3CPW2

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cpw200
3G4S3 3CCV3 1VQK3 1VQ53 1Q7Y4 3G6E3 3CCM3 1KC84 1YI23 3CCU3 1K734 1QVG2 1K9M4 1VQO3 3I563 1YJ93 3CCS3 1VQP3 3G713 1M1K4 1JJ22 1VQ73 1Q814 3CC73 3CCE3 1VQ83 1VQ43 3CMA3 1QVF2 1KQS2 1VQ93 1K8A4 3CCQ3 3CD63 3CCL3 1YJN3 1Q864 3CME3 2OTJ3 3OW22 3CCR3 1NJI4 1YJW3 1W2B2 1S723 1YHQ3 1N8R4 3CPW2 2OTL3 3CC43 1VQM3 1VQN3 3I553 3CXC2 1YIJ3 2QA43 2QEX3 1YIT3 1Q824 1VQ63 1KD14 3CC23 3CCJ3 1VQL3 1M904
chains in the Genus database with same CATH superfamily
2GU1A 1RGCA 1BRHA 3Q1CA 1K41A 1BSEA 1OGXA 1OF5B 3HIGA 4HKVB 3LXUX 1BSBA 2O3OA 1TRQA 1BNJA 1W02A 3SOAA 2P05A 3PGBA 4K61A 3SLUA 4BU4A 2F5MA 3T8UA 1R4CA 3S28A 1B20A 2Z76A 3CCR3 3B4PA 1C7HA 3X3YA 3X40A 4BTYA 3K63A 5GSPA 2B24B 2CWTA 1I3IA 1RRHA 2FNQA 1UDII 2LQVA 3MHEA 4RNZA 2GXFA 2K0MA 3MG2A 1FYSA 3HIIA 2L4VA 2B1XB 1JNQA 2OOVA 1VQK3 1UUVB 4IIAA 1DYUA 3LOYA 1SPUA 3M8CA 1TJDA 1ZS7A 1OCVA 4AKZA 4N3VA 1QJGA 1RLSA 1UUWB 5JPUA 1JZDA 1W00A 2CFGA 3GWRA 3JUQA 3KE7A 2JQ5A 3GZYB 1JBRA 1BVIA 3DGMA 2HOHA 2CFLA 4HM5B 1A2KA 1O7PB 2BO9B 2W2CA 5IERA 3CCL3 3GZXB 4FCJA 2CHCA 4KFFA 4WHAA 1BNEA 2CG0A 2FXTA 5AEWB 1DVDA 3MWZA 4ILFA 4HAAA 2PNCA 1CQSA 1BRSA 2KF6A 3AGOA 1N9EA 4QWTA 1TIJA 3NV0B 4J9AA 1YIJ3 2OTL3 1A67A 2C10A 2V1LA 5HGRA 2XGNA 1IVWA 1JB4A 3FF0A 4EBGA 3GRDA 3SVAA 1M904 1N8QA 3PCSA 1EUIC 1BIRA 3UNLA 4FMAA 2R41A 1Q42A 3NHXA 5IENA 2INXA 1I70A 1G96A 1YVBI 4HM8B 1RNBA 1VQP3 1MWUA 2CIUA 4MMYB 1Q814 4HM1B 1W5ZA 4OK0A 4LEHA 3PCRA 1NO3A 3G8ZA 1LRAA 3NV0A 5FGOA 2IUJA 3S29A 4OUQA 5CF1A 1TUHA 1KQS2 1DMQA 1GMPA 3FZWA 1FUTA 1DETA 5G1LA 4J5GA 2O9UX 4N6TA 1W2B2 3KFQC 4N6UA 3IMAB 5EEOA 3QRDA 1PY3A 1G02A 3URPA 1WQLB 5IG3A 4RNTA 2P09A 1W2ZA 1NWWA 1RGKA 1CYUA 8RNTA 3NQYA 2LYXA 2Z6BA 1UGHI 3MG1A 3TDGA 1FUSA 3PXMA 3Q3FA 2P38A 3LTAA 3LTCA 1QVG2 3UL6A 1LOYA 1Y4KA 4HZBB 3VSYA 3N54B 1JN5B 3G0KA 1GOVA 3DXOA 2KAAA 1QMAA 2BNGA 1ROVA 4O8SA 1WNHA 3WOEB 2BT3A 3S67A 3O8YA 2BMQB 6GSPA 1B27A 1NB3I 2ZHXB 3CPOA 2H0GA 3KSED 1LQGC 1R4YA 2F99A 2YX9A 5HOHA 1BOXA 1SARA 3T0UA 4HJLB 1O7MB 1U5OA 1MWSA 3MYTA 1BU4A 1X1UA 4H61A 4STDA 4WFOA 3STDA 1JN5A 1D6UA 2CX1A 4CJNA 8CHOA 4MJDA 1BNGA 5IF6A 5D81A 2HMOB 3FSDA 5AIGA 3NX0A 4H3UA 4J5KA 3V98A 3GZRA 5BXQA 3NBBA 1BAOA 1W4NA 2RBIA 2XRXB 4L8PA 3EBTA 1ZO2A 1MNLA 1RJOA 3AMOA 1RRLA 2J8XB 7STDA 3B8LA 2YFIB 2CKFB 4K1VA 1UW1A 2HMLB 3GZBA 1RGEA 1F8NA 2CWUA 2P0MA 3LT9A 1RGGA 1STDA 1GYBA 3F14A 3KSPA 1I2GA 2KF4A 1IQYA 3EBYA 3CXC2 2M7OA 5STDA 1G0TA 5KP1A 3F8XA 2MC8A 3BU4A 1RMSA 1JKGB 1JZOA 4WP5A 1ULJB 3G6E3 1IQ8A 4R4KA 3BNDA 3FH1A 4KZ1A 1RCLA 4I5QA 3DY5A 4LGQA 2HMKB 3D4AA 1X1YA 1EG9B 3G713 1LXEA 3FCSB 1VQ73 4FMCA 3SXXA 1RGAA 3RGAA 1RN1A 2Z77A 3WR2A 2XFTA 1UUGB 1ISKA 4FCZA 1JBSA 4R1KA 2QGUA 1JKGA 1I0VA 5AYSC 3KZTA 2IY2A 1YHQ3 1GMRA 2STDA 3LTBA 1IVXA 4FMDA 1SIIA 2HMJB 2XF3A 1Q40B 3OXAA 1E97A 1GD3A 1RTUA 1BRJA 7GSPA 1LNHA 1O7GB 1OHSA 1OF5A 2WO0A 3MG3A 4TX4A 1AQZA 1T5YA 3U97A 5BVBA 3JUNA 5LC6A 1AR0A 1Q9EA 2HMMB 4HOHA 5CF2A 2F56A 3I563 3HX8A 1FA3A 1ROAA 1FZUA 5LC7A 4X2OA 2XEPA 1IDPA 1Q40A 3DGOA 3EN8A 1QVF2 1YVSA 4O3VA 3KCHA 4RZMA 1JB5A 1T2IA 1DMNA 5DREA 2W56B 1GY7A 4XDVA 1I0XA 1NJI4 1RHLA 3BNEA 3PS8A 3CPW2 1JV2B 3NQZA 4XB5A 2BHMA 1SIHA 1RSNA 4HYZA 1WMNA 1SQWA 1I2EA 1QAKA 3A76A 1O7NB 4IT7A 1B2MA 1YI23 1BGSA 1RNTA 4R9KA 3CCU3 2W6JH 3BNCA 2PZVA 2W56A 3X41A 1W7CA 1EEJA 2WOHA 1OHPA 4ORLA 4ZM8A 3JUPA 2JDIH 2XR8B 1OHOA 3JVCA 4L7KA 1B21A 1LOWA 1LOXA 1RGHA 1FW7A 1LNIA 1N5PA 1K8A4 3DGYA 3FF2A 2WGOA 1RN7A 2XSOB 5IG4A 1BRGA 1IV9A 1A2VA 3CME3 1AV4A 3OWUA 3WA3A 3OW22 3F40A 2P0XA 3F7XA 1JBTA 1S723 3UL5A 1TFOA 4EXRA 1BANA 3F7SA 1VQ63 4EW5A 1BRIA 1CEWI 1FGTA 2W9PA 2F98A 1WTHA 5G2GA 5M1AA 4AKYA 4KVHA 3DM8A 