1LQGC

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
b'TGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 9
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqgC00
2J8XB 1UUGB 1EUIC 1UGIA 1LQMB 2UGIA 1UGHI 1LQGC 4LYLB 1UDII 2ZHXB 2UUGC
chains in the Genus database with same CATH superfamily
1TTOA 3OX9A 4JRFA 3IJEB 3UJMA 2F98A 4BL3A 1YI23 1FGTA 1Q824 1JBRA 3JUNA 2ZDJA 1AY7A 2HMLB 1YJ93 1J2BA 1TU5A 4J8TA 2IY2A 2P0XA 2P0MA 4I5QA 1B2SA 2WOHA 3NQZA 4ILFA 2R4IA 3FG3A 1M9GA 2IYJA 3FZWA 1OHOA 5BU4A 4J5GA 1C7HA 1MGWA 2XFTA 3B7CA 2KCDA 4L7KA 1NWWA 2GU1A 3G8ZA 5M1AA 1JRQA 2HMOB 3MG1A 1OGXA 2CWVA 3BU4A 3OV4A 3LYGA 1QVF2 3CCL3 1UGHI 2Z76A 4EYCA 1TIJA 3N8BA 3SOYA 1HYFA 3OWUA 3CME3 3SVAA 1UCLA 4JF8A 1ISKA 3FCSB 1BNIA 4EBGA 1UCIA 1WNHA 4OUQA 1BRSA 1D6YA 1RRHA 3S27A 1AV4A 1B2XA 2CX0A 4TX4A 4WFOA 4ZM8A 1W5ZA 3F9SA 3CCU3 1RLSA 4RNTA 1M1XB 2RCDA 3IPTA 2QEX3 4HM3B 5AEUB 1VQ93 1Q42A 5D83A 1CH0A 3K9MC 1Q814 1CEWI 1DYUA 4NPBA 4R1KA 3S67A 4XDVA 2GXFA 1VQP3 4XB5A 1VQN3 3RGAA 5CF1A 1X1UA 4HAAA 3UB1A 1SIIA 3FH1A 4STDA 3FGYA 3PCSA 4L8OA 1W6GA 5IW9A 1RCKA 3D4AA 1O7MB 1ZS7A 2BT3A 2F5MA 5HGRA 3GRDA 1EG9B 6GSPA 1RMSA 1B27A 2BMRB 3CCS3 3GZXB 2INXA 3O8YA 4HM0B 3CNMA 1MWTA 3VF1A 1I3FA 3CMA3 1A2VA 1JBTA 2BNGA 2QIYA 2Z77A 3HX8A 5AI1A 1GOYA 1PFPA 2Y73A 1NB5I 3JUOA 1IV9A 1RGAA 4XBXA 4LYLB 1JNQA 2BIRA 3MHEA 2CFLA 3GAXA 5AIGA 4J5KA 1B2UA 1EA2A 1Q7HA 2GU3A 3JUMA 4KVHA 3AGOA 2RBIA 1LQGC 3I563 1NU3A 1LNHA 1RGKA 1MNLA 1EUIC 1UUWB 4HYZA 1FGQA 1MGRA 3CNXA 3SLUA 3I553 4WWUC 5AEWB 2XH9A 4XDWA 1RSNA 3ROBA 5BVBA 1VQ83 3ER7A 4EV2A 4K61A 4DKIA 1K8A4 3N9HA 1B3SA 1MWSA 2PNCA 1BSBA 1S5AA 1BUJA 1IYYA 1BRJA 4FMDA 4RNYA 1KQS2 2P38A 1BRIA 1YGEA 1AQZA 2W9PA 2XFSA 3OW22 5IG3A 1WMOA 3AMOB 1T2IA 1R4YA 2CFKA 1GYBA 2KRTA 3LTAA 3ECFA 3M8CA 3NX0A 4FCMA 1OHSA 1CYUA 1IVXA 1LVNA 1QJGA 1BANA 2CC3A 1QMAA 3WA3A 1X1XA 1TP6A 2UX0A 3LMLA 1UI8A 5IEPA 3BNBA 2FXTA 5RNTA 3CC23 4I4KA 1Q7Y4 3HK4A 3N54B 1LOVA 3VSYA 4WP5A 5ELJA 1K9M4 1VZZA 3AMOA 4CPKA 1JKGB 1X1YA 4MJDA 1VQ63 5A0OB 