4OVMA

Crystal structure of sgcj protein from streptomyces carzinostaticus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
RDVTAVADVPRRMMEAWASNDASAFASLFAPDGTMVLPGDVFQKGVDGIREFMTKCYAGPYKGTSVFGVPIDVRFTGPDTAILITQGGVMAPGEHSVAPDKEIRATWVLGKRDGAWLVEAYHNSPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein SgcJ
publication title Crystal structure of SgcJ, an NTF2-like superfamily protein involved in biosynthesis of the nine-membered enediyne antitumor antibiotic C-1027.
pubmed doi rcsb
source organism Streptomyces carzinostaticus subsp. neocarzinostaticus
molecule tags Unknown function
total genus 23
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ovmA00
3GZXB 3NV0B 5CF2A 4HM3B 2BMQB 3NXJA 4WP5A 2PZVA 4LMIA 4XB5A 4XDWA 1ZX2A 4GB5A 3EC9A 5AIIA 1SJWA 1JB5A 2CHCA 3GZRA 3MKIA 3UNLA 5IENA 4STDA 3JUNA 2YFIB 4ORLA 3NV0A 3Q90A 2BNGA 5D81A 1U5OA 1O7GB 1JKGB 1VZZA 2HMOB 3FSDA 3SOYA 3KZTA 2GEXA 1C7HA 3DM8A 4HJLB 4HKVB 1DMNA 5AIFA 3JUOA 2GEYA 6STDA 1JB4A 4WYKB 4XM4A 4L8PA 3MG3A 3F40A 1W00A 5KP1A 4H3UA 5HGRA 4J9AA 3OWSA 1W6YA 1OHOA 1JKGA 4XBTA 5CK6A 5D83A 3F7XA 1GS3A 1W02A 4K1UA 3FLJA 2IMJA 2CKFB 1OHPA 3HK4A 1Z1SA 4WYKA 1BUQA 2GBXB 3DZLA 3EBTA 3EQQB 3OWUA 3F7SA 3G0KA 3BB9A 5AI1A 4HM7B 1OCVA 3K7CA 4MJDA 1EG9B 1TUHA 4PEJA 3LYGA 3D9RA 3FF0A 3WMDA 2Z7AA 3SOAA 4CDLA 4HM2B 1ZO2A 3CPOA 3G16A 1Q40B 5CF1A 2BMOB 2OWPA 4RZMA 1NWWA 2YFLB 1OF5B 3MSOA 1JB2A 4HZBB 5JPPA 3F9SA 2QGUA 2HMMB 4N3VA 1Q42A 3NM2A 3GRDA 4HM4B 3SEDA 4HM5B 4X2HA 3KSPA 1OPYA 2Z76A 3T8UA 3E99A 5IG5A 2K54A 3B4OA 3MG1A 3VGNA 1Q40A 3FKAA 1O7MB 2XR8B 3EN8A 3ROBA 1NU3A 3I0YA 4X2OA 1OF5A 1JN5B 2HMJB 3MG2A 4J8TA 1DMMA 4R9KA 2GBWB 5G2GA 3H3HA 3VSYA 1DMQA 1OUNA 3CU3A 5DRVA 3DXOA 8CHOA 5IG0A 3NUVA 3OX9A 2STDA 3HZPA 1JN5A 1WQLB 5D82A 2B1XB 3K0ZA 1E97A 4XDVA 1ULJB 1OGZA 3G8ZA 2GXFA 2HMKB 1HKXA 3DMCA 1TP6A 1OHSA 1GY7A 4HM8B 3BLZA 1OGXA 2F99A 4XBYA 3F8XA 5CXOA 2F98A 1O7NB 1CQSA 5AIHA 1ISKA 3CNMA 1OH0A 4FCJA 2BMRB 3FF2A 5FW5A 3LZAA 5IERA 5KP3A 3IPTA 2HMLB 1QMAA 4K1VA 1K41A 3JUPA 4HZ9B 3HX8A 3A76A 3GZYB 5CLKA 3STDA 3RGRA 2QIYA 3UJMA 3OV4A 4HM6B 4FCMA 4LGQA 2HMNB 5IG3A 3H51A 3EBYA 3NHXA 5TGNA 1S5AA 4LEHA 1UUVB 3ER7A 3NBRA 3OWYA 3EN1B 3ECFA 1E3RA 2W2CA 5IG4A 2JQ5A 2YFJB 2I9WA 5BXQA 3EJVA 3B4PA 2UX0A 3F8HA 1QJGA 5AEUB 2Z77A 3EX9A 3MHEA 4HM0B 5IEPA 4R9LA 3JUQA 3CNXA 1GYBA 4IIAA 3OXAA 3T8NA 1O7WB 3B7CA 3F14A 3MYTA 2XSHB 1AR0A 5AEWB 4WWUC 3FGYA 1UUWB 3DUKA 1STDA 5KP4A 3EHCA 5IF6A 2RFRA 3S5CA 1O7PB 3KKGA 5AIGA 4L8OA 7STDA 1IDPA 3FZWA 5EVHA 4I4KA 4XBXA 5BVBA 4U13A 2B24B 4R1KA 1E3VA 1NDOB 4L7KA 1GY5A 1GY6A 1O7HB 4HVNA 3B8LA 1W01A 2RGQA 3FH1A 3EF8A 5IEOA 2XRXB 4HM1B 3JUMA 2A15A 1ASKA 1EA2A 3GZBA 1A2KA 3RGAA 2XSOB 2F86B 4KVHA 4Q53A 4OUQA 2R4IA 4OVMA 3KE7A 5STDA 3GWRA 2INXA 3M8CA 1ULIB 2RCDA 5DREA 5JPUA
chains in the Genus database with same CATH superfamily
3K63A 3GZXB 4HBRA 2CFKA 1M9GA 3NV0B 3NQYA 5CF2A 3SVAA 1BGSA 4HM3B 2XEPA 3DGNA 1BRKA 1BNIA 2BMQB 3NXJA 1IVWA 3CME3 2KCDA 4WP5A 2PZVA 4LMIA 1VQQA 4XB5A 4XDWA 1B27A 1DE3A 1ZX2A 4GB5A 1YNVX 3EC9A 2BHMA 1T2IA 1RGEA 5AIIA 1DYUA 1B2ZA 1BAOA 3I563 1TFOA 3UL5A 1SJWA 1JB5A 2WGOA 3NM7A 5A0OB 1K28A 1B2MA 2CHCA 3GZRA 3MKIA 3UNLA 4ZM8A 1T5YA 2IY2A 5IENA 1IVVA 4STDA 3JUNA 2W0QA 1I8VA 3AMOB 2YFIB 4ORLA 2H0IA 3NV0A 3V99A 3PCSA 3Q90A 5AYRB 4KFFA 3DGYA 3CC73 4BTXA 3CPW2 2P0XA 1VQ93 1IT7A 2BNGA 1RSNA 3X3ZA 1N8QA 3D3LA 1VQN3 2KXGA 1Q7Y4 5D81A 1U5OA 1O7GB 2O3OA 4NPBA 2E2UA 2F4YA 1JKGB 3JVCA 4AKYA 3MWZA 1VZZA 1QVF2 1RLSA 2HMOB 2IYJA 3FSDA 4GL6A 3LTBA 3SOYA 1BSDA 1S723 1IYYA 2W03A 1VQ43 3KZTA 4BTWA 2GEXA 1C7HA 3DM8A 4HJLB 1BRNL 1BVIA 1IV9A 1IV7A 1DMNA 1LOVA 1SIHA 4HKVB 3RDEA 1FGTA 5AIFA 2LQVA 1V58A 1VQ73 3JUOA 2GEYA 6STDA 1JB4A 4OK0A 2Q07A 3DH2A 4KFEA 4WYKB 4XM4A 3AMOA 4J5GA 1JBSA 4L8PA 3MG3A 1OACA 3LXUX 3F40A 4BTYA 1W00A 1TJDA 5KP1A 1RNBA 2CX1A 1LOYA 4O8SA 4H3UA 5HGRA 1LQMB 1FUTA 1BNGA 4J9AA 3OWSA 1MOLA 1STFI 1W4NA 2OTL3 1ZS7A 1W6YA 1OHOA 2QA43 1JKGA 1MWSA 4XBTA 1GOUA 2CWVA 5CK6A 1WMPA 1BNFA 2K0MA 1M904 5EQLA 5D83A 3F7XA 1GS3A 1W02A 2FXTA 3ZFZA 2AADA 2C4BA 1TIJA 4K1UA 2XFSA 1HU9A 3FLJA 3N54B 1UCJA 1K9M4 2IMJA 2OQEC 2W04A 2CKFB 4O2HA 1OHPA 1BIRA 4FCZA 3DGOA 1GMQA 3HK4A 1Z1SA 4WYKA 1JBTA 1BUQA 1VQO3 2GBXB 1LRAA 3DZLA 3EBTA 3EQQB 3OWUA 3F7SA 1BSBA 3G0KA 3K9MC 1RGAA 3BB9A 4LSOA 