2Y74A 2C4BA 4GL6A 3CCM3 5AIHA 3J7Yd 1FGQA 1B2ZA 3K9MC 4MMXB 5RNTA 4XDWA 2CFWA 2F86B 3H3HA 4KFEA 3CCS3 1NDOB 1Q7HA 3G16A 4NREA 3D9RA 1IVVA 3OX9A 1HYFA 1HU9A 2CH9A 1GS3A 2GEYA 3ER7A 3N8BA 4N6NB 5D83A 3IPTA 5CK6A 1Q864 1C54A 3S5CA 3ECFA 1YGEA 2W0QA 1IVUA 1N9JA 1OGZA 1UGIA 2CC3A 2W9QA 4LSOA 1YIT3 2ML6A 1LQMB 2ZL8A 5ELUA 1MGRA 3CCJ3 2OQEC 5AYRB 2CFDA 2UUGC 1GOUA 2BMOB 3LYGA 1BSDA 4FCMA 3G4S3 2RFRA 3PZWA 4O2HA 1K734 1K28A 2YFLB 4IPBA 3NM7A 4XM4A 4LZIA 4N6V0 4Q53A 5KP3A 3GSPA 1TRPA 1V74A 2BU4A 5AIFA 1SJWA 3CU3A 1L5GB 5IG0A 4KT3B 3U1WA 1N5HA 3X3XA 3CCE3 1VQ83 3I0YA 3Q90A 1A90A 1MOLA 3HOHA 1JRQA 1OPYA 2I9WA 3LTDA 1B2XA 1VQQA 4MMZB 5M18A 1IK3A 1YNVX 1T3BA 2ZA4A 3LZAA 3K5TA 3CMA3 3MKIA 3X3ZA 2CG1A 3WDGB 1NNVA 2H0HA 2KXGA 3H51A 1GY6A 4XBYA 5BIRA 3B4OA 1Q824 3NM2A 1D6YA 4MEIA 3RNTA 1BRNL 4RBNA 1MGWA 3DGNA 1VQ53 3FKAA 5CXOA 1Q7Y4 4HM3B 4FMBA 1KC84 1RKYA 2OQEA 3EE1A 4NPBA 4HBRA 2QIYA 1MWRA 3EQQB 1E3RA 4WWUC 1K9M4 1J2BA 2IYJA 1OH0A 1OUNA 4LYLB 2CFKA 1CYVA 9RNTA 1VQ43 2CX0A 3FG1A 1Z1SA 1CH0A 1PYLA 1I8VA 4AEQA 3WMDA 1O7HB 1X1WA 3MPHA 5AEUB 1ULIB 7RNTA 1LVNA 3UJMA 3PYJA 4JF8A 3Q2PA 1VZZA 2YFJB 1UI7A 1M9GA 1DMMA 2OWPA 2Q07A 4WYKB 3V99A 2E2TA 3HI7A 3CC23 1UI8A 1O7WB 1KWIA 1YGWA 2AADA 3MSOA 5KP4A 3CC73 4HM7B 2ML5A 3N9HA 4XBTA 1B2UA 2GBXB 4GSPA 2IA7A 2SARA 3F8HA 4G1MB 4N6OB 1FGOA 4NHFA 5DRVA 1QALA 1YJ93 1W6CA 3FGYA 3ZFZA 1T2HA 3JUOA 4BIRA 1DE3A 5IEOA 2K3DA 1FGRA 4WYKA 5JPPA 1BSCA 3SYUA 3D3LA 1X1XA 3KIIA 1I2FA 2D1WA 5IW9A 2OTJ3 3NXJA 2KF5A 1STFI 3ZG0A 1UCKA 3ALAA 3LH4A 2XGLA 1VQN3 3NBJA 3CC43 4EC6A 3UB1A 4CDLA 3BIRA 2E2UA 1RN4A 1KD14 1IQXA 6RNTA 3LT8A 4K90B 3VGNA 4EV5A 1OACA 1M1XB 5EQLA 1LOVA 4K1UA 4R9LA 2OCTA 5IEPA 2GSPA 2F5WA 1IYYA 4XBXA 1B3SA 1RGLA 4JRFA 2XFSA 1M1K4 4R80A 2Y73A 3AGNA 4CPKA 2KF3A 3AHSA 1AY7A 1RGFA 1WMPA 4CCVA 3OWYA 4L8OA 4BTXA 4PEJA 3T8NA 3SEDA 1DVCA 3EB8A 1TU5A 2HMNB 2RNTA 3WA2X 2GU3A 1N8R4 1QAFA 3SX1A 1UCJA 3I553 4HZ9B 1NB5I 1BNFA 1PU4A 3D5GA 1GMQA 4OVMA 2UGIA 2CK3H 3D79A 5EVHA 1W6YA 3GAXA 5ELJA 2BIRA 1EQKA 1BNSA 2Z7AA 5JBSA 5FW5A 1BRKA 1EKMA 1KSIA 1IU7A 3BLZA 1GD4A 3EF8A 4U13A 3OWSA 3QK9A 2W03A 1UCLA 1IT8A 2GEXA 3HZPA 2L1SA 1BUJA 3FG3A 4N6MA 2UX0A 3K7CA 1W6GA 4GB5A 2E2VA 5AI1A 2F4YA 1ASKA 4HM6B 1TP6A 3ZG5A 1AVLA 3CCQ3 1VQ93 6STDA 3JUMA 2RCDA 2MF7A 1I3FA 3BNBA 3CNMA 1YJW3 1A2PA 1US1A 3E99A 3HK4A 5BU4A 4BTWA 3VF1A 2BMRB 5IG5A 1MWTA 1HKXA 1VQL3 4BL3A 2D42A 1RCKA 3FG4A 5G1KA 5TGNA 1E3VA 1GOYA 3EJVA 3DMCA 3CCV3 3NBRA 3BB9A 2CW9A 3WODG 1V57A 3A5EA 3B7CA 4HM4B 2IUKA 3X42A 3WHOA 1U8CB 1IT7A 1ZGXA 2XH9A 4J8TA 1JJ22 4N6LA 1GY5A 2RSXA 3NUVA 4EYCA 4FR9A 5A0OB 3CD63 2R4IA 1BSAA 1AVKA 3AHWA 3EHCA 2ZDJA 5AIIA 2H0IA 1UCIA 4RNYA 3V92A 3K0ZA 2IMJA 3DUKA 5D82A 1FUWA 1EA2A 3IJEB 2C11A 3AMOB 4GHOA 3RDEA 1VQM3 5CLKA 2QEX3 3EX9A 3KN4A 1FGMA 1S5AA 3DH2A 2KRTA 1JB2A 3DGLA 3OV4A 4O02B 3FLJA 3LMLA 4EV2A 1WMOA 1IV7A 3EC9A 4HM0B 2CWVA 1TFKA 1NU3A 1RDSA 1D6ZA 2FGTA 3DZLA 3KKGA 1HZ1A 2SBLA 4I4KA 3ROBA 1VQO3 1BNRA 2AAEA 3CNXA 1BUQA 4KFDA 3WOFB 4DKIA 3EN1B 2W04A 1B2SA 1BNIA 4HVNA 3SOYA 2K54A 2RGQA 3F9SA 2GBWB 1V58A 3L0RA 5I97A 1YJN3 1ZX2A 2WGQA 3S27A 2XSHB 4X2HA 1GSPA 2WOFA 4LMIA 2OOVC 1TTOA 3RGRA 5M19A 2QA43 4HM2B 3D5IA 4BL2A 2A15A 1W01A 2KCDA 1PFPA
chains in the Genus database with same CATH topology
