A;  1YJN 3;  3MHE A;  1RGK A;  2D42 A;  3FCS B;  1QVF 2;  4O02 B;  1BRI A;  2AAD A;  1WNH A;  1JBT A;  3OWS A;  1VQL 3;  3CCM 3;  1OH0 A;  1BUQ A;  1NU3 A;  5STD A;  4FCM A;  3JVC A;  4HYZ A;  3ZG5 A;  2KAA A;  2ML6 A;  2P0M A;  4HM6 B;  7STD A;  2F5M A;  3CPW 2;  2GSP A;  1Q81 4;  1T2I A;  2FXT A;  1BRN L;  1AV4 A;  4CDL A;  6RNT A;  2CG1 A;  1WMN A;  1KC8 4;  2W04 A;  2BIR A;  3FF2 A;  2BHM A;  3MG1 A;  4N6O B;  4O8S A;  2UUG C;  3BB9 A;  4O2H A;  2P09 A;  3BNB A;  2B24 B;  3GZX B;  3KSE D;  3LYG A;  1G96 A;  1CQS A;  1B2M A;  2BO9 B;  2XRX B;  1FUS A;  3CCQ 3;  2XR8 B;  2CFK A;  3HIG A;  4N6T A;  1VQ7 3;  1UUV B;  1BOX A;  1BNF A;  1M9G A;  1T2H A;  5M19 A;  2FGT A;  2OQE A;  2IY2 A;  4JF8 A;  4L7K A;  3IPT A;  4BIR A;  1DE3 A;  4JRF A;  2LQV A;  1B3S A;  3DY5 A;  4BTY A;  2RNT A;  1Q82 4;  1UI7 A;  1W02 A;  1KD1 4;  1FGR A;  5RNT A;  8CHO A;  1BNE A;  4MMZ B;  2AAE A;  4GB5 A;  4HJL B;  2ML5 A;  4XDV A;  2QA4 3;  4LYL B;  9RNT A;  3WA3 A;  3BNC A;  3OW2 2;  3G6E 3;  5BVB A;  2P38 A;  1EEJ A;  4R1K A;  5I97 A;  1BU4 A;  1IV7 A;  3FLJ A;  2P05 A;  2PNC A;  2OOV C;  3FSD A;  4N6M A;  3G8Z A;  5G1L A;  1ULJ B;  4HM5 B;  3DZL A;  3FGY A;  3WA2 X;  7RNT A;  1ZS7 A;  4J5G A;  2C4B A;  2KF4 A;  3RDE A;  2CW9 A;  1DMM A;  3Q1C A;  3DUK A;  5JPP A;  4EC6 A;  1RCK A;  3FG3 A;  1V74 A;  1EUI C;  1FGM A;  1UCJ A;  3KE7 A;  3OV4 A;  4BL3 A;  1IVV A;  3NBB A;  4G1M B;  3HZP A;  3VSY A;  1Y4K A;  4EV2 A;  1M90 4;  2KF3 A;  2QGU A;  2Y73 A;  4OK0 A;  5D83 A;  1K9M 4;  4WP5 A;  1D6Z A;  4L8P A;  1MWT A;  3Q3F A;  5AYR B;  3URP A;  1JN5 B;  1BRJ A;  2M7O A;  3CNX A;  3ER7 A;  1YGE A;  1J2B A;  1I2E A;  1LOX A;  1ZGX A;  3GZR A;  4J8T A;  3BNE A;  3ZG0 A;  1SPU A;  4MEI A;  1MWU A;  1JZD A;  1I0V A;  3EQQ B;  2OWP A;  3F8X A;  3HK4 A;  3NBR A;  4MMY B;  5AII A;  3MPH A;  3GSP A;  1GOU A;  1I70 A;  2W6J H;  3DM8 A;  4R80 A;  3TDG A;  2CHC A;  4FMD A;  3EN1 B;  1I3I A;  1C54 A;  4KFD A;  1DVC A;  3V92 A;  1TU5 A;  4XDW A;  5M18 A;  2IMJ A;  1IK3 A;  2INX A;  4HOH A;  1UCK A;  3CCV 3;  1MGW A;  1TJD A;  3F8H A;  3HOH A;  4Q53 A;  1QAK A;  1DYU A;  4HM2 B;  3NX0 A;  4AEQ A;  2KF6 A;  2R41 A;  1JRQ A;  