3CPW2

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cpw200
3CCV3 3CPW2 3CCE3 1K734 3CCL3 1VQP3 1M904 3CC43 3CD63 1N8R4 1K8A4 1VQ53 3CC23 1M1K4 1K9M4 3CCQ3 1QVG2 1KQS2 1VQN3 1YIJ3 1S723 3CCR3 1Q864 3CMA3 2QEX3 1YJ93 1VQ83 1YJW3 1QVF2 1VQ93 1NJI4 1VQ73 3CCM3 3CCS3 3OW22 1Q7Y4 1KD14 1YIT3 3G4S3 1VQ63 3G713 1YI23 1VQO3 3CXC2 1YHQ3 1YJN3 1VQM3 1VQK3 1W2B2 2OTJ3 3G6E3 1JJ22 3I563 3CC73 3I553 2QA43 1Q814 1Q824 1VQ43 3CCU3 3CCJ3 1VQL3 2OTL3 3CME3 1KC84
chains in the Genus database with same CATH superfamily
1RGKA 1GMQA 2GEXA 2ML5A 3T0UA 1T3BA 2F5MA 2XR8B 2XRXB 4IIAA 3X42A 6STDA 3WHOA 1FA3A 1C54A 1W2ZA 1FGRA 2F86B 4I4KA 1LQMB 1UCIA 4N6V0 1AR0A 3DH2A 3Q2PA 5BXQA 3DY5A 5GSPA 1GSPA 3SOAA 3B8LA 2RFRA 3ZG0A 1W01A 3AMOB 2W56A 5JPUA 1VQK3 2BHMA 1AV4A 2HOHA 3KFQC 5BIRA 1KWIA 1K28A 4N6NB 4LSOA 1RNBA 3NQYA 2CC3A 2BIRA 3H3HA 3WODG 1N9EA 1RGEA 3N9HA 1BUJA 4FCJA 3D9RA 3CCQ3 4XBTA 1UI8A 1J2BA 1GMRA 1SQWA 1OHSA 1UGHI 1V74A 3D79A 2IYJA 4XBYA 3UB1A 1E3RA 3WDGB 2INXA 3HX8A 3MG3A 2QEX3 1IV9A 1JKGB 3JUQA 3EB8A 3EX9A 2HMLB 3ECFA 3NX0A 3X40A 3FCSB 3RGAA 2CFWA 2GBXB 3EBTA 1STDA 3GWRA 3FSDA 3NV0B 1IK3A 1OF5A 1BRKA 1D6YA 1QMAA 1TRQA 2F4YA 2HMNB 1JN5B 3EE1A 3KCHA 1GMPA 2JQ5A 2OQEC 5AI1A 1VQM3 1BNSA 1TIJA 1I3IA 3JUPA 3HIIA 1V57A 2FXTA 2OTL3 1KC84 5ELJA 2PZVA 3F8HA 1BNEA 1EEJA 3GZYB 3LOYA 1B2MA 2R41A 4HZBB 2ML6A 1YGWA 3S5CA 3CC23 1GD3A 3JUOA 3X3XA 3B7CA 2RSXA 2RBIA 2YX9A 3S28A 1T2IA 1RNTA 1BSCA 3S67A 1B2UA 1IVUA 1NB5I 1LXEA 3K0ZA 1WNHA 1OGZA 4CJNA 1ZO2A 1NWWA 2Z77A 1STFI 4FMDA 4GHOA 1YIT3 2P38A 3LTAA 1SIIA 4OUQA 5AYRB 2WOHA 3MKIA 3LH4A 1UUVB 4KZ1A 1AY7A 1RHLA 4DKIA 3G16A 2W6JH 3F7XA 3FKAA 5EEOA 1QJGA 3G6E3 4BL3A 2F5WA 1JBSA 4KT3B 2GSPA 1FGOA 3FGYA 1I0XA 4HM0B 1IT7A 3H51A 8RNTA 5CF1A 3D5IA 4MMYB 1UGIA 3SLUA 1IDPA 1BU4A 1QALA 1R4YA 3AHSA 2MF7A 3K63A 3GAXA 8CHOA 1VQ83 4H3UA 4L7KA 4OVMA 1I8VA 5HGRA 1OPYA 4EW5A 3MHEA 4RNZA 1LOXA 3PXMA 1VQ73 2CFKA 1UUWB 3BNBA 2J8XB 2QGUA 2LYXA 4XM4A 5LC6A 3V99A 3UL5A 1OH0A 5IG0A 1JN5A 3DUKA 1VQ63 1JRQA 4BTXA 5BU4A 1VQO3 1RN4A 3OWUA 2P0MA 2KF3A 2I9WA 1G96A 5KP3A 4J8TA 4LGQA 3DGLA 1W6YA 5M1AA 2FGTA 3TDGA 7GSPA 2E2UA 4GSPA 4GL6A 1VQP3 1C7HA 1K8A4 4KFDA 1N5PA 4N6LA 1IVVA 2Q07A 2V1LA 1UW1A 3HI7A 4IPBA 2M7OA 1OGXA 1T5YA 3QK9A 5AIHA 1FUWA 2GU1A 1O7HB 3GZBA 1IV7A 1YNVX 1ZS7A 1LNIA 1PFPA 3URPA 5IERA 2BNGA 3G8ZA 3MWZA 6RNTA 2K54A 1LOYA 9RNTA 5IG4A 4IT7A 1LRAA 4LEHA 4R80A 3FZWA 3I0YA 1OF5B 1HZ1A 1BNJA 4HVNA 3RDEA 2XSOB 1W5ZA 2WOFA 5EVHA 5DRVA 2Z76A 1OCVA 2HMOB 3DGYA 3FG3A 4G1MB 3CCL3 2XGNA 1QAKA 5CXOA 1DYUA 1LOWA 3GRDA 4CDLA 3CNMA 1M9GA 5JPPA 4RBNA 3F8XA 2XEPA 1K41A 4J9AA 4N6TA 5KP4A 1TUHA 1ZGXA 1BSBA 1BRJA 5LC7A 3X3YA 3KSED 1RGLA 3BNDA 1YJ93 4K90B 1I0VA 2O9UX 5ELUA 2C10A 4H61A 4N6OB 1MGRA 2XGLA 3BNEA 2UGIA 4O02B 1BGSA 2BT3A 4HM7B 1RGGA 4LYLB 3G4S3 2O3OA 1JB4A 1AQZA 4MJDA 4BIRA 1G0TA 3K5TA 1GY7A 3LYGA 2YFJB 1YVSA 2CFGA 4MEIA 2CK3H 1VQQA 3I553 3Q1CA 1BRIA 3CU3A 1WMOA 3CCV3 1ASKA 2OOVC 1RGHA 4WWUC 1RCLA 3F7SA 1SPUA 4RZMA 3VF1A 3BNCA 1FUSA 2HMMB 1HKXA 5KP1A 3DZLA 4HM1B 3F40A 1W6CA 3J7Yd 3AGOA 2CW9A 4WHAA 2IA7A 5FW5A 2H0IA 4WFOA 2W04A 1MWUA 1YIJ3 1EG9B 2BMQB 2SARA 1FZUA 1A2PA 1SIHA 1A2KA 1S5AA 4R1KA 5AIGA 4BU4A 7STDA 4XBXA 3FLJA 1IYYA 5IEPA 1B2XA 3LT8A 3T8NA 1ROAA 4K1VA 3CCS3 1DMQA 2CHCA 2ZDJA 2OCTA 3EF8A 1YVBI 2BU4A 1L5GB 3STDA 2CFDA 2D1WA 5IG3A 2WGOA 3UL6A 3JUMA 3HK4A 4HM6B 4LZIA 3OX9A 3CCJ3 1CYUA 1TTOA 2F56A 1US1A 3PS8A 2P0XA 4STDA 1LQGC 3MG1A 1RN7A 5D82A 1RLSA 5TGNA 1M904 3NBRA 3DMCA 3LTDA 4BL2A 1I2EA 4TX4A 1IVXA 2C4BA 2P09A 3PGBA 2UX0A 5CF2A 3E99A 1PU4A 2IY2A 2OOVA 2H0GA 2ZA4A 3A5EA 3NBJA 1M1XB 4AEQA 2CG0A 3MG2A 3ROBA 3BLZA 2BO9B 3DGOA 3OW22 1Q7Y4 3D4AA 2CWUA 4FMBA 5IG5A 