2GU1A 3Q1CA 1K41A 1OGXA 1OF5B 3HIGA 4HKVB 3LXUX 2O3OA 3SOAA 1W02A 2P05A 3PGBA 4K61A 3SLUA 3T8UA 1R4CA 3S28A 2Z76A 3CCR3 3B4PA 1C7HA 3X3YA 3X40A 4BTYA 3K63A 2B24B 2CWTA 1RRHA 2FNQA 4RNZA 2LQVA 3MHEA 2GXFA 2K0MA 3MG2A 3HIIA 2L4VA 2B1XB 1JNQA 2OOVA 1VQK3 1UUVB 4IIAA 1DYUA 3LOYA 1SPUA 3M8CA 1OCVA 4AKZA 4N3VA 1QJGA 1UUWB 5JPUA 3JUQA 1W00A 2CFGA 3GWRA 3KE7A 2JQ5A 3GZYB 3DGMA 2CFLA 4HM5B 1A2KA 1O7PB 2BO9B 2W2CA 5IERA 3CCL3 3GZXB 4FCJA 2CHCA 4KFFA 4WHAA 5AEWB 2CG0A 2FXTA 1DVDA 3MWZA 2PNCA 1CQSA 4QWTA 2OTL3 1N9EA 1A67A 1TIJA 3NV0B 4J9AA 1YIJ3 2C10A 2V1LA 5HGRA 2XGNA 1IVWA 1JB4A 3FF0A 4EBGA 3GRDA 3SVAA 1M904 1N8QA 3PCSA 3UNLA 4FMAA 3NHXA 1Q42A 5IENA 2INXA 1YVBI 1G96A 4HM8B 1VQP3 2CIUA 4MMYB 1Q814 4HM1B 1W5ZA 4OK0A 4LEHA 3PCRA 1NO3A 3G8ZA 3NV0A 5FGOA 2IUJA 3S29A 5CF1A 4OUQA 1KQS2 1TUHA 1DMQA 3FZWA 2O9UX 4N6TA 1W2B2 3KFQC 4N6UA 3IMAB 5EEOA 3QRDA 1WQLB 5IG3A 2P09A 1W2ZA 1NWWA 1CYUA 3NQYA 2LYXA 2Z6BA 3TDGA 3MG1A 3PXMA 2P38A 3LTAA 3LTCA 1QVG2 3UL6A 1Y4KA 4HZBB 3VSYA 3N54B 1JN5B 3G0KA 3DXOA 1QMAA 2BNGA 1ROVA 4O8SA 1WNHA 3WOEB 2BT3A 3S67A 3O8YA 2BMQB 1NB3I 3CPOA 3KSED 2F99A 2YX9A 3T0UA 4HJLB 1O7MB 1U5OA 3MYTA 3STDA 4H61A 4STDA 4WFOA 1JN5A 1D6UA 8CHOA 4MJDA 5IF6A 5D81A 2HMOB 3FSDA 5AIGA 3NX0A 4H3UA 3V98A 3GZRA 5BXQA 3NBBA 1W4NA 2XRXB 4L8PA 3EBTA 1ZO2A 1MNLA 1RJOA 3AMOA 1RRLA 7STDA 3B8LA 2YFIB 2CKFB 4K1VA 1UW1A 2HMLB 3GZBA 1F8NA 2CWUA 2P0MA 3LT9A 1STDA 3F14A 1GYBA 3KSPA 1IQYA 3EBYA 3CXC2 2M7OA 5STDA 5KP1A 3F8XA 2MC8A 1JKGB 4WP5A 3G6E3 1ULJB 1IQ8A 4R4KA 3BNDA 3FH1A 4KZ1A 3DY5A 4LGQA 2HMKB 1EG9B 3G713 1LXEA 3FCSB 1VQ73 4FMCA 3SXXA 3RGAA 2Z77A 2XFTA 1ISKA 4FCZA 4R1KA 2QGUA 1JKGA 5AYSC 3KZTA 1YHQ3 2STDA 3LTBA 1IVXA 4FMDA 1SIIA 2HMJB 2XF3A 1Q40B 3OXAA 1E97A 1GD3A 1LNHA 1O7GB 1OHSA 1OF5A 2WO0A 3MG3A 4TX4A 1T5YA 5BVBA 3U97A 3JUNA 5LC6A 1AR0A 2HMMB 5CF2A 3I563 3HX8A 1FA3A 1ROAA 5LC7A 4X2OA 2XEPA 1IDPA 1Q40A 3DGOA 3EN8A 1QVF2 4O3VA 4RZMA 1JB5A 1DMNA 5DREA 2W56B 1GY7A 4XDVA 1NJI4 3BNEA 3PS8A 3CPW2 1JV2B 3NQZA 4XB5A 2BHMA 1SIHA 4HYZA 1WMNA 1SQWA 1QAKA 3A76A 1O7NB 4IT7A 1YI23 3CCU3 4R9KA 2W6JH 3BNCA 2PZVA 2W56A 3X41A 1W7CA 2WOHA 1OHPA 4ORLA 4ZM8A 3JUPA 2JDIH 2XR8B 1OHOA 3JVCA 4L7KA 1LOXA 1N5PA 1K8A4 3FF2A 2WGOA 1RN7A 2XSOB 5IG4A 1IV9A 1A2VA 3CME3 1AV4A 3OWUA 3WA3A 3OW22 3F40A 2P0XA 3F7XA 1S723 3UL5A 1TFOA 4EXRA 3F7SA 1VQ63 1CEWI 1FGTA 2W9PA 2F98A 1WTHA 5G2GA 4AKYA 4KVHA 3DM8A 2Y74A 4GL6A 3CCM3 5AIHA 3J7Yd 1FGQA 3K9MC 4MMXB 4XDWA 2CFWA 2F86B 3H3HA 4KFEA 3CCS3 1NDOB 3G16A 4NREA 3D9RA 1IVVA 3OX9A 1HU9A 2CH9A 1GS3A 2GEYA 3ER7A 3N8BA 4N6NB 5D83A 3IPTA 5CK6A 1Q864 3S5CA 3ECFA 1YGEA 2W0QA 1IVUA 1N9JA 1OGZA 4LSOA 2CC3A 2W9QA 1YIT3 2ML6A 2ZL8A 5ELUA 3CCJ3 2OQEC 5AYRB 2CFDA 2BMOB 3LYGA 3G4S3 4FCMA 2RFRA 3PZWA 4O2HA 1K734 1K28A 2YFLB 4IPBA 3NM7A 4XM4A 4LZIA 4N6V0 4Q53A 5KP3A 1V74A 5AIFA 1SJWA 3CU3A 1L5GB 5IG0A 3U1WA 1N5HA 3X3XA 3CCE3 1VQ83 3I0YA 3Q90A 1A90A 1MOLA 1JRQA 1OPYA 2I9WA 3LTDA 4MMZB 1IK3A 3LZAA 3K5TA 3CMA3 3MKIA 3X3ZA 2CG1A 3WDGB 2KXGA 3H51A 1GY6A 4XBYA 3B4OA 1Q824 3NM2A 1D6YA 4MEIA 4RBNA 3DGNA 1VQ53 3FKAA 5CXOA 1Q7Y4 4HM3B 4FMBA 1KC84 1RKYA 2OQEA 3EE1A 1J2BA 4HBRA 2QIYA 3EQQB 1K9M4 1E3RA 4WWUC 1OH0A 1OUNA 2CFKA 1CYVA 1VQ43 3FG1A 1Z1SA 4AEQA 3WMDA 1O7HB 3MPHA 5AEUB 1ULIB 1LVNA 3UJMA 3PYJA 4JF8A 3Q2PA 1VZZA 2YFJB 1UI7A 1M9GA 1DMMA 2Q07A 2OWPA 4WYKB 3V99A 2E2TA 3HI7A 3CC23 1UI8A 1O7WB 1KWIA 3MSOA 5KP4A 3CC73 4HM7B 2ML5A 3N9HA 4XBTA 2GBXB 2IA7A 3F8HA 4G1MB 4N6OB 1FGOA 4NHFA 5DRVA 1QALA 1YJ93 1W6CA 3FGYA 3JUOA 5IEOA 1FGRA 4WYKA 5JPPA 3D3LA 3KIIA 2D1WA 5IW9A 2OTJ3 3NXJA 1STFI 3LH4A 3ALAA 2XGLA 1VQN3 3NBJA 3CC43 4EC6A 3UB1A 4CDLA 2E2UA 1KD14 1IQXA 3LT8A 4K90B 3VGNA 4EV5A 1OACA 1M1XB 5EQLA 4K1UA 4R9LA 2OCTA 5IEPA 4XBXA 4JRFA 2XFSA 1M1K4 4R80A 2Y73A 1WMPA 4CCVA 3OWYA 4L8OA 4BTXA 4PEJA 3T8NA 3SEDA 1DVCA 3EB8A 1TU5A 2HMNB 3WA2X 2GU3A 1N8R4 1QAFA 3SX1A 3I553 4HZ9B 1NB5I 1PU4A 4OVMA 2CK3H 5EVHA 1W6YA 3GAXA 5ELJA 1EQKA 2Z7AA 5JBSA 5FW5A 1EKMA 1KSIA 1IU7A 3BLZA 1GD4A 3EF8A 4U13A 3OWSA 3QK9A 2W03A 1IT8A 2GEXA 3HZPA 3FG3A 4N6MA 2UX0A 3K7CA 1W6GA 4GB5A 2E2VA 5AI1A 1VQ93 1ASKA 4HM6B 1TP6A 1AVLA 3CCQ3 