4OVMA

Crystal structure of sgcj protein from streptomyces carzinostaticus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
RDVTAVADVPRRMMEAWASNDASAFASLFAPDGTMVLPGDVFQKGVDGIREFMTKCYAGPYKGTSVFGVPIDVRFTGPDTAILITQGGVMAPGEHSVAPDKEIRATWVLGKRDGAWLVEAYHNSPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized protein SgcJ
publication title Crystal structure of SgcJ, an NTF2-like superfamily protein involved in biosynthesis of the nine-membered enediyne antitumor antibiotic C-1027.
pubmed doi rcsb
source organism Streptomyces carzinostaticus subsp. neocarzinostaticus
total genus 23
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ovmA00
1DMQA 3NHXA 1O7HB 1JN5B 3JUPA 2HMNB 3FKAA 5CF2A 3FGYA 1TUHA 5IG3A 1TP6A 1GS3A 1A2KA 3BB9A 3NV0A 1ASKA 2RCDA 1JB5A 1JB4A 4OVMA 2GBXB 3F7XA 1OHPA 1DMNA 3DMCA 1OCVA 3T8NA 3SOAA 1GY7A 1O7GB 2RGQA 1Q40A 3KE7A 4XDVA 3G8ZA 1ZO2A 3OV4A 3RGAA 3CPOA 3EJVA 4N3VA 3GZRA 3FLJA 5AIHA 5BVBA 4HM7B 2QIYA 1EG9B 2F99A 2BMQB 1O7MB 4L7KA 3ROBA 4LEHA 1WQLB 3HK4A 1C7HA 3STDA 3MG2A 3CNXA 3EBTA 1UUWB 2BMRB 5AIGA 1JKGA 4GB5A 1STDA 4IIAA 1OF5B 4MJDA 4XBTA 2GBWB 1K41A 3ER7A 2Z77A 3JUNA 1E97A 3SOYA 1UUVB 2UX0A 4LGQA 1OUNA 5CLKA 1DMMA 5AIIA 3MHEA 5D82A 2INXA 4HVNA 3UNLA 2W2CA 1Z1SA 1JN5A 2GEYA 3F14A 4X2HA 4R9LA 3EN1B 3H3HA 4K1VA 3EN8A 4XDWA 5IENA 4RZMA 3M8CA 4LMIA 3OXAA 5AIFA 2CHCA 4L8PA 2YFJB 3FF0A 1GYBA 3UJMA 4HZBB 3SEDA 1ZX2A 3I0YA 1JB2A 3IPTA 5JPPA 3EF8A 5G2GA 3KZTA 5IF6A 3LZAA 4HM3B 3B8LA 3FZWA 3LYGA 3JUOA 4I4KA 1W01A 5KP1A 1ISKA 5KP3A 3CU3A 3DM8A 3FF2A 1BUQA 3JUQA 1S5AA 2R4IA 5BXQA 5CF1A 3K7CA 1W02A 4J9AA 3DXOA 1NU3A 3BLZA 3KSPA 1E3RA 3B7CA 3HZPA 1O7WB 4R9KA 3OWSA 3E99A 3T8UA 1ULJB 3F9SA 3F40A 4HKVB 2XRXB 3Q90A 1QMAA 2OWPA 1HKXA 5IEPA 1QJGA 3MG1A 1OF5A 4HM0B 3EHCA 2QGUA 3H51A 3EBYA 3OWYA 1Q42A 2IMJA 2K54A 3VGNA 4CDLA 3NXJA 4R1KA 1SJWA 2XR8B 4ORLA 2GXFA 3MSOA 1AR0A 2CKFB 4HM4B 5D83A 1O7PB 5IG4A 4H3UA 2GEXA 3FH1A 5AEUB 5STDA 2A15A 2PZVA 2XSOB 3GWRA 1OHSA 3KKGA 5CK6A 3ECFA 2Z7AA 4FCMA 4HM5B 3G16A 4WYKB 1ULIB 2STDA 2F86B 3GRDA 5FW5A 3NM2A 4PEJA 3EQQB 4J8TA 1OGZA 3F7SA 1O7NB 6STDA 3WMDA 3MKIA 1OPYA 2HMMB 3B4OA 1EA2A 4WP5A 5AEWB 4WWUC 2B24B 2XSHB 1OHOA 4XB5A 5IERA 1NWWA 4XBXA 3F8HA 3EC9A 4HM8B 3NV0B 2YFIB 2HMOB 3NUVA 3EX9A 4L8OA 4KVHA 3DUKA 4U13A 5EVHA 3CNMA 3DZLA 3MG3A 1GY5A 1VZZA 4STDA 3FSDA 5KP4A 1GY6A 4HM2B 3VSYA 3GZYB 1CQSA 1Q40B 4XM4A 5TGNA 3HX8A 5DRVA 2Z76A 7STDA 1OH0A 4HJLB 3RGRA 4HM1B 5IG0A 3NBRA 1OGXA 4XBYA 3A76A 3OX9A 3GZBA 1E3VA 2JQ5A 5JPUA 4X2OA 3JUMA 1IDPA 3D9RA 4K1UA 3S5CA 4OUQA 2BMOB 4Q53A 3B4PA 2RFRA 3GZXB 8CHOA 4HM6B 2I9WA 5D81A 1W00A 3OWUA 3K0ZA 4HZ9B 1NDOB 2HMKB 1JKGB 3MYTA 5DREA 2YFLB 4FCJA 5AI1A 5IG5A 4WYKA 2F98A 5HGRA 2HMJB 3G0KA 3F8XA 5IEOA 2B1XB 2HMLB 1W6YA 2BNGA 5CXOA 1U5OA
chains in the Genus database with same CATH superfamily
2W56B 3N9HA 1YJW3 3IMAB 5FGOA 3NX0A 1AVLA 1DMQA 2IUJA 2P09A 4K61A 3NHXA 1RNTA 7GSPA 1O7HB 1B2XA 1JN5B 3JUPA 2HMNB 3FKAA 5CF2A 3UL6A 4HAAA 1I70A 3K9MC 3LT9A 3FGYA 1TUHA 1JRQA 5BIRA 1KQS2 5IG3A 1TP6A 1HYFA 1GS3A 1A2KA 2UGIA 3BB9A 3CXC2 1YVBI 3K63A 1ASKA 2RCDA 3NV0A 3S67A 1SIIA 2KF4A 1JB5A 1CYVA 1JB4A 3GSPA 4OVMA 1EQKA 2GBXB 3F7XA 1YIT3 1OHPA 4BTWA 1RGGA 1DMNA 4HBRA 3AMOB 4RNTA 1VQK3 3FG3A 2O9UX 1W6GA 1D6YA 3DMCA 2L1SA 2BHMA 1OCVA 1GMPA 3CD63 3S27A 3BNEA 2BIRA 2D42A 3U1WA 3ZG5A 3SYUA 3KN4A 3CCJ3 1GMRA 2MF7A 3JVCA 3T8NA 2P0MA 3FG1A 3SOAA 4N6NB 3SX1A 1GY7A 1O7GB 2RGQA 1GMQA 1BNGA 4N6MA 1Q40A 3KE7A 1YVSA 2WGQA 4XDVA 1WMNA 1BRGA 4GSPA 2OCTA 3G8ZA 4J5KA 1J2BA 4HOHA 1RGCA 1ZO2A 4IPBA 1JNQA 2WOFA 3OV4A 3NM7A 2Z6BA 1UDII 2JDIH 2XFSA 1YGWA 3RGAA 1G0TA 3CPOA 3IJEB 1I2EA 3EJVA 4N3VA 2MC8A 3Q2PA 1BNJA 1FGQA 3N54B 3GZRA 2F5WA 1EKMA 1DE3A 1PYLA 1NB3I 1MWSA 3FLJA 3KFQC 5AIHA 2UUGC 5BVBA 3A5EA 1B3SA 2CC3A 4HM7B 2QIYA 3T0UA 4R4KA 1LXEA 1BNFA 4MMZB 4JRFA 1IQ8A 2XGNA 2OQEA 4AEQA 1C54A 1EG9B 2F99A 3BNCA 2CH9A 1S723 1A2PA 4NPBA 2BMQB 2XH9A 4FMBA 1O7MB 3PGBA 4L7KA 3ROBA 4N6V0 3CPW2 1WQLB 4LEHA 3HK4A 4WHAA 1C7HA 3STDA 1NB5I 1VQN3 3MG2A 1D6UA 1WTHA 3G6E3 3CNXA 3EBTA 1IVVA 1UUWB 4K90B 1IK3A 3CCV3 3CCL3 1VQ43 1TFKA 3AHWA 1HU9A 2F56A 2BMRB 1IT7A 3Q1CA 5AIGA 3WOFB 1DETA 1I0VA 2H0GA 4FR9A 3CCS3 1JKGA 4GB5A 4AKZA 3X3XA 1SIHA 1TFOA 3WDGB 4J5GA 1RCLA 1STDA 2CWUA 3WA2X 4IIAA 1OF5B 2GBWB 4MJDA 1K41A 3D3LA 