3CPW2

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cpw200
1VQN3 1VQ43 3I553 3CC23 1NJI4 1Q7Y4 3CCQ3 3G4S3 3I563 1QVF2 1VQP3 1VQK3 1VQM3 1VQ83 3CCR3 2OTL3 3CXC2 3CME3 3CPW2 1VQ63 3CD63 1YIJ3 1YIT3 1K8A4 3CC43 3G6E3 1VQO3 1QVG2 1KQS2 1M904 1JJ22 2QEX3 1Q824 1Q864 1K9M4 1N8R4 3CCV3 1YJ93 3G713 1KC84 3CMA3 1KD14 3CCE3 1YJW3 3OW22 1S723 3CCL3 2OTJ3 3CCU3 1VQ73 1YJN3 3CCM3 1YI23 1Q814 1W2B2 1VQ53 2QA43 1M1K4 1VQ93 3CC73 1YHQ3 1K734 3CCJ3 1VQL3 3CCS3
chains in the Genus database with same CATH superfamily
1DE3A 1BSBA 3H51A 3K7CA 5JPPA 5JBSA 4L8OA 5D81A 3KKGA 1LQMB 5KP1A 3X3XA 8RNTA 1X1XA 1DMQA 3X41A 3GSPA 1BRIA 5STDA 4KT3B 1SJWA 2F86B 1STFI 2QEX3 1LQGC 3MPHA 1O7WB 1N8R4 1K41A 1B2ZA 8CHOA 7RNTA 2IUKA 1RCKA 1MWSA 5D83A 3T8UA 1IV9A 1HU9A 1OHSA 1RGGA 1RRLA 2W03A 1BRHA 3BNCA 2OTJ3 1A67A 1C54A 5FW5A 1BRKA 1YI23 3NV0B 4CDLA 4G1MB 4HM1B 1BUJA 6STDA 1SIIA 3Q3FA 1FGQA 4U13A 2L4VA 4N6MA 3FSDA 4EC6A 1KWIA 1K28A 1DMNA 1GY6A 1TFKA 1FUSA 2CFWA 1OPYA 2C4BA 1UCKA 1I70A 1SPUA 3GZRA 1ZGXA 1JKGB 3EN8A 1NNVA 3U1WA 3KFQC 1IT7A 1M1XB 4HM0B 1Q40A 1YIJ3 4O2HA 3CD63 1BSEA 2BHMA 1OGXA 4O3VA 1UUVB 1PY3A 4ZM8A 4WP5A 3AMOA 1L5GB 1I3IA 1W6GA 1T2HA 3HK4A 1Q42A 4O02B 1I2EA 1BRSA 3MYTA 4K1VA 4RNTA 3MHEA 3D5GA 1W00A 2GBXB 3JUQA 1IQYA 2CWTA 1RGFA 3GAXA 3HIIA 4GHOA 3LOYA 1ISKA 3URPA 1OH0A 2ZA4A 1Q7HA 3SXXA 1LVNA 2IA7A 1R4CA 1AQZA 3DGLA 3UB1A 3WOEB 1UI7A 1N5HA 1FGRA 3CCQ3 2R4IA 4BL3A 5BU4A 6RNTA 2CX0A 2P09A 3Q1CA 3BNDA 1RGHA 3GZYB 1FZUA 4XDWA 2IMJA 3ZG0A 1JBTA 3S29A 3DGMA 3UL6A 4WWUC 2XRXB 1YIT3 4CJNA 1RRHA 3Q90A 5EVHA 1RGLA 4FMCA 1TU5A 1B2SA 2HMJB 2KF4A 3OV4A 3PXMA 2KXGA 5TGNA 4BL2A 2HMLB 3CCE3 3DMCA 5HGRA 3K5TA 2CHCA 2WOFA 3HZPA 2BMQB 4L8PA 1VZZA 1JNQA 1B3SA 2STDA 2W6JH 3L0RA 4EV2A 1UCJA 3FF2A 1DETA 2W2CA 3D3LA 3V92A 3ZFZA 1IT8A 4H61A 2KF3A 1FGOA 4K90B 1Q7Y4 1A2PA 2K0MA 2RBIA 4ILFA 5DRVA 3HOHA 3OX9A 3UL5A 1NU3A 2KF6A 3EHCA 1W7CA 2SARA 2WGOA 3HI7A 4HOHA 3SVAA 1BOXA 2P0MA 1EEJA 3LTCA 1LXEA 1KQS2 4HAAA 4K61A 5FGOA 2BO9B 2F5MA 1GOYA 4HM2B 4PEJA 3IMAB 3JUPA 4EV5A 4N6NB 3F8HA 3A76A 1O7NB 1T2IA 3K0ZA 3FG3A 1DVCA 1BU4A 4BU4A 2GBWB 3WMDA 3NM7A 4N6OB 4N6LA 5AI1A 5BIRA 1BNEA 1ROVA 2XSHB 5IG5A 4JRFA 3EX9A 3KE7A 1PU4A 2LYXA 1IK3A 4IIAA 1QAKA 2I9WA 1ZX2A 3K9MC 1VQK3 1RNTA 1RGCA 1WMPA 1DMMA 4J9AA 3KZTA 1JJ22 2E2UA 3CCV3 3O8YA 3LTBA 2CFGA 2C10A 2F5WA 3AHWA 3BU4A 1LOWA 5IG3A 1BSAA 2XEPA 2F98A 3B4OA 2QA43 4AKYA 5A0OB 4HM5B 1BNJA 4EYCA 1I0XA 1Z1SA 3QRDA 4N6V0 3RGAA 5IERA 1WMNA 2W04A 2KF5A 2YFLB 4R1KA 3SOAA 1N5PA 3LT8A 4IT7A 1IVWA 1TRPA 3HX8A 1PFPA 1BVIA 4MMZB 1GD3A 1G02A 4KFDA 4GB5A 1BUQA 2UUGC 1MNLA 2ZDJA 7GSPA 4MJDA 1GOVA 4O8SA 3GWRA 2B1XB 1S723 2CWUA 1BIRA 1Q40B 1W01A 1GYBA 3MG1A 1TIJA 4RNYA 3VF1A 3NUVA 4AKZA 3IJEB 2BMRB 2KAAA 2Z6BA 2K3DA 4NREA 4I5QA 1KSIA 1O7MB 2CW9A 3S67A 4HM6B 1MGWA 2M7OA 1FW7A 5IEPA 2OOVC 4HM4B 2C11A 3VSYA 1I2GA 1BRGA 1ULJB 2HMNB 4ORLA 2OQEA 1NO3A 4HZBB 2KRTA 2QIYA 2R41A 5ELJA 3MG2A 1HKXA 1OCVA 2GXFA 3FKAA 3VGNA 1VQ63 3FG1A 3F8XA 3F7SA 5KP3A 4FMDA 1RN1A 1UI8A 1IVVA 1O7HB 2CC3A 3CMA3 2ML6A 3JVCA 3G713 1YJ93 2K54A 1NB5I 1CYVA 2RFRA 3CCU3 1ROAA 2D1WA 3M8CA 1A2KA 4N6UA 1VQ93 3LYGA 1BNRA 1HZ1A 2KCDA 5G1LA 1EA2A 1BGSA 4HVNA 1SIHA 1VQL3 3F9SA 4HJLB 1PYLA 1TTOA 1NJI4 2HMOB 2FXTA 2CH9A 1QVF2 1X1WA 2HOHA 3STDA 3WOFB 1VQ83 1V74A 3CXC2 1MWRA 3CPW2 4J5KA 2JQ5A 5EQLA 3DUKA 4WHAA 1X1YA 1MWUA 1DVDA 1JZOA 4NHFA 4K1UA 3GZXB 3ZG5A 2W9QA 1NDOB 1W02A 2BNGA 4XM4A 1RGEA 2CKFB 2OCTA 3NHXA 4XBXA 5ELUA 4HM8B 4BIRA 2P38A 1YJN3 3DGYA 1UDII 3EBTA 4RNZA 3CU3A 3CCM3 5HOHA 1N9JA 3S27A 5AEUB 4KZ1A 3EQQB 3PGBA 4HYZA 1OF5A 2CIUA 1YGEA 1LNHA 1YGWA 4KFFA 6GSPA 1LRAA 1UGHI 1BNGA 1U5OA 2JDIH 3T0UA 3B7CA 1MOLA 3UNLA 1CH0A 2H0IA 