2KF6A 5AI1A 4HM7B 7GSPA 1OCVA 3J7Yd 3K7CA 3IJEB 3WDGB 1HZ1A 4MJDA 1EG9B 1TUHA 1BSEA 4PEJA 3X3XA 1JZDA 4EV5A 1JNQA 1M1XB 3WA2X 3LYGA 1RHLA 3D9RA 9RNTA 4QWTA 3BIRA 3FF0A 3WMDA 2OOVA 1MNLA 2Z7AA 3CCE3 3SOAA 4CDLA 1G96A 3N9HA 5AYSC 1LQGC 1UCIA 1R4CA 2CFLA 3KSED 1I0XA 1TTOA 1YIT3 4HM2B 1ZO2A 3CPOA 5M1AA 2FNQA 3G16A 5RNTA 1J2BA 1YGEA 4KFDA 3CXC2 1Q40B 5CF1A 7RNTA 2BMOB 2OWPA 1N5HA 4O3VA 2CIUA 4RZMA 1EQKA 3CC43 3G6E3 1NWWA 4WFOA 1BNEA 2R41A 3BNCA 4FMDA 1X1UA 3MPHA 2YFLB 1FUSA 1VQM3 4EV2A 1N9EA 1HYFA 1OF5B 3MSOA 1RCLA 1JB2A 1FGOA 3KFQC 4HZBB 3PYJA 4JF8A 1BRGA 5JPPA 1KQS2 3F9SA 2QGUA 2ZHXB 2HMMB 3FG3A 4N3VA 1DETA 1Q42A 2E2VA 3NM2A 3GRDA 4EW5A 2OQEA 1YGWA 1AY7A 4HM4B 3SEDA 4HM5B 4MEIA 4MMXB 3QRDA 4X2HA 3KSPA 3S67A 1OPYA 2Z76A 2H0GA 4RNZA 1W6CA 1IU7A 1RNTA 3E99A 1YVBI 2C11A 2K54A 3T8UA 3B4OA 5IG5A 3MG1A 1V74A 3VGNA 1Q40A 3FKAA 1PFPA 1O7MB 2XR8B 4K61A 5EEOA 2OCTA 2GU3A 3EN8A 3S29A 3WHOA 1GSPA 1FZUA 1RGKA 3PS8A 1RGHA 3ROBA 3WOEB 1YHQ3 1NU3A 3I0YA 1BNJA 4X2OA 1CEWI 1RGFA 1OF5A 1JN5B 4EYCA 1LXEA 5KP4A 1Q814 3DY5A 2IUKA 3EB8A 1WMOA 3GSPA 1N5PA 1Q824 1I0VA 1T3BA 2HMJB 3OW22 3MG2A 3S28A 1GD3A 4J8TA 1D6ZA 3LT8A 1QAKA 3KN4A 1BRSA 3X40A 1DMMA 3AHWA 4R9KA 3FG1A 4BL2A 1RN4A 1KWIA 2GBWB 2RNTA 5G2GA 3H3HA 1A2PA 4HAAA 3VSYA 2FGTA 2LYXA 4AEQA 1DMQA 1OUNA 3CU3A 4N6MA 4HOHA 1BRHA 3LMLA 5DRVA 3DXOA 4H61A 1RGGA 8CHOA 1MWUA 2CWTA 5IG0A 3CCV3 1JBRA 2MF7A 1VQP3 1KC84 3NUVA 2OOVC 4IT7A 2WO0A 4CPKA 4CJNA 1VQ53 3OX9A 2STDA 4N6V0 3HZPA 4MMYB 3PXMA 1VQ83 5BIRA 4BL3A 2ZA4A 1NJI4 3Q1CA 3UB1A 4GHOA 1JN5A 1F8NA 2UUGC 1WQLB 5IW9A 5D82A 3LTDA 2B1XB 5M18A 3GAXA 1MWTA 2RBIA 3K0ZA 3Q2PA 1Q7HA 1QALA 1RN7A 1T2HA 2H0HA 2WOHA 1E97A 4XDVA 1KD14 1CYVA 1ULJB 5G1LA 4BU4A 1OGZA 3LT9A 2CX0A 3G8ZA 1IVXA 2GXFA 1BNRA 3CCS3 2HMKB 3HIGA 1HKXA 3CCJ3 1WNHA 1A2VA 3DMCA 3CCQ3 2W56B 3LOYA 2ML5A 4RNTA 5ELUA 1TP6A 1OHSA 1GY7A 3DGLA 3KCHA 4LYLB 1EKMA 3BNBA 1TRQA 4HM8B 1M1K4 6GSPA 1YI23 3ZG0A 5BU4A 3NBJA 1ROAA 4FMAA 1IQYA 4N6NB 1FW7A 3BLZA 1OGXA 2F99A 2CFWA 1FYSA 4XBYA 3I553 1R4YA 2ML6A 3URPA 3F8XA 2IA7A 5CXOA 2Y74A 2E2TA 2WOFA 2QEX3 2F98A 1O7NB 2M7OA 4IPBA 1CQSA 1LNHA 2CW9A 3K5TA 1SPUA 1AVLA 3WA3A 1VQK3 1PYLA 3CMA3 2PNCA 5AIHA 4BIRA 1RMSA 2Z6BA 3PCRA 2MC8A 4EXRA 2KRTA 1NB5I 1ISKA 3FCSB 3CNMA 2CK3H 1LVNA 1OH0A 1JRQA 2W56A 3D4AA 3QK9A 4FCJA 4FMCA 2CWUA 3WR2A 4EC6A 2SBLA 1V57A 3A5EA 2BMRB 1BU4A 3FF2A 4ILFA 5FW5A 3LZAA 5IERA 2CG0A 2KF4A 1B2XA 1IQ8A 1UW1A 3CD63 1W2ZA 4K90B 5KP3A 3IPTA 1Q9EA 2P09A 4HYZA 2HMLB 3T0UA 2XFTA 1QMAA 4K1VA 1K41A 3CCR3 3Q3FA 2V1LA 3JUPA 1Q864 1BRIA 1UUGB 1X1YA 3IMAB 2W6JH 1RRHA 1UI8A 2BO9B 4HZ9B 1EUIC 4FR9A 1G02A 1FGMA 2IUJA 2P0MA 1UDII 3SLUA 3SX1A 4N6OB 3HX8A 3U97A 3A76A 3GZYB 5CLKA 3STDA 2CH9A 1GD4A 2QIYA 4JRFA 1BRJA 1BSAA 3RGRA 3UJMA 1IT8A 3OV4A 2CG1A 1W2B2 2F5WA 3FG4A 1TRPA 2L1SA 4HM6B 4FCMA 1AVKA 4LGQA 2XGNA 1B2SA 2HMNB 5IG3A 1A67A 3BNDA 1UCLA 1MGRA 1FGRA 3H51A 3EBYA 2BT3A 1N8R4 1UCKA 4RBNA 4CCVA 1QVG2 2WGQA 1LOWA 3NHXA 5TGNA 1S5AA 2KAAA 1B20A 1GMRA 2SARA 4TX4A 1W5ZA 1SARA 3LH4A 1K8A4 1B2UA 4LEHA 1UUVB 3ER7A 3NBRA 3OWYA 3EN1B 4AKZA 4EBGA 2O9UX 1Y4KA 1SQWA 4KT3B 3ECFA 4LZIA 4N6TA 1FA3A 1CH0A 1RRLA 3WODG 3V92A 1E3RA 2W2CA 3ZG5A 5IG4A 1UGIA 1GOYA 1FUWA 3HIIA 2JQ5A 2YFJB 3HOHA 1A90A 2I9WA 3SXXA 5BXQA 3EJVA 1AQZA 1TFKA 3DGMA 3B4PA 6RNTA 2CFGA 2UX0A 1C54A 3F8HA 1QJGA 5AEUB 5FGOA 2Z77A 1PU4A 3EX9A 3MHEA 4HM0B 1B21A 5IEPA 1JV2B 3UL6A 1IQXA 2W9QA 3O8YA 2AAEA 2D1WA 2KF5A 2P05A 4R9LA 1YJN3 3D5IA 3JUQA 3CNXA 1GYBA 4IIAA 3NQZA 2KF3A 2XF3A 2UGIA 1I2GA 3AGNA 3OXAA 3T8NA 3SYUA 1U8CB 1LOXA 2OTJ3 2XH9A 1O7WB 4J5KA 3B7CA 3D5GA 3EE1A 3F14A 1NO3A 2P38A 3L0RA 3MYTA 1D6YA 1WMNA 2W9PA 2XSHB 3V98A 3CC23 1AR0A 1NB3I 5AEWB 1BUJA 4N6LA 1SIIA 4WWUC 3FGYA 5I97A 1UUWB 3DUKA 3CCM3 1STDA 3LTCA 1I2EA 1D6UA 1JZOA 4RNYA 3EHCA 1FGQA 1UGHI 2XGLA 3VF1A 5IF6A 2RFRA 1RCKA 1N9JA 4I5QA 1YJW3 2JDIH 3PGBA 4WHAA 5LC6A 2ZL8A 3S5CA 1O7PB 2F56A 5G1KA 3KKGA 5AIGA 1IVUA 4L8OA 3ALAA 1PY3A 3BU4A 7STDA 1IDPA 5JBSA 3FZWA 4O02B 1X1WA 5EVHA 4I4KA 1B3SA 3D79A 4NHFA 3KIIA 4NREA 4XBXA 1K734 1W7CA 5GSPA 5BVBA 3X42A 3PZWA 3RNTA 4U13A 1CYUA 1DVCA 2B24B 1BNSA 5ELJA 3U1WA 1EEJA 1MGWA 1RDSA 2RSXA 4G1MB 4R1KA 3WOFB 1IK3A 2HOHA 1NNVA 1I70A 1YJ93 1E3VA 3NX0A 3AHSA 2D42A 1VQ63 1GMPA 1US1A 5M19A 1NDOB 4DKIA 1I2FA 1QAFA 4L7KA 3CCU3 8RNTA 1YIJ3 3NBBA 1GY5A 1GY6A 2YX9A 1O7HB 4HVNA 2C10A 1LNIA 1KSIA 4FMBA 3B8LA 3AGOA 1RN1A 2F5MA 2J8XB 1W01A 1RTUA 2RGQA 1YVSA 1L5GB 1X1XA 3FH1A 3LTAA 3EF8A 4KZ1A 4GSPA 1RKYA 3HI7A 1RGCA 3G4S3 4N6UA 5IEOA 2GSPA 1MWRA 2Y73A 2XRXB 4HM1B 2GU1A 3JUMA 2A15A 1ASKA 1EA2A 1BOXA 1RGLA 2ZDJA 5HOHA 2CFDA 1BANA 1A2KA 1UI7A 3BNEA 1GOVA 3GZBA 3RGAA 3G713 3S27A 4R4KA 2XSOB 4R80A 1VQL3 2F86B 1I3IA 2BU4A 2CC3A 4KVHA 1ZGXA 4Q53A 4OUQA 2K3DA 2R4IA 1G0TA 4OVMA 1W6GA 1TU5A 1WTHA 2L4VA 4MMZB 3KE7A 5LC7A 5STDA 1JJ22 1AV4A 3N8BA 3GWRA 1I3FA 2BIRA 3TDGA 1BSCA 1RJOA 1ROVA 2INXA 3M8CA 1ULIB 3X3YA 3CCL3 3X41A 2RCDA 5DREA 1DVDA 5JPUA