4XBTA 1JZOA 2RNTA 2E2UA 1YNVX 3ER7A 3DY5A 5RNTA 3TDGA 1U8CB 2Z77A 1I3IA 3JUNA 1E97A 1QAKA 1A2VA 1A90A 3SOYA 1M9GA 1AV4A 1UUVB 2UX0A 1RCKA 4LGQA 3S29A 1OUNA 1QVG2 2BU4A 5CLKA 1VQ73 1DMMA 4IT7A 5AIIA 1BNSA 3MHEA 5D82A 1RLSA 1RN7A 2INXA 3KSED 4HVNA 3UL5A 1V58A 2CG1A 3UNLA 1BGSA 2FNQA 3AGOA 1UGHI 3D4AA 2W2CA 1Z1SA 1JN5A 2GEYA 3F14A 3HIGA 4X2HA 3G713 4R9LA 1BUJA 1MOLA 3EN1B 3H3HA 4K1VA 3EN8A 4XDWA 1TTOA 5IENA 2R41A 4RZMA 2W03A 3M8CA 4LMIA 1RGFA 1AQZA 3OXAA 5AIFA 2CHCA 4L8PA 3ZFZA 1FGMA 2P05A 1VQM3 3RNTA 1IQXA 2H0IA 3AGNA 3ALAA 1BSCA 2YFJB 2WGOA 2CW9A 1K734 2QEX3 3AMOA 2FGTA 3FF0A 4BU4A 1GYBA 5LC7A 3UJMA 4HZBB 3PXMA 2XFTA 4LSOA 1TRPA 3LTCA 1IU7A 3SEDA 3CCE3 1ROAA 2CFWA 4RNYA 1DVCA 1ZX2A 3I0YA 1JB2A 3IPTA 5JPPA 1PFPA 1YI23 1BOXA 1N5PA 3EF8A 4CCVA 5G2GA 3KZTA 1STFI 2Y73A 2P38A 3EE1A 1BRIA 4EV5A 5IF6A 2XGLA 2BT3A 2HOHA 1RGEA 1BRSA 3LZAA 4FCZA 1B20A 3J7Yd 1RNBA 4HM3B 3B8LA 3FZWA 3NQZA 3LYGA 1G02A 1N9JA 4EBGA 3JUOA 4I4KA 2KXGA 3PZWA 1W01A 5KP1A 1ISKA 5KP3A 5CXOA 3CU3A 1UGIA 1JV2B 1SQWA 3GAXA 1UCJA 1W4NA 3CCR3 6RNTA 2ZDJA 3DM8A 2CFGA 2LQVA 3FF2A 1BUQA 2CFLA 2F4YA 3JUQA 1S5AA 2C10A 2R4IA 2OOVA 1VQO3 2ZHXB 4MEIA 4N6TA 1BNEA 1LOVA 4TX4A 1LNIA 1WMOA 2W04A 5BXQA 1DYUA 1KC84 3LXUX 5CF1A 1VQP3 1MNLA 4N6LA 3WODG 3K7CA 1W7CA 1BIRA 2ML5A 4O2HA 1RN1A 1W02A 1BAOA 1IVWA 3DXOA 1NU3A 1RSNA 1ZGXA 3BLZA 4J9AA 3KSPA 1E3RA 3B7CA 3HZPA 3QK9A 4I5QA 3NBBA 1O7WB 1VQQA 4R9KA 5EQLA 4FMCA 3OWSA 3E99A 3DGMA 1KSIA 1N8R4 2WO0A 4AKYA 1FGTA 1ZS7A 2CX1A 2CWTA 4KFEA 3T8UA 2GU3A 1GD3A 1ULJB 3X40A 3F9SA 3F40A 1TRQA 1GSPA 4HKVB 2XRXB 1FUWA 1LOWA 3Q90A 4EYCA 1QMAA 1FA3A 2OWPA 2K3DA 1BNIA 1HKXA 1UCKA 1GOYA 1I3FA 2FXTA 2ML6A 5IEPA 1RRLA 2CIUA 1HZ1A 1QJGA 5ELJA 3MG1A 4OK0A 1OF5A 1WNHA 3BNDA 4HM0B 3EHCA 3I553 1LQGC 2QGUA 3X3YA 3H51A 3S28A 1D6ZA 1UCLA 3FG4A 1B2SA 1IV7A 3ZG0A 1LQMB 3HIIA 1B21A 1GD4A 1FZUA 3EBYA 3OWYA 1AY7A 3DGOA 1GOUA 4FMDA 3LT8A 1B2ZA 1OACA 1Q42A 1I8VA 2IMJA 2K54A 4N6OB 3VGNA 3QRDA 1I2GA 4CDLA 3LOYA 1F8NA 3NXJA 4R1KA 1UI7A 4EC6A 4LZIA 2OTL3 1SJWA 1W2B2 1US1A 3G4S3 1SARA 2XR8B 4ORLA 2GXFA 3MSOA 3WR2A 1AR0A 1BRJA 1Y4KA 2CKFB 5AYRB 7RNTA 1K8A4 4HM4B 3O8YA 2GSPA 1KD14 2LYXA 3WA3A 4KFFA 1LVNA 3D5IA 1Q864 1VQ53 3PYJA 2CWVA 5D83A 1O7PB 1K28A 5IG4A 1RGKA 2C4BA 4H3UA 2GEXA 3FH1A 1RGAA 3RDEA 1RTUA 4EXRA 5STDA 3LH4A 5AEUB 6GSPA 2A15A 1BSBA 3VF1A 2PZVA 2OOVC 2F5MA 3D79A 5IW9A 1QALA 2XSOB 4O8SA 1JJ22 1MGRA 3D5GA 1LRAA 2KF6A 3HI7A 3SVAA 1UCIA 3GWRA 1PY3A 1OHSA 3KKGA 3X3ZA 8RNTA 5M18A 1CYUA 1T2HA 1LOYA 5CK6A 3X41A 3ECFA 2CG0A 1VQL3 4QWTA 3L0RA 1Q814 2H0HA 5EEOA 4NHFA 3PCSA 1MGWA 5LC6A 2OQEC 2P0XA 2Z7AA 4FCMA 3CC23 4HM5B 2J8XB 1N5HA 2QA43 1X1YA 3URPA 1BSAA 1JZDA 3LTDA 2IUKA 3G16A 3WOEB 1IT8A 4WYKB 2ZA4A 1ULIB 2STDA 3FCSB 1SPUA 3LTBA 2F86B 3BIRA 3GRDA 5FW5A 3NQYA 1X1UA 1ROVA 1X1WA 1R4CA 1RGHA 1RJOA 3CC43 1RGLA 1TIJA 3NM2A 3NBJA 1N8QA 3EQQB 2AAEA 4J8TA 2CK3H 1FUTA 1OGZA 3F7SA 4PEJA 3SLUA 1O7NB 1RDSA 1FYSA 1A67A 2E2VA 1T3BA 6STDA 4GL6A 3WMDA 3LMLA 1I2FA 3MKIA 3PCRA 3V92A 1OPYA 2HMMB 1YGEA 1YIJ3 3B4OA 4O3VA 1IQYA 1Q9EA 1EA2A 1JBRA 1GOVA 4R80A 1RHLA 1BANA 4WP5A 5AEWB 2OTJ3 1B27A 2XF3A 2SARA 4WWUC 3V98A 3CMA3 3CCM3 2B24B 4LYLB 2XEPA 2XSHB 1OHOA 4XB5A 5IERA 1NWWA 4WFOA 1YJN3 1M1XB 1BRHA 1W2ZA 3CME3 4XBXA 3F8HA 2ZL8A 3EC9A 2KF5A 3DGNA 1Q7Y4 4HM8B 4N6UA 3NV0B 2L4VA 2YFIB 2PNCA 2WOHA 2RSXA 4KZ1A 1WMPA 1BNRA 5AYSC 1NJI4 1W6CA 2HMOB 3DH2A 3NUVA 2Q07A 3EX9A 1BRNL 3KCHA 1CH0A 4L8OA 2CFDA 1DVDA 2D1WA 4KVHA 3DUKA 1I0XA 1KWIA 1MWRA 4U13A 5EVHA 1L5GB 3AHSA 3CNMA 3UB1A 3DZLA 1MWUA 5A0OB 1TJDA 1QAFA 3MG3A 5G1LA 1EUIC 3PS8A 1GY5A 1LNHA 4ILFA 4CJNA 1IVUA 1LOXA 1VZZA 4STDA 2RBIA 3FSDA 4FMAA 5GSPA 2YX9A 1GY6A 3HOHA 4HM2B 3VSYA 4ZM8A 3KIIA 3GZYB 1CQSA 1Q824 1Q40B 1BRKA 4XM4A 5TGNA 3DGLA 1W5ZA 3HX8A 1UW1A 5DRVA 1PU4A 2Z76A 1VQ93 4MMYB 1YJ93 3MWZA 4KT3B 7STDA 1IYYA 1OH0A 3OW22 4HJLB 3RGRA 1B2UA 1FGOA 4HM1B 2E2TA 1RKYA 1FW7A 5IG0A 5G1KA 4EV2A 3CC73 1JBSA 3NBRA 4G1MB 4CPKA 2KAAA 3N8BA 3EB8A 1OGXA 4XBYA 1B2MA 3U97A 1K9M4 4JF8A 1VQ63 3A76A 3OX9A 3I563 5ELUA 1BU4A 3BU4A 1R4YA 3GZBA 3WHOA 1E3VA 3BNBA 2KCDA 4BTXA 5I97A 2JQ5A 5JPUA 1FUSA 3K5TA 1N9EA 4X2OA 1IVXA 3JUMA 1IDPA 3D9RA 1EEJA 2W9PA 3SXXA 2GU1A 1V74A 4K1UA 5BU4A 5KP4A 5JBSA 2W6JH 3LTAA 3S5CA 1CEWI 4OUQA 1RRHA 2O3OA 1T2IA 2K0MA 2KF3A 4BL3A 2BMOB 2BO9B 5HOHA 2SBLA 1V57A 2KRTA 4Q53A 4HYZA 1FGRA 4BTYA 1NO3A 3B4PA 1BSEA 2RFRA 3GZXB 8CHOA 4HM6B 4RNZA 2I9WA 1IV9A 2W9QA 3DGYA 3X42A 2W0QA 3Q3FA 5D81A 1BVIA 1MWTA 4MMXB 1VQ83 1W00A 3OWUA 4EW5A 4BL2A 3K0ZA 4HZ9B 2Y74A 2CX0A 1NDOB 3V99A 2HMKB 1JKGB 1UI8A 2V1LA 3MYTA 4NREA 5DREA 4DKIA 1BSDA 2YFLB 4FCJA 5AI1A 4GHOA 9RNTA 5IG5A 2IA7A 5M19A 1JBTA 1AVKA 1YHQ3 2C11A 4H61A 2IYJA 4WYKA 4O02B 1M1K4 1TU5A 2F98A 2CFKA 2M7OA 5HGRA 4BIRA 3CCQ3 2HMJB 2IY2A 2W56A 3CCU3 2AADA 3G0KA 3F8XA 3MPHA 1QVF2 5IEOA 4RBNA 1G96A 1Q7HA 2B1XB 1RMSA 1X1XA 1UUGB 5M1AA 1M904 2HMLB 1W6YA 2BNGA 1NNVA 1RN4A 4KFDA 1T5YA 1U5OA