5DRV A;  3I56 3;  1NB5 I;  3CCR 3;  1HU9 A;  1RNB A;  1MWS A;  1AR0 A;  4N6N B;  1F8N A;  1E3R A;  1D6Y A;  4H3U A;  2B1X B;  2XSH B;  1OGX A;  1WTH A;  3AHS A;  1WMO A;  2HMK B;  3RNT A;  4HM0 B;  5LC7 A;  3D79 A;  1UUG B;  4HM3 B;  2IA7 A;  3O8Y A;  1UGI A;  3LXU X;  1GS3 A;  4AKY A;  5FGO A;  1K8A 4;  4GL6 A;  1BRS A;  1Q9E A;  2H0H A;  2K3D A;  3LOY A;  3NV0 A;  3X40 A;  1YNV X;  3E99 A;  1UDI I;  4WYK A;  3G4S 3;  3KN4 A;  1Q7Y 4;  3OWY A;  3X3X A;  2YFL B;  1VQ9 3;  1JJ2 2;  2LYX A;  3K5T A;  1W00 A;  1ZX2 A;  3PCS A;  5IW9 A;  3LTB A;  2YFJ B;  2F86 B;  4PEJ A;  3SXX A;  3GAX A;  2CIU A;  4WHA A;  5D82 A;  1RN7 A;  3AMO B;  5AI1 A;  1OHP A;  2F5W A;  1LXE A;  3D5G A;  2HOH A;  1FGT A;  4EW5 A;  4FMA A;  4HM7 B;  2OQE C;  4XBX A;  1N5P A;  1KQS 2;  1BAO A;  4BTW A;  1QJG A;  3DGL A;  5HOH A;  1YIJ 3;  4X2H A;  1E3V A;  1JZO A;  3LTD A;  4FMB A;  3RGA A;  3UB1 A;  1X1Y A;  2XF3 A;  2CX0 A;  2HML B;  3DH2 A;  4WFO A;  3SOA A;  2SBL A;  5IER A;  1RLS A;  5JPU A;  1PU4 A;  5BIR A;  1N8R 4;  2OCT A;  2A15 A;  3LH4 A;  2QIY A;  1GOV A;  2CK3 H;  1A2V A;  3NHX A;  4STD A;  1JV2 B;  5AIG A;  3U97 A;  3X42 A;  2E2V A;  2XEP A;  1W6Y A;  5KP3 A;  1BSD A;  3DMC A;  5DRE A;  3MG2 A;  1IT7 A;  1T5Y A;  3EBY A;  1RJO A;  5BXQ A;  1S72 3;  3ECF A;  1TUH A;  2L1S A;  3JUP A;  3FKA A;  4I5Q A;  1K28 A;  1LNI A;  1B27 A;  5EQL A;  1RGF A;  1GSP A;  1YGW A;  2C10 A;  3PS8 A;  2OTL 3;  1SAR A;  1IV9 A;  3MWZ A;  4ZM8 A;  2WGQ A;  1W01 A;  1U5O A;  1BRK A;  1GY6 A;  1OF5 B;  2W2C A;  3F14 A;  1JKG B;  2Z76 A;  4HZB B;  1A67 A;  2STD A;  3OWU A;  3WR2 A;  1QAL A;  3AHW A;  3BND A;  3F7X A;  3WHO A;  3VGN A;  3J7Y d;  3F9S A;  2XGL A;  2GU3 A;  1V58 A;  4R9L A;  1DVD A;  3N54 B;  1BRG A;  2CFL A;  2IUK A;  1KWI A;  3CMA 3;  2BU4 A;  3SLU A;  4LEH A;  1OPY A;  3A5E A;  4XB5 A;  1JBR A;  2UGI A;  2RGQ A;  4BU4 A;  1BGS A;  1HZ1 A;  5IEP A;  4MMX B;  2HMN B;  3IJE B;  1Q40 B;  2KF5 A;  3CCS 3;  1O7M B;  1CEW I;  3U1W A;  1JB2 A;  3WOE B;  2BMR B;  3GZY B;  2UX0 A;  2C11 A;  1VQ5 3;  4BTX A;  4QWT A;  2W9Q A;  2JQ5 A;  2P0X A;  2CC3 A;  4KFF A;  1IT8 A;  2H0I A;  5CK6 A;  2W03 A;  2GXF A;  4OUQ A;  