3J7Yd 2ML5A 3CCR3 3RDEA 2BMOB 2YX9A 3HIGA 3KSPA 4FR9A 1WQLB 4N6TA 3BNBA 3D79A 3ER7A 3FGYA 2XSOB 1GY5A 1YVSA 1ZO2A 2IY2A 3OWUA 1B2XA 1RN4A 2W0QA 1YJW3 1CEWI 2W56A 4FMBA 4CCVA 3E99A 1EUIC 2XR8B 5M18A 3LT9A 3N54B 1JRQA 5RNTA 4N3VA 5IF6A 1M1K4 1BAOA 3WODG 3LH4A 4R4KA 1K734 3FLJA 1AVLA 1IQXA 1YVBI 5JPUA 3F7XA 1VQ43 1EG9B 2XFTA 3CNMA 3DH2A 1AR0A 1IYYA 1S5AA 1BSDA 4HM7B 1ASKA 2AADA 1I8VA 3OXAA 3SLUA 1NWWA 1I2FA 1W5ZA 3K63A 3T8NA 1NB3I 5LC7A 1M904 1AVKA 5IG0A 1K9M4 2XF3A 3DXOA 3LXUX 3V99A 2E2TA 2FGTA 1G0TA 1T3BA 4RBNA 4WYKA 5EEOA 3OW22 3FH1A 3WR2A 1GMPA 3EC9A 2ZHXB 2RCDA 9RNTA 5BVBA 5CXOA 1FGTA 1B2MA 3FF0A 3FZWA 3Q2PA 1GOUA 4X2HA 2UGIA 2YFJB 2SBLA 4H3UA 4XBTA 5LC6A 4EXRA 1LOXA 1QAFA 1LOVA 3B4PA 1OHPA 1O7GB 1E3VA 1W2ZA 4LGQA 1WMOA 4RZMA 1D6UA 1ULIB 1BNIA 1IV7A 2GEXA 3EF8A 3OWSA 5G1KA 3CC43 2CFLA 1RLSA 1QVG2 7STDA 2O9UX 1D6YA 3FCSB 1YNVX 3G0KA 3N8BA 2PNCA 3KCHA 1FUTA 2MF7A 1W6YA 3CCL3 2WOHA 5M19A 1OACA 4FMAA 2W9PA 1I0VA 2A15A 2J8XB 1DYUA 1GY7A 4OK0A 3AMOB 5IEOA 1JBRA 5AIGA 4J8TA 2BIRA 1RGAA 1GS3A 2H0GA 2BU4A 4J5GA 1US1A 2AAEA 1HYFA 1UCLA 3UJMA 1SQWA 3V98A 3G4S3 3F14A 3MSOA 1JN5A 2F56A 4EBGA 1E3RA 3BIRA 1RSNA 2CG0A 1W4NA 1N8QA 2OQEC 4XB5A 3NQYA 3G6E3 1OHOA 3ECFA 1Q824 2CG1A 1Q864 3EN1B 5D82A 3D9RA 3EJVA 3SOYA 2OOVA 3S28A 1C7HA 3X3YA 1EKMA 1VQQA 1BANA 1JB5A 2UX0A 3LZAA 3MKIA 1RCLA 1TJDA 2XH9A 3GRDA 4LYLB 4MMYB 1G96A 4XBYA 3WA3A 2Z76A 1O7PB 3CC73 3PCRA 1N9EA 3FG4A 1BNFA 1YHQ3 2L1SA 1FGMA 3CCS3 2P0XA 1AV4A 2HMMB 3QK9A 1VQN3 1FA3A 3G8ZA 2O3OA 3NX0A 4LEHA 5M1AA 1RKYA 1VQP3 1E97A 2XFSA 3NBRA 3WHOA 1VQM3 1OF5B 3D5IA 3OWYA 2F99A 1CQSA 2ZL8A 3BNEA 4GSPA 3BLZA 1QALA 5DREA 1GMRA 3B8LA 3DY5A 4IPBA 2GU1A 4HBRA 1JB2A 1LOYA 3LMLA 2IYJA 3IPTA 3EB8A 3NV0A 1QJGA 3G16A 3NBBA 3WDGB 3TDGA 1IU7A 1FYSA 4XDVA 5CLKA 1V58A 1MWTA 1BNSA 3PS8A 4LZIA 5AYRB 3KSED 2F4YA 3DGOA 1WNHA 4HKVB 4FCJA 3LTDA 3D4AA 3F40A 1BRNL 1A2VA 1TUHA 3ALAA 1FUWA 3CCJ3 4FCZA 2W56B 1M9GA 1JKGA 1RJOA 1B2UA 4BTWA 3NXJA 3ROBA 3I553 3CC23 1GD4A 2GEYA 3AGOA 1UCIA 1UUWB 3GZBA 3LTAA 3KN4A 2CWVA 2Z7AA 3I0YA 1RMSA 3CME3 3DGNA 1B20A 1UUGB 4X2OA 3SYUA 1RGKA 4TX4A 1JBSA 1D6ZA 2IUJA 3DZLA 4QWTA 4DKIA 1QMAA 2PZVA 2QGUA 4MMXB 2OWPA 1JZDA 3CNXA 3KIIA 4I4KA 2D42A 4NPBA 5AIIA 2YFIB 4EW5A 3X40A 2P05A 4BTYA 2INXA 1Q814 3NM2A 1W2B2 4GL6A 2BT3A 3NQZA 4BTXA 1V57A 4LSOA 2E2VA 4CPKA 2Y74A 4OVMA 4WYKB 1TRQA 4AEQA 1RTUA 2H0HA 2XGLA 2HMKB 2XGNA 3NBJA 1T5YA 4KVHA 1BSCA 2B24B 3A5EA 3AGNA 1WTHA 1RN7A 1STDA 1IDPA 3BB9A 4Q53A 2RSXA 1MGRA 2Q07A 5G2GA 1OGZA 3EBYA 4STDA 3PCSA 4OUQA 1X1UA 1VQO3 1A90A 4JF8A 2GSPA 2FNQA 5KP4A 5AIFA 1B27A 1UGIA 1W6CA 1Y4KA 3RGRA 3SX1A 3U97A 1AY7A 5AYSC 4WFOA 2WGQA 2MC8A 1BRJA 3PYJA 5AIHA 3EE1A 1IVUA 2CX1A 3DM8A 5CF1A 1R4YA 1TP6A 4FCMA 3JUMA 4L7KA 3AHSA 2Z77A 1SARA 4KFEA 3SEDA 1Q9EA 4R9LA 2CK3H 1F8NA 2LQVA 4HZ9B 1UW1A 1I3FA 5AEWB 3I563 5GSPA 1B21A 4LMIA 2Y73A 1J2BA 2OTL3 5CK6A 2V1LA 1RDSA 1ZS7A 3H3HA 1OUNA 1CYUA 1K8A4 1EQKA 1IQ8A 3JUNA 3MG3A 3MWZA 4MEIA 1JN5B 1GSPA 1RHLA 2RGQA 5I97A 5BXQA 1KC84 1KD14 5IG4A 2CFKA 5CF2A 5IENA 1GMQA 4HM3B 1VQ73 3WA2X 1IVXA 2CFDA 1U8CB 3CPOA 3X3ZA 3N9HA 1TFOA 4R80A 1VQ53 3S5CA 1LNIA 5IW9A 2RNTA 4R9KA 1JB4A 2GU3A 1JV2B 3JUOA 3X42A 3RNTA 1RNBA 3PZWA 2WO0A
chains in the Genus database with same CATH topology