2JQ5A 4RNZA 1B20A 1I70A 3DH2A 3PGBA 3MG3A 3WA2X 1W6CA 2D42A 1OGZA 1RNTA 5JBSA 1IV7A 1EEJA 1WTHA 4KFEA 3NQYA 1WMPA 3DUKA 1W01A 1JKGA 3EC9A 3K5TA 3RNTA 1BRGA 3DGYA 2Y74A 2XGNA 1SARA 4HZBB 1Y4KA 8CHOA 1RRLA 3NBBA 4ORLA 3MG2A 3S29A 1ULJB 3L0RA 3KKGA 1GMPA 5AIFA 1W7CA 3JUPA 1Q40B 1PY3A 2O3OA 1MOLA 1C54A 4N6V0 5DRVA 3LT9A 3CCJ3 7GSPA 1PYLA 1X1WA 2PZVA 4R9LA 5FGOA 1BRKA 3B4OA 2ZA4A 4WYKB 4N6UA 2O9UX 4BTYA 2C10A 5I97A 1Q40A 1RGFA 1STDA 1OF5B 1MWRA 2CG0A 2QGUA 2HOHA 1JN5B 1B2MA 2BU4A 2XGLA 4WYKA 3CCR3 3X3YA 2H0IA 4RBNA 5KP1A 3D79A 1S723 3FF0A 3EBTA 2F86B 3V99A 2J8XB 3PCRA 1OF5A 1AVKA 1A90A 1JZOA 3D5IA 1B2ZA 2CWTA 3DGNA 2F99A 1T5YA 1JN5A 2H0GA 3DM8A 3PXMA 5G1LA 1WMNA 4H3UA 1V57A 1D6ZA 3K7CA 1BOXA 1W00A 2IA7A 1TJDA 5BIRA 3MSOA 4BL2A 4HM7B 2CFGA 1YVBI 3LZAA 4R80A 3WOEB 4N3VA 2BHMA 2KF6A 3EF8A 3K0ZA 1HZ1A 5G2GA 3CPW2 4EW5A 2CWUA 3T8NA 3CCE3 2CKFB 1PU4A 1AR0A 4BIRA 3Q3FA 1SJWA 2ML5A 3BLZA 3NXJA 1BRHA 3DGOA 1IQYA 1RN7A 3NHXA 4R4KA 3HIGA 1BNSA 2KF3A 2MF7A 3EN8A 3FKAA 3GSPA 3OWSA 5IF6A 2W6JH 2F5WA 5BXQA 3DGLA 3NM2A 3SEDA 1EQKA 4OVMA 1T2HA 1KC84 1I2GA 2XSHB 7RNTA 1G02A 1OCVA 1OPYA 1WQLB 1I0VA 2CFWA 1I3IA 1BSDA 6STDA 3RDEA 3NUVA 1BNFA 1YJN3 1JB2A 2CHCA 5JPPA 1YJW3 1RDSA 2AAEA 2HMKB 2W56B 3EN1B 4L8PA 2GSPA 4N6MA 4AEQA 2OQEC 1YNVX 3KE7A 2OWPA 1BRNL 4KT3B 3F14A 2BO9B 4GSPA 1VQL3 4Q53A 1E3RA 1DVDA 1BIRA 1QALA 2W56A 1I2EA 3EJVA 3OXAA 1L5GB 3URPA 3SXXA 1W2B2 1ROVA 1W02A 4MMYB 4WHAA 3WOFB 4CDLA 3AHWA 3WMDA 4AKYA 3MPHA 1DMMA 1RHLA 1ULIB 1IT7A 3F8XA 2KAAA 4K1VA 1BNEA 1TRPA 3X3ZA 1UCJA 1VQQA 1US1A 2CX1A 2H0HA 3KCHA 3GZBA 1YHQ3 5LC6A 1FGRA 1RN1A 2QA43 1OHPA 2CFDA 4HM5B 1T3BA 3FLJA 1UDII 2CIUA 3DMCA 1IVVA 4XBTA 3FG1A 2ML6A 4KZ1A 1LQMB 3I0YA 3EHCA 3NBJA 4NREA 3CCV3 2CG1A 3EB8A 4HM1B 4KFFA 1BAOA 1KSIA 3BNCA 1DMNA 4HM6B 4LZIA 4FR9A 1U5OA 3KSED 1I2FA 1QAFA 1DMQA 2GBWB 3PZWA 4GL6A 1GD4A 4N6TA 5DREA 1FW7A 1CQSA 2E2UA 4G1MB 1OACA 1BGSA 3AGNA 4OK0A 2KXGA 3G6E3 5D81A 1GY5A 4HM4B 3MYTA 4K90B 3HZPA 3X3XA 3HIIA 1VQO3 3LTDA 1JJ22 3NBRA 4X2HA 3ZG5A 1NNVA 1RCLA 