1BIRA 3EHCA 1N9JA 5EQLA 1W2B2 1B3SA 2K3DA 3SYUA 1RSNA 4ORLA 2W03A 1VQL3 3AGNA 4HKVB 3WA2X 5IEOA 4L8PA 3X3ZA 1CH0A 1O7GB 3B4PA 7RNTA 1NNVA 1RDSA 1GYBA 5G2GA 1N8R4 3PZWA 1RMSA 3VGNA 1W00A 3UJMA 2IUKA 1IQXA 2OWPA 4HYZA 4X2OA 1NDOB 3VSYA 1FGMA 2C11A 1I3FA 3CCR3 1W6GA 4WYKB 1YJW3 1NU3A 2W9PA 4BTWA 1EUIC 4NHFA 4AKYA 5FGOA 1RN1A 4J5KA 1X1UA 1GD4A 2XSHB 5JBSA 1O7PB 4EXRA 2R4IA 2B1XB 3G713 3EBYA 4RNYA 1A2VA 1BOXA 1X1XA 4QWTA 4KFEA 1O7MB 1JJ22 1W02A 2WO0A 3U97A 3K7CA 2KF6A 3MSOA 1Q9EA 2D42A 5RNTA 5D83A 4LMIA 3CCE3 1MWTA 1U5OA 4R4KA 2CWTA 1QAFA 2YFIB 1OUNA 3LTCA 1TFOA 3CD63 4JF8A 5G1LA 3M8CA 3IJEB 4I5QA 1K9M4 1M1K4 2P05A 5M18A 3NM7A 3BB9A 3JUNA 1KQS2 1GOYA 3EN1B 1E3VA 1VZZA 3NUVA 3LTBA 1RGAA 4N3VA 3K9MC 1LOVA 1TJDA 3B4OA 3S27A 5IF6A 3NQZA 4HJLB 3MPHA 3BU4A 1B27A 1EKMA 1GS3A 2CX1A 1BNFA 2IMJA 3HIGA 1X1WA 4O3VA 1O7NB 2B24B 5AIFA 2GBWB 5AEWB 1TFKA 1EQKA 5AYSC 2XF3A 4FCMA 4BTYA 2JDIH 3DGNA 1B21A 4N6UA 1Q814 1O7WB 4CPKA 1D6UA 3ALAA 3CPW2 4MMXB 1TRPA 1MGWA 1R4CA 1IVWA 2CX0A 1UI7A 3GZXB 3SEDA 5IENA 1JZOA 1N5HA 3KKGA 2Y73A 1PYLA 3OXAA 1ZX2A 4WYKA 1BAOA 1Y4KA 2GU3A 3CNXA 4XDWA 4U13A 2ZL8A 1JB2A 2CIUA 2CKFB 1CYVA 2H0HA 3ZG5A 4NPBA 4EYCA 1CEWI 1MWRA 3DGMA 1UDII 4XDVA 1KD14 1B2ZA 4NREA 1ULIB 4J5GA 3WA3A 3SOYA 1HU9A 3LMLA 6GSPA 1YHQ3 1OHOA 1T2HA 4HM2B 1YJN3 1NB3I 1EA2A 3AHWA 2YFLB 1LNHA 3IMAB 4WP5A 3EN8A 3SXXA 4RNTA 1DVDA 1BRNL 2L4VA 4GB5A 1JNQA 4EV5A 1AVKA 5DREA 3NBBA 1ISKA 5AIIA 1RTUA 4FR9A 3NHXA 3EQQB 2Z7AA 1MNLA 2AADA 1UUGB 1QVG2 1FW7A 1U8CB 3F14A 1I2GA 4HM8B 3CPOA 3N54B 1A90A 5CLKA 1MOLA 3CCM3 5G1KA 2RNTA 1HYFA 1RGFA 1RRLA 3BIRA 1NO3A 1DETA 1UCKA 3JVCA 1B2SA 2LQVA 4PEJA 3FF0A 1GOUA 5STDA 1BSEA 4X2HA 1WQLB 1KSIA 3UNLA 1K734 3KZTA 4OK0A 1Z1SA 2STDA 3V98A 3LZAA 4O2HA 1I70A 3N8BA 2F98A 2PNCA 5IW9A 1RRHA 1ULJB 1GOVA 1Q40B 3LXUX 1IQ8A 2KF4A 1UCJA 3EJVA 4HM4B 1BNGA 3X41A 3CMA3 4AKZA 4HOHA 3KIIA 1JV2B 2HMKB 4HM3B 4JRFA 1BRSA 1A67A 2AAEA 4HM5B 1WTHA 4O8SA 3S29A 3CXC2 2W0QA 4EC6A 1JBTA 2CWVA 1SARA 2CH9A 3CC73 1VQ43 1BSDA 2BMRB 2Y74A 1VQN3 3KN4A 3LT9A 5BVBA 4KFFA 1GY6A 3NXJA 3WOEB 1BSAA 2W9QA 1BUQA 1OACA 4MMZB 1VQ53 1FGQA 1RGCA 5M19A 1W7CA 3O8YA 1BRHA 3G0KA 1JZDA 1ROVA 2FNQA 3WMDA 1SJWA 2HMJB 3D5GA 3EC9A 4R9LA 2KRTA 3Q90A 2GXFA 1NJI4 3F9SA 3NM2A 4ILFA 3AMOA 4HBRA 1B20A 1DE3A 5AEUB 2CFLA 3PYJA 3RGRA 2RCDA 4FCZA 3FF2A 3OV4A 2ZHXB 2Z6BA 1FGTA 3QRDA 5D81A 2OTJ3 1IT8A 3DXOA 2RGQA 3MYTA 2GEYA 5A0OB 3FH1A 1RKYA 3I563 1CQSA 1G02A 1F8NA 1DMNA 1N8QA 2SBLA 2CG1A 2A15A 1FUTA 1DVCA 1Q40A 3KSPA 3OWSA 4K1UA 3SVAA 2OQEA 1IQYA 3CC43 4N6MA 1LVNA 3DM8A 1JKGA 1JBRA 1RCKA 3ZFZA 3T8UA 2K0MA 3IPTA 3U1WA 1S723 4ZM8A 1Q864 2XFTA 1AVLA 1WMPA 2KF5A 4EV2A 3FG1A 3NV0A 3GZRA 1YGEA 5CK6A 1VQ93 1QVF2 5I97A 2KCDA 2KAAA 1BNIA 4HAAA 1DMMA 1FYSA 1E97A 2E2TA 1BNRA 4Q53A 2IUJA 4HZ9B 4XB5A 4L8OA 3KE7A 1Q824 2UUGC 1BVIA 2KXGA 2F99A 2W56B 2WGQA 3GSPA 3CME3 3ER7A 1UCLA 3OWYA 4R9KA 4FMCA 4KVHA 1RJOA 2BMOB 3RNTA 2XFSA 1Q7HA 2E2VA 3L0RA 1Q42A 1PY3A 1TP6A 2QIYA 3Q3FA 5HOHA 4CCVA 3SX1A 3WOFB 1MWSA 1W4NA 1D6ZA 4FMAA 4K61A 3HZPA 1V58A 3WR2A 3PCSA 1OHPA 2XH9A 3PCRA 2L1SA 3D3LA 1WMNA 1YI23 1IU7A 3A76A 1BANA 2MC8A 3V92A 1I2FA 1X1YA 1JB5A 2W2CA 1BRGA 1GY5A 3HOHA 4EBGA 1TU5A 3CCU3 3FG4A 2QA43
chains in the Genus database with same CATH topology