5KP1 A;  1RKY A;  2OTJ 3;  1G0T A;  2Z6B A;  4HZ9 B;  3MKI A;  3S27 A;  1Q7H A;  2RCD A;  2PZV A;  3N8B A;  4J5K A;  3CCU 3;  4NRE A;  3V98 A;  3CC7 3;  4OVM A;  1JB5 A;  2IUJ A;  1A90 A;  2CH9 A;  2ZA4 A;  3ALA A;  4LSO A;  3H3H A;  4K1U A;  1EG9 B;  2K0M A;  2O9U X;  4HM1 B;  1FZU A;  1BNJ A;  1GD3 A;  5CLK A;  3EE1 A;  1RMS A;  1RTU A;  1PYL A;  1LVN A;  2XGN A;  5FW5 A;  5IG4 A;  3IMA B;  1NB3 I;  3OX9 A;  3STD A;  3LTA A;  2V1L A;  2WOH A;  2XFS A;  3EX9 A;  3F7S A;  1SIH A;  2KXG A;  4HKV B;  3X41 A;  4EBG A;  4KZ1 A;  2ZHX B;  3PYJ A;  1TFO A;  1JN5 A;  3K0Z A;  4K90 B;  3K9M C;  1CYV A;  1E97 A;  3BLZ A;  1JB4 A;  1I2G A;  3MSO A;  6STD A;  1I0X A;  4RZM A;  1BSE A;  1FW7 A;  4R9K A;  1DMN A;  3GWR A;  3G16 A;  1CYU A;  1GMQ A;  1ZO2 A;  4CJN A;  4CCV A;  3CCJ 3;  1B2S A;  4GSP A;  1IVU A;  3LTC A;  3VF1 A;  2W0Q A;  1M1K 4;  3KSP A;  1PFP A;  3N9H A;  5G1K A;  1NO3 A;  4HBR A;  3V99 A;  4HAA A;  4AKZ A;  3QK9 A;  5ELJ A;  2CG0 A;  4XBY A;  1EQK A;  4N6U A;  1ISK A;  4KT3 B;  2IYJ A;  4LMI A;  1OCV A;  1L5G B;  4K61 A;  3CU3 A;  3SVA A;  2Q07 A;  3B7C A;  4FCZ A;  4IPB A;  3WOF B;  1IVW A;  1AVK A;  4N6L A;  1LQM B;  4X2O A;  1A2P A;  2ZL8 A;  1W6C A;  3PGB A;  5AEW B;  4H61 A;  5HGR A;  1C7H A;  1YIT 3;  1SJW A;  4EV5 A;  1JNQ A;  2BMO B;  1EA2 A;  3SX1 A;  1T3B A;  4O3V A;  1QVG 2;  2GU1 A;  1FGO A;  1NNV A;  2WO0 A;  2SAR A;  1YI2 3;  2W56 B;  3JUN A;  1RNT A;  1ULI B;  1NJI 4;  3S5C A;  2KRT A;  3CC4 3;  1RSN A;  4HM8 B;  1GY7 A;  3WDG B;  1IYY A;  3LML A;  3NBJ A;  5D81 A;  1RN1 A;  1O7H B;  2E2U A;  2CWU A;  3AMO A;  5AIH A;  1N5H A;  1MWR A;  3WMD A;  3D3L A;  1YVB I;  3AGN A;  3BU4 A;  3AGO A;  3KCH A;  4R4K A;  1I3F A;  1OAC A;  2CFD A;  3FG4 A;  5AIF A;  4KFE A;  3ROB A;  3D9R A;  2BNG A;  1GY5 A;  1NDO B;  2MF7 A;  3F40 A;  3M8C A;  1YJ9 3;  1DMQ A;  3JUQ A;  1O7N B;  3Q90 A;  1RGC A;  3EN8 A;  1TRP A;  2BMQ B;  1LNH A;  4FMC A;  3HI7 A;  1TP6 A;  2I9W A;  2CKF B;  2GBW B;  3S29 A;  1RRH A;  1G02 A;  1RGG A;  3BIR A;  3LT8 A;  4CPK A;  1W2B 2;  1VZZ A;  1FUW A;  1I8V A;  1N8Q A;  1RCL A;  5JBS A;  1VQN 3;  1IQ8 A;  1LRA A;  1R4C A;  3K7C A;  1V57 A;  1YJW 3;  3CCE 