2WGOA 4U13A 3WODG 4BU4A 1AVLA 1HU9A 4R9KA 2GBXB 1YIT3 3VGNA 1LOYA 1QAKA 4HZ9B 4BTWA 3TDGA 5GSPA 2E2VA 4IIAA 3MKIA 2GEYA 1LXEA 1SIHA 3KZTA 6RNTA 1U8CB 1BNJA 5IG0A 2OCTA 4EC6A 1FUWA 4HKVB 3ZFZA 1G0TA 2Z6BA 1Q864 2D1WA 2MC8A 4FMCA 5FW5A 2I9WA 3SYUA 2KF5A 3WR2A 2WOFA 5EQLA 1GS3A 1JB4A 1SPUA 3X40A 1TFKA 1KWIA 5AYSC 1JBSA 1STFI 1IK3A 1EKMA 2V1LA 1V74A 1NB3I 3U1WA 2XEPA 3FSDA 5KP3A 4O2HA 3F8HA 1BSCA 3BNDA 3DXOA 3GWRA 2RSXA 4EV5A 1JB5A 1GY6A 3DGMA 2RGQA 2SBLA 3LXUX 2GEXA 2YFLB 1CYVA 3CU3A 2XRXB 3KIIA 4XM4A 3S28A 3T8UA 2BMQB 2HMJB 2BMOB 3F40A 5IG5A 1LRAA 2CW9A 3LTCA 5G1KA 3T0UA 3WDGB 2FGTA 3U97A 2Z7AA 1QVG2 5HOHA 1Q9EA 2W2CA 4EXRA 1DETA 1I0XA 1K41A 3F7SA 1ZO2A 4IPBA 1ZX2A 4HOHA 1RN4A 4CJNA 3UL5A 2F56A 4K1UA 4RZMA 5EEOA 4PEJA 3G4S3 1BNGA 2AADA 1BUQA 1W6YA 1N8QA 5KP4A 2XR8B 3G0KA 7STDA 1N9EA 2W9QA 2WGQA 4X2OA 2B24B 2HMMB 1NDOB 1VQ73 3NM7A 3AHSA 4HM8B 1RGCA 4KFDA 1IVUA 1G96A 5IERA 1UGIA 1IQXA 5LC7A 3HI7A 2OTL3 2FNQA 1LOXA 1V58A 2XF3A 5STDA 2P09A 1N5HA 2IUKA 3HOHA 3IMAB 3QK9A 3FF2A 2YFIB 1YIJ3 3A76A 1GOVA 1MWUA 4N6NB 3EQQB 3WHOA 1A2PA 2IMJA 2KF4A 8RNTA 1B21A 4IT7A 1HKXA 2K54A 4J9AA 1IVWA 1GD3A 2YX9A 3QRDA 2LYXA 1K28A 3BIRA 3LTBA 1JZDA 3BNEA 1IQ8A 3V98A 3KSPA 5CLKA 1KD14 3CCM3 4HVNA 3UL6A 3NV0B 3CC73 1O7NB 2OQEA 2OOVC 4FMAA 3UNLA 1W2ZA 1TRQA 2SARA 1VQM3 5CF2A 3H51A 2RFRA 3ZG0A 2ZL8A 1GOUA 1GSPA 3PS8A 5D82A 3S5CA 2OOVA 2CK3H 5CK6A 3LH4A 1E97A 5JPUA 1RNBA 3NV0A 1N9JA 5AYRB 1FGOA 3ALAA 3D9RA 1GMRA 2L4VA 3X42A 1DE3A 5IEOA 4H61A 3E99A 1BSAA 2W03A 4LSOA 2B1XB 3Q1CA 1R4CA 1GY7A 3GZRA 1RJOA 2WO0A 1BU4A 2UGIA 2OTJ3 4CCVA 3J7Yd 1FGMA 4MEIA 5CXOA 3H3HA 5IENA 3OWYA 4HM2B 3SOAA 1E3VA 1UUGB 3D5GA 3PYJA 1D6UA 2STDA 5M18A 1ASKA 1O7GB 2RNTA 4AKZA 1RGGA 1JV2B 1LNIA 1O7WB 1ROAA 1UUVB 3CXC2 1UW1A 3G16A 1M904 2W04A 5AIHA 3EBYA 1M1K4 3DY5A 1RGLA 4FCZA 4NHFA 3Q90A 3RGRA 2IUJA 2ZHXB 1IU7A 1VQ43 3JVCA 4LEHA 1NO3A 2Q07A 4O3VA 1FA3A 1A67A 2C11A 2JDIH 1BNRA 4MMXB 5ELUA 2W0QA 1TUHA 4N6OB 4GHOA 1N8R4 2F4YA 3K63A 1GMQA 3STDA 2LQVA 1K734 1BSEA 3LT8A 4BTXA 1RKYA 