2GEXA 2ML5A 3T0UA 2XR8B 2XRXB 4IIAA 3X42A 6STDA 1FA3A 1W2ZA 1FGRA 2F86B 4I4KA 4N6V0 1AR0A 3Q2PA 5BXQA 3DY5A 3SOAA 3B8LA 2RFRA 1W01A 3AMOB 2W56A 5JPUA 1VQK3 2BHMA 1AV4A 3KFQC 1KWIA 1K28A 4N6NB 4LSOA 3NQYA 2CC3A 3H3HA 3WODG 1N9EA 3N9HA 4FCJA 3D9RA 3CCQ3 4XBTA 1UI8A 1J2BA 1SQWA 1OHSA 1V74A 3WDGB 4XBYA 3UB1A 1E3RA 2INXA 3HX8A 3MG3A 2QEX3 1IV9A 1JKGB 3JUQA 3EB8A 3EX9A 2HMLB 3ECFA 3NX0A 3X40A 3FCSB 3RGAA 2CFWA 2GBXB 3EBTA 1STDA 3GWRA 3FSDA 3NV0B 1IK3A 1OF5A 1D6YA 1QMAA 3EE1A 1VQM3 2HMNB 1JN5B 2OQEC 2JQ5A 5AI1A 1TIJA 3JUPA 3HIIA 2FXTA 2OTL3 1KC84 5ELJA 2PZVA 3F8HA 3GZYB 3LOYA 4HZBB 2ML6A 3S5CA 3CC23 1GD3A 3JUOA 3X3XA 3B7CA 2RSXA 2YX9A 3S28A 3S67A 1IVUA 1NB5I 1LXEA 3K0ZA 1WNHA 1OGZA 1ZO2A 1NWWA 2Z77A 1STFI 4FMDA 1YIT3 2P38A 3LTAA 1SIIA 4OUQA 5AYRB 2WOHA 3MKIA 3LH4A 1UUVB 4KZ1A 3G16A 2W6JH 3F7XA 3FKAA 5EEOA 1QJGA 3G6E3 1FGOA 3FGYA 4HM0B 1IT7A 3H51A 5CF1A 4MMYB 3SLUA 1IDPA 1QALA 2MF7A 3K63A 3GAXA 8CHOA 1VQ83 4H3UA 4L7KA 4OVMA 5HGRA 1OPYA 3MHEA 4RNZA 1LOXA 3PXMA 1VQ73 2CFKA 1UUWB 3BNBA 4XM4A 2QGUA 2LYXA 5LC6A 3V99A 3UL5A 1OH0A 5IG0A 1JN5A 3DUKA 1VQ63 1JRQA 4BTXA 1VQO3 3OWUA 2P0MA 2I9WA 1G96A 5KP3A 4J8TA 4LGQA 3DGLA 1W6YA 3TDGA 2FGTA 2E2UA 4GL6A 1VQP3 1C7HA 1K8A4 4KFDA 1N5PA 4N6LA 1IVVA 2Q07A 2V1LA 1UW1A 3HI7A 4IPBA 2M7OA 1OGXA 1T5YA 3QK9A 5AIHA 1FUWA 2GU1A 1O7HB 3GZBA 1IV7A 1PFPA 5IERA 2BNGA 3G8ZA 3MWZA 2K54A 5IG4A 4IT7A 4LEHA 4R80A 3FZWA 3I0YA 1OF5B 4HVNA 3RDEA 2XSOB 1W5ZA 2WOFA 5EVHA 5DRVA 2Z76A 1OCVA 2HMOB 3FG3A 4G1MB 3CCL3 2XGNA 1QAKA 5CXOA 1DYUA 3GRDA 4CDLA 3CNMA 1M9GA 5JPPA 4RBNA 3F8XA 2XEPA 1K41A 4J9AA 4N6TA 5KP4A 1TUHA 5LC7A 3X3YA 3KSED 1YJ93 3BNDA 4K90B 5ELUA 2O9UX 2C10A 4H61A 4N6OB 4O02B 2XGLA 3BNEA 2BT3A 4HM7B 3G4S3 2O3OA 1JB4A 4MJDA 3K5TA 1GY7A 3LYGA 2YFJB 2CFGA 4MEIA 2CK3H 3I553 3Q1CA 3CU3A 1WMOA 3CCV3 1ASKA 2OOVC 4WWUC 3F7SA 1SPUA 4RZMA 3VF1A 3BNCA 2HMMB 1HKXA 5KP1A 3DZLA 4HM1B 3F40A 1W6CA 3J7Yd 2CW9A 4WHAA 2IA7A 5FW5A 4WFOA 2W04A 1YIJ3 1EG9B 2BMQB 1SIHA 1A2KA 1S5AA 4R1KA 5AIGA 7STDA 4XBXA 3FLJA 5IEPA 3LT8A 3T8NA 1ROAA 4K1VA 3CCS3 1DMQA 2CHCA 2ZDJA 2OCTA 3EF8A 1YVBI 1L5GB 3STDA 2CFDA 2D1WA 5IG3A 2WGOA 3UL6A 3JUMA 3HK4A 4HM6B 4LZIA 3OX9A 3CCJ3 1CYUA 1US1A 3PS8A 2P0XA 4STDA 3MG1A 1RN7A 5D82A 5TGNA 1M904 3NBRA 3DMCA 3LTDA 4TX4A 1IVXA 2P09A 3PGBA 2UX0A 5CF2A 3E99A 1PU4A 2OOVA 3NBJA 1M1XB 4AEQA 2CG0A 3MG2A 3ROBA 3BLZA 2BO9B 3DGOA 3OW22 1Q7Y4 2CWUA 4FMBA 5IG5A 3EHCA 1N9JA 5EQLA 1W2B2 4ORLA 2W03A 1VQL3 4HKVB 3WA2X 5IEOA 4L8PA 3X3ZA 1O7GB 3B4PA 1GYBA 5G2GA 1N8R4 3PZWA 3VGNA 1W00A 3UJMA 2IUKA 1IQXA 2OWPA 4HYZA 4X2OA 1NDOB 3VSYA 1FGMA 2C11A 3CCR3 1W6GA 4WYKB 1YJW3 1NU3A 2W9PA 4BTWA 4NHFA 4AKYA 5FGOA 1GD4A 2XSHB 5JBSA 1O7PB 4EXRA 2R4IA 2B1XB 3G713 3EBYA 4RNYA 1A2VA 4QWTA 4KFEA 1O7MB 1JJ22 1W02A 2WO0A 3U97A 3K7CA 3MSOA 2D42A 5D83A 4LMIA 3CCE3 1U5OA 4R4KA 2CWTA 1QAFA 2YFIB 1OUNA 3LTCA 1TFOA 3CD63 4JF8A 3M8CA 3IJEB 1M1K4 1K9M4 2P05A 3NM7A 3BB9A 3JUNA 1KQS2 3EN1B 1E3VA 1VZZA 3NUVA 3LTBA 3S27A 4N3VA 3K9MC 3B4OA 5IF6A 3NQZA 4HJLB 3MPHA 1EKMA 1GS3A 2IMJA 3HIGA 4O3VA 1O7NB 2B24B 5AIFA 2GBWB 5AEWB 1TFKA 1EQKA 5AYSC 2XF3A 4FCMA 4BTYA 2JDIH 3DGNA 4N6UA 1Q814 1O7WB 1D6UA 3ALAA 3CPW2 4MMXB 1R4CA 1IVWA 1UI7A 3GZXB 3SEDA 5IENA 1N5HA 3KKGA 2Y73A 3OXAA 1ZX2A 4WYKA 1Y4KA 2GU3A 3CNXA 4XDWA 4U13A 2ZL8A 2CKFB 1JB2A 2CIUA 1CYVA 4EYCA 1CEWI 3DGMA 4XDVA 1KD14 4NREA 1ULIB 3WA3A 3SOYA 1HU9A 3LMLA 1YHQ3 1OHOA 1YJN3 4HM2B 1NB3I 1EA2A 1DVDA 2YFLB 1LNHA 3IMAB 4WP5A 3EN8A 3SXXA 2L4VA 4GB5A 1JNQA 4EV5A 1AVKA 5DREA 3NBBA 1ISKA 5AIIA 4FR9A 3NHXA 3EQQB 2Z7AA 1MNLA 1QVG2 1U8CB 3F14A 4HM8B 3CPOA 3N54B 1A90A 5CLKA 1MOLA 3CCM3 1RRLA 1NO3A 3JVCA 2LQVA 4PEJA 3FF0A 5STDA 4X2HA 1WQLB 1KSIA 3UNLA 1K734 3KZTA 4OK0A 1Z1SA 2STDA 3V98A 3LZAA 4O2HA 3N8BA 2F98A 2PNCA 5IW9A 1RRHA 1ULJB 1Q40B 3LXUX 1IQ8A 3EJVA 4HM4B 3X41A 3CMA3 4AKZA 3KIIA 1JV2B 2HMKB 4HM3B 4JRFA 1A67A 4HM5B 1WTHA 4O8SA 3S29A 3CXC2 2W0QA 4EC6A 2CWVA 3CC73 2CH9A 1VQ43 2BMRB 2Y74A 1VQN3 3KN4A 3LT9A 5BVBA 4KFFA 1GY6A 3NXJA 3WOEB 2W9QA 1BUQA 1OACA 4MMZB 1VQ53 1FGQA 1W7CA 3O8YA 3G0KA 1ROVA 2FNQA 3WMDA 1SJWA 2HMJB 3EC9A 4R9LA 2KRTA 3Q90A 2GXFA 1NJI4 