6STDA 3JUMA 2RCDA 2MF7A 3BNBA 3CNMA 1YJW3 1US1A 3E99A 3HK4A 4BTWA 3VF1A 2BMRB 5IG5A 1HKXA 1VQL3 2D42A 3FG4A 5TGNA 1E3VA 3EJVA 3DMCA 3CCV3 3NBRA 3BB9A 2CW9A 3WODG 3B7CA 4HM4B 2IUKA 3X42A 1U8CB 1IT7A 2XH9A 4J8TA 1JJ22 4N6LA 1GY5A 2RSXA 3NUVA 4EYCA 4FR9A 5A0OB 3CD63 2R4IA 3EHCA 1AVKA 2ZDJA 5AIIA 4RNYA 3V92A 3K0ZA 2IMJA 3DUKA 5D82A 1FUWA 1EA2A 3IJEB 2C11A 3AMOB 3RDEA 1VQM3 5CLKA 2QEX3 3EX9A 3KN4A 1FGMA 1S5AA 4O02B 2KRTA 1JB2A 3DGLA 3OV4A 4EV2A 3FLJA 3LMLA 1WMOA 1IV7A 3EC9A 4HM0B 2CWVA 1TFKA 1NU3A 1D6ZA 2FGTA 3DZLA 3KKGA 3ROBA 2SBLA 4I4KA 1VQO3 1BUQA 3CNXA 4KFDA 3WOFB 3EN1B 2W04A 4HVNA 3SOYA 2K54A 2RGQA 3F9SA 2GBWB 3L0RA 5I97A 1YJN3 1ZX2A 2WGQA 3S27A 2XSHB 4X2HA 2WOFA 4LMIA 2OOVC 3RGRA 2QA43 4HM2B 2A15A 1W01A 2KCDA 1PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S 3;  3CCV 3;  1VQK 3;  1VQ5 3;  1Q7Y 4;  3G6E 3;  3CCM 3;  1KC8 4;  1YI2 3;  3CCU 3;  1K73 4;  1QVG 2;  1K9M 4;  1VQO 3;  3I56 3;  1YJ9 3;  3CCS 3;  1VQP 3;  3G71 3;  1M1K 4;  1JJ2 2;  1VQ7 3;  1Q81 4;  3CC7 3;  3CCE 3;  1VQ8 3;  1VQ4 3;  3CMA 3;  1QVF 2;  1KQS 2;  1VQ9 3;  1K8A 4;  3CCQ 3;  3CD6 3;  3CCL 3;  1YJN 3;  1Q86 4;  3CME 3;  2OTJ 3;  3OW2 2;  3CCR 3;  1NJI 4;  1YJW 3;  1W2B 2;  1S72 3;  1YHQ 3;  1N8R 4;  3CPW 2;  2OTL 3;  3CC4 3;  1VQM 3;  1VQN 3;  3I55 3;  3CXC 2;  1YIJ 3;  2QA4 3;  2QEX 3;  1YIT 3;  1Q82 4;  1VQ6 3;  1KD1 4;  3CC2 3;  3CCJ 3;  1VQL 3;  1M90 4; 
#chains in the Genus database with same CATH topology
 2GU1 A;  1RGC A;  1BRH A;  3Q1C A;  1K41 A;  1BSE A;  1OGX A;  1OF5 B;  3HIG A;  4HKV B;  3LXU X;  1BSB A;  2O3O A;  1TRQ A;  1BNJ A;  1W02 A;  3SOA A;  2P05 A;  3PGB A;  4K61 A;  3SLU A;  4BU4 A;  2F5M A;  3T8U A;  1R4C A;  3S28 A;  1B20 A;  2Z76 A;  3CCR 3;  3B4P A;  1C7H A;  3X3Y A;  3X40 A;  4BTY A;  3K63 A;  5GSP A;  2B24 B;  2CWT A;  1I3I A;  1RRH A;  2FNQ A;  1UDI I;  2LQV A;  3MHE A;  4RNZ A;  2GXF A;  2K0M A;  3MG2 A;  1FYS A;  3HII A;  2L4V A;  2B1X B;  1JNQ A;  2OOV A;  1VQK 3;  1UUV B;  4IIA A;  1DYU A;  3LOY A;  1SPU A;  3M8C A;  1TJD A;  1ZS7 A;  1OCV A;  4AKZ A;  4N3V A;  1QJG A;  1RLS A;  1UUW B;  5JPU A;  1JZD A;  1W00 A;  2CFG A;  3GWR A;  3JUQ A;  3KE7 A;  2JQ5 A;  3GZY B;  1JBR A;  1BVI A;  3DGM A;  2HOH A;  2CFL A;  4HM5 B;  1A2K A;  1O7P B;  2BO9 B;  2W2C A;  5IER A;  3CCL 3;  3GZX B;  4FCJ A;  2CHC A;  4KFF A;  4WHA A;  1BNE A;  2CG0 A;  2FXT A;  5AEW B;  1DVD A;  3MWZ A;  4ILF A;  4HAA A;  2PNC A;  1CQS A;  1BRS A;  2KF6 A;  3AGO A;  1N9E A;  4QWT A;  1TIJ A;  3NV0 B;  4J9A A;  1YIJ 3;  2OTL 3;  1A67 A;  2C10 A;  2V1L A;  5HGR A;  2XGN A;  1IVW A;  1JB4 A;  3FF0 A;  4EBG A;  3GRD A;  3SVA A;  1M90 4;  1N8Q A;  3PCS A;  1EUI C;  1BIR A;  3UNL A;  4FMA A;  2R41 A;  1Q42 A;  3NHX A;  5IEN A;  2INX A;  1I70 A;  1G96 A;  1YVB I;  4HM8 B;  1RNB A;  1VQP 3;  1MWU A;  2CIU A;  4MMY B;  1Q81 4;  4HM1 B;  1W5Z A;  4OK0 A;  4LEH A;  3PCR A;  1NO3 A;  3G8Z A;  1LRA A;  3NV0 A;  5FGO A;  2IUJ A;  3S29 A;  4OUQ A;  5CF1 A;  1TUH A;  1KQS 2;  1DMQ A;  1GMP A;  3FZW A;  1FUT A;  1DET A;  5G1L A;  4J5G A;  2O9U X;  4N6T A;  1W2B 2;  3KFQ C;  4N6U A;  3IMA B;  5EEO A;  3QRD A;  1PY3 A;  1G02 A;  3URP A;  1WQL B;  5IG3 A;  4RNT A;  2P09 A;  1W2Z A;  1NWW A;  1RGK A;  1CYU A;  8RNT A;  3NQY A;  2LYX A;  2Z6B A;  1UGH I;  3MG1 A;  3TDG A;  1FUS A;  3PXM A;  3Q3F A;  2P38 A;  3LTA A;  3LTC A;  1QVG 2;  3UL6 A;  1LOY A;  1Y4K A;  4HZB B;  3VSY A;  3N54 B;  1JN5 B;  3G0K A;  1GOV A;  3DXO A;  2KAA A;  1QMA A;  2BNG A;  1ROV A;  4O8S A;  1WNH A;  3WOE B;  2BT3 A;  3S67 A;  3O8Y A;  2BMQ B;  6GSP A;  1B27 A;  1NB3 I;  2ZHX B;  3CPO A;  2H0G A;  3KSE D;  1LQG C;  1R4Y A;  