chains in the Genus database with same CATH topology
2W56B 3N9HA 1YJW3 3IMAB 5FGOA 3NX0A 1AVLA 1DMQA 2IUJA 2P09A 4K61A 3NHXA 1O7HB 1JN5B 3JUPA 2HMNB 3FKAA 5CF2A 3UL6A 3K9MC 3LT9A 3FGYA 1TUHA 1JRQA 1KQS2 5IG3A 1TP6A 1GS3A 1A2KA 3BB9A 3CXC2 1YVBI 3K63A 1ASKA 2RCDA 3NV0A 3S67A 1SIIA 1JB5A 1CYVA 1JB4A 1EQKA 4OVMA 2GBXB 3F7XA 1YIT3 1OHPA 4BTWA 1DMNA 4HBRA 3AMOB 1VQK3 3FG3A 2O9UX 1W6GA 1D6YA 3DMCA 2BHMA 1OCVA 3CD63 3S27A 3BNEA 2D42A 3U1WA 3KN4A 3CCJ3 2MF7A 3JVCA 3T8NA 2P0MA 3FG1A 3SOAA 4N6NB 3SX1A 1GY7A 1O7GB 2RGQA 4N6MA 1Q40A 3KE7A 2WGQA 4XDVA 1WMNA 2OCTA 3G8ZA 1ZO2A 4IPBA 1JNQA 2WOFA 3OV4A 3NM7A 2Z6BA 2XFSA 2JDIH 3RGAA 3IJEB 3CPOA 3EJVA 4N3VA 2MC8A 3Q2PA 1FGQA 3N54B 3GZRA 1EKMA 1NB3I 3FLJA 3KFQC 5AIHA 5BVBA 2CC3A 4HM7B 2QIYA 3T0UA 4R4KA 1LXEA 4MMZB 4JRFA 1IQ8A 2XGNA 2OQEA 4AEQA 1EG9B 2F99A 3BNCA 2CH9A 1S723 2BMQB 2XH9A 4FMBA 1O7MB 3PGBA 4L7KA 3ROBA 4N6V0 3CPW2 1WQLB 4LEHA 3HK4A 4WHAA 1C7HA 3STDA 1VQN3 3MG2A 1D6UA 1WTHA 3G6E3 3CNXA 3EBTA 1IVVA 1UUWB 4K90B 1IK3A 3CCV3 3CCL3 1VQ43 1TFKA 1HU9A 3WOFB 2BMRB 1IT7A 3Q1CA 5AIGA 4FR9A 3CCS3 1JKGA 4GB5A 4AKZA 3X3XA 1SIHA 1TFOA 3WDGB 1STDA 2CWUA 3WA2X 4IIAA 1OF5B 2GBWB 4MJDA 1K41A 3D3LA 4XBTA 2E2UA 3ER7A 3DY5A 3TDGA 1U8CB 2Z77A 3JUNA 1E97A 1QAKA 1A2VA 1A90A 3SOYA 1M9GA 1AV4A 1UUVB 2UX0A 4LGQA 3S29A 1OUNA 1QVG2 5CLKA 1VQ73 1DMMA 4IT7A 5AIIA 3MHEA 5D82A 2INXA 1RN7A 3KSED 4HVNA 3UL5A 2CG1A 3UNLA 2FNQA 2W2CA 1Z1SA 1JN5A 2GEYA 3F14A 3HIGA 4X2HA 3G713 4R9LA 1MOLA 3EN1B 3H3HA 4K1VA 3EN8A 4XDWA 5IENA 4RZMA 2W03A 3M8CA 4LMIA 3OXAA 5AIFA 2CHCA 4L8PA 1FGMA 2P05A 1VQM3 1IQXA 3ALAA 2YFJB 2WGOA 2CW9A 1K734 2QEX3 3AMOA 2FGTA 3FF0A 1GYBA 5LC7A 3UJMA 4HZBB 3PXMA 2XFTA 4LSOA 3LTCA 1IU7A 3SEDA 3CCE3 1ROAA 2CFWA 4RNYA 1DVCA 1ZX2A 3I0YA 1JB2A 3IPTA 5JPPA 1PFPA 1YI23 3EF8A 1N5PA 4CCVA 5G2GA 3KZTA 1STFI 2Y73A 2P38A 3EE1A 4EV5A 5IF6A 2XGLA 2BT3A 4FCZA 3LZAA 3J7Yd 4HM3B 3B8LA 3FZWA 3NQZA 3LYGA 1N9JA 4EBGA 3JUOA 4I4KA 2KXGA 3PZWA 1W01A 5KP1A 1ISKA 5KP3A 5CXOA 3CU3A 3GAXA 1JV2B 1SQWA 1W4NA 3CCR3 2ZDJA 3DM8A 2CFGA 2LQVA 3FF2A 1BUQA 2CFLA 3JUQA 1S5AA 2C10A 2R4IA 2OOVA 1VQO3 1TU5A 4MEIA 4N6TA 4TX4A 1J2BA 5BXQA 1WMOA 2W04A 1DYUA 1KC84 3LXUX 5CF1A 1VQP3 1MNLA 4N6LA 3WODG 3K7CA 1W7CA 4O2HA 2ML5A 1W02A 4J9AA 1IVWA 3DXOA 1NU3A 3BLZA 3KSPA 1E3RA 3B7CA 3HZPA 3QK9A 5EQLA 3NBBA 1O7WB 4R9KA 4FMCA 3OWSA 3E99A 3DGMA 1KSIA 1N8R4 2WO0A 4AKYA 1FGTA 4KFEA 3T8UA 2CWTA 2GU3A 1GD3A 1ULJB 3X40A 3F9SA 3F40A 4HKVB 1FUWA 2XRXB 3Q90A 4EYCA 1QMAA 2OWPA 1HKXA 2FXTA 2ML6A 5IEPA 1RRLA 2CIUA 1QJGA 5ELJA 3MG1A 4OK0A 1OF5A 1WNHA 3BNDA 4HM0B 3EHCA 3I553 2QGUA 3X3YA 3H51A 3S28A 1D6ZA 3FG4A 1IV7A 3HIIA 3EBYA 1GD4A 3OWYA 4FMDA 3DGOA 3LT8A 1OACA 1Q42A 2IMJA 2K54A 4N6OB 3VGNA 3QRDA 4CDLA 3LOYA 1F8NA 3NXJA 4R1KA 1UI7A 4EC6A 4LZIA 2OTL3 1SJWA 1W2B2 1US1A 3G4S3 2XR8B 4ORLA 2GXFA 3MSOA 1AR0A 1Y4KA 2CKFB 5AYRB 1K8A4 4HM4B 3O8YA 1KD14 2LYXA 3WA3A 4KFFA 1LVNA 1Q864 1VQ53 3PYJA 2CWVA 5D83A 1O7PB 1K28A 5IG4A 3RDEA 4H3UA 2GEXA 3FH1A 4EXRA 5AEUB 5STDA 3LH4A 2A15A 3VF1A 2PZVA 2OOVC 5IW9A 1QALA 2XSOB 4O8SA 1JJ22 3HI7A 3SVAA 3GWRA 1OHSA 3KKGA 3X3ZA 1CYUA 5CK6A 3X41A 3ECFA 2CG0A 1VQL3 4QWTA 3L0RA 1Q814 5EEOA 4NHFA 3PCSA 5LC6A 2OQEC 2P0XA 2Z7AA 4FCMA 3CC23 4HM5B 2QA43 1N5HA 3LTDA 2IUKA 3G16A 3WOEB 1IT8A 4WYKB 1ULIB 2STDA 3FCSB 1SPUA 3LTBA 2F86B 3GRDA 5FW5A 3NQYA 1ROVA 1R4CA 1RJOA 3CC43 1TIJA 4WFOA 3NM2A 3NBJA 1N8QA 3EQQB 4J8TA 4PEJA 2CK3H 3SLUA 1OGZA 3F7SA 1A67A 1O7NB 2E2VA 6STDA 4GL6A 3WMDA 3LMLA 3MKIA 3PCRA 3V92A 1OPYA 2HMMB 1YGEA 1YIJ3 3B4OA 4O3VA 1IQYA 1EA2A 4R80A 4WP5A 5AEWB 2OTJ3 2XF3A 4WWUC 3V98A 3CMA3 3CCM3 2B24B 2XEPA 2XSHB 1OHOA 4XB5A 5IERA 1NWWA 1YJN3 1M1XB 1W2ZA 3CME3 4XBXA 3F8HA 2ZL8A 