3;  2Z7A A;  1TRQ A;  2HMO B;  1I2F A;  1BSA A;  3LZA A;  5M1A A;  4GHO A;  1BIR A;  3B4O A;  2Y74 A;  3JUO A;  2R4I A;  3G71 3;  2D1W A;  3L0R A;  5CXO A;  1RRL A;  1Z1S A;  1STD A;  4U13 A;  5G2G A;  1GD4 A;  1RGA A;  1VQP 3;  3UL6 A;  1W2Z A;  2JDI H;  3OXA A;  3FF0 A;  1OF5 A;  4RNT A;  2ZDJ A;  1JKG A;  2QEX 3;  1B21 A;  2F98 A;  1QMA A;  3NM7 A;  3SYU A;  3DGO A;  1CH0 A;  1UW1 A;  3PXM A;  3NQZ A;  1IDP A;  1BAN A;  3FG1 A;  3S28 A;  2J8X B;  3T8N A;  3EF8 A;  2RBI A;  2Z77 A;  1HYF A;  1JBS A;  1B2Z A;  5ELU A;  1AVL A;  3HII A;  3WOD G;  1W7C A;  2WOF A;  3EB8 A;  4I4K A;  1A2K A;  1TFK A;  1RGE A;  1Q40 A;  1X1X A;  1LOV A;  3PZW A;  2BT3 A;  3NM2 A;  1W5Z A;  4N3V A;  1IU7 A;  5IG5 A;  1BNG A;  1WMP A;  1NWW A;  1BSC A;  2W9P A;  3EHC A;  4MJD A;  5AYS C;  1TTO A;  1KSI A;  2CWV A;  1O7P B;  1OUN A;  4EXR A;  1RN4 A;  1M1X B;  2K54 A;  3H51 A;  4TX4 A;  1GMP A;  2KCD A;  4DKI A;  3JUM A;  4K1V A;  1OGZ A;  4LGQ A;  4L8O A;  1IQX A;  1LOY A;  1BSB A;  3T8U A;  1R4Y A;  4IT7 A;  1VQ4 3;  1UCL A;  1ROV A;  3PCR A;  3FZW A;  4BL2 A;  1VQQ A;  2YX9 A;  3I55 3;  1O7G B;  2XH9 A;  3DXO A;  3DGN A;  1W4N A;  1GMR A;  3UNL A;  3KFQ C;  1D6U A;  3FH1 A;  2WGO A;  3Q2P A;  4FR9 A;  1VQ6 3;  5CF1 A;  1QAF A;  1FYS A;  2GEY A;  2CFG A;  1UGH I;  3LT9 A;  1ASK A;  1IQY A;  2GEX A;  2HMJ B;  4EYC A;  5IF6 A;  3CCL 3;  1RHL A;  1B2U A;  5EVH A;  1DET A;  4RNY A;  3SED A; 
#chains in the Genus database with same CATH homology
 4J9A A;  3G0K A;  3T0U A;  5CF2 A;  1TIJ A;  4ORL A;  1K41 A;  1STF I;  2YFI B;  3I0Y A;  4XBT A;  4RNZ A;  3SOY A;  3UJM A;  3CXC 2;  3NUV A;  3X3Z A;  1W6G A;  4KVH A;  1O7W B;  3NXJ A;  4HVN A;  3X3Y A;  3K63 A;  4IIA A;  3KZT A;  5KP4 A;  1MOL A;  3S67 A;  1Q42 A;  1VQ8 3;  4FCJ A;  2CWT A;  5EEO A;  2L4V A;  4LZI A;  2OOV A;  4XM4 A;  1GYB A;  1N9J A;  4RBN A;  3NV0 B;  3CME 3;  2RFR A;  4WYK B;  5IG0 A;  1UI8 A;  3UL5 A;  1K73 4;  4NHF A;  1OHS A;  5TGN A;  2HMM B;  1VQK 3;  1S5A A;  3MG3 A;  1OHO A;  3CC2 3;  5A0O B;  1UUW B;  1Q86 4;  3EJV A;  1VQO 3;  2RSX A;  5IEN A;  3KII A;  3A76 A;  1U8C B;  1SII A;  3EBT A;  3CD6 3;  5LC6 A;  2GBX B;  3CPO A;  3KKG