chains in the Genus database with same CATH topology
3K63A 3GZXB 4HBRA 2CFKA 1M9GA 3NV0B 3NQYA 5CF2A 3SVAA 4HM3B 2XEPA 3DGNA 2BMQB 3NXJA 1IVWA 3CME3 2KCDA 4WP5A 2PZVA 4LMIA 4XB5A 4XDWA 1ZX2A 4GB5A 3EC9A 2BHMA 5AIIA 1DYUA 3I563 1TFOA 3UL5A 1SJWA 1JB5A 2WGOA 3NM7A 5A0OB 1K28A 2CHCA 3GZRA 3MKIA 3UNLA 4ZM8A 1T5YA 5IENA 1IVVA 4STDA 3JUNA 2W0QA 3AMOB 2YFIB 4ORLA 3NV0A 3V99A 3PCSA 3Q90A 5AYRB 4KFFA 3CC73 4BTXA 3CPW2 2P0XA 1VQ93 1IT7A 2BNGA 3X3ZA 1VQN3 1N8QA 3D3LA 2KXGA 1Q7Y4 5D81A 1U5OA 1O7GB 2O3OA 4AKYA 2E2UA 3JVCA 1JKGB 3MWZA 1VZZA 1QVF2 2HMOB 3FSDA 4GL6A 3SOYA 3LTBA 1S723 2W03A 1VQ43 3KZTA 4BTWA 2GEXA 1C7HA 3DM8A 4HJLB 1IV9A 1IV7A 1DMNA 1SIHA 4HKVB 3RDEA 1FGTA 5AIFA 2LQVA 1VQ73 3JUOA 2GEYA 6STDA 1JB4A 4OK0A 2Q07A 4KFEA 4WYKB 4XM4A 3AMOA 4L8PA 3MG3A 1OACA 3LXUX 3F40A 4BTYA 1W00A 5KP1A 4O8SA 4H3UA 5HGRA 4J9AA 3OWSA 1MOLA 1STFI 1W4NA 2OTL3 1W6YA 1OHOA 2QA43 1JKGA 4XBTA 2CWVA 5CK6A 1WMPA 2K0MA 1M904 5EQLA 5D83A 3F7XA 1GS3A 1W02A 2FXTA 1TIJA 4K1UA 2XFSA 1HU9A 3FLJA 3N54B 1K9M4 2IMJA 2OQEC 2W04A 2CKFB 4O2HA 1OHPA 4FCZA 3DGOA 3HK4A 1Z1SA 4WYKA 1BUQA 1VQO3 2GBXB 3DZLA 3EBTA 3EQQB 3OWUA 3F7SA 3G0KA 3K9MC 3BB9A 4LSOA 5AI1A 4HM7B 1OCVA 3J7Yd 3K7CA 3IJEB 3WDGB 4MJDA 1EG9B 1TUHA 4PEJA 3X3XA 4EV5A 1JNQA 1M1XB 3WA2X 3LYGA 3D9RA 4QWTA 3FF0A 3WMDA 2OOVA 1MNLA 2Z7AA 3CCE3 3SOAA 4CDLA 1G96A 3N9HA 5AYSC 1R4CA 2CFLA 3KSED 1YIT3 4HM2B 1ZO2A 3CPOA 1J2BA 2FNQA 3G16A 1YGEA 4KFDA 3CXC2 1Q40B 5CF1A 2BMOB 2OWPA 1N5HA 4O3VA 2CIUA 4RZMA 1EQKA 3CC43 3G6E3 1NWWA 4WFOA 3BNCA 4FMDA 3MPHA 2YFLB 1VQM3 4EV2A 1N9EA 1OF5B 3MSOA 1JB2A 1FGOA 3KFQC 4HZBB 3PYJA 4JF8A 5JPPA 1KQS2 3F9SA 2QGUA 2HMMB 3FG3A 4N3VA 1Q42A 2E2VA 3NM2A 3GRDA 2OQEA 4HM4B 3SEDA 4HM5B 4MEIA 4MMXB 3QRDA 4X2HA 3KSPA 3S67A 1OPYA 2Z76A 4RNZA 1W6CA 1IU7A 3T8UA 3E99A 1YVBI 2C11A 2K54A 5IG5A 3B4OA 3MG1A 1V74A 3VGNA 1Q40A 3FKAA 1PFPA 1O7MB 2XR8B 4K61A 5EEOA 2OCTA 2GU3A 3EN8A 3S29A 1YHQ3 3PS8A 3ROBA 3WOEB 1NU3A 3I0YA 4X2OA 1CEWI 1OF5A 1JN5B 4EYCA 1LXEA 1Q814 3DY5A 2IUKA 3EB8A 1WMOA 1N5PA 1Q824 2HMJB 3OW22 3MG2A 3S28A 1GD3A 4J8TA 1D6ZA 3LT8A 1QAKA 3KN4A 3X40A 1DMMA 4R9KA 3FG1A 1KWIA 2GBWB 5G2GA 3H3HA 3VSYA 2FGTA 2LYXA 4AEQA 1DMQA 1OUNA 3CU3A 4N6MA 3LMLA 5DRVA 3DXOA 4H61A 8CHOA 2CWTA 5IG0A 3CCV3 2MF7A 1VQP3 1KC84 3NUVA 2OOVC 4IT7A 2WO0A 1VQ53 3OX9A 2STDA 4N6V0 3HZPA 4MMYB 3PXMA 1VQ83 1NJI4 3Q1CA 3UB1A 1JN5A 1F8NA 1WQLB 5IW9A 5D82A 3LTDA 2B1XB 3GAXA 3K0ZA 3Q2PA 1QALA 1RN7A 2WOHA 1E97A 4XDVA 1KD14 1CYVA 1ULJB 1OGZA 3LT9A 3G8ZA 1IVXA 2GXFA 3CCS3 2HMKB 3HIGA 1HKXA 3CCJ3 1WNHA 1A2VA 3DMCA 3CCQ3 2W56B 3LOYA 2ML5A 5ELUA 1TP6A 1OHSA 1GY7A 3DGLA 1EKMA 3BNBA 4HM8B 1M1K4 1YI23 3NBJA 1ROAA 4FMAA 1IQYA 4N6NB 3BLZA 1OGXA 2F99A 2CFWA 3I553 4XBYA 2ML6A 3F8XA 2IA7A 5CXOA 2Y74A 2E2TA 2WOFA 2QEX3 2F98A 1O7NB 2M7OA 4IPBA 1CQSA 1LNHA 2CW9A 3K5TA 1SPUA 1AVLA 3WA3A 1VQK3 3CMA3 2PNCA 5AIHA 1NB5I 2Z6BA 3PCRA 2MC8A 4EXRA 2KRTA 1ISKA 3FCSB 3CNMA 2CK3H 1LVNA 1OH0A 1JRQA 2W56A 3QK9A 4FCJA 4FMCA 2CWUA 4EC6A 2SBLA 2BMRB 3FF2A 5FW5A 3LZAA 5IERA 2CG0A 1UW1A 1IQ8A 3CD63 1W2ZA 4K90B 5KP3A 3IPTA 2P09A 4HYZA 2HMLB 3T0UA 2XFTA 1QMAA 4K1VA 1K41A 3CCR3 2V1LA 3JUPA 1Q864 3IMAB 2W6JH 1RRHA 1UI8A 2BO9B 4HZ9B 4FR9A 2IUJA 1FGMA 2P0MA 3SX1A 3SLUA 4N6OB 3HX8A 3U97A 3A76A 3GZYB 5CLKA 3STDA 2CH9A 1GD4A 2QIYA 4JRFA 3RGRA 3UJMA 1IT8A 3OV4A 2CG1A 1W2B2 3FG4A 4HM6B 4FCMA 1AVKA 4LGQA 2XGNA 2HMNB 5IG3A 1A67A 3BNDA 1FGRA 3H51A 3EBYA 2BT3A 1N8R4 4RBNA 4CCVA 1QVG2 2WGQA 3NHXA 5TGNA 1S5AA 4TX4A 1W5ZA 3LH4A 1K8A4 4LEHA 1UUVB 3ER7A 3NBRA 3OWYA 3EN1B 4AKZA 4EBGA 2O9UX 1Y4KA 1SQWA 1FA3A 3ECFA 4LZIA 4N6TA 1RRLA 3WODG 3V92A 1E3RA 2W2CA 5IG4A 1FUWA 3HIIA 2JQ5A 2YFJB 1A90A 2I9WA 3SXXA 