3EC9A 1Q7Y4 3DGNA 4HM8B 4N6UA 3NV0B 2L4VA 2YFIB 2PNCA 2WOHA 2RSXA 4KZ1A 1WMPA 5AYSC 1NJI4 1W6CA 2HMOB 3NUVA 2Q07A 3EX9A 4L8OA 2CFDA 1DVDA 2D1WA 4KVHA 3DUKA 1KWIA 4U13A 5EVHA 1L5GB 3CNMA 3UB1A 3DZLA 5A0OB 1QAFA 3MG3A 3PS8A 1GY5A 1LNHA 1IVUA 1LOXA 1VZZA 4STDA 3FSDA 4FMAA 5KP4A 2YX9A 1GY6A 4HM2B 3VSYA 4ZM8A 3KIIA 3GZYB 1CQSA 1Q824 1Q40B 4XM4A 5TGNA 3DGLA 1W5ZA 3HX8A 1UW1A 5DRVA 1PU4A 2Z76A 1VQ93 4MMYB 1YJ93 3MWZA 7STDA 1OH0A 3OW22 4HJLB 3RGRA 1FGOA 4HM1B 1RKYA 2E2TA 5IG0A 3CC73 4EV2A 3NBRA 4G1MB 3N8BA 3EB8A 1OGXA 4XBYA 3U97A 1K9M4 4JF8A 1VQ63 3A76A 3OX9A 3I563 5ELUA 3GZBA 4BTXA 5I97A 1E3VA 3BNBA 2KCDA 2JQ5A 5JPUA 3K5TA 1N9EA 4X2OA 1IVXA 3JUMA 1IDPA 3D9RA 2W9PA 3SXXA 2GU1A 1V74A 4K1UA 5JBSA 2W6JH 3LTAA 3S5CA 1CEWI 4OUQA 1RRHA 2O3OA 2K0MA 2BMOB 2BO9B 2SBLA 2KRTA 4Q53A 4HYZA 1FGRA 4BTYA 1NO3A 3B4PA 2RFRA 3GZXB 8CHOA 4HM6B 4RNZA 2I9WA 1IV9A 2W9QA 3X42A 2W0QA 5D81A 4MMXB 1VQ83 1W00A 3OWUA 3K0ZA 4HZ9B 2Y74A 3V99A 1NDOB 2HMKB 1JKGB 1UI8A 2V1LA 3MYTA 4NREA 5DREA 1NB5I 1FA3A 2YFLB 4FCJA 5AI1A 5IG5A 2IA7A 1AVKA 1YHQ3 2C11A 4H61A 4WYKA 4O02B 1M1K4 2F98A 2CFKA 2M7OA 5HGRA 3CCQ3 2HMJB 2W56A 1QVF2 3CCU3 3G0KA 3MPHA 3F8XA 5IEOA 4RBNA 1G96A 2B1XB 1M904 2HMLB 1W6YA 2BNGA 4KFDA 1T5YA 1U5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMQ A;  3NHX A;  1O7H B;  1JN5 B;  3JUP A;  2HMN B;  3FKA A;  5CF2 A;  3FGY A;  1TUH A;  5IG3 A;  1TP6 A;  1GS3 A;  1A2K A;  3BB9 A;  3NV0 A;  1ASK A;  2RCD A;  1JB5 A;  1JB4 A;  4OVM A;  2GBX B;  3F7X A;  1OHP A;  1DMN A;  3DMC A;  1OCV A;  3T8N A;  3SOA A;  1GY7 A;  1O7G B;  2RGQ A;  1Q40 A;  3KE7 A;  4XDV A;  3G8Z A;  1ZO2 A;  3OV4 A;  3RGA A;  3CPO A;  3EJV A;  4N3V A;  3GZR A;  3FLJ A;  5AIH A;  5BVB A;  4HM7 B;  2QIY A;  1EG9 B;  2F99 A;  2BMQ B;  1O7M B;  4L7K A;  3ROB A;  4LEH A;  1WQL B;  3HK4 A;  1C7H A;  3STD A;  3MG2 A;  3CNX A;  3EBT A;  1UUW B;  2BMR B;  5AIG A;  1JKG A;  4GB5 A;  1STD A;  4IIA A;  1OF5 B;  4MJD A;  4XBT A;  2GBW B;  1K41 A;  3ER7 A;  2Z77 A;  3JUN A;  1E97 A;  3SOY A;  1UUV B;  2UX0 A;  4LGQ A;  1OUN A;  5CLK A;  1DMM A;  5AII A;  3MHE A;  5D82 A;  2INX A;  4HVN A;  3UNL A;  2W2C A;  1Z1S A;  1JN5 A;  2GEY A;  3F14 A;  4X2H A;  4R9L A;  3EN1 B;  3H3H A;  4K1V A;  3EN8 A;  4XDW A;  5IEN A;  4RZM A;  3M8C A;  4LMI A;  3OXA A;  5AIF A;  2CHC A;  4L8P A;  2YFJ B;  3FF0 A;  1GYB A;  3UJM A;  4HZB B;  3SED A;  1ZX2 A;  3I0Y A;  1JB2 A;  3IPT A;  5JPP A;  3EF8 A;  5G2G A;  3KZT A;  5IF6 A;  3LZA A;  4HM3 B;  3B8L A;  3FZW A;  3LYG A;  3JUO A;  4I4K A;  1W01 A;  5KP1 A;  1ISK A;  5KP3 A;  3CU3 A;  3DM8 A;  3FF2 A;  1BUQ A;  3JUQ A;  1S5A A;  2R4I A;  5BXQ A;  5CF1 A;  3K7C A;  1W02 A;  4J9A A;  3DXO A;  1NU3 A;  3BLZ A;  3KSP A;  1E3R A;  3B7C A;  3HZP A;  1O7W B;  4R9K A;  3OWS A;  3E99 A;  3T8U A;  1ULJ B;  3F9S A;  3F40 A;  4HKV B;  2XRX B;  3Q90 A;  1QMA A;  2OWP A;  1HKX A;  5IEP A;  1QJG A;  3MG1 A;  1OF5 A;  4HM0 B;  3EHC A;  2QGU A;  3H51 A;  3EBY A;  3OWY A;  1Q42 A;  2IMJ A;  2K54 A;  3VGN A;  4CDL A;  3NXJ A;  4R1K A;  1SJW A;  2XR8 B;  4ORL A;  2GXF A;  3MSO A;  1AR0 A;  2CKF B;  4HM4 B;  5D83 A;  1O7P B;  5IG4 A;  4H3U A;  2GEX A;  3FH1 A;  5AEU B;  5STD A;  2A15 A;  2PZV A;  2XSO B;  3GWR A;  1OHS A;  3KKG A;  5CK6 A;  3ECF A;  2Z7A A;  4FCM A;  4HM5 B;  3G16 A;  4WYK B;  1ULI B;  2STD A;  2F86 B;  3GRD A;  5FW5 A;  3NM2 A;  4PEJ A;  3EQQ B;  4J8T A;  1OGZ A;  3F7S A;  1O7N B;  6STD A;  3WMD A;  3MKI A;  1OPY A;  2HMM B;  3B4O A;  1EA2 A;  4WP5 A;  5AEW B;  4WWU C;  2B24 B;  2XSH B;  1OHO A;  4XB5 A;  5IER A;  1NWW A;  4XBX A;  3F8H A;  3EC9 A;  4HM8 B;  3NV0 B;  2YFI B;  2HMO B;  3NUV A;  3EX9 A;  4L8O A;  4KVH A;  3DUK A;  4U13 A;  5EVH A;  3CNM A;  3DZL A;  3MG3 A;  1GY5 A;  1VZZ A;  4STD A;  3FSD A;  5KP4 A;  1GY6 A;  4HM2 B;  3VSY A;  3GZY B;  1CQS A;  1Q40 B;  4XM4 A;  5TGN A;  3HX8 A;  5DRV A;  2Z76 A;  7STD A;  1OH0 A;  4HJL B;  3RGR A;  4HM1 B;  5IG0 A;  3NBR A;  1OGX A;  4XBY A;  3A76 A;  3OX9 A;  3GZB A;  1E3V A;  2JQ5 A;  5JPU A;  4X2O A;  3JUM A;  1IDP A;  3D9R A;  4K1U A;  3S5C A;  4OUQ A;  2BMO B;  4Q53 A;  3B4P A;  2RFR A;  3GZX B;  8CHO A;  4HM6 B;  2I9W A;  5D81 A;  1W00 A;  3OWU A;  3K0Z A;  4HZ9 B;  1NDO B;  2HMK B;  1JKG B;  3MYT A;  5DRE A;  2YFL B;  4FCJ A;  5AI1 A;  5IG5 A;  4WYK A;  2F98 A;  5HGR A;  2HMJ B;  3G0K A;  3F8X A;  5IEO A;  2B1X B;  2HML B;  1W6Y A;  2BNG A;  5CXO A;  1U5O A; 