3H51A 3K7CA 5JPPA 5JBSA 4L8OA 5D81A 3KKGA 5KP1A 3X3XA 1DMQA 3X41A 5STDA 1SJWA 2F86B 1STFI 2QEX3 3MPHA 1O7WB 1N8R4 1K41A 8CHOA 2IUKA 5D83A 3T8UA 1IV9A 1HU9A 1OHSA 2OTJ3 1RRLA 2W03A 3BNCA 1A67A 5FW5A 1YI23 3NV0B 4CDLA 4G1MB 4HM1B 6STDA 1SIIA 1FGQA 4U13A 2L4VA 4N6MA 3FSDA 4EC6A 1KWIA 1K28A 1DMNA 1GY6A 1TFKA 2CFWA 1OPYA 3GZRA 1SPUA 1JKGB 3EN8A 3U1WA 3KFQC 1IT7A 1M1XB 4HM0B 1Q40A 1YIJ3 4O2HA 3CD63 2BHMA 1OGXA 4O3VA 1UUVB 4ZM8A 4WP5A 3AMOA 1L5GB 1W6GA 4O02B 3HK4A 1Q42A 3MYTA 4K1VA 3MHEA 1W00A 2GBXB 3JUQA 1IQYA 2CWTA 3GAXA 3HIIA 3LOYA 1ISKA 1OH0A 3SXXA 1LVNA 2IA7A 1R4CA 3WOEB 3DGLA 3UB1A 1UI7A 1N5HA 1FGRA 3CCQ3 2R4IA 2P09A 3Q1CA 3BNDA 3GZYB 4XDWA 2IMJA 3S29A 3DGMA 3UL6A 4WWUC 2XRXB 1YIT3 1RRHA 3Q90A 5EVHA 4FMCA 1TU5A 2HMJB 3PXMA 3CCE3 3OV4A 2KXGA 5TGNA 2HMLB 3DMCA 5HGRA 3K5TA 2CHCA 2WOFA 3HZPA 2BMQB 4L8PA 1VZZA 1JNQA 2W6JH 2STDA 3L0RA 4EV2A 3FF2A 2W2CA 3D3LA 3V92A 1IT8A 4H61A 4K90B 1FGOA 1Q7Y4 2K0MA 5DRVA 3OX9A 3UL5A 1NU3A 3EHCA 1W7CA 2WGOA 3HI7A 3SVAA 2P0MA 3LTCA 1LXEA 1KQS2 4K61A 5FGOA 2BO9B 4PEJA 4HM2B 4EV5A 3IMAB 3JUPA 4N6NB 3F8HA 3A76A 1O7NB 3K0ZA 3FG3A 1DVCA 2GBWB 3WMDA 3NM7A 4N6OB 4N6LA 5AI1A 5IG5A 1ROVA 2XSHB 4JRFA 3EX9A 3KE7A 1PU4A 2LYXA 1IK3A 4IIAA 1QAKA 2I9WA 1ZX2A 3K9MC 1VQK3 1WMPA 1DMMA 4J9AA 3KZTA 1JJ22 2E2UA 3CCV3 3O8YA 3LTBA 2CFGA 2C10A 5IG3A 2XEPA 2F98A 3B4OA 2QA43 4AKYA 5A0OB 4HM5B 4EYCA 1Z1SA 3QRDA 4N6V0 3RGAA 5IERA 1WMNA 2W04A 2YFLB 4R1KA 3SOAA 1N5PA 3LT8A 4IT7A 1IVWA 3HX8A 1PFPA 4MMZB 1GD3A 4KFDA 4GB5A 1BUQA 1MNLA 2ZDJA 4MJDA 4O8SA 3GWRA 2B1XB 1S723 2CWUA 1Q40B 1W01A 1GYBA 3MG1A 1TIJA 4RNYA 3VF1A 3NUVA 4AKZA 3IJEB 2BMRB 2Z6BA 4NREA 1KSIA 1O7MB 2CW9A 3S67A 4HM6B 2M7OA 5IEPA 2OOVC 4HM4B 2C11A 3VSYA 1ULJB 2OQEA 2HMNB 4ORLA 1NO3A 4HZBB 2KRTA 2QIYA 5ELJA 3MG2A 1HKXA 1OCVA 2GXFA 3FKAA 3VGNA 1VQ63 3FG1A 3F8XA 3F7SA 5KP3A 4FMDA 1UI8A 1IVVA 1O7HB 2CC3A 3CMA3 2ML6A 3JVCA 3G713 1YJ93 2K54A 1NB5I 1CYVA 2RFRA 3CCU3 1ROAA 2D1WA 3M8CA 1A2KA 4N6UA 1VQ93 3LYGA 2KCDA 1EA2A 4HVNA 1SIHA 1VQL3 3F9SA 4HJLB 1NJI4 2HMOB 2FXTA 2CH9A 1QVF2 3STDA 3WOFB 1VQ83 1V74A 3CXC2 3CPW2 2JQ5A 5EQLA 3DUKA 4WHAA 1DVDA 4NHFA 4K1UA 3GZXB 2W9QA 1NDOB 1W02A 2BNGA 4XM4A 2CKFB 2OCTA 3NHXA 4XBXA 5ELUA 4HM8B 2P38A 1YJN3 3EBTA 4RNZA 3CCM3 3CU3A 1N9JA 3S27A 5AEUB 4KZ1A 3EQQB 3PGBA 4HYZA 1OF5A 2CIUA 1YGEA 1LNHA 4KFFA 1U5OA 2JDIH 3T0UA 3B7CA 1MOLA 3UNLA 3J7Yd 2ML5A 3CCR3 3RDEA 2BMOB 2YX9A 3HIGA 3KSPA 4FR9A 1WQLB 4N6TA 3BNBA 3ER7A 3FGYA 2XSOB 1GY5A 1ZO2A 3OWUA 2W0QA 1YJW3 1CEWI 2W56A 4FMBA 4CCVA 3E99A 2XR8B 3LT9A 3N54B 1JRQA 4N3VA 5IF6A 1M1K4 3WODG 3LH4A 4R4KA 1K734 3FLJA 1AVLA 1IQXA 1YVBI 5JPUA 3F7XA 1VQ43 1EG9B 2XFTA 3CNMA 1AR0A 1S5AA 4HM7B 1ASKA 3OXAA 3SLUA 1NWWA 1W5ZA 3K63A 3T8NA 1NB3I 5LC7A 1M904 1AVKA 5IG0A 1K9M4 2XF3A 3DXOA 3LXUX 3V99A 2E2TA 2FGTA 5EEOA 3OW22 4RBNA 4WYKA 3FH1A 3EC9A 2RCDA 5BVBA 5CXOA 1FGTA 3FF0A 3FZWA 3Q2PA 4X2HA 5LC6A 2YFJB 2SBLA 4H3UA 4XBTA 4EXRA 1LOXA 1QAFA 3B4PA 1OHPA 1O7GB 1E3VA 1W2ZA 4LGQA 1WMOA 4RZMA 1D6UA 1ULIB 1IV7A 2GEXA 3EF8A 3OWSA 3CC43 2CFLA 1QVG2 7STDA 2O9UX 1D6YA 3FCSB 3G0KA 3N8BA 2PNCA 2MF7A 3CCL3 1W6YA 2WOHA 1OACA 4FMAA 2W9PA 2A15A 1DYUA 1GY7A 4OK0A 3AMOB 5IEOA 5AIGA 4J8TA 1GS3A 1US1A 3UJMA 1SQWA 3V98A 3G4S3 3F14A 3MSOA 1JN5A 4EBGA 1E3RA 2CG0A 1W4NA 1N8QA 2OQEC 4XB5A 3NQYA 3G6E3 1OHOA 3ECFA 1Q824 2CG1A 1Q864 3EN1B 5D82A 3D9RA 3EJVA 3SOYA 2OOVA 3S28A 1C7HA 3X3YA 1EKMA 1JB5A 2UX0A 3LZAA 3MKIA 2XH9A 3GRDA 4XBYA 4MMYB 1G96A 3WA3A 2Z76A 1O7PB 3CC73 3PCRA 1N9EA 3FG4A 1YHQ3 1FGMA 3CCS3 2P0XA 1AV4A 2HMMB 3QK9A 1VQN3 1FA3A 3G8ZA 2O3OA 3NX0A 4LEHA 1RKYA 1VQP3 1E97A 2XFSA 3NBRA 1VQM3 1OF5B 3OWYA 2F99A 1CQSA 2ZL8A 3BNEA 3BLZA 1QALA 5DREA 3B8LA 3DY5A 4IPBA 2GU1A 4HBRA 1JB2A 3LMLA 3WDGB 3IPTA 3EB8A 3NV0A 1QJGA 3G16A 3NBBA 3TDGA 1IU7A 5CLKA 4XDVA 3PS8A 4LZIA 5AYRB 3KSED 3DGOA 1WNHA 4HKVB 4FCJA 3LTDA 3F40A 1A2VA 1TUHA 3ALAA 1FUWA 3CCJ3 4FCZA 2W56B 1M9GA 1JKGA 1RJOA 4BTWA 3NXJA 3ROBA 3I553 3CC23 1GD4A 2GEYA 1UUWB 3GZBA 3LTAA 3KN4A 2CWVA 2Z7AA 3I0YA 3CME3 3DGNA 4X2OA 4TX4A 1D6ZA 2IUJA 3DZLA 4QWTA 1QMAA 2PZVA 2QGUA 4MMXB 2OWPA 3CNXA 3KIIA 4I4KA 2D42A 5AIIA 2YFIB 3X40A 