3F9SA 3NM2A 3AMOA 4HBRA 5AEUB 2CFLA 3PYJA 3RGRA 2RCDA 4FCZA 3FF2A 3OV4A 2Z6BA 1FGTA 3QRDA 5D81A 2OTJ3 1IT8A 3DXOA 2RGQA 3MYTA 2GEYA 5A0OB 3FH1A 1RKYA 3I563 1CQSA 1F8NA 1DMNA 1N8QA 2SBLA 2CG1A 2A15A 3KSPA 1DVCA 1Q40A 3OWSA 3SVAA 4K1UA 2OQEA 1IQYA 3CC43 4N6MA 1LVNA 3DM8A 1JKGA 3T8UA 2K0MA 3IPTA 3U1WA 1S723 4ZM8A 1Q864 2XFTA 1AVLA 1WMPA 4EV2A 1QVF2 3FG1A 3NV0A 3GZRA 1YGEA 5CK6A 1VQ93 5I97A 2KCDA 1DMMA 1E97A 2E2TA 4Q53A 2IUJA 4HZ9B 4XB5A 4L8OA 3KE7A 1Q824 2KXGA 2F99A 2W56B 2WGQA 3CME3 3ER7A 3OWYA 4R9KA 4FMCA 4KVHA 1RJOA 2BMOB 2XFSA 2E2VA 3L0RA 1Q42A 2QIYA 1TP6A 4CCVA 3SX1A 3WOFB 1W4NA 1D6ZA 4FMAA 4K61A 3HZPA 3PCSA 1OHPA 2XH9A 3PCRA 3D3LA 1WMNA 1YI23 1IU7A 3A76A 2MC8A 3V92A 1JB5A 2W2CA 2QA43 1GY5A 4EBGA 1TU5A 3CCU3 3FG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV 3;  3CPW 2;  3CCE 3;  1K73 4;  3CCL 3;  1VQP 3;  1M90 4;  3CC4 3;  3CD6 3;  1N8R 4;  1K8A 4;  1VQ5 3;  3CC2 3;  1M1K 4;  1K9M 4;  3CCQ 3;  1QVG 2;  1KQS 2;  1VQN 3;  1YIJ 3;  1S72 3;  3CCR 3;  1Q86 4;  3CMA 3;  2QEX 3;  1YJ9 3;  1VQ8 3;  1YJW 3;  1QVF 2;  1VQ9 3;  1NJI 4;  1VQ7 3;  3CCM 3;  3CCS 3;  3OW2 2;  1Q7Y 4;  1KD1 4;  1YIT 3;  3G4S 3;  1VQ6 3;  3G71 3;  1YI2 3;  1VQO 3;  3CXC 2;  1YHQ 3;  1YJN 3;  1VQM 3;  1VQK 3;  1W2B 2;  2OTJ 3;  3G6E 3;  1JJ2 2;  3I56 3;  3CC7 3;  3I55 3;  2QA4 3;  1Q81 4;  1Q82 4;  1VQ4 3;  3CCU 3;  3CCJ 3;  1VQL 3;  2OTL 3;  3CME 3;  1KC8 4; 
#chains in the Genus database with same CATH topology
 1RGK A;  1GMQ A;  2GEX A;  2ML5 A;  3T0U A;  1T3B A;  2F5M A;  2XR8 B;  2XRX B;  4IIA A;  3X42 A;  6STD A;  3WHO A;  1FA3 A;  1C54 A;  1W2Z A;  1FGR A;  2F86 B;  4I4K A;  1LQM B;  1UCI A;  4N6V 0;  1AR0 A;  3DH2 A;  3Q2P A;  5BXQ A;  3DY5 A;  5GSP A;  1GSP A;  3SOA A;  3B8L A;  2RFR A;  3ZG0 A;  1W01 A;  3AMO B;  2W56 A;  5JPU A;  1VQK 3;  2BHM A;  1AV4 A;  2HOH A;  3KFQ C;  5BIR A;  1KWI A;  1K28 A;  4N6N B;  4LSO A;  1RNB A;  3NQY A;  2CC3 A;  2BIR A;  3H3H A;  3WOD G;  1N9E A;  1RGE A;  3N9H A;  1BUJ A;  4FCJ A;  3D9R A;  3CCQ 3;  4XBT A;  1UI8 A;  1J2B A;  1GMR A;  1SQW A;  1OHS A;  1UGH I;  1V74 A;  3D79 A;  2IYJ A;  4XBY A;  3UB1 A;  1E3R A;  3WDG B;  2INX A;  3HX8 A;  3MG3 A;  2QEX 3;  1IV9 A;  1JKG B;  3JUQ A;  3EB8 A;  3EX9 A;  2HML B;  3ECF A;  3NX0 A;  3X40 A;  3FCS B;  3RGA A;  2CFW A;  2GBX B;  3EBT A;  1STD A;  3GWR A;  3FSD A;  3NV0 B;  1IK3 A;  1OF5 A;  1BRK A;  1D6Y A;  1QMA A;  1TRQ A;  2F4Y A;  2HMN B;  1JN5 B;  3EE1 A;  3KCH A;  1GMP A;  2JQ5 A;  2OQE C;  5AI1 A;  1VQM 3;  1BNS A;  1TIJ A;  1I3I A;  3JUP A;  3HII A;  1V57 A;  2FXT A;  2OTL 3;  1KC8 4;  5ELJ A;  2PZV A;  3F8H A;  1BNE A;  1EEJ A;  3GZY B;  3LOY A;  1B2M A;  2R41 A;  4HZB B;  2ML6 A;  1YGW A;  3S5C A;  3CC2 3;  1GD3 A;  3JUO A;  3X3X A;  3B7C A;  2RSX A;  2RBI A;  2YX9 A;  3S28 A;  1T2I A;  1RNT A;  1BSC A;  3S67 A;  1B2U A;  1IVU A;  1NB5 I;  1LXE A;  3K0Z A;  1WNH A;  1OGZ A;  4CJN A;  1ZO2 A;  1NWW A;  2Z77 A;  1STF I;  4FMD A;  4GHO A;  1YIT 3;  2P38 A;  3LTA A;  1SII A;  4OUQ A;  5AYR B;  2WOH A;  3MKI A;  3LH4 A;  1UUV B;  4KZ1 A;  1AY7 A;  1RHL A;  4DKI A;  3G16 A;  2W6J H;  3F7X A;  3FKA A;  5EEO A;  1QJG A;  3G6E 3;  4BL3 A;  2F5W A;  1JBS A;  4KT3 B;  2GSP A;  1FGO A;  3FGY A;  1I0X A;  4HM0 B;  1IT7 A;  3H51 A;  8RNT A;  5CF1 A;  3D5I A;  4MMY B;  1UGI A;  3SLU A;  1IDP A;  1BU4 A;  1QAL A;  1R4Y A;  3AHS A;  2MF7 A;  3K63 A;  3GAX A;  8CHO A;  1VQ8 3;  4H3U A;  4L7K A;  4OVM A;  1I8V A;  5HGR A;  1OPY A;  4EW5 A;  3MHE A;  4RNZ A;  1LOX A;  3PXM A;  1VQ7 3;  2CFK A;  1UUW B;  3BNB A;  2J8X B;  2QGU A;  2LYX A;  4XM4 A;  5LC6 A;  3V99 A;  3UL5 A;  1OH0 A;  5IG0 A;  1JN5 A;  