#chains in the Genus database with same CATH topology
 2W56 B;  3N9H A;  1YJW 3;  3IMA B;  5FGO A;  3NX0 A;  1AVL A;  1DMQ A;  2IUJ A;  2P09 A;  4K61 A;  3NHX A;  1RNT A;  7GSP A;  1O7H B;  1B2X A;  1JN5 B;  3JUP A;  2HMN B;  3FKA A;  5CF2 A;  3UL6 A;  4HAA A;  1I70 A;  3K9M C;  3LT9 A;  3FGY A;  1TUH A;  1JRQ A;  5BIR A;  1KQS 2;  5IG3 A;  1TP6 A;  1HYF A;  1GS3 A;  1A2K A;  2UGI A;  3BB9 A;  3CXC 2;  1YVB I;  3K63 A;  1ASK A;  2RCD A;  3NV0 A;  3S67 A;  1SII A;  2KF4 A;  1JB5 A;  1CYV A;  1JB4 A;  3GSP A;  4OVM A;  1EQK A;  2GBX B;  3F7X A;  1YIT 3;  1OHP A;  4BTW A;  1RGG A;  1DMN A;  4HBR A;  3AMO B;  4RNT A;  1VQK 3;  3FG3 A;  2O9U X;  1W6G A;  1D6Y A;  3DMC A;  2L1S A;  2BHM A;  1OCV A;  1GMP A;  3CD6 3;  3S27 A;  3BNE A;  2BIR A;  2D42 A;  3U1W A;  3ZG5 A;  3SYU A;  3KN4 A;  3CCJ 3;  1GMR A;  2MF7 A;  3JVC A;  3T8N A;  2P0M A;  3FG1 A;  3SOA A;  4N6N B;  3SX1 A;  1GY7 A;  1O7G B;  2RGQ A;  1GMQ A;  1BNG A;  4N6M A;  1Q40 A;  3KE7 A;  1YVS A;  2WGQ A;  4XDV A;  1WMN A;  1BRG A;  4GSP A;  2OCT A;  3G8Z A;  4J5K A;  1J2B A;  4HOH A;  1RGC A;  1ZO2 A;  4IPB A;  1JNQ A;  2WOF A;  3OV4 A;  3NM7 A;  2Z6B A;  1UDI I;  2JDI H;  2XFS A;  1YGW A;  3RGA A;  1G0T A;  3CPO A;  3IJE B;  1I2E A;  3EJV A;  4N3V A;  2MC8 A;  3Q2P A;  1BNJ A;  1FGQ A;  3N54 B;  3GZR A;  2F5W A;  1EKM A;  1DE3 A;  1PYL A;  1NB3 I;  1MWS A;  3FLJ A;  3KFQ C;  5AIH A;  2UUG C;  5BVB A;  3A5E A;  1B3S A;  2CC3 A;  4HM7 B;  2QIY A;  3T0U A;  4R4K A;  1LXE A;  1BNF A;  4MMZ B;  4JRF A;  1IQ8 A;  2XGN A;  2OQE A;  4AEQ A;  1C54 A;  1EG9 B;  2F99 A;  3BNC A;  2CH9 A;  1S72 3;  1A2P A;  4NPB A;  2BMQ B;  2XH9 A;  4FMB A;  1O7M B;  3PGB A;  4L7K A;  3ROB A;  4N6V 0;  3CPW 2;  1WQL B;  4LEH A;  3HK4 A;  4WHA A;  1C7H A;  3STD A;  1NB5 I;  1VQN 3;  3MG2 A;  1D6U A;  1WTH A;  3G6E 3;  3CNX A;  3EBT A;  1IVV A;  1UUW B;  4K90 B;  1IK3 A;  3CCV 3;  3CCL 3;  1VQ4 3;  1TFK A;  3AHW A;  1HU9 A;  2F56 A;  2BMR B;  1IT7 A;  3Q1C A;  5AIG A;  3WOF B;  1DET A;  1I0V A;  2H0G A;  4FR9 A;  3CCS 3;  1JKG A;  4GB5 A;  4AKZ A;  3X3X A;  1SIH A;  1TFO A;  3WDG B;  4J5G A;  1RCL A;  1STD A;  2CWU A;  3WA2 X;  4IIA A;  1OF5 B;  2GBW B;  4MJD A;  1K41 A;  3D3L A;  4XBT A;  1JZO A;  2RNT A;  2E2U A;  1YNV X;  3ER7 A;  3DY5 A;  5RNT A;  3TDG A;  1U8C B;  2Z77 A;  1I3I A;  3JUN A;  1E97 A;  1QAK A;  1A2V A;  1A90 A;  3SOY A;  1M9G A;  1AV4 A;  1UUV B;  2UX0 A;  1RCK A;  4LGQ A;  3S29 A;  1OUN A;  1QVG 2;  2BU4 A;  5CLK A;  1VQ7 3;  1DMM A;  4IT7 A;  5AII A;  1BNS A;  3MHE A;  5D82 A;  1RLS A;  1RN7 A;  2INX A;  3KSE D;  4HVN A;  3UL5 A;  1V58 A;  2CG1 A;  3UNL A;  1BGS A;  2FNQ A;  3AGO A;  1UGH I;  3D4A A;  2W2C A;  1Z1S A;  1JN5 A;  2GEY A;  3F14 A;  3HIG A;  4X2H A;  3G71 3;  4R9L A;  1BUJ A;  1MOL A;  3EN1 B;  3H3H A;  4K1V A;  3EN8 A;  4XDW A;  1TTO A;  5IEN A;  2R41 A;  4RZM A;  2W03 A;  3M8C A;  4LMI A;  1RGF A;  1AQZ A;  3OXA A;  5AIF A;  2CHC A;  4L8P A;  3ZFZ A;  1FGM A;  2P05 A;  1VQM 3;  3RNT A;  1IQX A;  2H0I A;  3AGN A;  3ALA A;  1BSC A;  2YFJ B;  2WGO A;  2CW9 A;  1K73 4;  2QEX 3;  3AMO A;  2FGT A;  3FF0 A;  4BU4 A;  1GYB A;  5LC7 A;  3UJM A;  4HZB B;  3PXM A;  2XFT A;  4LSO A;  1TRP A;  3LTC A;  1IU7 A;  3SED A;  3CCE 3;  1ROA A;  2CFW A;  4RNY A;  1DVC A;  1ZX2 A;  3I0Y A;  1JB2 A;  3IPT A;  5JPP A;  1PFP A;  1YI2 3;  1BOX A;  1N5P A;  3EF8 A;  4CCV A;  5G2G A;  3KZT A;  1STF I;  2Y73 A;  2P38 A;  3EE1 A;  1BRI A;  4EV5 A;  5IF6 A;  2XGL A;  2BT3 A;  2HOH A;  1RGE A;  1BRS A;  3LZA A;  4FCZ A;  1B20 A;  3J7Y d;  1RNB A;  4HM3 B;  3B8L A;  3FZW A;  3NQZ A;  3LYG A;  1G02 A;  1N9J A;  4EBG A;  3JUO A;  4I4K A;  2KXG A;  3PZW A;  1W01 A;  5KP1 A;  1ISK A;  5KP3 A;  5CXO A;  3CU3 A;  1UGI A;  1JV2 B;  1SQW A;  3GAX A;  1UCJ A;  1W4N A;  3CCR 3;  6RNT A;  2ZDJ A;  3DM8 A;  2CFG A;  2LQV A;  3FF2 A;  1BUQ A;  2CFL A;  2F4Y A;  3JUQ A;  1S5A A;  2C10 A;  2R4I A;  2OOV A;  1VQO 3;  2ZHX B;  4MEI A;  4N6T A;  1BNE A;  1LOV A;  4TX4 A;  1LNI A;  1WMO A;  2W04 A;  5BXQ A;  1DYU A;  1KC8 4;  3LXU X;  5CF1 A;  1VQP 3;  1MNL A;  4N6L A;  