2P05A 4BTYA 2INXA 1Q814 3NM2A 1W2B2 4GL6A 2BT3A 3NQZA 4BTXA 4LSOA 2E2VA 2Y74A 4OVMA 4WYKB 4AEQA 2XGLA 3NBJA 2HMKB 2XGNA 1T5YA 4KVHA 2B24B 1WTHA 1RN7A 1STDA 1IDPA 3BB9A 4Q53A 2RSXA 2Q07A 5G2GA 1OGZA 3EBYA 4STDA 3PCSA 4OUQA 1VQO3 1A90A 4JF8A 2FNQA 5KP4A 5AIFA 3RGRA 1W6CA 1Y4KA 3U97A 3SX1A 5AYSC 4WFOA 2WGQA 2MC8A 3PYJA 5AIHA 3EE1A 1IVUA 3DM8A 5CF1A 1TP6A 4FCMA 3JUMA 4L7KA 2Z77A 4KFEA 3SEDA 4R9LA 2CK3H 1F8NA 2LQVA 4HZ9B 1UW1A 5AEWB 3I563 4LMIA 2Y73A 1J2BA 2OTL3 5CK6A 2V1LA 3H3HA 1OUNA 1CYUA 1K8A4 1EQKA 1IQ8A 3JUNA 3MG3A 3MWZA 4MEIA 1JN5B 2RGQA 5I97A 1KC84 1KD14 5BXQA 5IG4A 2CFKA 5CF2A 5IENA 4HM3B 1VQ73 3WA2X 1IVXA 2CFDA 1U8CB 3CPOA 3X3ZA 3N9HA 1TFOA 4R80A 1VQ53 3S5CA 5IW9A 4R9KA 1JB4A 2GU3A 1JV2B 3JUOA 3X42A 3PZWA 2WO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN 3;  1VQ4 3;  3I55 3;  3CC2 3;  1NJI 4;  1Q7Y 4;  3CCQ 3;  3G4S 3;  3I56 3;  1QVF 2;  1VQP 3;  1VQK 3;  1VQM 3;  1VQ8 3;  3CCR 3;  2OTL 3;  3CXC 2;  3CME 3;  3CPW 2;  1VQ6 3;  3CD6 3;  1YIJ 3;  1YIT 3;  1K8A 4;  3CC4 3;  3G6E 3;  1VQO 3;  1QVG 2;  1KQS 2;  1M90 4;  1JJ2 2;  2QEX 3;  1Q82 4;  1Q86 4;  1K9M 4;  1N8R 4;  3CCV 3;  1YJ9 3;  3G71 3;  1KC8 4;  3CMA 3;  1KD1 4;  3CCE 3;  1YJW 3;  3OW2 2;  1S72 3;  3CCL 3;  2OTJ 3;  3CCU 3;  1VQ7 3;  1YJN 3;  3CCM 3;  1YI2 3;  1Q81 4;  1W2B 2;  1VQ5 3;  2QA4 3;  1M1K 4;  1VQ9 3;  3CC7 3;  1YHQ 3;  1K73 4;  3CCJ 3;  1VQL 3;  3CCS 3; 
#chains in the Genus database with same CATH topology
 1DE3 A;  1BSB A;  3H51 A;  3K7C A;  5JPP A;  5JBS A;  4L8O A;  5D81 A;  3KKG A;  1LQM B;  5KP1 A;  3X3X A;  8RNT A;  1X1X A;  1DMQ A;  3X41 A;  3GSP A;  1BRI A;  5STD A;  4KT3 B;  1SJW A;  2F86 B;  1STF I;  2QEX 3;  1LQG C;  3MPH A;  1O7W B;  1N8R 4;  1K41 A;  1B2Z A;  8CHO A;  7RNT A;  2IUK A;  1RCK A;  1MWS A;  5D83 A;  3T8U A;  1IV9 A;  1HU9 A;  1OHS A;  1RGG A;  1RRL A;  2W03 A;  1BRH A;  3BNC A;  2OTJ 3;  1A67 A;  1C54 A;  5FW5 A;  1BRK A;  1YI2 3;  3NV0 B;  4CDL A;  4G1M B;  4HM1 B;  1BUJ A;  6STD A;  1SII A;  3Q3F A;  1FGQ A;  4U13 A;  2L4V A;  4N6M A;  3FSD A;  4EC6 A;  1KWI A;  1K28 A;  1DMN A;  1GY6 A;  1TFK A;  1FUS A;  2CFW A;  1OPY A;  2C4B A;  1UCK A;  1I70 A;  1SPU A;  3GZR A;  1ZGX A;  1JKG B;  3EN8 A;  1NNV A;  3U1W A;  3KFQ C;  1IT7 A;  1M1X B;  4HM0 B;  1Q40 A;  1YIJ 3;  4O2H A;  3CD6 3;  1BSE A;  2BHM A;  1OGX A;  4O3V A;  1UUV B;  1PY3 A;  4ZM8 A;  4WP5 A;  3AMO A;  1L5G B;  1I3I A;  1W6G A;  1T2H A;  3HK4 A;  1Q42 A;  4O02 B;  1I2E A;  1BRS A;  3MYT A;  4K1V A;  4RNT A;  3MHE A;  3D5G A;  1W00 A;  2GBX B;  3JUQ A;  1IQY A;  2CWT A;  1RGF A;  3GAX A;  3HII A;  4GHO A;  3LOY A;  1ISK A;  3URP A;  1OH0 A;  2ZA4 A;  1Q7H A;  3SXX A;  1LVN A;  2IA7 A;  1R4C A;  1AQZ A;  3DGL A;  3UB1 A;  3WOE B;  1UI7 A;  1N5H A;  1FGR A;  3CCQ 3;  2R4I A;  4BL3 A;  5BU4 A;  6RNT A;  2CX0 A;  2P09 A;  3Q1C A;  3BND A;  1RGH A;  3GZY B;  1FZU A;  4XDW A;  2IMJ A;  3ZG0 A;  1JBT A;  3S29 A;  3DGM A;  3UL6 A;  4WWU C;  2XRX B;  1YIT 3;  4CJN A;  1RRH A;  3Q90 A;  5EVH A;  1RGL A;  4FMC A;  1TU5 A;  1B2S A;  2HMJ B;  2KF4 A;  3OV4 A;  3PXM A;  2KXG A;  5TGN A;  4BL2 A;  2HML B;  3CCE 3;  3DMC A;  5HGR A;  3K5T A;  2CHC A;  2WOF A;  3HZP A;  2BMQ B;  4L8P A;  1VZZ A;  1JNQ A;  1B3S A;  2STD A;  2W6J H;  3L0R A;  4EV2 A;  1UCJ A;  3FF2 A;  1DET A;  2W2C A;  3D3L A;  3V92 A;  3ZFZ A;  1IT8 A;  4H61 A;  2KF3 A;  1FGO A;  4K90 B;  1Q7Y 4;  1A2P A;  2K0M A;  2RBI A;  4ILF A;  5DRV A;  3HOH A;  3OX9 A;  3UL5 A;  1NU3 A;  2KF6 A;  3EHC A;  1W7C A;  2SAR A;  2WGO A;  3HI7 A;  4HOH A;  3SVA A;  1BOX A;  2P0M A;  1EEJ A;  3LTC A;  1LXE A;  1KQS 2;  4HAA A;  4K61 A;  5FGO A;  2BO9 B;  