3DUK A;  1VQ6 3;  1JRQ A;  4BTX A;  5BU4 A;  1VQO 3;  1RN4 A;  3OWU A;  2P0M A;  2KF3 A;  2I9W A;  1G96 A;  5KP3 A;  4J8T A;  4LGQ A;  3DGL A;  1W6Y A;  5M1A A;  2FGT A;  3TDG A;  7GSP A;  2E2U A;  4GSP A;  4GL6 A;  1VQP 3;  1C7H A;  1K8A 4;  4KFD A;  1N5P A;  4N6L A;  1IVV A;  2Q07 A;  2V1L A;  1UW1 A;  3HI7 A;  4IPB A;  2M7O A;  1OGX A;  1T5Y A;  3QK9 A;  5AIH A;  1FUW A;  2GU1 A;  1O7H B;  3GZB A;  1IV7 A;  1YNV X;  1ZS7 A;  1LNI A;  1PFP A;  3URP A;  5IER A;  2BNG A;  3G8Z A;  3MWZ A;  6RNT A;  2K54 A;  1LOY A;  9RNT A;  5IG4 A;  4IT7 A;  1LRA A;  4LEH A;  4R80 A;  3FZW A;  3I0Y A;  1OF5 B;  1HZ1 A;  1BNJ A;  4HVN A;  3RDE A;  2XSO B;  1W5Z A;  2WOF A;  5EVH A;  5DRV A;  2Z76 A;  1OCV A;  2HMO B;  3DGY A;  3FG3 A;  4G1M B;  3CCL 3;  2XGN A;  1QAK A;  5CXO A;  1DYU A;  1LOW A;  3GRD A;  4CDL A;  3CNM A;  1M9G A;  5JPP A;  4RBN A;  3F8X A;  2XEP A;  1K41 A;  4J9A A;  4N6T A;  5KP4 A;  1TUH A;  1ZGX A;  1BSB A;  1BRJ A;  5LC7 A;  3X3Y A;  3KSE D;  1RGL A;  3BND A;  1YJ9 3;  4K90 B;  1I0V A;  2O9U X;  5ELU A;  2C10 A;  4H61 A;  4N6O B;  1MGR A;  2XGL A;  3BNE A;  2UGI A;  4O02 B;  1BGS A;  2BT3 A;  4HM7 B;  1RGG A;  4LYL B;  3G4S 3;  2O3O A;  1JB4 A;  1AQZ A;  4MJD A;  4BIR A;  1G0T A;  3K5T A;  1GY7 A;  3LYG A;  2YFJ B;  1YVS A;  2CFG A;  4MEI A;  2CK3 H;  1VQQ A;  3I55 3;  3Q1C A;  1BRI A;  3CU3 A;  1WMO A;  3CCV 3;  1ASK A;  2OOV C;  1RGH A;  4WWU C;  1RCL A;  3F7S A;  1SPU A;  4RZM A;  3VF1 A;  3BNC A;  1FUS A;  2HMM B;  1HKX A;  5KP1 A;  3DZL A;  4HM1 B;  3F40 A;  1W6C A;  3J7Y d;  3AGO A;  2CW9 A;  4WHA A;  2IA7 A;  5FW5 A;  2H0I A;  4WFO A;  2W04 A;  1MWU A;  1YIJ 3;  1EG9 B;  2BMQ B;  2SAR A;  1FZU A;  1A2P A;  1SIH A;  1A2K A;  1S5A A;  4R1K A;  5AIG A;  4BU4 A;  7STD A;  4XBX A;  3FLJ A;  1IYY A;  5IEP A;  1B2X A;  3LT8 A;  3T8N A;  1ROA A;  4K1V A;  3CCS 3;  1DMQ A;  2CHC A;  2ZDJ A;  2OCT A;  3EF8 A;  1YVB I;  2BU4 A;  1L5G B;  3STD A;  2CFD A;  2D1W A;  5IG3 A;  2WGO A;  3UL6 A;  3JUM A;  3HK4 A;  4HM6 B;  4LZI A;  3OX9 A;  3CCJ 3;  1CYU A;  1TTO A;  2F56 A;  1US1 A;  3PS8 A;  2P0X A;  4STD A;  1LQG C;  3MG1 A;  1RN7 A;  5D82 A;  1RLS A;  5TGN A;  1M90 4;  3NBR A;  3DMC A;  3LTD A;  4BL2 A;  1I2E A;  4TX4 A;  1IVX A;  2C4B A;  2P09 A;  3PGB A;  2UX0 A;  5CF2 A;  3E99 A;  1PU4 A;  2IY2 A;  2OOV A;  2H0G A;  2ZA4 A;  3A5E A;  3NBJ A;  1M1X B;  4AEQ A;  2CG0 A;  3MG2 A;  3ROB A;  3BLZ A;  2BO9 B;  3DGO A;  3OW2 2;  1Q7Y 4;  3D4A A;  2CWU A;  4FMB A;  5IG5 A;  1BIR A;  3EHC A;  1N9J A;  5EQL A;  1W2B 2;  1B3S A;  2K3D A;  3SYU A;  1RSN A;  4ORL A;  2W03 A;  1VQL 3;  3AGN A;  4HKV B;  3WA2 X;  5IEO A;  4L8P A;  3X3Z A;  1CH0 A;  1O7G B;  3B4P A;  7RNT A;  1NNV A;  1RDS A;  1GYB A;  5G2G A;  1N8R 4;  3PZW A;  1RMS A;  3VGN A;  1W00 A;  3UJM A;  2IUK A;  1IQX A;  2OWP A;  4HYZ A;  4X2O A;  1NDO B;  3VSY A;  1FGM A;  2C11 A;  1I3F A;  3CCR 3;  1W6G A;  4WYK B;  1YJW 3;  1NU3 A;  2W9P A;  4BTW A;  1EUI C;  4NHF A;  4AKY A;  5FGO A;  1RN1 A;  4J5K A;  1X1U A;  1GD4 A;  2XSH B;  5JBS A;  1O7P B;  4EXR A;  2R4I A;  2B1X B;  3G71 3;  3EBY A;  4RNY A;  1A2V A;  1BOX A;  1X1X A;  4QWT A;  4KFE A;  1O7M B;  1JJ2 2;  1W02 A;  2WO0 A;  3U97 A;  3K7C A;  2KF6 A;  3MSO A;  1Q9E A;  2D42 A;  5RNT A;  5D83 A;  4LMI A;  3CCE 3;  1MWT A;  1U5O A;  4R4K A;  2CWT A;  1QAF A;  2YFI B;  1OUN A;  3LTC A;  1TFO A;  3CD6 3;  4JF8 A;  5G1L A;  3M8C A;  3IJE B;  4I5Q A;  1K9M 4;  1M1K 4;  2P05 A;  5M18 A;  3NM7 A;  3BB9 A;  3JUN A;  1KQS 2;  1GOY A;  3EN1 B;  1E3V A;  1VZZ A;  3NUV A;  3LTB A;  1RGA A;  4N3V A;  3K9M C;  1LOV A;  1TJD A;  3B4O A;  3S27 A;  5IF6 A;  3NQZ A;  4HJL