3WOD G;  3K7C A;  1W7C A;  1BIR A;  2ML5 A;  4O2H A;  1RN1 A;  1W02 A;  1BAO A;  1IVW A;  3DXO A;  1NU3 A;  1RSN A;  1ZGX A;  3BLZ A;  4J9A A;  3KSP A;  1E3R A;  3B7C A;  3HZP A;  3QK9 A;  4I5Q A;  3NBB A;  1O7W B;  1VQQ A;  4R9K A;  5EQL A;  4FMC A;  3OWS A;  3E99 A;  3DGM A;  1KSI A;  1N8R 4;  2WO0 A;  4AKY A;  1FGT A;  1ZS7 A;  2CX1 A;  2CWT A;  4KFE A;  3T8U A;  2GU3 A;  1GD3 A;  1ULJ B;  3X40 A;  3F9S A;  3F40 A;  1TRQ A;  1GSP A;  4HKV B;  2XRX B;  1FUW A;  1LOW A;  3Q90 A;  4EYC A;  1QMA A;  1FA3 A;  2OWP A;  2K3D A;  1BNI A;  1HKX A;  1UCK A;  1GOY A;  1I3F A;  2FXT A;  2ML6 A;  5IEP A;  1RRL A;  2CIU A;  1HZ1 A;  1QJG A;  5ELJ A;  3MG1 A;  4OK0 A;  1OF5 A;  1WNH A;  3BND A;  4HM0 B;  3EHC A;  3I55 3;  1LQG C;  2QGU A;  3X3Y A;  3H51 A;  3S28 A;  1D6Z A;  1UCL A;  3FG4 A;  1B2S A;  1IV7 A;  3ZG0 A;  1LQM B;  3HII A;  1B21 A;  1GD4 A;  1FZU A;  3EBY A;  3OWY A;  1AY7 A;  3DGO A;  1GOU A;  4FMD A;  3LT8 A;  1B2Z A;  1OAC A;  1Q42 A;  1I8V A;  2IMJ A;  2K54 A;  4N6O B;  3VGN A;  3QRD A;  1I2G A;  4CDL A;  3LOY A;  1F8N A;  3NXJ A;  4R1K A;  1UI7 A;  4EC6 A;  4LZI A;  2OTL 3;  1SJW A;  1W2B 2;  1US1 A;  3G4S 3;  1SAR A;  2XR8 B;  4ORL A;  2GXF A;  3MSO A;  3WR2 A;  1AR0 A;  1BRJ A;  1Y4K A;  2CKF B;  5AYR B;  7RNT A;  1K8A 4;  4HM4 B;  3O8Y A;  2GSP A;  1KD1 4;  2LYX A;  3WA3 A;  4KFF A;  1LVN A;  3D5I A;  1Q86 4;  1VQ5 3;  3PYJ A;  2CWV A;  5D83 A;  1O7P B;  1K28 A;  5IG4 A;  1RGK A;  2C4B A;  4H3U A;  2GEX A;  3FH1 A;  1RGA A;  3RDE A;  1RTU A;  4EXR A;  5STD A;  3LH4 A;  5AEU B;  6GSP A;  2A15 A;  1BSB A;  3VF1 A;  2PZV A;  2OOV C;  2F5M A;  3D79 A;  5IW9 A;  1QAL A;  2XSO B;  4O8S A;  1JJ2 2;  1MGR A;  3D5G A;  1LRA A;  2KF6 A;  3HI7 A;  3SVA A;  1UCI A;  3GWR A;  1PY3 A;  1OHS A;  3KKG A;  3X3Z A;  8RNT A;  5M18 A;  1CYU A;  1T2H A;  1LOY A;  5CK6 A;  3X41 A;  3ECF A;  2CG0 A;  1VQL 3;  4QWT A;  3L0R A;  1Q81 4;  2H0H A;  5EEO A;  4NHF A;  3PCS A;  1MGW A;  5LC6 A;  2OQE C;  2P0X A;  2Z7A A;  4FCM A;  3CC2 3;  4HM5 B;  2J8X B;  1N5H A;  2QA4 3;  1X1Y A;  3URP A;  1BSA A;  1JZD A;  3LTD A;  2IUK A;  3G16 A;  3WOE B;  1IT8 A;  4WYK B;  2ZA4 A;  1ULI B;  2STD A;  3FCS B;  1SPU A;  3LTB A;  2F86 B;  3BIR A;  3GRD A;  5FW5 A;  3NQY A;  1X1U A;  1ROV A;  1X1W A;  1R4C A;  1RGH A;  1RJO A;  3CC4 3;  1RGL A;  1TIJ A;  3NM2 A;  3NBJ A;  1N8Q A;  3EQQ B;  2AAE A;  4J8T A;  2CK3 H;  1FUT A;  1OGZ A;  3F7S A;  4PEJ A;  3SLU A;  1O7N B;  1RDS A;  1FYS A;  1A67 A;  2E2V A;  1T3B A;  6STD A;  4GL6 A;  3WMD A;  3LML A;  1I2F A;  3MKI A;  3PCR A;  3V92 A;  1OPY A;  2HMM B;  1YGE A;  1YIJ 3;  3B4O A;  4O3V A;  1IQY A;  1Q9E A;  1EA2 A;  1JBR A;  1GOV A;  4R80 A;  1RHL A;  1BAN A;  4WP5 A;  5AEW B;  2OTJ 3;  1B27 A;  2XF3 A;  2SAR A;  4WWU C;  3V98 A;  3CMA 3;  3CCM 3;  2B24 B;  4LYL B;  2XEP A;  2XSH B;  1OHO A;  4XB5 A;  5IER A;  1NWW A;  4WFO A;  1YJN 3;  1M1X B;  1BRH A;  1W2Z A;  3CME 3;  4XBX A;  3F8H A;  2ZL8 A;  3EC9 A;  2KF5 A;  3DGN A;  1Q7Y 4;  4HM8 B;  4N6U A;  3NV0 B;  2L4V A;  2YFI B;  2PNC A;  2WOH A;  2RSX A;  4KZ1 A;  1WMP A;  1BNR A;  5AYS C;  1NJI 4;  1W6C A;  2HMO B;  3DH2 A;  3NUV A;  2Q07 A;  3EX9 A;  1BRN L;  3KCH A;  1CH0 A;  4L8O A;  2CFD A;  1DVD A;  2D1W A;  4KVH A;  3DUK A;  1I0X A;  1KWI A;  1MWR A;  4U13 A;  5EVH A;  1L5G B;  3AHS A;  3CNM A;  3UB1 A;  3DZL A;  1MWU A;  5A0O B;  1TJD A;  1QAF A;  3MG3 A;  5G1L A;  1EUI C;  3PS8 A;  1GY5 A;  1LNH A;  4ILF A;  4CJN A;  1IVU A;  1LOX A;  1VZZ A;  4STD A;  2RBI A;  3FSD A;  4FMA A;  5GSP A;  2YX9 A;  1GY6 A;  3HOH A;  4HM2 B;  3VSY A;  4ZM8 A;  3KII A;  3GZY B;  1CQS A;  1Q82 4;  1Q40 B;  1BRK A;  4XM4 A;  5TGN A;  3DGL A;  1W5Z A;  3HX8 A;  1UW1 A;  5DRV A;  1PU4 A;  2Z76 A;  1VQ9 3;  4MMY B;  1YJ9 3;  3MWZ A;  4KT3 B;  7STD A;  1IYY A;  1OH0 A;  3OW2 2;  4HJL B;  3RGR A;  1B2U A;  1FGO A;  4HM1 B;  2E2T A;  1RKY A;  1FW7 A;  5IG0 A;  5G1K A;  4EV2 A;  3CC7 3;  1JBS A;  3NBR A;  4G1M B;  4CPK A;  2KAA A;  3N8B A;  3EB8 A;  1OGX A;  4XBY A;  1B2M A;  3U97 A;  1K9M 4;  4JF8 A;  1VQ6 3;  3A76 A;  3OX9 A;  3I56 3;  5ELU A;  1BU4 A;  3BU4 A;  1R4Y A;  3GZB A;  3WHO A;  1E3V A;  3BNB A;  2KCD A;  4BTX A;  5I97 A;  2JQ5 A;  5JPU A;  1FUS A;  3K5T A;  1N9E A;  4X2O