2F5M A;  1GOY A;  4HM2 B;  4PEJ A;  3IMA B;  3JUP A;  4EV5 A;  4N6N B;  3F8H A;  3A76 A;  1O7N B;  1T2I A;  3K0Z A;  3FG3 A;  1DVC A;  1BU4 A;  4BU4 A;  2GBW B;  3WMD A;  3NM7 A;  4N6O B;  4N6L A;  5AI1 A;  5BIR A;  1BNE A;  1ROV A;  2XSH B;  5IG5 A;  4JRF A;  3EX9 A;  3KE7 A;  1PU4 A;  2LYX A;  1IK3 A;  4IIA A;  1QAK A;  2I9W A;  1ZX2 A;  3K9M C;  1VQK 3;  1RNT A;  1RGC A;  1WMP A;  1DMM A;  4J9A A;  3KZT A;  1JJ2 2;  2E2U A;  3CCV 3;  3O8Y A;  3LTB A;  2CFG A;  2C10 A;  2F5W A;  3AHW A;  3BU4 A;  1LOW A;  5IG3 A;  1BSA A;  2XEP A;  2F98 A;  3B4O A;  2QA4 3;  4AKY A;  5A0O B;  4HM5 B;  1BNJ A;  4EYC A;  1I0X A;  1Z1S A;  3QRD A;  4N6V 0;  3RGA A;  5IER A;  1WMN A;  2W04 A;  2KF5 A;  2YFL B;  4R1K A;  3SOA A;  1N5P A;  3LT8 A;  4IT7 A;  1IVW A;  1TRP A;  3HX8 A;  1PFP A;  1BVI A;  4MMZ B;  1GD3 A;  1G02 A;  4KFD A;  4GB5 A;  1BUQ A;  2UUG C;  1MNL A;  2ZDJ A;  7GSP A;  4MJD A;  1GOV A;  4O8S A;  3GWR A;  2B1X B;  1S72 3;  2CWU A;  1BIR A;  1Q40 B;  1W01 A;  1GYB A;  3MG1 A;  1TIJ A;  4RNY A;  3VF1 A;  3NUV A;  4AKZ A;  3IJE B;  2BMR B;  2KAA A;  2Z6B A;  2K3D A;  4NRE A;  4I5Q A;  1KSI A;  1O7M B;  2CW9 A;  3S67 A;  4HM6 B;  1MGW A;  2M7O A;  1FW7 A;  5IEP A;  2OOV C;  4HM4 B;  2C11 A;  3VSY A;  1I2G A;  1BRG A;  1ULJ B;  2HMN B;  4ORL A;  2OQE A;  1NO3 A;  4HZB B;  2KRT A;  2QIY A;  2R41 A;  5ELJ A;  3MG2 A;  1HKX A;  1OCV A;  2GXF A;  3FKA A;  3VGN A;  1VQ6 3;  3FG1 A;  3F8X A;  3F7S A;  5KP3 A;  4FMD A;  1RN1 A;  1UI8 A;  1IVV A;  1O7H B;  2CC3 A;  3CMA 3;  2ML6 A;  3JVC A;  3G71 3;  1YJ9 3;  2K54 A;  1NB5 I;  1CYV A;  2RFR A;  3CCU 3;  1ROA A;  2D1W A;  3M8C A;  1A2K A;  4N6U A;  1VQ9 3;  3LYG A;  1BNR A;  1HZ1 A;  2KCD A;  5G1L A;  1EA2 A;  1BGS A;  4HVN A;  1SIH A;  1VQL 3;  3F9S A;  4HJL B;  1PYL A;  1TTO A;  1NJI 4;  2HMO B;  2FXT A;  2CH9 A;  1QVF 2;  1X1W A;  2HOH A;  3STD A;  3WOF B;  1VQ8 3;  1V74 A;  3CXC 2;  1MWR A;  3CPW 2;  4J5K A;  2JQ5 A;  5EQL A;  3DUK A;  4WHA A;  1X1Y A;  1MWU A;  1DVD A;  1JZO A;  4NHF A;  4K1U A;  3GZX B;  3ZG5 A;  2W9Q A;  1NDO B;  1W02 A;  2BNG A;  4XM4 A;  1RGE A;  2CKF B;  2OCT A;  3NHX A;  4XBX A;  5ELU A;  4HM8 B;  4BIR A;  2P38 A;  1YJN 3;  3DGY A;  1UDI I;  3EBT A;  4RNZ A;  3CU3 A;  3CCM 3;  5HOH A;  1N9J A;  3S27 A;  5AEU B;  4KZ1 A;  3EQQ B;  3PGB A;  4HYZ A;  1OF5 A;  2CIU A;  1YGE A;  1LNH A;  1YGW A;  4KFF A;  6GSP A;  1LRA A;  1UGH I;  1BNG A;  1U5O A;  2JDI H;  3T0U A;  3B7C A;  1MOL A;  3UNL A;  1CH0 A;  2H0I A;  3J7Y d;  2ML5 A;  3CCR 3;  3RDE A;  2BMO B;  2YX9 A;  3HIG A;  3KSP A;  4FR9 A;  1WQL B;  4N6T A;  3BNB A;  3D79 A;  3ER7 A;  3FGY A;  2XSO B;  1GY5 A;  1YVS A;  1ZO2 A;  2IY2 A;  3OWU A;  1B2X A;  1RN4 A;  2W0Q A;  1YJW 3;  1CEW I;  2W56 A;  4FMB A;  4CCV A;  3E99 A;  1EUI C;  2XR8 B;  5M18 A;  3LT9 A;  3N54 B;  1JRQ A;  5RNT A;  4N3V A;  5IF6 A;  1M1K 4;  1BAO A;  3WOD G;  3LH4 A;  4R4K A;  1K73 4;  3FLJ A;  1AVL A;  1IQX A;  1YVB I;  5JPU A;  3F7X A;  1VQ4 3;  1EG9 B;  2XFT A;  3CNM A;  3DH2 A;  1AR0 A;  1IYY A;  1S5A A;  1BSD A;  4HM7 B;  1ASK A;  2AAD A;  1I8V A;  3OXA A;  3SLU A;  1NWW A;  1I2F A;  1W5Z A;  3K63 A;  3T8N A;  1NB3 I;  5LC7 A;  1M90 4;  1AVK A;  5IG0 A;  1K9M 4;  2XF3 A;  3DXO A;  3LXU X;  3V99 A;  2E2T A;  2FGT A;  1G0T A;  1T3B A;  4RBN A;  4WYK A;  5EEO A;  3OW2 2;  3FH1 A;  3WR2 A;  1GMP A;  3EC9 A;  2ZHX B;  2RCD A;  9RNT A;  5BVB A;  5CXO A;  1FGT A;  1B2M A;  3FF0 A;  3FZW A;  3Q2P A;  1GOU A;  4X2H A;  2UGI A;  2YFJ B;  2SBL A;  4H3U A;  4XBT A;  5LC6 A;  4EXR A;  1LOX A;  1QAF A;  1LOV A;  3B4P A;  1OHP A;  1O7G B;  1E3V A;  1W2Z A;  4LGQ A;  1WMO A;  4RZM A;  1D6U