5BXQA 3EJVA 1TFKA 3DGMA 3B4PA 2CFGA 2UX0A 3F8HA 1QJGA 5AEUB 5FGOA 2Z77A 1PU4A 3EX9A 3MHEA 4HM0B 5IEPA 1JV2B 3UL6A 1IQXA 2W9QA 3O8YA 2D1WA 2P05A 4R9LA 1YJN3 3JUQA 3CNXA 1GYBA 4IIAA 3NQZA 2XF3A 3OXAA 3T8NA 1U8CB 1LOXA 2OTJ3 2XH9A 1O7WB 3B7CA 3EE1A 3F14A 1NO3A 2P38A 3L0RA 3MYTA 1D6YA 1WMNA 2W9PA 2XSHB 3V98A 3CC23 1AR0A 1NB3I 5AEWB 4N6LA 1SIIA 4WWUC 3FGYA 5I97A 1UUWB 3DUKA 3CCM3 1STDA 3LTCA 1D6UA 4RNYA 3VF1A 3EHCA 1FGQA 5KP4A 2XGLA 5IF6A 2RFRA 1N9JA 1YJW3 2JDIH 3PGBA 4WHAA 5LC6A 2ZL8A 3S5CA 1O7PB 3KKGA 5AIGA 1IVUA 4L8OA 3ALAA 7STDA 1IDPA 5JBSA 3FZWA 4O02B 5EVHA 4I4KA 4NHFA 3KIIA 4NREA 4XBXA 1K734 1W7CA 5BVBA 3X42A 3PZWA 4U13A 1CYUA 1DVCA 2B24B 3U1WA 5ELJA 2RSXA 4G1MB 4R1KA 1IK3A 3WOFB 1YJ93 1E3VA 3NX0A 2D42A 1VQ63 1US1A 1NDOB 1QAFA 4L7KA 3CCU3 1YIJ3 3NBBA 1GY5A 1GY6A 2YX9A 1O7HB 4HVNA 2C10A 1KSIA 4FMBA 3B8LA 1W01A 2RGQA 1L5GB 3FH1A 3LTAA 3EF8A 4KZ1A 1RKYA 3HI7A 3G4S3 4N6UA 5IEOA 2Y73A 2XRXB 4HM1B 2GU1A 3JUMA 2A15A 1ASKA 1EA2A 2ZDJA 2CFDA 1UI7A 1A2KA 3BNEA 3GZBA 3G713 3RGAA 3S27A 4R4KA 2XSOB 4R80A 1VQL3 2F86B 2CC3A 4KVHA 4Q53A 4OUQA 2R4IA 4OVMA 1W6GA 1TU5A 1WTHA 2L4VA 4MMZB 3KE7A 5LC7A 5STDA 1JJ22 1AV4A 3N8BA 3GWRA 3TDGA 1RJOA 1ROVA 2INXA 3M8CA 1ULIB 3X3YA 3CCL3 3X41A 2RCDA 5DREA 1DVDA 5JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZX B;  3NV0 B;  5CF2 A;  4HM3 B;  2BMQ B;  3NXJ A;  4WP5 A;  2PZV A;  4LMI A;  4XB5 A;  4XDW A;  1ZX2 A;  4GB5 A;  3EC9 A;  5AII A;  1SJW A;  1JB5 A;  2CHC A;  3GZR A;  3MKI A;  3UNL A;  5IEN A;  4STD A;  3JUN A;  2YFI B;  4ORL A;  3NV0 A;  3Q90 A;  2BNG A;  5D81 A;  1U5O A;  1O7G B;  1JKG B;  1VZZ A;  2HMO B;  3FSD A;  3SOY A;  3KZT A;  2GEX A;  1C7H A;  3DM8 A;  4HJL B;  4HKV B;  1DMN A;  5AIF A;  3JUO A;  2GEY A;  6STD A;  1JB4 A;  4WYK B;  4XM4 A;  4L8P A;  3MG3 A;  3F40 A;  1W00 A;  5KP1 A;  4H3U A;  5HGR A;  4J9A A;  3OWS A;  1W6Y A;  1OHO A;  1JKG A;  4XBT A;  5CK6 A;  5D83 A;  3F7X A;  1GS3 A;  1W02 A;  4K1U A;  3FLJ A;  2IMJ A;  2CKF B;  1OHP A;  3HK4 A;  1Z1S A;  4WYK A;  1BUQ A;  2GBX B;  3DZL A;  3EBT A;  3EQQ B;  3OWU A;  3F7S A;  3G0K A;  3BB9 A;  5AI1 A;  4HM7 B;  1OCV A;  3K7C A;  4MJD A;  1EG9 B;  1TUH A;  4PEJ A;  3LYG A;  3D9R A;  3FF0 A;  3WMD A;  2Z7A A;  3SOA A;  4CDL A;  4HM2 B;  1ZO2 A;  3CPO A;  3G16 A;  1Q40 B;  5CF1 A;  2BMO B;  2OWP A;  4RZM A;  1NWW A;  2YFL B;  1OF5 B;  3MSO A;  1JB2 A;  4HZB B;  5JPP A;  3F9S A;  2QGU A;  2HMM B;  4N3V A;  1Q42 A;  3NM2 A;  3GRD A;  4HM4 B;  3SED A;  4HM5 B;  4X2H A;  3KSP A;  1OPY A;  2Z76 A;  3T8U A;  3E99 A;  5IG5 A;  2K54 A;  3B4O A;  3MG1 A;  3VGN A;  1Q40 A;  3FKA A;  1O7M B;  2XR8 B;  3EN8 A;  3ROB A;  1NU3 A;  3I0Y A;  4X2O A;  1OF5 A;  1JN5 B;  2HMJ B;  3MG2 A;  4J8T A;  1DMM A;  4R9K A;  2GBW B;  5G2G A;  3H3H A;  3VSY A;  1DMQ A;  1OUN A;  3CU3 A;  5DRV A;  3DXO A;  8CHO A;  5IG0 A;  3NUV A;  3OX9 A;  2STD A;  3HZP A;  1JN5 A;  1WQL B;  5D82 A;  2B1X B;  3K0Z A;  1E97 A;  4XDV A;  1ULJ B;  1OGZ A;  3G8Z A;  2GXF A;  2HMK B;  1HKX A;  3DMC A;  1TP6 A;  1OHS A;  1GY7 A;  4HM8 B;  3BLZ A;  1OGX A;  2F99 A;  4XBY A;  3F8X A;  5CXO A;  2F98 A;  1O7N B;  1CQS A;  5AIH A;  1ISK A;  3CNM A;  1OH0 A;  4FCJ A;  2BMR B;  3FF2 A;  5FW5 A;  3LZA A;  5IER A;  5KP3 A;  3IPT A;  2HML B;  1QMA A;  4K1V A;  1K41 A;  3JUP A;  4HZ9 B;  3HX8 A;  3A76 A;  3GZY B;  5CLK A;  3STD A;  3RGR A;  2QIY A;  3UJM A;  3OV4 A;  4HM6 B;  4FCM A;  4LGQ A;  2HMN B;  5IG3 A;  3H51 A;  3EBY A;  3NHX A;  5TGN A;  1S5A A;  4LEH A;  1UUV B;  3ER7 A;  3NBR A;  3OWY A;  3EN1 B;  3ECF A;  1E3R A;  2W2C A;  5IG4 A;  2JQ5 A;  2YFJ B;  2I9W A;  5BXQ A;  3EJV A;  3B4P A;  2UX0 A;  3F8H A;  1QJG A;  5AEU B;  2Z77 A;  3EX9 A;  3MHE A;  4HM0 B;  5IEP A;  4R9L A;  3JUQ A;  3CNX A;  1GYB A;  4IIA A;  3OXA A;  3T8N A;  1O7W B;  3B7C A;  3F14 A;  3MYT A;  2XSH B;  1AR0 A;  5AEW B;  4WWU C;  3FGY A;  1UUW B;  3DUK A;  1STD A;  5KP4 A;  3EHC A;  5IF6 A;  2RFR A;  3S5C A;  1O7P B;  3KKG A;  5AIG A;  4L8O A;  7STD A;  1IDP A;  3FZW A;  5EVH A;  4I4K A;  4XBX A;  5BVB A;  4U13 A;  2B24 B;  4R1K A;  1E3V A;  1NDO B;  4L7K A;  1GY5 A;  1GY6 A;  1O7H B;  4HVN A;  3B8L A;  1W01 A;  2RGQ A;  3FH1 A;  3EF8 A;  5IEO A;  2XRX B;  4HM1 B;  3JUM A;  2A15 A;  1ASK A;  1EA2 A;  3GZB A;  1A2K A;  3RGA A;  2XSO B;  2F86 B;  4KVH A;  4Q53 A;  4OUQ A;  2R4I A;  4OVM A;  3KE7 A;  5STD A;  3GWR A;  2INX A;  3M8C A;  1ULI B;  2RCD A;  5DRE A;  5JPU A; 