2F99 A;  2YX9 A;  5HOH A;  1BOX A;  1SAR A;  3T0U A;  4HJL B;  1O7M B;  1U5O A;  1MWS A;  3MYT A;  1BU4 A;  1X1U A;  4H61 A;  4STD A;  4WFO A;  3STD A;  1JN5 A;  1D6U A;  2CX1 A;  4CJN A;  8CHO A;  4MJD A;  1BNG A;  5IF6 A;  5D81 A;  2HMO B;  3FSD A;  5AIG A;  3NX0 A;  4H3U A;  4J5K A;  3V98 A;  3GZR A;  5BXQ A;  3NBB A;  1BAO A;  1W4N A;  2RBI A;  2XRX B;  4L8P A;  3EBT A;  1ZO2 A;  1MNL A;  1RJO A;  3AMO A;  1RRL A;  2J8X B;  7STD A;  3B8L A;  2YFI B;  2CKF B;  4K1V A;  1UW1 A;  2HML B;  3GZB A;  1RGE A;  1F8N A;  2CWU A;  2P0M A;  3LT9 A;  1RGG A;  1STD A;  1GYB A;  3F14 A;  3KSP A;  1I2G A;  2KF4 A;  1IQY A;  3EBY A;  3CXC 2;  2M7O A;  5STD A;  1G0T A;  5KP1 A;  3F8X A;  2MC8 A;  3BU4 A;  1RMS A;  1JKG B;  1JZO A;  4WP5 A;  1ULJ B;  3G6E 3;  1IQ8 A;  4R4K A;  3BND A;  3FH1 A;  4KZ1 A;  1RCL A;  4I5Q A;  3DY5 A;  4LGQ A;  2HMK B;  3D4A A;  1X1Y A;  1EG9 B;  3G71 3;  1LXE A;  3FCS B;  1VQ7 3;  4FMC A;  3SXX A;  1RGA A;  3RGA A;  1RN1 A;  2Z77 A;  3WR2 A;  2XFT A;  1UUG B;  1ISK A;  4FCZ A;  1JBS A;  4R1K A;  2QGU A;  1JKG A;  1I0V A;  5AYS C;  3KZT A;  2IY2 A;  1YHQ 3;  1GMR A;  2STD A;  3LTB A;  1IVX A;  4FMD A;  1SII A;  2HMJ B;  2XF3 A;  1Q40 B;  3OXA A;  1E97 A;  1GD3 A;  1RTU A;  1BRJ A;  7GSP A;  1LNH A;  1O7G B;  1OHS A;  1OF5 A;  2WO0 A;  3MG3 A;  4TX4 A;  1AQZ A;  1T5Y A;  3U97 A;  5BVB A;  3JUN A;  5LC6 A;  1AR0 A;  1Q9E A;  2HMM B;  4HOH A;  5CF2 A;  2F56 A;  3I56 3;  3HX8 A;  1FA3 A;  1ROA A;  1FZU A;  5LC7 A;  4X2O A;  2XEP A;  1IDP A;  1Q40 A;  3DGO A;  3EN8 A;  1QVF 2;  1YVS A;  4O3V A;  3KCH A;  4RZM A;  1JB5 A;  1T2I A;  1DMN A;  5DRE A;  2W56 B;  1GY7 A;  4XDV A;  1I0X A;  1NJI 4;  1RHL A;  3BNE A;  3PS8 A;  3CPW 2;  1JV2 B;  3NQZ A;  4XB5 A;  2BHM A;  1SIH A;  1RSN A;  4HYZ A;  1WMN A;  1SQW A;  1I2E A;  1QAK A;  3A76 A;  1O7N B;  4IT7 A;  1B2M A;  1YI2 3;  1BGS A;  1RNT A;  4R9K A;  3CCU 3;  2W6J H;  3BNC A;  2PZV A;  2W56 A;  3X41 A;  1W7C A;  1EEJ A;  2WOH A;  1OHP A;  4ORL A;  4ZM8 A;  3JUP A;  2JDI H;  2XR8 B;  1OHO A;  3JVC A;  4L7K A;  1B21 A;  1LOW A;  1LOX A;  1RGH A;  1FW7 A;  1LNI A;  1N5P A;  1K8A 4;  3DGY A;  3FF2 A;  2WGO A;  1RN7 A;  2XSO B;  5IG4 A;  1BRG A;  1IV9 A;  1A2V A;  3CME 3;  1AV4 A;  3OWU A;  3WA3 A;  3OW2 2;  3F40 A;  2P0X A;  3F7X A;  1JBT A;  1S72 3;  3UL5 A;  1TFO A;  4EXR A;  1BAN A;  3F7S A;  1VQ6 3;  4EW5 A;  1BRI A;  1CEW I;  1FGT A;  2W9P A;  2F98 A;  1WTH A;  5G2G A;  5M1A A;  4AKY A;  4KVH A;  3DM8 A;  2Y74 A;  2C4B A;  4GL6 A;  3CCM 3;  5AIH A;  3J7Y d;  1FGQ A;  1B2Z A;  3K9M C;  4MMX B;  5RNT A;  4XDW A;  2CFW A;  2F86 B;  3H3H A;  4KFE A;  3CCS 3;  1NDO B;  1Q7H A;  3G16 A;  4NRE A;  3D9R A;  1IVV A;  3OX9 A;  1HYF A;  1HU9 A;  2CH9 A;  1GS3 A;  2GEY A;  3ER7 A;  3N8B A;  4N6N B;  5D83 A;  3IPT A;  5CK6 A;  1Q86 4;  1C54 A;  3S5C A;  3ECF A;  1YGE A;  2W0Q A;  1IVU A;  1N9J A;  1OGZ A;  1UGI A;  2CC3 A;  2W9Q A;  4LSO A;  1YIT 3;  2ML6 A;  1LQM B;  2ZL8 A;  5ELU A;  1MGR A;  3CCJ 3;  2OQE C;  5AYR B;  2CFD A;  2UUG C;  1GOU A;  2BMO B;  3LYG A;  1BSD A;  4FCM A;  3G4S 3;  2RFR A;  3PZW A;  4O2H A;  1K73 4;  1K28 A;  2YFL B;  4IPB A;  3NM7 A;  4XM4 A;  4LZI A;  4N6V 0;  4Q53 A;  5KP3 A;  3GSP A;  1TRP A;  1V74 A;  2BU4 A;  5AIF A;  1SJW A;  3CU3 A;  1L5G B;  5IG0 A;  4KT3 B;  3U1W A;  1N5H A;  3X3X A;  3CCE 3;  1VQ8 3;  3I0Y A;  3Q90 A;  1A90 A;  1MOL A;  3HOH A;  1JRQ A;  1OPY A;  2I9W A;  3LTD A;  1B2X A;  1VQQ A;  4MMZ B;  5M18 A;  1IK3 A;  1YNV X;  1T3B A;  2ZA4 A;  3LZA A;  3K5T A;  3CMA 3;  3MKI A;  3X3Z A;  2CG1 A;  3WDG B;  1NNV A;  2H0H A;  2KXG A;  3H51 A;  1GY6 A;  4XBY A;  5BIR A;  3B4O