A;  1ULI B;  1BNI A;  1IV7 A;  2GEX A;  3EF8 A;  3OWS A;  5G1K A;  3CC4 3;  2CFL A;  1RLS A;  1QVG 2;  7STD A;  2O9U X;  1D6Y A;  3FCS B;  1YNV X;  3G0K A;  3N8B A;  2PNC A;  3KCH A;  1FUT A;  2MF7 A;  1W6Y A;  3CCL 3;  2WOH A;  5M19 A;  1OAC A;  4FMA A;  2W9P A;  1I0V A;  2A15 A;  2J8X B;  1DYU A;  1GY7 A;  4OK0 A;  3AMO B;  5IEO A;  1JBR A;  5AIG A;  4J8T A;  2BIR A;  1RGA A;  1GS3 A;  2H0G A;  2BU4 A;  4J5G A;  1US1 A;  2AAE A;  1HYF A;  1UCL A;  3UJM A;  1SQW A;  3V98 A;  3G4S 3;  3F14 A;  3MSO A;  1JN5 A;  2F56 A;  4EBG A;  1E3R A;  3BIR A;  1RSN A;  2CG0 A;  1W4N A;  1N8Q A;  2OQE C;  4XB5 A;  3NQY A;  3G6E 3;  1OHO A;  3ECF A;  1Q82 4;  2CG1 A;  1Q86 4;  3EN1 B;  5D82 A;  3D9R A;  3EJV A;  3SOY A;  2OOV A;  3S28 A;  1C7H A;  3X3Y A;  1EKM A;  1VQQ A;  1BAN A;  1JB5 A;  2UX0 A;  3LZA A;  3MKI A;  1RCL A;  1TJD A;  2XH9 A;  3GRD A;  4LYL B;  4MMY B;  1G96 A;  4XBY A;  3WA3 A;  2Z76 A;  1O7P B;  3CC7 3;  3PCR A;  1N9E A;  3FG4 A;  1BNF A;  1YHQ 3;  2L1S A;  1FGM A;  3CCS 3;  2P0X A;  1AV4 A;  2HMM B;  3QK9 A;  1VQN 3;  1FA3 A;  3G8Z A;  2O3O A;  3NX0 A;  4LEH A;  5M1A A;  1RKY A;  1VQP 3;  1E97 A;  2XFS A;  3NBR A;  3WHO A;  1VQM 3;  1OF5 B;  3D5I A;  3OWY A;  2F99 A;  1CQS A;  2ZL8 A;  3BNE A;  4GSP A;  3BLZ A;  1QAL A;  5DRE A;  1GMR A;  3B8L A;  3DY5 A;  4IPB A;  2GU1 A;  4HBR A;  1JB2 A;  1LOY A;  3LML A;  2IYJ A;  3IPT A;  3EB8 A;  3NV0 A;  1QJG A;  3G16 A;  3NBB A;  3WDG B;  3TDG A;  1IU7 A;  1FYS A;  4XDV A;  5CLK A;  1V58 A;  1MWT A;  1BNS A;  3PS8 A;  4LZI A;  5AYR B;  3KSE D;  2F4Y A;  3DGO A;  1WNH A;  4HKV B;  4FCJ A;  3LTD A;  3D4A A;  3F40 A;  1BRN L;  1A2V A;  1TUH A;  3ALA A;  1FUW A;  3CCJ 3;  4FCZ A;  2W56 B;  1M9G A;  1JKG A;  1RJO A;  1B2U A;  4BTW A;  3NXJ A;  3ROB A;  3I55 3;  3CC2 3;  1GD4 A;  2GEY A;  3AGO A;  1UCI A;  1UUW B;  3GZB A;  3LTA A;  3KN4 A;  2CWV A;  2Z7A A;  3I0Y A;  1RMS A;  3CME 3;  3DGN A;  1B20 A;  1UUG B;  4X2O A;  3SYU A;  1RGK A;  4TX4 A;  1JBS A;  1D6Z A;  2IUJ A;  3DZL A;  4QWT A;  4DKI A;  1QMA A;  2PZV A;  2QGU A;  4MMX B;  2OWP A;  1JZD A;  3CNX A;  3KII A;  4I4K A;  2D42 A;  4NPB A;  5AII A;  2YFI B;  4EW5 A;  3X40 A;  2P05 A;  4BTY A;  2INX A;  1Q81 4;  3NM2 A;  1W2B 2;  4GL6 A;  2BT3 A;  3NQZ A;  4BTX A;  1V57 A;  4LSO A;  2E2V A;  4CPK A;  2Y74 A;  4OVM A;  4WYK B;  1TRQ A;  4AEQ A;  1RTU A;  2H0H A;  2XGL A;  2HMK B;  2XGN A;  3NBJ A;  1T5Y A;  4KVH A;  1BSC A;  2B24 B;  3A5E A;  3AGN A;  1WTH A;  1RN7 A;  1STD A;  1IDP A;  3BB9 A;  4Q53 A;  2RSX A;  1MGR A;  2Q07 A;  5G2G A;  1OGZ A;  3EBY A;  4STD A;  3PCS A;  4OUQ A;  1X1U A;  1VQO 3;  1A90 A;  4JF8 A;  2GSP A;  2FNQ A;  5KP4 A;  5AIF A;  1B27 A;  1UGI A;  1W6C A;  1Y4K A;  3RGR A;  3SX1 A;  3U97 A;  1AY7 A;  5AYS C;  4WFO A;  2WGQ A;  2MC8 A;  1BRJ A;  3PYJ A;  5AIH A;  3EE1 A;  1IVU A;  2CX1 A;  3DM8 A;  5CF1 A;  1R4Y A;  1TP6 A;  4FCM A;  3JUM A;  4L7K A;  3AHS A;  2Z77 A;  1SAR A;  4KFE A;  3SED A;  1Q9E A;  4R9L A;  2CK3 H;  1F8N A;  2LQV A;  4HZ9 B;  1UW1 A;  1I3F A;  5AEW B;  3I56 3;  5GSP A;  1B21 A;  4LMI A;  2Y73 A;  1J2B A;  2OTL 3;  5CK6 A;  2V1L A;  1RDS A;  1ZS7 A;  3H3H A;  1OUN A;  1CYU A;  1K8A 4;  1EQK A;  1IQ8 A;  3JUN A;  3MG3 A;  3MWZ A;  4MEI A;  1JN5 B;  1GSP A;  1RHL A;  2RGQ A;  5I97 A;  5BXQ A;  1KC8 4;  1KD1 4;  5IG4 A;  2CFK A;  5CF2 A;  5IEN A;  1GMQ A;  4HM3 B;  1VQ7 3;  3WA2 X;  1IVX A;  2CFD A;  1U8C B;  3CPO A;  3X3Z A;  3N9H A;  1TFO A;  4R80 A;  1VQ5 3;  3S5C A;  1LNI A;  5IW9 A;  2RNT A;  4R9K A;  1JB4 A;  2GU3 A;  1JV2 B;  3JUO A;  3X42 A;  3RNT A;  1RNB A;  3PZW A;  2WO0 A; 
#chains in the Genus database with same CATH homology