2C4BA 3F7XA 1VQK3 1UCKA 3KN4A 1IDPA 1W4NA 4FMBA 3Q2PA 4LMIA 2XSOB 1I8VA 2R41A 3G713 3A5EA 1BVIA 1N5PA 3KFQC 3LOYA 1ZGXA 1FZUA 3B4PA 3B8LA 5M19A 1RTUA 3GZYB 4XBYA 3EE1A 1TFOA 3CD63 1LOWA 2HMNB 1VQ53 1OH0A 1Z1SA 3DZLA 1OUNA 4LGQA 2E2TA 3CC43 1FUSA 3D3LA 5EVHA 1A2KA 2A15A 1O7PB 3JUQA 1UI7A 3SX1A 1O7HB 1NJI4 3X41A 2K3DA 1FUTA 1F8NA 1YGWA 2L1SA 4O8SA 9RNTA 2UUGC 2CH9A 3MWZA 4N6LA 4HBRA 1FYSA 5TGNA 1RGHA 2P05A 4FCJA 4HJLB 3BB9A 2YFJB 3FG4A 3V92A 5AIIA 1IT8A 1DVCA 1YVSA 4MMZB 2M7OA 4QWTA 1SQWA 5IG4A 3CCQ3 2K0MA 1RGEA 3CPOA 4O02B 4GB5A 3EX9A
chains in the Genus database with same CATH topology
2J8XB 1UUGB 1EUIC 1UGIA 1LQMB 2UGIA 1UGHI 1LQGC 4LYLB 1UDII 2ZHXB 2UUGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8X B;  1UUG B;  1EUI C;  1UGI A;  1LQM B;  2UGI A;  1UGH I;  1LQG C;  4LYL B;  1UDI I;  2ZHX B;  2UUG C; 
#chains in the Genus database with same CATH topology
 1TTO A;  3OX9 A;  4JRF A;  3IJE B;  3UJM A;  2F98 A;  4BL3 A;  1YI2 3;  1FGT A;  1Q82 4;  1JBR A;  3JUN A;  2ZDJ A;  1AY7 A;  2HML B;  1YJ9 3;  1J2B A;  1TU5 A;  4J8T A;  2IY2 A;  2P0X A;  2P0M A;  4I5Q A;  1B2S A;  2WOH A;  3NQZ A;  4ILF A;  2R4I A;  3FG3 A;  1M9G A;  2IYJ A;  3FZW A;  1OHO A;  5BU4 A;  4J5G A;  1C7H A;  1MGW A;  2XFT A;  3B7C A;  2KCD A;  4L7K A;  1NWW A;  2GU1 A;  3G8Z A;  5M1A A;  1JRQ A;  2HMO B;  3MG1 A;  1OGX A;  2CWV A;  3BU4 A;  3OV4 A;  3LYG A;  1QVF 2;  3CCL 3;  1UGH I;  2Z76 A;  4EYC A;  1TIJ A;  3N8B A;  3SOY A;  1HYF A;  3OWU A;  3CME 3;  3SVA A;  1UCL A;  4JF8 A;  1ISK A;  3FCS B;  1BNI A;  4EBG A;  1UCI A;  1WNH A;  4OUQ A;  1BRS A;  1D6Y A;  1RRH A;  3S27 A;  1AV4 A;  1B2X A;  2CX0 A;  4TX4 A;  4WFO A;  4ZM8 A;  1W5Z A;  3F9S A;  3CCU 3;  1RLS A;  4RNT A;  1M1X B;  2RCD A;  3IPT A;  2QEX 3;  4HM3 B;  5AEU B;  1VQ9 3;  1Q42 A;  5D83 A;  1CH0 A;  3K9M C;  1Q81 4;  1CEW I;  1DYU A;  4NPB A;  4R1K A;  3S67 A;  4XDV A;  2GXF A;  1VQP 3;  4XB5 A;  1VQN 3;  3RGA A;  5CF1 A;  1X1U A;  4HAA A;  3UB1 A;  1SII A;  3FH1 A;  4STD A;  