A;  1Q82 4;  3NM2 A;  1D6Y A;  4MEI A;  3RNT A;  1BRN L;  4RBN A;  1MGW A;  3DGN A;  1VQ5 3;  3FKA A;  5CXO A;  1Q7Y 4;  4HM3 B;  4FMB A;  1KC8 4;  1RKY A;  2OQE A;  3EE1 A;  4NPB A;  4HBR A;  2QIY A;  1MWR A;  3EQQ B;  1E3R A;  4WWU C;  1K9M 4;  1J2B A;  2IYJ A;  1OH0 A;  1OUN A;  4LYL B;  2CFK A;  1CYV A;  9RNT A;  1VQ4 3;  2CX0 A;  3FG1 A;  1Z1S A;  1CH0 A;  1PYL A;  1I8V A;  4AEQ A;  3WMD A;  1O7H B;  1X1W A;  3MPH A;  5AEU B;  1ULI B;  7RNT A;  1LVN A;  3UJM A;  3PYJ A;  4JF8 A;  3Q2P A;  1VZZ A;  2YFJ B;  1UI7 A;  1M9G A;  1DMM A;  2OWP A;  2Q07 A;  4WYK B;  3V99 A;  2E2T A;  3HI7 A;  3CC2 3;  1UI8 A;  1O7W B;  1KWI A;  1YGW A;  2AAD A;  3MSO A;  5KP4 A;  3CC7 3;  4HM7 B;  2ML5 A;  3N9H A;  4XBT A;  1B2U A;  2GBX B;  4GSP A;  2IA7 A;  2SAR A;  3F8H A;  4G1M B;  4N6O B;  1FGO A;  4NHF A;  5DRV A;  1QAL A;  1YJ9 3;  1W6C A;  3FGY A;  3ZFZ A;  1T2H A;  3JUO A;  4BIR A;  1DE3 A;  5IEO A;  2K3D A;  1FGR A;  4WYK A;  5JPP A;  1BSC A;  3SYU A;  3D3L A;  1X1X A;  3KII A;  1I2F A;  2D1W A;  5IW9 A;  2OTJ 3;  3NXJ A;  2KF5 A;  1STF I;  3ZG0 A;  1UCK A;  3ALA A;  3LH4 A;  2XGL A;  1VQN 3;  3NBJ A;  3CC4 3;  4EC6 A;  3UB1 A;  4CDL A;  3BIR A;  2E2U A;  1RN4 A;  1KD1 4;  1IQX A;  6RNT A;  3LT8 A;  4K90 B;  3VGN A;  4EV5 A;  1OAC A;  1M1X B;  5EQL A;  1LOV A;  4K1U A;  4R9L A;  2OCT A;  5IEP A;  2GSP A;  2F5W A;  1IYY A;  4XBX A;  1B3S A;  1RGL A;  4JRF A;  2XFS A;  1M1K 4;  4R80 A;  2Y73 A;  3AGN A;  4CPK A;  2KF3 A;  3AHS A;  1AY7 A;  1RGF A;  1WMP A;  4CCV A;  3OWY A;  4L8O A;  4BTX A;  4PEJ A;  3T8N A;  3SED A;  1DVC A;  3EB8 A;  1TU5 A;  2HMN B;  2RNT A;  3WA2 X;  2GU3 A;  1N8R 4;  1QAF A;  3SX1 A;  1UCJ A;  3I55 3;  4HZ9 B;  1NB5 I;  1BNF A;  1PU4 A;  3D5G A;  1GMQ A;  4OVM A;  2UGI A;  2CK3 H;  3D79 A;  5EVH A;  1W6Y A;  3GAX A;  5ELJ A;  2BIR A;  1EQK A;  1BNS A;  2Z7A A;  5JBS A;  5FW5 A;  1BRK A;  1EKM A;  1KSI A;  1IU7 A;  3BLZ A;  1GD4 A;  3EF8 A;  4U13 A;  3OWS A;  3QK9 A;  2W03 A;  1UCL A;  1IT8 A;  2GEX A;  3HZP A;  2L1S A;  1BUJ A;  3FG3 A;  4N6M A;  2UX0 A;  3K7C A;  1W6G A;  4GB5 A;  2E2V A;  5AI1 A;  2F4Y A;  1ASK A;  4HM6 B;  1TP6 A;  3ZG5 A;  1AVL A;  3CCQ 3;  1VQ9 3;  6STD A;  3JUM A;  2RCD A;  2MF7 A;  1I3F A;  3BNB A;  3CNM A;  1YJW 3;  1A2P A;  1US1 A;  3E99 A;  3HK4 A;  5BU4 A;  4BTW A;  3VF1 A;  2BMR B;  5IG5 A;  1MWT A;  1HKX A;  1VQL 3;  4BL3 A;  2D42 A;  1RCK A;  3FG4 A;  5G1K A;  5TGN A;  1E3V A;  1GOY A;  3EJV A;  3DMC A;  3CCV 3;  3NBR A;  3BB9 A;  2CW9 A;  3WOD G;  1V57 A;  3A5E A;  3B7C A;  4HM4 B;  2IUK A;  3X42 A;  3WHO A;  1U8C B;  1IT7 A;  1ZGX A;  2XH9 A;  4J8T A;  1JJ2 2;  4N6L A;  1GY5 A;  2RSX A;  3NUV A;  4EYC A;  4FR9 A;  5A0O B;  3CD6 3;  2R4I A;  1BSA A;  1AVK A;  3AHW A;  3EHC A;  2ZDJ A;  5AII A;  2H0I A;  1UCI A;  4RNY A;  3V92 A;  3K0Z A;  2IMJ A;  3DUK A;  5D82 A;  1FUW A;  1EA2 A;  3IJE B;  2C11 A;  3AMO B;  4GHO A;  3RDE A;  1VQM 3;  5CLK A;  2QEX 3;  3EX9 A;  3KN4 A;  1FGM A;  1S5A A;  3DH2 A;  2KRT A;  1JB2 A;  3DGL A;  3OV4 A;  4O02 B;  3FLJ A;  3LML A;  4EV2 A;  1WMO A;  1IV7 A;  3EC9 A;  4HM0 B;  2CWV A;  1TFK A;  1NU3 A;  1RDS A;  1D6Z A;  2FGT A;  3DZL A;  3KKG A;  1HZ1 A;  2SBL A;  4I4K A;  3ROB A;  1VQO 3;  1BNR A;  2AAE A;  3CNX A;  1BUQ A;  4KFD A;  3WOF B;  4DKI A;  3EN1 B;  2W04 A;  1B2S A;  1BNI A;  4HVN A;  3SOY A;  2K54 A;  2RGQ A;  3F9S A;  2GBW B;  1V58 A;  3L0R A;  5I97 A;  1YJN 3;  1ZX2 A;  2WGQ A;  3S27 A;  2XSH B;  4X2H A;  1GSP A;  2WOF A;  4LMI A;  2OOV C;  1TTO A;  3RGR A;  5M19 A;  2QA4 3;  4HM2 B;  3D5I A;  4BL2 A;  2A15 A;  1W01 A;  2KCD A;  1PFP A; 
#chains in the Genus database with same CATH homology