A;  4WWU C;  1EKM A;  4HM4 B;  1HKX A;  3GRD A;  2MC8 A;  3RGR A;  1ROA A;  5AEU B;  1VQM 3;  3EC9 A;  1IVX A;  2W56 A;  1FA3 A;  1FGQ A;  2FNQ A;  4N6V 0;  1US1 A;  3HX8 A;  2E2T A;  3MYT A;  1WQL B;  1SQW A;  2XFT A;  2XSO B;  2CFW A;  5IG3 A;  1N9E A;  3QRD A;  5IEO A;  3B4P A;  1YHQ 3;  3CNM A;  2F99 A;  3NQY A;  1MNL A;  3GZB A;  2O3O A;  3DGM A;  3B8L A;  1YJN 3;  3MHE A;  2D42 A;  3FCS B;  1QVF 2;  4O02 B;  1WNH A;  3OWS A;  1VQL 3;  3CCM 3;  1OH0 A;  1BUQ A;  1NU3 A;  5STD A;  4FCM A;  3JVC A;  4HYZ A;  7STD A;  2ML6 A;  2P0M A;  4HM6 B;  3CPW 2;  1Q81 4;  2FXT A;  1AV4 A;  4CDL A;  2CG1 A;  1WMN A;  1KC8 4;  2W04 A;  3FF2 A;  2BHM A;  3MG1 A;  4N6O B;  4O8S A;  3BB9 A;  4O2H A;  2P09 A;  3BNB A;  2B24 B;  3GZX B;  3KSE D;  3LYG A;  1G96 A;  1CQS A;  2BO9 B;  2XRX B;  3CCQ 3;  2XR8 B;  2CFK A;  3HIG A;  4N6T A;  1VQ7 3;  1M9G A;  1UUV B;  2FGT A;  2OQE A;  4JF8 A;  4L7K A;  3IPT A;  4JRF A;  2LQV A;  3DY5 A;  4BTY A;  1Q82 4;  1UI7 A;  1W02 A;  1KD1 4;  1FGR A;  8CHO A;  4MMZ B;  4GB5 A;  4HJL B;  2ML5 A;  4XDV A;  2QA4 3;  3WA3 A;  3BNC A;  3OW2 2;  3G6E 3;  5BVB A;  2P38 A;  4R1K A;  5I97 A;  1IV7 A;  3FLJ A;  2P05 A;  2PNC A;  2OOV C;  3FSD A;  4N6M A;  3G8Z A;  1ULJ B;  4HM5 B;  3DZL A;  3FGY A;  3WA2 X;  3RDE A;  2CW9 A;  1DMM A;  3Q1C A;  3DUK A;  5JPP A;  4EC6 A;  3FG3 A;  1V74 A;  3KE7 A;  1FGM A;  3OV4 A;  1IVV A;  3NBB A;  4G1M B;  3HZP A;  3VSY A;  1Y4K A;  4EV2 A;  1M90 4;  2QGU A;  2Y73 A;  5D83 A;  4OK0 A;  1K9M 4;  4WP5 A;  1D6Z A;  4L8P A;  5AYR B;  1JN5 B;  2M7O A;  3CNX A;  3ER7 A;  1YGE A;  1J2B A;  1LOX A;  3GZR A;  4J8T A;  3BNE A;  1SPU A;  4MEI A;  3F8X A;  3EQQ B;  2OWP A;  3HK4 A;  3NBR A;  4MMY B;  5AII A;  3MPH A;  3DM8 A;  4R80 A;  2W6J H;  3TDG A;  2CHC A;  4FMD A;  3EN1 B;  4KFD A;  1DVC A;  1TU5 A;  4XDW A;  2IMJ A;  1IK3 A;  2INX A;  3CCV 3;  3F8H A;  4Q53 A;  1QAK A;  1DYU A;  4HM2 B;  3NX0 A;  4AEQ A;  1NB5 I;  3I56 3;  1JRQ A;  5DRV A;  3CCR 3;  1HU9 A;  1AR0 A;  4N6N B;  1F8N A;  1E3R A;  1D6Y A;  4H3U A;  2B1X B;  2XSH B;  1OGX A;  1WTH A;  1WMO A;  2HMK B;  4HM0 B;  5LC7 A;  4HM3 B;  2IA7 A;  3O8Y A;  3LXU X;  1GS3 A;  4AKY A;  5FGO A;  