 3H51 A;  3K7C A;  5JPP A;  5JBS A;  4L8O A;  5D81 A;  3KKG A;  5KP1 A;  3X3X A;  1DMQ A;  3X41 A;  5STD A;  1SJW A;  2F86 B;  1STF I;  2QEX 3;  3MPH A;  1O7W B;  1N8R 4;  1K41 A;  8CHO A;  2IUK A;  5D83 A;  3T8U A;  1IV9 A;  1HU9 A;  1OHS A;  2OTJ 3;  1RRL A;  2W03 A;  3BNC A;  1A67 A;  5FW5 A;  1YI2 3;  3NV0 B;  4CDL A;  4G1M B;  4HM1 B;  6STD A;  1SII A;  1FGQ A;  4U13 A;  2L4V A;  4N6M A;  3FSD A;  4EC6 A;  1KWI A;  1K28 A;  1DMN A;  1GY6 A;  1TFK A;  2CFW A;  1OPY A;  3GZR A;  1SPU A;  1JKG B;  3EN8 A;  3U1W A;  3KFQ C;  1IT7 A;  1M1X B;  4HM0 B;  1Q40 A;  1YIJ 3;  4O2H A;  3CD6 3;  2BHM A;  1OGX A;  4O3V A;  1UUV B;  4ZM8 A;  4WP5 A;  3AMO A;  1L5G B;  1W6G A;  4O02 B;  3HK4 A;  1Q42 A;  3MYT A;  4K1V A;  3MHE A;  1W00 A;  2GBX B;  3JUQ A;  1IQY A;  2CWT A;  3GAX A;  3HII A;  3LOY A;  1ISK A;  1OH0 A;  3SXX A;  1LVN A;  2IA7 A;  1R4C A;  3WOE B;  3DGL A;  3UB1 A;  1UI7 A;  1N5H A;  1FGR A;  3CCQ 3;  2R4I A;  2P09 A;  3Q1C A;  3BND A;  3GZY B;  4XDW A;  2IMJ A;  3S29 A;  3DGM A;  3UL6 A;  4WWU C;  2XRX B;  1YIT 3;  1RRH A;  3Q90 A;  5EVH A;  4FMC A;  1TU5 A;  2HMJ B;  3PXM A;  3CCE 3;  3OV4 A;  2KXG A;  5TGN A;  2HML B;  3DMC A;  5HGR A;  3K5T A;  2CHC A;  2WOF A;  3HZP A;  2BMQ B;  4L8P A;  1VZZ A;  1JNQ A;  2W6J H;  2STD A;  3L0R A;  4EV2 A;  3FF2 A;  2W2C A;  3D3L A;  3V92 A;  1IT8 A;  4H61 A;  4K90 B;  1FGO A;  1Q7Y 4;  2K0M A;  5DRV A;  3OX9 A;  3UL5 A;  1NU3 A;  3EHC A;  1W7C A;  2WGO A;  3HI7 A;  3SVA A;  2P0M A;  3LTC A;  1LXE A;  1KQS 2;  4K61 A;  5FGO A;  2BO9 B;  4PEJ A;  4HM2 B;  4EV5 A;  3IMA B;  3JUP A;  4N6N B;  3F8H A;  3A76 A;  1O7N B;  3K0Z A;  3FG3 A;  1DVC A;  2GBW B;  3WMD A;  3NM7 A;  4N6O B;  4N6L A;  5AI1 A;  5IG5 A;  1ROV A;  2XSH B;  4JRF A;  3EX9 A;  3KE7 A;  1PU4 A;  2LYX A;  1IK3 A;  4IIA A;  1QAK A;  2I9W A;  1ZX2 A;  3K9M C;  1VQK 3;  1WMP A;  1DMM A;  4J9A A;  3KZT A;  1JJ2 2;  2E2U A;  3CCV 3;  3O8Y A;  3LTB A;  2CFG A;  2C10 A;  5IG3 A;  2XEP A;  2F98 A;  3B4O A;  2QA4 3;  4AKY A;  5A0O B;  4HM5 B;  4EYC A;  1Z1S A;  3QRD A;  4N6V 0;  3RGA A;  5IER A;  1WMN A;  2W04 A;  2YFL B;  4R1K A;  3SOA A;  1N5P A;  3LT8 A;  4IT7 A;  1IVW A;  3HX8 A;  1PFP A;  4MMZ B;  1GD3 A;  4KFD A;  4GB5 A;  1BUQ A;  1MNL A;  2ZDJ A;  4MJD A;  4O8S A;  3GWR A;  2B1X B;  1S72 3;  2CWU A;  1Q40 B;  1W01 A;  1GYB A;  3MG1 A;  1TIJ A;  4RNY A;  3VF1 A;  3NUV A;  4AKZ A;  3IJE B;  2BMR B;  2Z6B A;  4NRE A;  1KSI A;  1O7M B;  2CW9 A;  3S67 A;  4HM6 B;  2M7O A;  5IEP A;  2OOV C;  4HM4 B;  2C11 A;  3VSY A;  1ULJ B;  2OQE A;  2HMN B;  4ORL A;  1NO3 A;  4HZB B;  2KRT A;  2QIY A;  5ELJ A;  3MG2 A;  1HKX A;  1OCV A;  2GXF A;  3FKA A;  3VGN A;  1VQ6 3;  3FG1 A;  3F8X A;  3F7S A;  5KP3 A;  4FMD A;  1UI8 A;  1IVV A;  1O7H B;  2CC3 A;  3CMA 3;  2ML6 A;  3JVC A;  3G71 3;  1YJ9 3;  2K54 A;  1NB5 I;  1CYV A;  2RFR A;  3CCU 3;  1ROA A;  2D1W A;  3M8C A;  1A2K A;  4N6U A;  1VQ9 3;  3LYG A;  2KCD A;  1EA2 A;  4HVN A;  1SIH A;  1VQL 3;  3F9S A;  4HJL B;  1NJI 4;  2HMO B;  2FXT A;  2CH9 A;  1QVF 2;  3STD A;  3WOF B;  1VQ8 3;  1V74 A;  3CXC 2;  3CPW 2;  2JQ5 A;  5EQL A;  3DUK A;  4WHA A;  1DVD A;  4NHF A;  4K1U A;  3GZX B;  2W9Q A;  1NDO B;  1W02 A;  2BNG A;  4XM4 A;  2CKF B;  2OCT A;  3NHX A;  4XBX A;  5ELU A;  4HM8 B;  2P38 A;  1YJN 3;  3EBT A;  4RNZ A;  3CCM 3;  3CU3 A;  1N9J A;  3S27 A;  5AEU B;  4KZ1 A;  3EQQ B;  3PGB A;  4HYZ A;  1OF5 A;  2CIU A;  1YGE A;  1LNH A;  4KFF A;  1U5O A;  2JDI H;  3T0U A;  3B7C A;  1MOL A;  3UNL A;  3J7Y d;  2ML5 A;  3CCR 3;  3RDE A;  2BMO B;  2YX9 A;  3HIG A;  3KSP A;  4FR9 A;  1WQL B;  4N6T A;  3BNB A;  3ER7 A;  