 2GU1 A;  3Q1C A;  1K41 A;  1OGX A;  1OF5 B;  3HIG A;  4HKV B;  3LXU X;  2O3O A;  3SOA A;  1W02 A;  2P05 A;  3PGB A;  4K61 A;  3SLU A;  3T8U A;  1R4C A;  3S28 A;  2Z76 A;  3CCR 3;  3B4P A;  1C7H A;  3X3Y A;  3X40 A;  4BTY A;  3K63 A;  2B24 B;  2CWT A;  1RRH A;  2FNQ A;  4RNZ A;  2LQV A;  3MHE A;  2GXF A;  2K0M A;  3MG2 A;  3HII A;  2L4V A;  2B1X B;  1JNQ A;  2OOV A;  1VQK 3;  1UUV B;  4IIA A;  1DYU A;  3LOY A;  1SPU A;  3M8C A;  1OCV A;  4AKZ A;  4N3V A;  1QJG A;  1UUW B;  5JPU A;  3JUQ A;  1W00 A;  2CFG A;  3GWR A;  3KE7 A;  2JQ5 A;  3GZY B;  3DGM A;  2CFL A;  4HM5 B;  1A2K A;  1O7P B;  2BO9 B;  2W2C A;  5IER A;  3CCL 3;  3GZX B;  4FCJ A;  2CHC A;  4KFF A;  4WHA A;  5AEW B;  2CG0 A;  2FXT A;  1DVD A;  3MWZ A;  2PNC A;  1CQS A;  4QWT A;  2OTL 3;  1N9E A;  1A67 A;  1TIJ A;  3NV0 B;  4J9A A;  1YIJ 3;  2C10 A;  2V1L A;  5HGR A;  2XGN A;  1IVW A;  1JB4 A;  3FF0 A;  4EBG A;  3GRD A;  3SVA A;  1M90 4;  1N8Q A;  3PCS A;  3UNL A;  4FMA A;  3NHX A;  1Q42 A;  5IEN A;  2INX A;  1YVB I;  1G96 A;  4HM8 B;  1VQP 3;  2CIU A;  4MMY B;  1Q81 4;  4HM1 B;  1W5Z A;  4OK0 A;  4LEH A;  3PCR A;  1NO3 A;  3G8Z A;  3NV0 A;  5FGO A;  2IUJ A;  3S29 A;  5CF1 A;  4OUQ A;  1KQS 2;  1TUH A;  1DMQ A;  3FZW A;  2O9U X;  4N6T A;  1W2B 2;  3KFQ C;  4N6U A;  3IMA B;  5EEO A;  3QRD A;  1WQL B;  5IG3 A;  2P09 A;  1W2Z A;  1NWW A;  1CYU A;  3NQY A;  2LYX A;  2Z6B A;  3TDG A;  3MG1 A;  3PXM A;  2P38 A;  3LTA A;  3LTC A;  1QVG 2;  3UL6 A;  1Y4K A;  4HZB B;  3VSY A;  3N54 B;  1JN5 B;  3G0K A;  3DXO A;  1QMA A;  2BNG A;  1ROV A;  4O8S A;  1WNH A;  3WOE B;  2BT3 A;  3S67 A;  3O8Y A;  2BMQ B;  1NB3 I;  3CPO A;  3KSE D;  2F99 A;  2YX9 A;  3T0U A;  4HJL B;  1O7M B;  1U5O A;  3MYT A;  3STD A;  4H61 A;  4STD A;  4WFO A;  1JN5 A;  1D6U A;  8CHO A;  4MJD A;  5IF6 A;  5D81 A;  2HMO B;  3FSD A;  5AIG A;  3NX0 A;  4H3U A;  3V98 A;  3GZR A;  5BXQ A;  3NBB A;  1W4N A;  2XRX B;  4L8P A;  3EBT A;  1ZO2 A;  1MNL A;  1RJO A;  3AMO A;  1RRL A;  7STD A;  3B8L A;  2YFI B;  2CKF B;  4K1V A;  1UW1 A;  2HML B;  3GZB A;  1F8N A;  2CWU A;  2P0M A;  3LT9 A;  1STD A;  3F14 A;  1GYB A;  3KSP A;  1IQY A;  3EBY A;  3CXC 2;  2M7O A;  5STD A;  5KP1 A;  3F8X A;  2MC8 A;  1JKG B;  4WP5 A;  3G6E 3;  1ULJ B;  1IQ8 A;  4R4K A;  3BND A;  3FH1 A;  4KZ1 A;  3DY5 A;  4LGQ A;  2HMK B;  1EG9 B;  3G71 3;  1LXE A;  3FCS B;  1VQ7 3;  4FMC A;  3SXX A;  3RGA A;  2Z77 A;  2XFT A;  1ISK A;  4FCZ A;  4R1K A;  2QGU A;  1JKG A;  5AYS C;  3KZT A;  1YHQ 3;  2STD A;  3LTB A;  1IVX A;  4FMD A;  1SII A;  2HMJ B;  2XF3 A;  1Q40 B;  3OXA A;  1E97 A;  1GD3 A;  1LNH A;  1O7G B;  1OHS A;  1OF5 A;  2WO0 A;  3MG3 A;  4TX4 A;  1T5Y A;  5BVB A;  3U97 A;  3JUN A;  5LC6 A;  1AR0 A;  2HMM B;  5CF2 A;  3I56 3;  3HX8 A;  1FA3 A;  1ROA A;  5LC7 A;  4X2O A;  2XEP A;  1IDP A;  1Q40 A;  3DGO A;  3EN8 A;  1QVF 2;  4O3V A;  4RZM A;  1JB5 A;  1DMN A;  5DRE A;  2W56 B;  1GY7 A;  4XDV A;  1NJI 4;  3BNE A;  3PS8 A;  3CPW 2;  1JV2 B;  3NQZ A;  4XB5 A;  2BHM A;  1SIH A;  4HYZ A;  1WMN A;  1SQW A;  1QAK A;  3A76 A;  1O7N B;  4IT7 A;  1YI2 3;  3CCU 3;  4R9K A;  2W6J H;  3BNC A;  2PZV A;  2W56 A;  3X41 A;  1W7C A;  2WOH A;  1OHP A;  4ORL A;  4ZM8 A;  3JUP A;  2JDI H;  2XR8 B;  1OHO A;  3JVC A;  4L7K A;  1LOX A;  1N5P A;  1K8A 4;  3FF2 A;  2WGO A;  1RN7 A;  2XSO B;  5IG4 A;  1IV9 A;  1A2V A;  3CME 3;  1AV4 A;  3OWU A;  3WA3 A;  3OW2 2;  3F40 A;  2P0X A;  3F7X A;  1S72 3;  3UL5 A;  1TFO A;  4EXR A;  3F7S A;  1VQ6 3;  1CEW I;  1FGT A;  2W9P A;  2F98 A;  1WTH A;  5G2G A;  4AKY A;  4KVH A;  3DM8 A;  2Y74 A;  4GL6 A;  3CCM 3;  5AIH A;  3J7Y d;  1FGQ A;  3K9M C;  4MMX B;  