1K8A 4;  4GL6 A;  3LOY A;  3NV0 A;  3X40 A;  1Q7Y 4;  3E99 A;  4WYK A;  3G4S 3;  1VQ9 3;  3KN4 A;  3OWY A;  3X3X A;  2YFL B;  1JJ2 2;  2LYX A;  3K5T A;  1W00 A;  1ZX2 A;  3PCS A;  5IW9 A;  3LTB A;  2YFJ B;  2F86 B;  4PEJ A;  3SXX A;  3GAX A;  2CIU A;  4WHA A;  5D82 A;  1RN7 A;  3AMO B;  5AI1 A;  1OHP A;  1LXE A;  1FGT A;  4FMA A;  4HM7 B;  2OQE C;  4XBX A;  1N5P A;  1KQS 2;  4BTW A;  1QJG A;  3DGL A;  1YIJ 3;  4X2H A;  1E3V A;  3UB1 A;  3LTD A;  4FMB A;  3RGA A;  2XF3 A;  5JPU A;  2HML B;  1PU4 A;  4WFO A;  3SOA A;  2SBL A;  5IER A;  1N8R 4;  2OCT A;  2A15 A;  3LH4 A;  2QIY A;  2CK3 H;  1A2V A;  3NHX A;  4STD A;  1JV2 B;  5AIG A;  3U97 A;  3X42 A;  2E2V A;  2XEP A;  1W6Y A;  5KP3 A;  5DRE A;  3DMC A;  3MG2 A;  1IT7 A;  1T5Y A;  3EBY A;  1RJO A;  5BXQ A;  1S72 3;  3ECF A;  1TUH A;  3JUP A;  3FKA A;  1K28 A;  5EQL A;  2C10 A;  3PS8 A;  2OTL 3;  1IV9 A;  3MWZ A;  4ZM8 A;  2WGQ A;  1W01 A;  1U5O A;  1GY6 A;  1OF5 B;  2W2C A;  3F14 A;  1JKG B;  2Z76 A;  4HZB B;  1A67 A;  2STD A;  3OWU A;  1QAL A;  3BND A;  3F7X A;  3J7Y d;  3VGN A;  3F9S A;  2XGL A;  2GU3 A;  4R9L A;  1DVD A;  3N54 B;  2CFL A;  2IUK A;  1KWI A;  3CMA 3;  3SLU A;  4LEH A;  1OPY A;  4XB5 A;  2RGQ A;  5IEP A;  4MMX B;  2HMN B;  3IJE B;  1Q40 B;  3CCS 3;  1O7M B;  1CEW I;  3U1W A;  1JB2 A;  3WOE B;  2BMR B;  3GZY B;  2UX0 A;  2C11 A;  1VQ5 3;  4BTX A;  4QWT A;  2W9Q A;  2JQ5 A;  2P0X A;  2CC3 A;  4KFF A;  1IT8 A;  5CK6 A;  2W03 A;  2GXF A;  4OUQ A;  5KP1 A;  1RKY A;  2OTJ 3;  2Z6B A;  4HZ9 B;  3MKI A;  3S27 A;  3N8B A;  2RCD A;  2PZV A;  3CCU 3;  4NRE A;  3V98 A;  3CC7 3;  4OVM A;  1JB5 A;  2IUJ A;  1A90 A;  2CH9 A;  3ALA A;  4LSO A;  3H3H A;  4K1U A;  1EG9 B;  2K0M A;  2O9U X;  4HM1 B;  1GD3 A;  5CLK A;  3EE1 A;  1LVN A;  2XGN A;  5FW5 A;  5IG4 A;  3IMA B;  1NB3 I;  3OX9 A;  3STD A;  3LTA A;  2V1L A;  2WOH A;  2XFS A;  3EX9 A;  3F7S A;  1SIH A;  2KXG A;  4HKV B;  3X41 A;  4EBG A;  4KZ1 A;  3PYJ A;  1TFO A;  1JN5 A;  3K0Z A;  4K90 B;  3K9M C;  1CYV A;  1E97 A;  3BLZ A;  1JB4 A;  3MSO A;  6STD A;  4RZM A;  4R9K A;  1DMN A;  3GWR A;  3G16 A;  1CYU A;  1ZO2 A;  3CCJ 3;  4CCV A;  1IVU A;  3LTC A;  3VF1 A;  2W0Q A;  1M1K 4;  3KSP