B;  3MPH A;  3BU4 A;  1B27 A;  1EKM A;  1GS3 A;  2CX1 A;  1BNF A;  2IMJ A;  3HIG A;  1X1W A;  4O3V A;  1O7N B;  2B24 B;  5AIF A;  2GBW B;  5AEW B;  1TFK A;  1EQK A;  5AYS C;  2XF3 A;  4FCM A;  4BTY A;  2JDI H;  3DGN A;  1B21 A;  4N6U A;  1Q81 4;  1O7W B;  4CPK A;  1D6U A;  3ALA A;  3CPW 2;  4MMX B;  1TRP A;  1MGW A;  1R4C A;  1IVW A;  2CX0 A;  1UI7 A;  3GZX B;  3SED A;  5IEN A;  1JZO A;  1N5H A;  3KKG A;  2Y73 A;  1PYL A;  3OXA A;  1ZX2 A;  4WYK A;  1BAO A;  1Y4K A;  2GU3 A;  3CNX A;  4XDW A;  4U13 A;  2ZL8 A;  1JB2 A;  2CIU A;  2CKF B;  1CYV A;  2H0H A;  3ZG5 A;  4NPB A;  4EYC A;  1CEW I;  1MWR A;  3DGM A;  1UDI I;  4XDV A;  1KD1 4;  1B2Z A;  4NRE A;  1ULI B;  4J5G A;  3WA3 A;  3SOY A;  1HU9 A;  3LML A;  6GSP A;  1YHQ 3;  1OHO A;  1T2H A;  4HM2 B;  1YJN 3;  1NB3 I;  1EA2 A;  3AHW A;  2YFL B;  1LNH A;  3IMA B;  4WP5 A;  3EN8 A;  3SXX A;  4RNT A;  1DVD A;  1BRN L;  2L4V A;  4GB5 A;  1JNQ A;  4EV5 A;  1AVK A;  5DRE A;  3NBB A;  1ISK A;  5AII A;  1RTU A;  4FR9 A;  3NHX A;  3EQQ B;  2Z7A A;  1MNL A;  2AAD A;  1UUG B;  1QVG 2;  1FW7 A;  1U8C B;  3F14 A;  1I2G A;  4HM8 B;  3CPO A;  3N54 B;  1A90 A;  5CLK A;  1MOL A;  3CCM 3;  5G1K A;  2RNT A;  1HYF A;  1RGF A;  1RRL A;  3BIR A;  1NO3 A;  1DET A;  1UCK A;  3JVC A;  1B2S A;  2LQV A;  4PEJ A;  3FF0 A;  1GOU A;  5STD A;  1BSE A;  4X2H A;  1WQL B;  1KSI A;  3UNL A;  1K73 4;  3KZT A;  4OK0 A;  1Z1S A;  2STD A;  3V98 A;  3LZA A;  4O2H A;  1I70 A;  3N8B A;  2F98 A;  2PNC A;  5IW9 A;  1RRH A;  1ULJ B;  1GOV A;  1Q40 B;  3LXU X;  1IQ8 A;  2KF4 A;  1UCJ A;  3EJV A;  4HM4 B;  1BNG A;  3X41 A;  3CMA 3;  4AKZ A;  4HOH A;  3KII A;  1JV2 B;  2HMK B;  4HM3 B;  4JRF A;  1BRS A;  1A67 A;  2AAE A;  4HM5 B;  1WTH A;  4O8S A;  3S29 A;  3CXC 2;  2W0Q A;  4EC6 A;  1JBT A;  2CWV A;  1SAR A;  2CH9 A;  3CC7 3;  1VQ4 3;  1BSD A;  2BMR B;  2Y74 A;  1VQN 3;  3KN4 A;  3LT9 A;  5BVB A;  4KFF A;  1GY6 A;  3NXJ A;  3WOE B;  1BSA A;  2W9Q A;  1BUQ A;  1OAC A;  4MMZ B;  1VQ5 3;  1FGQ A;  1RGC A;  5M19 A;  1W7C A;  3O8Y A;  1BRH A;  3G0K A;  1JZD A;  1ROV A;  2FNQ A;  3WMD A;  1SJW A;  2HMJ B;  3D5G A;  3EC9 A;  4R9L A;  2KRT A;  3Q90 A;  2GXF A;  1NJI 4;  3F9S A;  3NM2 A;  4ILF A;  3AMO A;  4HBR A;  1B20 A;  1DE3 A;  5AEU B;  2CFL A;  3PYJ A;  3RGR A;  2RCD A;  4FCZ A;  3FF2 A;  3OV4 A;  2ZHX B;  2Z6B A;  1FGT A;  3QRD A;  5D81 A;  2OTJ 3;  1IT8 A;  3DXO A;  2RGQ A;  3MYT A;  2GEY A;  5A0O B;  3FH1 A;  1RKY A;  3I56 3;  1CQS A;  1G02 A;  1F8N A;  1DMN A;  1N8Q A;  2SBL A;  2CG1 A;  2A15 A;  1FUT A;  1DVC A;  1Q40 A;  3KSP A;  3OWS A;  4K1U A;  3SVA A;  2OQE A;  1IQY A;  3CC4 3;  4N6M A;  1LVN A;  3DM8 A;  1JKG A;  1JBR A;  1RCK A;  3ZFZ A;  3T8U A;  2K0M A;  3IPT A;  3U1W A;  1S72 3;  4ZM8 A;  1Q86 4;  2XFT A;  1AVL A;  1WMP A;  2KF5 A;  4EV2 A;  3FG1 A;  3NV0 A;  3GZR A;  1YGE A;  5CK6 A;  1VQ9 3;  1QVF 2;  5I97 A;  2KCD A;  2KAA A;  1BNI A;  4HAA A;  1DMM A;  1FYS A;  1E97 A;  2E2T A;  1BNR A;  4Q53 A;  2IUJ A;  4HZ9 B;  4XB5 A;  4L8O A;  3KE7 A;  1Q82 4;  2UUG C;  1BVI A;  2KXG A;  2F99 A;  2W56 B;  2WGQ A;  3GSP A;  3CME 3;  3ER7 A;  1UCL A;  3OWY A;  4R9K A;  4FMC A;  4KVH A;  1RJO A;  2BMO B;  3RNT A;  2XFS A;  1Q7H A;  2E2V A;  3L0R A;  1Q42 A;  1PY3 A;  1TP6 A;  2QIY A;  3Q3F A;  5HOH A;  4CCV A;  3SX1 A;  3WOF B;  1MWS A;  1W4N A;  1D6Z A;  4FMA A;  4K61 A;  3HZP A;  1V58 A;  3WR2 A;  3PCS A;  1OHP A;  2XH9 A;  3PCR A;  2L1S A;  3D3L A;  1WMN A;  1YI2 3;  1IU7 A;  3A76 A;  1BAN A;  2MC8 A;  3V92 A;  1I2F A;  1X1Y A;  1JB5 A;  2W2C A;  1BRG A;  1GY5 A;  3HOH A;  4EBG A;  1TU5 A;  3CCU 3;  3FG4 A;  2QA4 3; 
#chains in the Genus database with same CATH homology