3FGY A;  2XSO B;  1GY5 A;  1ZO2 A;  3OWU A;  2W0Q A;  1YJW 3;  1CEW I;  2W56 A;  4FMB A;  4CCV A;  3E99 A;  2XR8 B;  3LT9 A;  3N54 B;  1JRQ A;  4N3V A;  5IF6 A;  1M1K 4;  3WOD G;  3LH4 A;  4R4K A;  1K73 4;  3FLJ A;  1AVL A;  1IQX A;  1YVB I;  5JPU A;  3F7X A;  1VQ4 3;  1EG9 B;  2XFT A;  3CNM A;  1AR0 A;  1S5A A;  4HM7 B;  1ASK A;  3OXA A;  3SLU A;  1NWW A;  1W5Z A;  3K63 A;  3T8N A;  1NB3 I;  5LC7 A;  1M90 4;  1AVK A;  5IG0 A;  1K9M 4;  2XF3 A;  3DXO A;  3LXU X;  3V99 A;  2E2T A;  2FGT A;  5EEO A;  3OW2 2;  4RBN A;  4WYK A;  3FH1 A;  3EC9 A;  2RCD A;  5BVB A;  5CXO A;  1FGT A;  3FF0 A;  3FZW A;  3Q2P A;  4X2H A;  5LC6 A;  2YFJ B;  2SBL A;  4H3U A;  4XBT A;  4EXR A;  1LOX A;  1QAF A;  3B4P A;  1OHP A;  1O7G B;  1E3V A;  1W2Z A;  4LGQ A;  1WMO A;  4RZM A;  1D6U A;  1ULI B;  1IV7 A;  2GEX A;  3EF8 A;  3OWS A;  3CC4 3;  2CFL A;  1QVG 2;  7STD A;  2O9U X;  1D6Y A;  3FCS B;  3G0K A;  3N8B A;  2PNC A;  2MF7 A;  3CCL 3;  1W6Y A;  2WOH A;  1OAC A;  4FMA A;  2W9P A;  2A15 A;  1DYU A;  1GY7 A;  4OK0 A;  3AMO B;  5IEO A;  5AIG A;  4J8T A;  1GS3 A;  1US1 A;  3UJM A;  1SQW A;  3V98 A;  3G4S 3;  3F14 A;  3MSO A;  1JN5 A;  4EBG A;  1E3R A;  2CG0 A;  1W4N A;  1N8Q A;  2OQE C;  4XB5 A;  3NQY A;  3G6E 3;  1OHO A;  3ECF A;  1Q82 4;  2CG1 A;  1Q86 4;  3EN1 B;  5D82 A;  3D9R A;  3EJV A;  3SOY A;  2OOV A;  3S28 A;  1C7H A;  3X3Y A;  1EKM A;  1JB5 A;  2UX0 A;  3LZA A;  3MKI A;  2XH9 A;  3GRD A;  4XBY A;  4MMY B;  1G96 A;  3WA3 A;  2Z76 A;  1O7P B;  3CC7 3;  3PCR A;  1N9E A;  3FG4 A;  1YHQ 3;  1FGM A;  3CCS 3;  2P0X A;  1AV4 A;  2HMM B;  3QK9 A;  1VQN 3;  1FA3 A;  3G8Z A;  2O3O A;  3NX0 A;  4LEH A;  1RKY A;  1VQP 3;  1E97 A;  2XFS A;  3NBR A;  1VQM 3;  1OF5 B;  3OWY A;  2F99 A;  1CQS A;  2ZL8 A;  3BNE A;  3BLZ A;  1QAL A;  5DRE A;  3B8L A;  3DY5 A;  4IPB A;  2GU1 A;  4HBR A;  1JB2 A;  3LML A;  3WDG B;  3IPT A;  3EB8 A;  3NV0 A;  1QJG A;  3G16 A;  3NBB A;  3TDG A;  1IU7 A;  5CLK A;  4XDV A;  3PS8 A;  4LZI A;  5AYR B;  3KSE D;  3DGO A;  1WNH A;  4HKV B;  4FCJ A;  3LTD A;  3F40 A;  1A2V A;  1TUH A;  3ALA A;  1FUW A;  3CCJ 3;  4FCZ A;  2W56 B;  1M9G A;  1JKG A;  1RJO A;  4BTW A;  3NXJ A;  3ROB A;  3I55 3;  3CC2 3;  1GD4 A;  2GEY A;  1UUW B;  3GZB A;  3LTA A;  3KN4 A;  2CWV A;  2Z7A A;  3I0Y A;  3CME 3;  3DGN A;  4X2O A;  4TX4 A;  1D6Z A;  2IUJ A;  3DZL A;  4QWT A;  1QMA A;  2PZV A;  2QGU A;  4MMX B;  2OWP A;  3CNX A;  3KII A;  4I4K A;  2D42 A;  5AII A;  2YFI B;  3X40 A;  2P05 A;  4BTY A;  2INX A;  1Q81 4;  3NM2 A;  1W2B 2;  4GL6 A;  2BT3 A;  3NQZ A;  4BTX A;  4LSO A;  2E2V A;  2Y74 A;  4OVM A;  4WYK B;  4AEQ A;  2XGL A;  3NBJ A;  2HMK B;  2XGN A;  1T5Y A;  4KVH A;  2B24 B;  1WTH A;  1RN7 A;  1STD A;  1IDP A;  3BB9 A;  4Q53 A;  2RSX A;  2Q07 A;  5G2G A;  1OGZ A;  3EBY A;  4STD A;  3PCS A;  4OUQ A;  1VQO 3;  1A90 A;  4JF8 A;  2FNQ A;  5KP4 A;  5AIF A;  3RGR A;  1W6C A;  1Y4K A;  3U97 A;  3SX1 A;  5AYS C;  4WFO A;  2WGQ A;  2MC8 A;  3PYJ A;  5AIH A;  3EE1 A;  1IVU A;  3DM8 A;  5CF1 A;  1TP6 A;  4FCM A;  3JUM A;  4L7K A;  2Z77 A;  4KFE A;  3SED A;  4R9L A;  2CK3 H;  1F8N A;  2LQV A;  4HZ9 B;  1UW1 A;  5AEW B;  3I56 3;  4LMI A;  2Y73 A;  1J2B A;  2OTL 3;  5CK6 A;  2V1L A;  3H3H A;  1OUN A;  1CYU A;  1K8A 4;  1EQK A;  1IQ8 A;  3JUN A;  3MG3 A;  3MWZ A;  4MEI A;  1JN5 B;  2RGQ A;  5I97 A;  1KC8 4;  1KD1 4;  5BXQ A;  5IG4 A;  2CFK A;  5CF2 A;  5IEN A;  4HM3 B;  1VQ7 3;  3WA2 X;  1IVX A;  2CFD A;  1U8C B;  3CPO A;  3X3Z A;  3N9H A;  1TFO A;  4R80 A;  1VQ5 3;  3S5C A;  5IW9 A;  4R9K A;  1JB4 A;  2GU3 A;  1JV2 B;  3JUO A;  3X42 A;  3PZW A;  2WO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...