A;  1PFP A;  3N9H A;  1NO3 A;  4HBR A;  3V99 A;  4AKZ A;  3QK9 A;  5ELJ A;  2CG0 A;  4XBY A;  1EQK A;  4N6U A;  1ISK A;  4LMI A;  1OCV A;  1L5G B;  4K61 A;  3CU3 A;  3SVA A;  2Q07 A;  3B7C A;  4FCZ A;  4IPB A;  3WOF B;  1IVW A;  1AVK A;  4N6L A;  4X2O A;  2ZL8 A;  1W6C A;  3PGB A;  5AEW B;  4H61 A;  5HGR A;  1C7H A;  1YIT 3;  1SJW A;  4EV5 A;  1JNQ A;  2BMO B;  1EA2 A;  3SX1 A;  4O3V A;  1QVG 2;  2GU1 A;  1FGO A;  2WO0 A;  1YI2 3;  2W56 B;  3JUN A;  1ULI B;  1NJI 4;  3S5C A;  2KRT A;  3CC4 3;  4HM8 B;  1GY7 A;  3WDG B;  3LML A;  3NBJ A;  5D81 A;  1O7H B;  2E2U A;  2CWU A;  3AMO A;  5AIH A;  1N5H A;  3WMD A;  3D3L A;  1YVB I;  4R4K A;  5AIF A;  3V92 A;  1OAC A;  2CFD A;  3FG4 A;  3ROB A;  4KFE A;  3D9R A;  2BNG A;  1GY5 A;  1NDO B;  2MF7 A;  3F40 A;  3M8C A;  1YJ9 3;  1DMQ A;  3JUQ A;  1O7N B;  3Q90 A;  3EN8 A;  2BMQ B;  1LNH A;  4FMC A;  3HI7 A;  1TP6 A;  2I9W A;  2CKF B;  2GBW B;  3S29 A;  1RRH A;  3LT8 A;  1W2B 2;  1VZZ A;  1FUW A;  1N8Q A;  5JBS A;  1VQN 3;  1IQ8 A;  1R4C A;  3K7C A;  1YJW 3;  3CCE 3;  2Z7A A;  2HMO B;  3LZA A;  3B4O A;  2Y74 A;  3JUO A;  2R4I A;  3G71 3;  2D1W A;  3L0R A;  5CXO A;  1RRL A;  1Z1S A;  1STD A;  4U13 A;  5G2G A;  1GD4 A;  1VQP 3;  3UL6 A;  1W2Z A;  2JDI H;  3OXA A;  3FF0 A;  1OF5 A;  2ZDJ A;  1JKG A;  2QEX 3;  2F98 A;  1QMA A;  3NM7 A;  3DGO A;  1UW1 A;  3PXM A;  3NQZ A;  1IDP A;  3FG1 A;  3S28 A;  3T8N A;  3EF8 A;  2Z77 A;  5ELU A;  3WOD G;  1AVL A;  3HII A;  1W7C A;  2WOF A;  3EB8 A;  4I4K A;  1A2K A;  1TFK A;  1Q40 A;  3PZW A;  2BT3 A;  3NM2 A;  1W5Z A;  4N3V A;  1IU7 A;  5IG5 A;  1WMP A;  1NWW A;  2W9P A;  3EHC A;  4MJD A;  5AYS C;  1KSI A;  2CWV A;  1O7P B;  1OUN A;  4EXR A;  3H51 A;  1M1X B;  2K54 A;  4TX4 A;  2KCD A;  3JUM A;  4K1V A;  1OGZ A;  4LGQ A;  4L8O A;  1IQX A;  3T8U A;  4IT7 A;  1VQ4 3;  1ROV A;  3PCR A;  3FZW A;  2YX9 A;  3I55 3;  1O7G B;  2XH9 A;  3DXO A;  3DGN A;  1W4N A;  3UNL A;  3KFQ C;  1D6U A;  3FH1 A;  2WGO A;  3Q2P A;  4FR9 A;  1VQ6 3;  5CF1 A;  1QAF A;  4EYC A;  2GEY A;  2CFG A;  3LT9 A;  1ASK A;  1IQY A;  2GEX A;  2HMJ B;  5IF6 A;  3CCL 3;  5EVH A;  4RNY A;  3SED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...