 2GEX A;  2ML5 A;  3T0U A;  2XR8 B;  2XRX B;  4IIA A;  3X42 A;  6STD A;  1FA3 A;  1W2Z A;  1FGR A;  2F86 B;  4I4K A;  4N6V 0;  1AR0 A;  3Q2P A;  5BXQ A;  3DY5 A;  3SOA A;  3B8L A;  2RFR A;  1W01 A;  3AMO B;  2W56 A;  5JPU A;  1VQK 3;  2BHM A;  1AV4 A;  3KFQ C;  1KWI A;  1K28 A;  4N6N B;  4LSO A;  3NQY A;  2CC3 A;  3H3H A;  3WOD G;  1N9E A;  3N9H A;  4FCJ A;  3D9R A;  3CCQ 3;  4XBT A;  1UI8 A;  1J2B A;  1SQW A;  1OHS A;  1V74 A;  3WDG B;  4XBY A;  3UB1 A;  1E3R A;  2INX A;  3HX8 A;  3MG3 A;  2QEX 3;  1IV9 A;  1JKG B;  3JUQ A;  3EB8 A;  3EX9 A;  2HML B;  3ECF A;  3NX0 A;  3X40 A;  3FCS B;  3RGA A;  2CFW A;  2GBX B;  3EBT A;  1STD A;  3GWR A;  3FSD A;  3NV0 B;  1IK3 A;  1OF5 A;  1D6Y A;  1QMA A;  3EE1 A;  1VQM 3;  2HMN B;  1JN5 B;  2OQE C;  2JQ5 A;  5AI1 A;  1TIJ A;  3JUP A;  3HII A;  2FXT A;  2OTL 3;  1KC8 4;  5ELJ A;  2PZV A;  3F8H A;  3GZY B;  3LOY A;  4HZB B;  2ML6 A;  3S5C A;  3CC2 3;  1GD3 A;  3JUO A;  3X3X A;  3B7C A;  2RSX A;  2YX9 A;  3S28 A;  3S67 A;  1IVU A;  1NB5 I;  1LXE A;  3K0Z A;  1WNH A;  1OGZ A;  1ZO2 A;  1NWW A;  2Z77 A;  1STF I;  4FMD A;  1YIT 3;  2P38 A;  3LTA A;  1SII A;  4OUQ A;  5AYR B;  2WOH A;  3MKI A;  3LH4 A;  1UUV B;  4KZ1 A;  3G16 A;  2W6J H;  3F7X A;  3FKA A;  5EEO A;  1QJG A;  3G6E 3;  1FGO A;  3FGY A;  4HM0 B;  1IT7 A;  3H51 A;  5CF1 A;  4MMY B;  3SLU A;  1IDP A;  1QAL A;  2MF7 A;  3K63 A;  3GAX A;  8CHO A;  1VQ8 3;  4H3U A;  4L7K A;  4OVM A;  5HGR A;  1OPY A;  3MHE A;  4RNZ A;  1LOX A;  3PXM A;  1VQ7 3;  2CFK A;  1UUW B;  3BNB A;  4XM4 A;  2QGU A;  2LYX A;  5LC6 A;  3V99 A;  3UL5 A;  1OH0 A;  5IG0 A;  1JN5 A;  3DUK A;  1VQ6 3;  1JRQ A;  4BTX A;  1VQO 3;  3OWU A;  2P0M A;  2I9W A;  1G96 A;  5KP3 A;  4J8T A;  4LGQ A;  3DGL A;  1W6Y A;  3TDG A;  2FGT A;  2E2U A;  4GL6 A;  1VQP 3;  1C7H A;  1K8A 4;  4KFD A;  1N5P A;  4N6L A;  1IVV A;  2Q07 A;  2V1L A;  1UW1 A;  3HI7 A;  4IPB A;  2M7O A;  1OGX A;  1T5Y A;  3QK9 A;  5AIH A;  1FUW A;  2GU1 A;  1O7H B;  3GZB A;  1IV7 A;  1PFP A;  5IER A;  2BNG A;  3G8Z A;  3MWZ A;  2K54 A;  5IG4 A;  4IT7 A;  4LEH A;  4R80 A;  3FZW A;  3I0Y A;  1OF5 B;  4HVN A;  3RDE A;  2XSO B;  1W5Z A;  2WOF A;  5EVH A;  5DRV A;  2Z76 A;  1OCV A;  2HMO B;  3FG3 A;  4G1M B;  3CCL 3;  2XGN A;  1QAK A;  5CXO A;  1DYU A;  3GRD A;  4CDL A;  3CNM A;  1M9G A;  5JPP A;  4RBN A;  3F8X A;  2XEP A;  1K41 A;  4J9A A;  4N6T A;  5KP4 A;  1TUH A;  5LC7 A;  3X3Y A;  3KSE D;  1YJ9 3;  3BND A;  4K90 B;  5ELU A;  2O9U X;  2C10 A;  4H61 A;  4N6O B;  4O02 B;  2XGL A;  3BNE A;  2BT3 A;  4HM7 B;  3G4S 3;  2O3O A;  1JB4 A;  4MJD A;  3K5T A;  1GY7 A;  3LYG A;  2YFJ B;  2CFG A;  4MEI A;  2CK3 H;  3I55 3;  3Q1C A;  3CU3 A;  1WMO A;  3CCV 3;  1ASK A;  2OOV C;  4WWU C;  3F7S A;  1SPU A;  4RZM A;  3VF1 A;  3BNC A;  2HMM B;  1HKX A;  5KP1 A;  3DZL A;  4HM1 B;  3F40 A;  1W6C A;  3J7Y d;  2CW9 A;  4WHA A;  2IA7 A;  5FW5 A;  4WFO A;  2W04 A;  1YIJ 3;  1EG9 B;  2BMQ B;  1SIH A;  1A2K A;  1S5A A;  4R1K A;  5AIG A;  7STD A;  4XBX A;  3FLJ A;  5IEP A;  3LT8 A;  3T8N A;  1ROA A;  4K1V A;  3CCS 3;  1DMQ A;  2CHC A;  2ZDJ A;  2OCT A;  3EF8 A;  1YVB I;  1L5G B;  3STD A;  2CFD A;  2D1W A;  5IG3 A;  2WGO A;  3UL6 A;  3JUM A;  3HK4 A;  4HM6 B;  4LZI A;  3OX9 A;  3CCJ 3;  1CYU A;  1US1 A;  3PS8 A;  2P0X A;  4STD A;  3MG1 A;  1RN7 A;  5D82 A;  5TGN A;  1M90 4;  3NBR A;  3DMC A;  3LTD A;  4TX4 A;  1IVX A;  2P09 A;  3PGB A;  2UX0 A;  5CF2 A;  3E99 A;  1PU4 A;  2OOV A;  3NBJ A;  1M1X B;  4AEQ A;  2CG0 A;  3MG2 A;  3ROB A;  3BLZ A;  2BO9 B;  3DGO A;  3OW2 2;  1Q7Y 4;  2CWU A;  4FMB A;  5IG5 A;  3EHC A;  1N9J A;  5EQL A;  1W2B 2;  4ORL A;  2W03 A;  