#chains in the Genus database with same CATH topology
 3K63 A;  3GZX B;  4HBR A;  2CFK A;  1M9G A;  3NV0 B;  3NQY A;  5CF2 A;  3SVA A;  1BGS A;  4HM3 B;  2XEP A;  3DGN A;  1BRK A;  1BNI A;  2BMQ B;  3NXJ A;  1IVW A;  3CME 3;  2KCD A;  4WP5 A;  2PZV A;  4LMI A;  1VQQ A;  4XB5 A;  4XDW A;  1B27 A;  1DE3 A;  1ZX2 A;  4GB5 A;  1YNV X;  3EC9 A;  2BHM A;  1T2I A;  1RGE A;  5AII A;  1DYU A;  1B2Z A;  1BAO A;  3I56 3;  1TFO A;  3UL5 A;  1SJW A;  1JB5 A;  2WGO A;  3NM7 A;  5A0O B;  1K28 A;  1B2M A;  2CHC A;  3GZR A;  3MKI A;  3UNL A;  4ZM8 A;  1T5Y A;  2IY2 A;  5IEN A;  1IVV A;  4STD A;  3JUN A;  2W0Q A;  1I8V A;  3AMO B;  2YFI B;  4ORL A;  2H0I A;  3NV0 A;  3V99 A;  3PCS A;  3Q90 A;  5AYR B;  4KFF A;  3DGY A;  3CC7 3;  4BTX A;  3CPW 2;  2P0X A;  1VQ9 3;  1IT7 A;  2BNG A;  1RSN A;  3X3Z A;  1N8Q A;  3D3L A;  1VQN 3;  2KXG A;  1Q7Y 4;  5D81 A;  1U5O A;  1O7G B;  2O3O A;  4NPB A;  2E2U A;  2F4Y A;  1JKG B;  3JVC A;  4AKY A;  3MWZ A;  1VZZ A;  1QVF 2;  1RLS A;  2HMO B;  2IYJ A;  3FSD A;  4GL6 A;  3LTB A;  3SOY A;  1BSD A;  1S72 3;  1IYY A;  2W03 A;  1VQ4 3;  3KZT A;  4BTW A;  2GEX A;  1C7H A;  3DM8 A;  4HJL B;  1BRN L;  1BVI A;  1IV9 A;  1IV7 A;  1DMN A;  1LOV A;  1SIH A;  4HKV B;  3RDE A;  1FGT A;  5AIF A;  2LQV A;  1V58 A;  1VQ7 3;  3JUO A;  2GEY A;  6STD A;  1JB4 A;  4OK0 A;  2Q07 A;  3DH2 A;  4KFE A;  4WYK B;  4XM4 A;  3AMO A;  4J5G A;  1JBS A;  4L8P A;  3MG3 A;  1OAC A;  3LXU X;  3F40 A;  4BTY A;  1W00 A;  1TJD A;  5KP1 A;  1RNB A;  2CX1 A;  1LOY A;  4O8S A;  4H3U A;  5HGR A;  1LQM B;  1FUT A;  1BNG A;  4J9A A;  3OWS A;  1MOL A;  1STF I;  1W4N A;  2OTL 3;  1ZS7 A;  1W6Y A;  1OHO A;  2QA4 3;  1JKG A;  1MWS A;  4XBT A;  1GOU A;  2CWV A;  5CK6 A;  1WMP A;  1BNF A;  2K0M A;  1M90 4;  5EQL A;  5D83 A;  3F7X A;  1GS3 A;  1W02 A;  2FXT A;  3ZFZ A;  2AAD A;  2C4B A;  1TIJ A;  4K1U A;  2XFS A;  1HU9 A;  3FLJ A;  3N54 B;  1UCJ A;  1K9M 4;  2IMJ A;  2OQE C;  2W04 A;  2CKF B;  4O2H A;  1OHP A;  1BIR A;  4FCZ A;  3DGO A;  1GMQ A;  3HK4 A;  1Z1S A;  4WYK A;  1JBT A;  1BUQ A;  1VQO 3;  2GBX B;  1LRA A;  3DZL A;  3EBT A;  3EQQ B;  3OWU A;  3F7S A;  1BSB A;  3G0K A;  3K9M C;  1RGA A;  3BB9 A;  4LSO A;  2KF6 A;  5AI1 A;  4HM7 B;  7GSP A;  1OCV A;  3J7Y d;  3K7C A;  3IJE B;  3WDG B;  1HZ1 A;  4MJD A;  1EG9 B;  1TUH A;  1BSE A;  4PEJ A;  3X3X A;  1JZD A;  4EV5 A;  1JNQ A;  1M1X B;  3WA2 X;  3LYG A;  1RHL A;  3D9R A;  9RNT A;  4QWT A;  3BIR A;  3FF0 A;  3WMD A;  2OOV A;  1MNL A;  2Z7A A;  3CCE 3;  3SOA A;  4CDL A;  1G96 A;  3N9H A;  5AYS C;  1LQG C;  1UCI A;  1R4C A;  2CFL A;  3KSE D;  1I0X A;  1TTO A;  1YIT 3;  4HM2 B;  1ZO2 A;  3CPO A;  5M1A A;  2FNQ A;  3G16 A;  5RNT A;  1J2B A;  1YGE A;  4KFD A;  3CXC 2;  1Q40 B;  5CF1 A;  7RNT A;  2BMO B;  2OWP A;  1N5H A;  4O3V A;  2CIU A;  4RZM A;  1EQK A;  3CC4 3;  3G6E 3;  1NWW A;  4WFO A;  1BNE A;  2R41 A;  3BNC A;  4FMD A;  1X1U A;  3MPH A;  2YFL B;  1FUS A;  1VQM 3;  4EV2 A;  1N9E A;  1HYF A;  1OF5 B;  3MSO A;  1RCL A;  1JB2 A;  1FGO A;  3KFQ C;  4HZB B;  3PYJ A;  4JF8 A;  1BRG A;  5JPP A;  1KQS 2;  3F9S A;  2QGU A;  2ZHX B;  2HMM B;  3FG3 A;  4N3V A;  1DET A;  1Q42 A;  2E2V A;  3NM2 A;  3GRD A;  4EW5 A;  2OQE A;  1YGW A;  1AY7 A;  4HM4 B;  3SED A;  4HM5 B;  4MEI A;  4MMX B;  3QRD A;  4X2H A;  3KSP A;  3S67 A;  1OPY A;  2Z76 A;  2H0G A;  4RNZ A;  1W6C A;  1IU7 A;  1RNT A;  3E99 A;  1YVB I;  2C11 A;  2K54 A;  3T8U A;  3B4O A;  5IG5 A;  3MG1 A;  1V74 A;  3VGN A;  1Q40 A;  3FKA A;  1PFP A;  1O7M B;  2XR8 B;  4K61 A;  5EEO A;  2OCT A;  2GU3 A;  3EN8 A;  3S29 A;  3WHO A;  1GSP A;  1FZU A;  1RGK A;  3PS8 A;  1RGH A;  3ROB A;  3WOE B;  1YHQ 3;  1NU3 A;  3I0Y A;  1BNJ A;  4X2O A;  1CEW I;  1RGF A;  1OF5 A;  1JN5 B;  4EYC A;  1LXE A;  5KP4 A;  1Q81 4;  3DY5 A;  2IUK A;  3EB8 A;  1WMO A;  3GSP A;  1N5P A;  1Q82 4;  1I0V A;  1T3B A;  2HMJ B;  3OW2 2;  3MG2 A;  3S28 A;  1GD3 A;  4J8T A;  1D6Z A;  3LT8 A;  1QAK A;  3KN4 A;  1BRS A;  3X40 A;  1DMM A;  3AHW A;  4R9K A;  3FG1 A;  4BL2 A;  1RN4 A;  1KWI A;  2GBW B;  2RNT A;  5G2G A;  3H3H A;  1A2P A;  4HAA A;  3VSY A;  