A;  1IVX A;  3JUM A;  1IDP A;  3D9R A;  1EEJ A;  2W9P A;  3SXX A;  2GU1 A;  1V74 A;  4K1U A;  5BU4 A;  5KP4 A;  5JBS A;  2W6J H;  3LTA A;  3S5C A;  1CEW I;  4OUQ A;  1RRH A;  2O3O A;  1T2I A;  2K0M A;  2KF3 A;  4BL3 A;  2BMO B;  2BO9 B;  5HOH A;  2SBL A;  1V57 A;  2KRT A;  4Q53 A;  4HYZ A;  1FGR A;  4BTY A;  1NO3 A;  3B4P A;  1BSE A;  2RFR A;  3GZX B;  8CHO A;  4HM6 B;  4RNZ A;  2I9W A;  1IV9 A;  2W9Q A;  3DGY A;  3X42 A;  2W0Q A;  3Q3F A;  5D81 A;  1BVI A;  1MWT A;  4MMX B;  1VQ8 3;  1W00 A;  3OWU A;  4EW5 A;  4BL2 A;  3K0Z A;  4HZ9 B;  2Y74 A;  2CX0 A;  1NDO B;  3V99 A;  2HMK B;  1JKG B;  1UI8 A;  2V1L A;  3MYT A;  4NRE A;  5DRE A;  4DKI A;  1BSD A;  2YFL B;  4FCJ A;  5AI1 A;  4GHO A;  9RNT A;  5IG5 A;  2IA7 A;  5M19 A;  1JBT A;  1AVK A;  1YHQ 3;  2C11 A;  4H61 A;  2IYJ A;  4WYK A;  4O02 B;  1M1K 4;  1TU5 A;  2F98 A;  2CFK A;  2M7O A;  5HGR A;  4BIR A;  3CCQ 3;  2HMJ B;  2IY2 A;  2W56 A;  3CCU 3;  2AAD A;  3G0K A;  3F8X A;  3MPH A;  1QVF 2;  5IEO A;  4RBN A;  1G96 A;  1Q7H A;  2B1X B;  1RMS A;  1X1X A;  1UUG B;  5M1A A;  1M90 4;  2HML B;  1W6Y A;  2BNG A;  1NNV A;  1RN4 A;  4KFD A;  1T5Y A;  1U5O A; 
#chains in the Genus database with same CATH homology
 2W56 B;  3N9H A;  1YJW 3;  3IMA B;  5FGO A;  3NX0 A;  1AVL A;  1DMQ A;  2IUJ A;  2P09 A;  4K61 A;  3NHX A;  1O7H B;  1JN5 B;  3JUP A;  2HMN B;  3FKA A;  5CF2 A;  3UL6 A;  3K9M C;  3LT9 A;  3FGY A;  1TUH A;  1JRQ A;  1KQS 2;  5IG3 A;  1TP6 A;  1GS3 A;  1A2K A;  3BB9 A;  3CXC 2;  1YVB I;  3K63 A;  1ASK A;  2RCD A;  3NV0 A;  3S67 A;  1SII A;  1JB5 A;  1CYV A;  1JB4 A;  1EQK A;  4OVM A;  2GBX B;  3F7X A;  1YIT 3;  1OHP A;  4BTW A;  1DMN A;  4HBR A;  3AMO B;  1VQK 3;  3FG3 A;  2O9U X;  1W6G A;  1D6Y A;  3DMC A;  2BHM A;  1OCV A;  3CD6 3;  3S27 A;  3BNE A;  2D42 A;  3U1W A;  3KN4 A;  3CCJ 3;  2MF7 A;  3JVC A;  3T8N A;  2P0M A;  3FG1 A;  3SOA A;  4N6N B;  3SX1 A;  1GY7 A;  1O7G B;  2RGQ A;  4N6M A;  1Q40 A;  3KE7 A;  2WGQ A;  4XDV A;  1WMN A;  2OCT A;  3G8Z A;  1ZO2 A;  4IPB A;  1JNQ A;  2WOF A;  3OV4 A;  3NM7 A;  2Z6B A;  2XFS A;  2JDI H;  3RGA A;  3IJE B;  3CPO A;  3EJV A;  4N3V A;  2MC8 A;  3Q2P A;  1FGQ A;  3N54 B;  3GZR A;  1EKM A;  1NB3 I;  3FLJ A;  3KFQ C;  5AIH A;  5BVB A;  2CC3 A;  4HM7 B;  2QIY A;  3T0U A;  4R4K A;  1LXE A;  4MMZ B;  4JRF A;  1IQ8 A;  2XGN A;  2OQE A;  4AEQ A;  1EG9 B;  2F99 A;  3BNC A;  2CH9 A;  1S72 3;  2BMQ B;  2XH9 A;  4FMB A;  1O7M B;  3PGB A;  4L7K A;  3ROB A;  4N6V 0;  3CPW 2;  1WQL B;  4LEH A;  3HK4 A;  4WHA A;  1C7H A;  3STD A;  1VQN 3;  3MG2 A;  1D6U A;  1WTH A;  3G6E 3;  3CNX A;  3EBT A;  1IVV A;  1UUW B;  4K90 B;  1IK3 A;  3CCV 3;  3CCL 3;  1VQ4 3;  1TFK A;  1HU9 A;  3WOF B;  2BMR B;  1IT7 A;  3Q1C A;  5AIG A;  4FR9 A;  3CCS 3;  1JKG A;  4GB5 A;  4AKZ A;  3X3X A;  1SIH A;  1TFO A;  3WDG B;  1STD A;  2CWU A;  3WA2 X;  4IIA A;  1OF5 B;  2GBW B;  4MJD A;  1K41 A;  3D3L A;  4XBT A;  2E2U A;  3ER7 A;  3DY5 A;  3TDG A;  1U8C B;  2Z77 A;  3JUN A;  1E97 A;  1QAK A;  1A2V A;  1A90 A;  3SOY A;  1M9G A;  1AV4 A;  1UUV B;  2UX0 A;  4LGQ A;  3S29 A;  1OUN A;  1QVG 2;  5CLK A;  1VQ7 3;  1DMM A;  4IT7 A;  5AII A;  3MHE A;  5D82 A;  2INX A;  1RN7 A;  3KSE D;  4HVN A;  3UL5 A;  2CG1 A;  3UNL A;  2FNQ A;  2W2C A;  1Z1S A;  1JN5 A;  2GEY A;  3F14 A;  3HIG A;  4X2H A;  3G71 3;  4R9L A;  1MOL A;  3EN1 B;  3H3H A;  4K1V A;  3EN8 A;  4XDW A;  5IEN A;  4RZM A;  2W03 A;  3M8C A;  4LMI A;  3OXA A;  5AIF A;  2CHC A;  4L8P A;  1FGM A;  2P05 A;  1VQM 3;  1IQX A;  3ALA A;  2YFJ B;  2WGO A;  2CW9 A;  1K73 4;  2QEX 3;  3AMO A;  2FGT A;  3FF0 A;  1GYB A;  5LC7 A;  3UJM A;  4HZB B;  3PXM A;  2XFT A;  4LSO A;  3LTC A;  1IU7 A;  3SED A;  3CCE 3;  1ROA A;  2CFW A;  4RNY A;  1DVC A;  1ZX2 A;  3I0Y A;  1JB2 A;  3IPT A;  5JPP A;  1PFP A;  1YI2 3;  3EF8 A;  1N5P A;  4CCV A;  5G2G A;  3KZT A;  1STF I;  2Y73 A;  2P38 A;  3EE1 A;  4EV5 A;  5IF6 A;  2XGL A;  2BT3 A;  4FCZ A;  3LZA A;  3J7Y d;  4HM3 B;  3B8L A;  3FZW A;  3NQZ A;  3LYG A;  1N9J A;  4EBG A;  3JUO A;  4I4K A;  2KXG A;  3PZW A;  1W01 A;  5KP1 A;  1ISK A;  5KP3 A;  5CXO A;  3CU3 A;  3GAX A;  1JV2 B;  1SQW A;  1W4N A;  3CCR 3;  2ZDJ A;  3DM8 A;  2CFG A;  2LQV A;  3FF2 A;  1BUQ A;  2CFL A;  3JUQ A;  1S5A A;  2C10 A;  2R4I A;  