1VQL 3;  4HKV B;  3WA2 X;  5IEO A;  4L8P A;  3X3Z A;  1O7G B;  3B4P A;  1GYB A;  5G2G A;  1N8R 4;  3PZW A;  3VGN A;  1W00 A;  3UJM A;  2IUK A;  1IQX A;  2OWP A;  4HYZ A;  4X2O A;  1NDO B;  3VSY A;  1FGM A;  2C11 A;  3CCR 3;  1W6G A;  4WYK B;  1YJW 3;  1NU3 A;  2W9P A;  4BTW A;  4NHF A;  4AKY A;  5FGO A;  1GD4 A;  2XSH B;  5JBS A;  1O7P B;  4EXR A;  2R4I A;  2B1X B;  3G71 3;  3EBY A;  4RNY A;  1A2V A;  4QWT A;  4KFE A;  1O7M B;  1JJ2 2;  1W02 A;  2WO0 A;  3U97 A;  3K7C A;  3MSO A;  2D42 A;  5D83 A;  4LMI A;  3CCE 3;  1U5O A;  4R4K A;  2CWT A;  1QAF A;  2YFI B;  1OUN A;  3LTC A;  1TFO A;  3CD6 3;  4JF8 A;  3M8C A;  3IJE B;  1M1K 4;  1K9M 4;  2P05 A;  3NM7 A;  3BB9 A;  3JUN A;  1KQS 2;  3EN1 B;  1E3V A;  1VZZ A;  3NUV A;  3LTB A;  3S27 A;  4N3V A;  3K9M C;  3B4O A;  5IF6 A;  3NQZ A;  4HJL B;  3MPH A;  1EKM A;  1GS3 A;  2IMJ A;  3HIG A;  4O3V A;  1O7N B;  2B24 B;  5AIF A;  2GBW B;  5AEW B;  1TFK A;  1EQK A;  5AYS C;  2XF3 A;  4FCM A;  4BTY A;  2JDI H;  3DGN A;  4N6U A;  1Q81 4;  1O7W B;  1D6U A;  3ALA A;  3CPW 2;  4MMX B;  1R4C A;  1IVW A;  1UI7 A;  3GZX B;  3SED A;  5IEN A;  1N5H A;  3KKG A;  2Y73 A;  3OXA A;  1ZX2 A;  4WYK A;  1Y4K A;  2GU3 A;  3CNX A;  4XDW A;  4U13 A;  2ZL8 A;  2CKF B;  1JB2 A;  2CIU A;  1CYV A;  4EYC A;  1CEW I;  3DGM A;  4XDV A;  1KD1 4;  4NRE A;  1ULI B;  3WA3 A;  3SOY A;  1HU9 A;  3LML A;  1YHQ 3;  1OHO A;  1YJN 3;  4HM2 B;  1NB3 I;  1EA2 A;  1DVD A;  2YFL B;  1LNH A;  3IMA B;  4WP5 A;  3EN8 A;  3SXX A;  2L4V A;  4GB5 A;  1JNQ A;  4EV5 A;  1AVK A;  5DRE A;  3NBB A;  1ISK A;  5AII A;  4FR9 A;  3NHX A;  3EQQ B;  2Z7A A;  1MNL A;  1QVG 2;  1U8C B;  3F14 A;  4HM8 B;  3CPO A;  3N54 B;  1A90 A;  5CLK A;  1MOL A;  3CCM 3;  1RRL A;  1NO3 A;  3JVC A;  2LQV A;  4PEJ A;  3FF0 A;  5STD A;  4X2H A;  1WQL B;  1KSI A;  3UNL A;  1K73 4;  3KZT A;  4OK0 A;  1Z1S A;  2STD A;  3V98 A;  3LZA A;  4O2H A;  3N8B A;  2F98 A;  2PNC A;  5IW9 A;  1RRH A;  1ULJ B;  1Q40 B;  3LXU X;  1IQ8 A;  3EJV A;  4HM4 B;  3X41 A;  3CMA 3;  4AKZ A;  3KII A;  1JV2 B;  2HMK B;  4HM3 B;  4JRF A;  1A67 A;  4HM5 B;  1WTH A;  4O8S A;  3S29 A;  3CXC 2;  2W0Q A;  4EC6 A;  2CWV A;  3CC7 3;  2CH9 A;  1VQ4 3;  2BMR B;  2Y74 A;  1VQN 3;  3KN4 A;  3LT9 A;  5BVB A;  4KFF A;  1GY6 A;  3NXJ A;  3WOE B;  2W9Q A;  1BUQ A;  1OAC A;  4MMZ B;  1VQ5 3;  1FGQ A;  1W7C A;  3O8Y A;  3G0K A;  1ROV A;  2FNQ A;  3WMD A;  1SJW A;  2HMJ B;  3EC9 A;  4R9L A;  2KRT A;  3Q90 A;  2GXF A;  1NJI 4;  3F9S A;  3NM2 A;  3AMO A;  4HBR A;  5AEU B;  2CFL A;  3PYJ A;  3RGR A;  2RCD A;  4FCZ A;  3FF2 A;  3OV4 A;  2Z6B A;  1FGT A;  3QRD A;  5D81 A;  2OTJ 3;  1IT8 A;  3DXO A;  2RGQ A;  3MYT A;  2GEY A;  5A0O B;  3FH1 A;  1RKY A;  3I56 3;  1CQS A;  1F8N A;  1DMN A;  1N8Q A;  2SBL A;  2CG1 A;  2A15 A;  3KSP A;  1DVC A;  1Q40 A;  3OWS A;  3SVA A;  4K1U A;  2OQE A;  1IQY A;  3CC4 3;  4N6M A;  1LVN A;  3DM8 A;  1JKG A;  3T8U A;  2K0M A;  3IPT A;  3U1W A;  1S72 3;  4ZM8 A;  1Q86 4;  2XFT A;  1AVL A;  1WMP A;  4EV2 A;  1QVF 2;  3FG1 A;  3NV0 A;  3GZR A;  1YGE A;  5CK6 A;  1VQ9 3;  5I97 A;  2KCD A;  1DMM A;  1E97 A;  2E2T A;  4Q53 A;  2IUJ A;  4HZ9 B;  4XB5 A;  4L8O A;  3KE7 A;  1Q82 4;  2KXG A;  2F99 A;  2W56 B;  2WGQ A;  3CME 3;  3ER7 A;  3OWY A;  4R9K A;  4FMC A;  4KVH A;  1RJO A;  2BMO B;  2XFS A;  2E2V A;  3L0R A;  1Q42 A;  2QIY A;  1TP6 A;  4CCV A;  3SX1 A;  3WOF B;  1W4N A;  1D6Z A;  4FMA A;  4K61 A;  3HZP A;  3PCS A;  1OHP A;  2XH9 A;  3PCR A;  3D3L A;  1WMN A;  1YI2 3;  1IU7 A;  3A76 A;  2MC8 A;  3V92 A;  1JB5 A;  2W2C A;  2QA4 3;  1GY5 A;  4EBG A;  1TU5 A;  3CCU 3;  3FG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...