4XDW A;  2CFW A;  2F86 B;  3H3H A;  4KFE A;  3CCS 3;  1NDO B;  3G16 A;  4NRE A;  3D9R A;  1IVV A;  3OX9 A;  1HU9 A;  2CH9 A;  1GS3 A;  2GEY A;  3ER7 A;  3N8B A;  4N6N B;  5D83 A;  3IPT A;  5CK6 A;  1Q86 4;  3S5C A;  3ECF A;  1YGE A;  2W0Q A;  1IVU A;  1N9J A;  1OGZ A;  4LSO A;  2CC3 A;  2W9Q A;  1YIT 3;  2ML6 A;  2ZL8 A;  5ELU A;  3CCJ 3;  2OQE C;  5AYR B;  2CFD A;  2BMO B;  3LYG A;  3G4S 3;  4FCM A;  2RFR A;  3PZW A;  4O2H A;  1K73 4;  1K28 A;  2YFL B;  4IPB A;  3NM7 A;  4XM4 A;  4LZI A;  4N6V 0;  4Q53 A;  5KP3 A;  1V74 A;  5AIF A;  1SJW A;  3CU3 A;  1L5G B;  5IG0 A;  3U1W A;  1N5H A;  3X3X A;  3CCE 3;  1VQ8 3;  3I0Y A;  3Q90 A;  1A90 A;  1MOL A;  1JRQ A;  1OPY A;  2I9W A;  3LTD A;  4MMZ B;  1IK3 A;  3LZA A;  3K5T A;  3CMA 3;  3MKI A;  3X3Z A;  2CG1 A;  3WDG B;  2KXG A;  3H51 A;  1GY6 A;  4XBY A;  3B4O A;  1Q82 4;  3NM2 A;  1D6Y A;  4MEI A;  4RBN A;  3DGN A;  1VQ5 3;  3FKA A;  5CXO A;  1Q7Y 4;  4HM3 B;  4FMB A;  1KC8 4;  1RKY A;  2OQE A;  3EE1 A;  1J2B A;  4HBR A;  2QIY A;  3EQQ B;  1K9M 4;  1E3R A;  4WWU C;  1OH0 A;  1OUN A;  2CFK A;  1CYV A;  1VQ4 3;  3FG1 A;  1Z1S A;  4AEQ A;  3WMD A;  1O7H B;  3MPH A;  5AEU B;  1ULI B;  1LVN A;  3UJM A;  3PYJ A;  4JF8 A;  3Q2P A;  1VZZ A;  2YFJ B;  1UI7 A;  1M9G A;  1DMM A;  2Q07 A;  2OWP A;  4WYK B;  3V99 A;  2E2T A;  3HI7 A;  3CC2 3;  1UI8 A;  1O7W B;  1KWI A;  3MSO A;  5KP4 A;  3CC7 3;  4HM7 B;  2ML5 A;  3N9H A;  4XBT A;  2GBX B;  2IA7 A;  3F8H A;  4G1M B;  4N6O B;  1FGO A;  4NHF A;  5DRV A;  1QAL A;  1YJ9 3;  1W6C A;  3FGY A;  3JUO A;  5IEO A;  1FGR A;  4WYK A;  5JPP A;  3D3L A;  3KII A;  2D1W A;  5IW9 A;  2OTJ 3;  3NXJ A;  1STF I;  3LH4 A;  3ALA A;  2XGL A;  1VQN 3;  3NBJ A;  3CC4 3;  4EC6 A;  3UB1 A;  4CDL A;  2E2U A;  1KD1 4;  1IQX A;  3LT8 A;  4K90 B;  3VGN A;  4EV5 A;  1OAC A;  1M1X B;  5EQL A;  4K1U A;  4R9L A;  2OCT A;  5IEP A;  4XBX A;  4JRF A;  2XFS A;  1M1K 4;  4R80 A;  2Y73 A;  1WMP A;  4CCV A;  3OWY A;  4L8O A;  4BTX A;  4PEJ A;  3T8N A;  3SED A;  1DVC A;  3EB8 A;  1TU5 A;  2HMN B;  3WA2 X;  2GU3 A;  1N8R 4;  1QAF A;  3SX1 A;  3I55 3;  4HZ9 B;  1NB5 I;  1PU4 A;  4OVM A;  2CK3 H;  5EVH A;  1W6Y A;  3GAX A;  5ELJ A;  1EQK A;  2Z7A A;  5JBS A;  5FW5 A;  1EKM A;  1KSI A;  1IU7 A;  3BLZ A;  1GD4 A;  3EF8 A;  4U13 A;  3OWS A;  3QK9 A;  2W03 A;  1IT8 A;  2GEX A;  3HZP A;  3FG3 A;  4N6M A;  2UX0 A;  3K7C A;  1W6G A;  4GB5 A;  2E2V A;  5AI1 A;  1VQ9 3;  1ASK A;  4HM6 B;  1TP6 A;  1AVL A;  3CCQ 3;  6STD A;  3JUM A;  2RCD A;  2MF7 A;  3BNB A;  3CNM A;  1YJW 3;  1US1 A;  3E99 A;  3HK4 A;  4BTW A;  3VF1 A;  2BMR B;  5IG5 A;  1HKX A;  1VQL 3;  2D42 A;  3FG4 A;  5TGN A;  1E3V A;  3EJV A;  3DMC A;  3CCV 3;  3NBR A;  3BB9 A;  2CW9 A;  3WOD G;  3B7C A;  4HM4 B;  2IUK A;  3X42 A;  1U8C B;  1IT7 A;  2XH9 A;  4J8T A;  1JJ2 2;  4N6L A;  1GY5 A;  2RSX A;  3NUV A;  4EYC A;  4FR9 A;  5A0O B;  3CD6 3;  2R4I A;  3EHC A;  1AVK A;  2ZDJ A;  5AII A;  4RNY A;  3V92 A;  3K0Z A;  2IMJ A;  3DUK A;  5D82 A;  1FUW A;  1EA2 A;  3IJE B;  2C11 A;  3AMO B;  3RDE A;  1VQM 3;  5CLK A;  2QEX 3;  3EX9 A;  3KN4 A;  1FGM A;  1S5A A;  4O02 B;  2KRT A;  1JB2 A;  3DGL A;  3OV4 A;  4EV2 A;  3FLJ A;  3LML A;  1WMO A;  1IV7 A;  3EC9 A;  4HM0 B;  2CWV A;  1TFK A;  1NU3 A;  1D6Z A;  2FGT A;  3DZL A;  3KKG A;  3ROB A;  2SBL A;  4I4K A;  1VQO 3;  1BUQ A;  3CNX A;  4KFD A;  3WOF B;  3EN1 B;  2W04 A;  4HVN A;  3SOY A;  2K54 A;  2RGQ A;  3F9S A;  2GBW B;  3L0R A;  5I97 A;  1YJN 3;  1ZX2 A;  2WGQ A;  3S27 A;  2XSH B;  4X2H A;  2WOF A;  4LMI A;  2OOV C;  3RGR A;  2QA4 3;  4HM2 B;  2A15 A;  1W01 A;  2KCD A;  1PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...