2OOV A;  1VQO 3;  1TU5 A;  4MEI A;  4N6T A;  4TX4 A;  1J2B A;  5BXQ A;  1WMO A;  2W04 A;  1DYU A;  1KC8 4;  3LXU X;  5CF1 A;  1VQP 3;  1MNL A;  4N6L A;  3WOD G;  3K7C A;  1W7C A;  4O2H A;  2ML5 A;  1W02 A;  4J9A A;  1IVW A;  3DXO A;  1NU3 A;  3BLZ A;  3KSP A;  1E3R A;  3B7C A;  3HZP A;  3QK9 A;  5EQL A;  3NBB A;  1O7W B;  4R9K A;  4FMC A;  3OWS A;  3E99 A;  3DGM A;  1KSI A;  1N8R 4;  2WO0 A;  4AKY A;  1FGT A;  4KFE A;  3T8U A;  2CWT A;  2GU3 A;  1GD3 A;  1ULJ B;  3X40 A;  3F9S A;  3F40 A;  4HKV B;  1FUW A;  2XRX B;  3Q90 A;  4EYC A;  1QMA A;  2OWP A;  1HKX A;  2FXT A;  2ML6 A;  5IEP A;  1RRL A;  2CIU A;  1QJG A;  5ELJ A;  3MG1 A;  4OK0 A;  1OF5 A;  1WNH A;  3BND A;  4HM0 B;  3EHC A;  3I55 3;  2QGU A;  3X3Y A;  3H51 A;  3S28 A;  1D6Z A;  3FG4 A;  1IV7 A;  3HII A;  3EBY A;  1GD4 A;  3OWY A;  4FMD A;  3DGO A;  3LT8 A;  1OAC A;  1Q42 A;  2IMJ A;  2K54 A;  4N6O B;  3VGN A;  3QRD A;  4CDL A;  3LOY A;  1F8N A;  3NXJ A;  4R1K A;  1UI7 A;  4EC6 A;  4LZI A;  2OTL 3;  1SJW A;  1W2B 2;  1US1 A;  3G4S 3;  2XR8 B;  4ORL A;  2GXF A;  3MSO A;  1AR0 A;  1Y4K A;  2CKF B;  5AYR B;  1K8A 4;  4HM4 B;  3O8Y A;  1KD1 4;  2LYX A;  3WA3 A;  4KFF A;  1LVN A;  1Q86 4;  1VQ5 3;  3PYJ A;  2CWV A;  5D83 A;  1O7P B;  1K28 A;  5IG4 A;  3RDE A;  4H3U A;  2GEX A;  3FH1 A;  4EXR A;  5AEU B;  5STD A;  3LH4 A;  2A15 A;  3VF1 A;  2PZV A;  2OOV C;  5IW9 A;  1QAL A;  2XSO B;  4O8S A;  1JJ2 2;  3HI7 A;  3SVA A;  3GWR A;  1OHS A;  3KKG A;  3X3Z A;  1CYU A;  5CK6 A;  3X41 A;  3ECF A;  2CG0 A;  1VQL 3;  4QWT A;  3L0R A;  1Q81 4;  5EEO A;  4NHF A;  3PCS A;  5LC6 A;  2OQE C;  2P0X A;  2Z7A A;  4FCM A;  3CC2 3;  4HM5 B;  2QA4 3;  1N5H A;  3LTD A;  2IUK A;  3G16 A;  3WOE B;  1IT8 A;  4WYK B;  1ULI B;  2STD A;  3FCS B;  1SPU A;  3LTB A;  2F86 B;  3GRD A;  5FW5 A;  3NQY A;  1ROV A;  1R4C A;  1RJO A;  3CC4 3;  1TIJ A;  4WFO A;  3NM2 A;  3NBJ A;  1N8Q A;  3EQQ B;  4J8T A;  4PEJ A;  2CK3 H;  3SLU A;  1OGZ A;  3F7S A;  1A67 A;  1O7N B;  2E2V A;  6STD A;  4GL6 A;  3WMD A;  3LML A;  3MKI A;  3PCR A;  3V92 A;  1OPY A;  2HMM B;  1YGE A;  1YIJ 3;  3B4O A;  4O3V A;  1IQY A;  1EA2 A;  4R80 A;  4WP5 A;  5AEW B;  2OTJ 3;  2XF3 A;  4WWU C;  3V98 A;  3CMA 3;  3CCM 3;  2B24 B;  2XEP A;  2XSH B;  1OHO A;  4XB5 A;  5IER A;  1NWW A;  1YJN 3;  1M1X B;  1W2Z A;  3CME 3;  4XBX A;  3F8H A;  2ZL8 A;  3EC9 A;  1Q7Y 4;  3DGN A;  4HM8 B;  4N6U A;  3NV0 B;  2L4V A;  2YFI B;  2PNC A;  2WOH A;  2RSX A;  4KZ1 A;  1WMP A;  5AYS C;  1NJI 4;  1W6C A;  2HMO B;  3NUV A;  2Q07 A;  3EX9 A;  4L8O A;  2CFD A;  1DVD A;  2D1W A;  4KVH A;  3DUK A;  1KWI A;  4U13 A;  5EVH A;  1L5G B;  3CNM A;  3UB1 A;  3DZL A;  5A0O B;  1QAF A;  3MG3 A;  3PS8 A;  1GY5 A;  1LNH A;  1IVU A;  1LOX A;  1VZZ A;  4STD A;  3FSD A;  4FMA A;  5KP4 A;  2YX9 A;  1GY6 A;  4HM2 B;  3VSY A;  4ZM8 A;  3KII A;  3GZY B;  1CQS A;  1Q82 4;  1Q40 B;  4XM4 A;  5TGN A;  3DGL A;  1W5Z A;  3HX8 A;  1UW1 A;  5DRV A;  1PU4 A;  2Z76 A;  1VQ9 3;  4MMY B;  1YJ9 3;  3MWZ A;  7STD A;  1OH0 A;  3OW2 2;  4HJL B;  3RGR A;  1FGO A;  4HM1 B;  1RKY A;  2E2T A;  5IG0 A;  3CC7 3;  4EV2 A;  3NBR A;  4G1M B;  3N8B A;  3EB8 A;  1OGX A;  4XBY A;  3U97 A;  1K9M 4;  4JF8 A;  1VQ6 3;  3A76 A;  3OX9 A;  3I56 3;  5ELU A;  3GZB A;  4BTX A;  5I97 A;  1E3V A;  3BNB A;  2KCD A;  2JQ5 A;  5JPU A;  3K5T A;  1N9E A;  4X2O A;  1IVX A;  3JUM A;  1IDP A;  3D9R A;  2W9P A;  3SXX A;  2GU1 A;  1V74 A;  4K1U A;  5JBS A;  2W6J H;  3LTA A;  3S5C A;  1CEW I;  4OUQ A;  1RRH A;  2O3O A;  2K0M A;  2BMO B;  2BO9 B;  2SBL A;  2KRT A;  4Q53 A;  4HYZ A;  1FGR A;  4BTY A;  1NO3 A;  3B4P A;  2RFR A;  3GZX B;  8CHO A;  4HM6 B;  4RNZ A;  2I9W A;  1IV9 A;  2W9Q A;  3X42 A;  2W0Q A;  5D81 A;  4MMX B;  1VQ8 3;  1W00 A;  3OWU A;  3K0Z A;  4HZ9 B;  2Y74 A;  3V99 A;  1NDO B;  2HMK B;  1JKG B;  1UI8 A;  2V1L A;  3MYT A;  4NRE A;  5DRE A;  1NB5 I;  1FA3 A;  2YFL B;  4FCJ A;  5AI1 A;  5IG5 A;  2IA7 A;  1AVK A;  1YHQ 3;  2C11 A;  4H61 A;  4WYK A;  4O02 B;  1M1K 4;  2F98 A;  2CFK A;  2M7O A;  5HGR A;  3CCQ 3;  2HMJ B;  2W56 A;  1QVF 2;  3CCU 3;  3G0K A;  3MPH A;  3F8X A;  5IEO A;  4RBN A;  1G96 A;  2B1X B;  1M90 4;  2HML B;  1W6Y A;  2BNG A;  4KFD A;  1T5Y A;  1U5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...