2FGT A;  2LYX A;  4AEQ A;  1DMQ A;  1OUN A;  3CU3 A;  4N6M A;  4HOH A;  1BRH A;  3LML A;  5DRV A;  3DXO A;  4H61 A;  1RGG A;  8CHO A;  1MWU A;  2CWT A;  5IG0 A;  3CCV 3;  1JBR A;  2MF7 A;  1VQP 3;  1KC8 4;  3NUV A;  2OOV C;  4IT7 A;  2WO0 A;  4CPK A;  4CJN A;  1VQ5 3;  3OX9 A;  2STD A;  4N6V 0;  3HZP A;  4MMY B;  3PXM A;  1VQ8 3;  5BIR A;  4BL3 A;  2ZA4 A;  1NJI 4;  3Q1C A;  3UB1 A;  4GHO A;  1JN5 A;  1F8N A;  2UUG C;  1WQL B;  5IW9 A;  5D82 A;  3LTD A;  2B1X B;  5M18 A;  3GAX A;  1MWT A;  2RBI A;  3K0Z A;  3Q2P A;  1Q7H A;  1QAL A;  1RN7 A;  1T2H A;  2H0H A;  2WOH A;  1E97 A;  4XDV A;  1KD1 4;  1CYV A;  1ULJ B;  5G1L A;  4BU4 A;  1OGZ A;  3LT9 A;  2CX0 A;  3G8Z A;  1IVX A;  2GXF A;  1BNR A;  3CCS 3;  2HMK B;  3HIG A;  1HKX A;  3CCJ 3;  1WNH A;  1A2V A;  3DMC A;  3CCQ 3;  2W56 B;  3LOY A;  2ML5 A;  4RNT A;  5ELU A;  1TP6 A;  1OHS A;  1GY7 A;  3DGL A;  3KCH A;  4LYL B;  1EKM A;  3BNB A;  1TRQ A;  4HM8 B;  1M1K 4;  6GSP A;  1YI2 3;  3ZG0 A;  5BU4 A;  3NBJ A;  1ROA A;  4FMA A;  1IQY A;  4N6N B;  1FW7 A;  3BLZ A;  1OGX A;  2F99 A;  2CFW A;  1FYS A;  4XBY A;  3I55 3;  1R4Y A;  2ML6 A;  3URP A;  3F8X A;  2IA7 A;  5CXO A;  2Y74 A;  2E2T A;  2WOF A;  2QEX 3;  2F98 A;  1O7N B;  2M7O A;  4IPB A;  1CQS A;  1LNH A;  2CW9 A;  3K5T A;  1SPU A;  1AVL A;  3WA3 A;  1VQK 3;  1PYL A;  3CMA 3;  2PNC A;  5AIH A;  4BIR A;  1RMS A;  2Z6B A;  3PCR A;  2MC8 A;  4EXR A;  2KRT A;  1NB5 I;  1ISK A;  3FCS B;  3CNM A;  2CK3 H;  1LVN A;  1OH0 A;  1JRQ A;  2W56 A;  3D4A A;  3QK9 A;  4FCJ A;  4FMC A;  2CWU A;  3WR2 A;  4EC6 A;  2SBL A;  1V57 A;  3A5E A;  2BMR B;  1BU4 A;  3FF2 A;  4ILF A;  5FW5 A;  3LZA A;  5IER A;  2CG0 A;  2KF4 A;  1B2X A;  1IQ8 A;  1UW1 A;  3CD6 3;  1W2Z A;  4K90 B;  5KP3 A;  3IPT A;  1Q9E A;  2P09 A;  4HYZ A;  2HML B;  3T0U A;  2XFT A;  1QMA A;  4K1V A;  1K41 A;  3CCR 3;  3Q3F A;  2V1L A;  3JUP A;  1Q86 4;  1BRI A;  1UUG B;  1X1Y A;  3IMA B;  2W6J H;  1RRH A;  1UI8 A;  2BO9 B;  4HZ9 B;  1EUI C;  4FR9 A;  1G02 A;  1FGM A;  2IUJ A;  2P0M A;  1UDI I;  3SLU A;  3SX1 A;  4N6O B;  3HX8 A;  3U97 A;  3A76 A;  3GZY B;  5CLK A;  3STD A;  2CH9 A;  1GD4 A;  2QIY A;  4JRF A;  1BRJ A;  1BSA A;  3RGR A;  3UJM A;  1IT8 A;  3OV4 A;  2CG1 A;  1W2B 2;  2F5W A;  3FG4 A;  1TRP A;  2L1S A;  4HM6 B;  4FCM A;  1AVK A;  4LGQ A;  2XGN A;  1B2S A;  2HMN B;  5IG3 A;  1A67 A;  3BND A;  1UCL A;  1MGR A;  1FGR A;  3H51 A;  3EBY A;  2BT3 A;  1N8R 4;  1UCK A;  4RBN A;  4CCV A;  1QVG 2;  2WGQ A;  1LOW A;  3NHX A;  5TGN A;  1S5A A;  2KAA A;  1B20 A;  1GMR A;  2SAR A;  4TX4 A;  1W5Z A;  1SAR A;  3LH4 A;  1K8A 4;  1B2U A;  4LEH A;  1UUV B;  3ER7 A;  3NBR A;  3OWY A;  3EN1 B;  4AKZ A;  4EBG A;  2O9U X;  1Y4K A;  1SQW A;  4KT3 B;  3ECF A;  4LZI A;  4N6T A;  1FA3 A;  1CH0 A;  1RRL A;  3WOD G;  3V92 A;  1E3R A;  2W2C A;  3ZG5 A;  5IG4 A;  1UGI A;  1GOY A;  1FUW A;  3HII A;  2JQ5 A;  2YFJ B;  3HOH A;  1A90 A;  2I9W A;  3SXX A;  5BXQ A;  3EJV A;  1AQZ A;  1TFK A;  3DGM A;  3B4P A;  6RNT A;  2CFG A;  2UX0 A;  1C54 A;  3F8H A;  1QJG A;  5AEU B;  5FGO A;  2Z77 A;  1PU4 A;  3EX9 A;  3MHE A;  4HM0 B;  1B21 A;  5IEP A;  1JV2 B;  3UL6 A;  1IQX A;  2W9Q A;  3O8Y A;  2AAE A;  2D1W A;  2KF5 A;  2P05 A;  4R9L A;  1YJN 3;  3D5I A;  3JUQ A;  3CNX A;  1GYB A;  4IIA A;  3NQZ A;  2KF3 A;  2XF3 A;  2UGI A;  1I2G A;  3AGN A;  3OXA A;  3T8N A;  3SYU A;  1U8C B;  1LOX A;  2OTJ 3;  2XH9 A;  1O7W B;  4J5K A;  3B7C A;  3D5G A;  3EE1 A;  3F14 A;  1NO3 A;  2P38 A;  3L0R A;  3MYT A;  1D6Y A;  1WMN A;  2W9P A;  2XSH B;  3V98 A;  3CC2 3;  1AR0 A;  1NB3 I;  5AEW B;  1BUJ A;  4N6L A;  1SII A;  4WWU C;  3FGY A;  5I97 A;  1UUW B;  3DUK A;  3CCM 3;  1STD A;  3LTC A;  1I2E A;  1D6U A;  1JZO A;  4RNY A;  3EHC A;  1FGQ A;  1UGH I;  2XGL A;  3VF1 A;  5IF6 A;  2RFR A;  1RCK A;  1N9J A;  4I5Q A;  1YJW 3;  2JDI H;  3PGB A;  4WHA A;  5LC6 A;  2ZL8 A;  3S5C A;  1O7P B;  2F56 A;  5G1K A;  3KKG A;  5AIG A;  1IVU A;  4L8O A;  3ALA A;  1PY3 A;  3BU4 A;  7STD A;  1IDP A;  5JBS A;  3FZW A;  4O02 B;  1X1W A;  5EVH A;  4I4K A;  1B3S A;  3D79 A;  4NHF A;  3KII A;  4NRE A;  4XBX A;  1K73 4;  1W7C A;  5GSP A;  5BVB A;  3X42 A;  3PZW A;  3RNT A;  4U13 A;  1CYU A;  1DVC A;  2B24 B;  1BNS A;  5ELJ A;  3U1W A;  1EEJ A;  1MGW A;  1RDS A;  2RSX A;  4G1M B;  4R1K A;  3WOF B;  1IK3 A;  2HOH A;  1NNV A;  1I70 A;  1YJ9 3;  1E3V A;  3NX0 A;  3AHS A;  2D42 A;  1VQ6 3;  1GMP A;  1US1 A;  5M19 A;  1NDO B;  4DKI A;  1I2F A;  1QAF A;  4L7K A;  3CCU 3;  8RNT A;  1YIJ 3;  3NBB A;  1GY5 A;  1GY6 A;  2YX9 A;  1O7H B;  4HVN A;  2C10 A;  1LNI A;  1KSI A;  4FMB A;  3B8L A;  3AGO A;  1RN1 A;  2F5M A;  2J8X B;  1W01 A;  1RTU A;  2RGQ A;  1YVS A;  1L5G B;  1X1X A;  3FH1 A;  3LTA A;  3EF8 A;  4KZ1 A;  4GSP A;  1RKY A;  3HI7 A;  1RGC A;  3G4S 3;  4N6U A;  5IEO A;  2GSP A;  1MWR A;  2Y73 A;  2XRX B;  4HM1 B;  2GU1 A;  3JUM A;  2A15 A;  1ASK A;  1EA2 A;  1BOX A;  1RGL A;  2ZDJ A;  5HOH A;  2CFD A;  1BAN A;  1A2K A;  1UI7 A;  3BNE A;  1GOV A;  3GZB A;  3RGA A;  3G71 3;  3S27 A;  4R4K A;  2XSO B;  4R80 A;  1VQL 3;  2F86 B;  1I3I A;  2BU4 A;  2CC3 A;  4KVH A;  1ZGX A;  4Q53 A;  4OUQ A;  2K3D A;  2R4I A;  1G0T A;  4OVM A;  1W6G A;  1TU5 A;  1WTH A;  2L4V A;  4MMZ B;  3KE7 A;  5LC7 A;  5STD A;  1JJ2 2;  1AV4 A;  3N8B A;  3GWR A;  1I3F A;  2BIR A;  3TDG A;  1BSC A;  1RJO A;  1ROV A;  2INX A;  3M8C A;  1ULI B;  3X3Y A;  3CCL 3;  3X41 A;  2RCD A;  5DRE A;  1DVD A;  5JPU A; 
#chains in the Genus database with same CATH homology
 3K63 A;  3GZX B;  4HBR A;  2CFK A;  1M9G A;  3NV0 B;  3NQY A;  5CF2 A;  3SVA A;  4HM3 B;  2XEP A;  3DGN A;  2BMQ B;  3NXJ A;  1IVW A;  3CME 3;  2KCD A;  4WP5 A;  2PZV A;  4LMI A;  4XB5 A;  4XDW A;  1ZX2 A;  4GB5 A;  3EC9 A;  2BHM A;  5AII A;  1DYU A;  3I56 3;  1TFO A;  3UL5 A;  1SJW A;  1JB5 A;  2WGO A;  3NM7 A;  5A0O B;  1K28 A;  2CHC A;  3GZR A;  3MKI A;  3UNL A;  4ZM8 A;  1T5Y A;  5IEN A;  1IVV A;  4STD A;  3JUN A;  2W0Q A;  3AMO B;  2YFI B;  4ORL A;  3NV0 A;  3V99 A;  3PCS A;  3Q90 A;  5AYR B;  4KFF A;  3CC7 3;  4BTX A;  3CPW 2;  2P0X A;  1VQ9 3;  1IT7 A;  2BNG A;  3X3Z A;  1VQN 3;  1N8Q A;  3D3L A;  2KXG A;  1Q7Y 4;  5D81 A;  1U5O A;  1O7G B;  2O3O A;  4AKY A;  2E2U A;  3JVC A;  1JKG B;  3MWZ A;  1VZZ A;  1QVF 2;  2HMO B;  3FSD A;  4GL6 A;  3SOY A;  3LTB A;  1S72 3;  2W03 A;  1VQ4 3;  3KZT A;  4BTW A;  2GEX A;  1C7H A;  3DM8 A;  4HJL B;  1IV9 A;  1IV7 A;  1DMN A;  1SIH A;  4HKV B;  3RDE A;  1FGT A;  5AIF A;  2LQV A;  1VQ7 3;  3JUO A;  2GEY A;  6STD A;  1JB4 A;  4OK0 A;  2Q07 A;  4KFE A;  4WYK B;  4XM4 A;  3AMO A;  4L8P A;  3MG3 A;  1OAC A;  3LXU X;  3F40 A;  4BTY A;  1W00 A;  5KP1 A;  4O8S A;  4H3U A;  5HGR A;  4J9A A;  3OWS A;  1MOL A;  1STF I;  1W4N A;  2OTL 3;  1W6Y A;  1OHO A;  2QA4 3;  1JKG A;  4XBT A;  2CWV A;  5CK6 A;  1WMP A;  2K0M A;  1M90 4;  5EQL A;  5D83 A;  3F7X A;  1GS3 A;  1W02 A;  2FXT A;  1TIJ A;  4K1U A;  2XFS A;  1HU9 A;  3FLJ A;  3N54 B;  1K9M 4;  2IMJ A;  2OQE C;  2W04 A;  2CKF B;  4O2H A;  1OHP A;  4FCZ A;  3DGO A;  3HK4 A;  1Z1S A;  4WYK A;  1BUQ A;  1VQO 3;  2GBX B;  3DZL A;  3EBT A;  3EQQ B;  3OWU A;  3F7S A;  3G0K A;  3K9M C;  3BB9 A;  4LSO A;  5AI1 A;  4HM7 B;  1OCV A;  3J7Y d;  3K7C A;  3IJE B;  3WDG B;  4MJD A;  1EG9 B;  1TUH A;  4PEJ A;  3X3X A;  4EV5 A;  1JNQ A;  1M1X B;  3WA2 X;  3LYG A;  3D9R A;  4QWT A;  3FF0 A;  3WMD A;  2OOV A;  1MNL A;  2Z7A A;  3CCE 3;  3SOA A;  4CDL A;  1G96 A;  3N9H A;  5AYS C;  1R4C A;  2CFL A;  3KSE D;  1YIT 3;  4HM2 B;  1ZO2 A;  3CPO A;  1J2B A;  2FNQ A;  3G16 A;  1YGE A;  4KFD A;  3CXC 2;  1Q40 B;  5CF1 A;  2BMO B;  2OWP A;  1N5H A;  4O3V A;  2CIU A;  4RZM A;  1EQK A;  3CC4 3;  3G6E 3;  1NWW A;  4WFO A;  3BNC A;  4FMD A;  3MPH A;  2YFL B;  1VQM 3;  4EV2 A;  1N9E A;  1OF5 B;  3MSO A;  1JB2 A;  1FGO A;  3KFQ C;  4HZB B;  3PYJ A;  4JF8 A;  5JPP A;  1KQS 2;  3F9S A;  2QGU A;  2HMM B;  3FG3 A;  4N3V A;  1Q42 A;  2E2V A;  3NM2 A;  3GRD A;  2OQE A;  4HM4 B;  3SED A;  4HM5 B;  4MEI A;  4MMX B;  3QRD A;  4X2H A;  3KSP A;  3S67 A;  1OPY A;  2Z76 A;  4RNZ A;  1W6C A;  1IU7 A;  3T8U A;  3E99 A;  1YVB I;  2C11 A;  2K54 A;  5IG5 A;  3B4O A;  3MG1 A;  1V74 A;  3VGN A;  1Q40 A;  3FKA A;  1PFP A;  1O7M B;  2XR8 B;  4K61 A;  5EEO A;  2OCT A;  2GU3 A;  3EN8 A;  3S29 A;  1YHQ 3;  3PS8 A;  3ROB A;  3WOE B;  1NU3 A;  3I0Y A;  4X2O A;  1CEW I;  1OF5 A;  1JN5 B;  4EYC A;  1LXE A;  1Q81 4;  3DY5 A;  2IUK A;  3EB8 A;  1WMO A;  1N5P A;  1Q82 4;  2HMJ B;  3OW2 2;  3MG2 A;  3S28 A;  1GD3 A;  4J8T A;  1D6Z A;  3LT8 A;  1QAK A;  3KN4 A;  3X40 A;  1DMM A;  4R9K A;  3FG1 A;  1KWI A;  2GBW B;  5G2G A;  3H3H A;  3VSY A;  2FGT A;  2LYX A;  4AEQ A;  1DMQ A;  1OUN A;  3CU3 A;  4N6M A;  3LML A;  5DRV A;  3DXO A;  4H61 A;  8CHO A;  2CWT A;  5IG0 A;  3CCV 3;  2MF7 A;  1VQP 3;  1KC8 4;  3NUV A;  2OOV C;  4IT7 A;  2WO0 A;  1VQ5 3;  3OX9 A;  2STD A;  4N6V 0;  3HZP A;  4MMY B;  3PXM A;  1VQ8 3;  1NJI 4;  3Q1C A;  3UB1 A;  1JN5 A;  1F8N A;  1WQL B;  5IW9 A;  5D82 A;  3LTD A;  2B1X B;  3GAX A;  3K0Z A;  3Q2P A;  1QAL A;  1RN7 A;  2WOH A;  1E97 A;  4XDV A;  1KD1 4;  1CYV A;  1ULJ B;  1OGZ A;  3LT9 A;  3G8Z A;  1IVX A;  2GXF A;  3CCS 3;  2HMK B;  3HIG A;  1HKX A;  3CCJ 3;  1WNH A;  1A2V A;  3DMC A;  3CCQ 3;  2W56 B;  3LOY A;  2ML5 A;  5ELU A;  1TP6 A;  1OHS A;  1GY7 A;  3DGL A;  1EKM A;  3BNB A;  4HM8 B;  1M1K 4;  1YI2 3;  3NBJ A;  1ROA A;  4FMA A;  1IQY A;  4N6N B;  3BLZ A;  1OGX A;  2F99 A;  2CFW A;  3I55 3;  4XBY A;  2ML6 A;  3F8X A;  2IA7 A;  5CXO A;  2Y74 A;  2E2T A;  2WOF A;  2QEX 3;  2F98 A;  1O7N B;  2M7O A;  4IPB A;  1CQS A;  1LNH A;  2CW9 A;  3K5T A;  1SPU A;  1AVL A;  3WA3 A;  1VQK 3;  3CMA 3;  2PNC A;  5AIH A;  1NB5 I;  2Z6B A;  3PCR A;  2MC8 A;  4EXR A;  2KRT A;  1ISK A;  3FCS B;  3CNM A;  2CK3 H;  1LVN A;  1OH0 A;  1JRQ A;  2W56 A;  3QK9 A;  4FCJ A;  4FMC A;  2CWU A;  4EC6 A;  2SBL A;  2BMR B;  3FF2 A;  5FW5 A;  3LZA A;  5IER A;  2CG0 A;  1UW1 A;  1IQ8 A;  3CD6 3;  1W2Z A;  4K90 B;  5KP3 A;  3IPT A;  2P09 A;  4HYZ A;  2HML B;  3T0U A;  2XFT A;  1QMA A;  4K1V A;  1K41 A;  3CCR 3;  2V1L A;  3JUP A;  1Q86 4;  3IMA B;  2W6J H;  1RRH A;  1UI8 A;  2BO9 B;  4HZ9 B;  4FR9 A;  2IUJ A;  1FGM A;  2P0M A;  3SX1 A;  3SLU A;  4N6O B;  3HX8 A;  3U97 A;  3A76 A;  3GZY B;  5CLK A;  3STD A;  2CH9 A;  1GD4 A;  2QIY A;  4JRF A;  3RGR A;  3UJM A;  1IT8 A;  3OV4 A;  2CG1 A;  1W2B 2;  3FG4 A;  4HM6 B;  4FCM A;  1AVK A;  4LGQ A;  2XGN A;  2HMN B;  5IG3 A;  1A67 A;  3BND A;  1FGR A;  3H51 A;  3EBY A;  2BT3 A;  1N8R 4;  4RBN A;  4CCV A;  1QVG 2;  2WGQ A;  3NHX A;  5TGN A;  1S5A A;  4TX4 A;  1W5Z A;  3LH4 A;  1K8A 4;  4LEH A;  1UUV B;  3ER7 A;  3NBR A;  3OWY A;  3EN1 B;  4AKZ A;  4EBG A;  2O9U X;  1Y4K A;  1SQW A;  1FA3 A;  3ECF A;  4LZI A;  4N6T A;  1RRL A;  3WOD G;  3V92 A;  1E3R A;  2W2C A;  5IG4 A;  1FUW A;  3HII A;  2JQ5 A;  2YFJ B;  1A90 A;  2I9W A;  3SXX A;  5BXQ A;  3EJV A;  1TFK A;  3DGM A;  3B4P A;  2CFG A;  2UX0 A;  3F8H A;  1QJG A;  5AEU B;  5FGO A;  2Z77 A;  1PU4 A;  3EX9 A;  3MHE A;  4HM0 B;  5IEP A;  1JV2 B;  3UL6 A;  1IQX A;  2W9Q A;  3O8Y A;  2D1W A;  2P05 A;  4R9L A;  1YJN 3;  3JUQ A;  3CNX A;  1GYB A;  4IIA A;  3NQZ A;  2XF3 A;  3OXA A;  3T8N A;  1U8C B;  1LOX A;  2OTJ 3;  2XH9 A;  1O7W B;  3B7C A;  3EE1 A;  3F14 A;  1NO3 A;  2P38 A;  3L0R A;  3MYT A;  1D6Y A;  1WMN A;  2W9P A;  2XSH B;  3V98 A;  3CC2 3;  1AR0 A;  1NB3 I;  5AEW B;  4N6L A;  1SII A;  4WWU C;  3FGY A;  5I97 A;  1UUW B;  3DUK A;  3CCM 3;  1STD A;  3LTC A;  1D6U A;  4RNY A;  3VF1 A;  3EHC A;  1FGQ A;  5KP4 A;  2XGL A;  5IF6 A;  2RFR A;  1N9J A;  1YJW 3;  2JDI H;  3PGB A;  4WHA A;  5LC6 A;  2ZL8 A;  3S5C A;  1O7P B;  3KKG A;  5AIG A;  1IVU A;  4L8O A;  3ALA A;  7STD A;  1IDP A;  5JBS A;  3FZW A;  4O02 B;  5EVH A;  4I4K A;  4NHF A;  3KII A;  4NRE A;  4XBX A;  1K73 4;  1W7C A;  5BVB A;  3X42 A;  3PZW A;  4U13 A;  1CYU A;  1DVC A;  2B24 B;  3U1W A;  5ELJ A;  2RSX A;  4G1M B;  4R1K A;  1IK3 A;  3WOF B;  1YJ9 3;  1E3V A;  3NX0 A;  2D42 A;  1VQ6 3;  1US1 A;  1NDO B;  1QAF A;  4L7K A;  3CCU 3;  1YIJ 3;  3NBB A;  1GY5 A;  1GY6 A;  2YX9 A;  1O7H B;  4HVN A;  2C10 A;  1KSI A;  4FMB A;  3B8L A;  1W01 A;  2RGQ A;  1L5G B;  3FH1 A;  3LTA A;  3EF8 A;  4KZ1 A;  1RKY A;  3HI7 A;  3G4S 3;  4N6U A;  5IEO A;  2Y73 A;  2XRX B;  4HM1 B;  2GU1 A;  3JUM A;  2A15 A;  1ASK A;  1EA2 A;  2ZDJ A;  2CFD A;  1UI7 A;  1A2K A;  3BNE A;  3GZB A;  3G71 3;  3RGA A;  3S27 A;  4R4K A;  2XSO B;  4R80 A;  1VQL 3;  2F86 B;  2CC3 A;  4KVH A;  4Q53 A;  4OUQ A;  2R4I A;  4OVM A;  1W6G A;  1TU5 A;  1WTH A;  2L4V A;  4MMZ B;  3KE7 A;  5LC7 A;  5STD A;  1JJ2 2;  1AV4 A;  3N8B A;  3GWR A;  3TDG A;  1RJO A;  1ROV A;  2INX A;  3M8C A;  1ULI B;  3X3Y A;  3CCL 3;  3X41 A;  2RCD A;  5DRE A;  1DVD A;  5JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...