3FGY A;  3PCS A;  4L8O A;  1W6G A;  5IW9 A;  1RCK A;  3D4A A;  1O7M B;  1ZS7 A;  2BT3 A;  2F5M A;  5HGR A;  3GRD A;  1EG9 B;  6GSP A;  1RMS A;  1B27 A;  2BMR B;  3CCS 3;  3GZX B;  2INX A;  3O8Y A;  4HM0 B;  3CNM A;  1MWT A;  3VF1 A;  1I3F A;  3CMA 3;  1A2V A;  1JBT A;  2BNG A;  2QIY A;  2Z77 A;  3HX8 A;  5AI1 A;  1GOY A;  1PFP A;  2Y73 A;  1NB5 I;  3JUO A;  1IV9 A;  1RGA A;  4XBX A;  4LYL B;  1JNQ A;  2BIR A;  3MHE A;  2CFL A;  3GAX A;  5AIG A;  4J5K A;  1B2U A;  1EA2 A;  1Q7H A;  2GU3 A;  3JUM A;  4KVH A;  3AGO A;  2RBI A;  1LQG C;  3I56 3;  1NU3 A;  1LNH A;  1RGK A;  1MNL A;  1EUI C;  1UUW B;  4HYZ A;  1FGQ A;  1MGR A;  3CNX A;  3SLU A;  3I55 3;  4WWU C;  5AEW B;  2XH9 A;  4XDW A;  1RSN A;  3ROB A;  5BVB A;  1VQ8 3;  3ER7 A;  4EV2 A;  4K61 A;  4DKI A;  1K8A 4;  3N9H A;  1B3S A;  1MWS A;  2PNC A;  1BSB A;  1S5A A;  1BUJ A;  1IYY A;  1BRJ A;  4FMD A;  4RNY A;  1KQS 2;  2P38 A;  1BRI A;  1YGE A;  1AQZ A;  2W9P A;  2XFS A;  3OW2 2;  5IG3 A;  1WMO A;  3AMO B;  1T2I A;  1R4Y A;  2CFK A;  1GYB A;  2KRT A;  3LTA A;  3ECF A;  3M8C A;  3NX0 A;  4FCM A;  1OHS A;  1CYU A;  1IVX A;  1LVN A;  1QJG A;  1BAN A;  2CC3 A;  1QMA A;  3WA3 A;  1X1X A;  1TP6 A;  2UX0 A;  3LML A;  1UI8 A;  5IEP A;  3BNB A;  2FXT A;  5RNT A;  3CC2 3;  4I4K A;  1Q7Y 4;  3HK4 A;  3N54 B;  1LOV A;  3VSY A;  4WP5 A;  5ELJ A;  1K9M 4;  1VZZ A;  3AMO A;  4CPK A;  1JKG B;  1X1Y A;  4MJD A;  1VQ6 3;  5A0O B;  2JQ5 A;  4RNZ A;  1B20 A;  1I70 A;  3DH2 A;  3PGB A;  3MG3 A;  3WA2 X;  1W6C A;  2D42 A;  1OGZ A;  1RNT A;  5JBS A;  1IV7 A;  1EEJ A;  1WTH A;  4KFE A;  3NQY A;  1WMP A;  3DUK A;  1W01 A;  1JKG A;  3EC9 A;  3K5T A;  3RNT A;  1BRG A;  3DGY A;  2Y74 A;  2XGN A;  1SAR A;  4HZB B;  1Y4K A;  8CHO A;  1RRL A;  3NBB A;  4ORL A;  3MG2 A;  3S29 A;  1ULJ B;  3L0R A;  3KKG A;  1GMP A;  5AIF A;  1W7C A;  3JUP A;  1Q40 B;  1PY3 A;  2O3O A;  1MOL A;  1C54 A;  4N6V 0;  5DRV A;  3LT9 A;  3CCJ 3;  7GSP A;  1PYL A;  1X1W A;  2PZV A;  4R9L A;  5FGO A;  1BRK A;  3B4O A;  2ZA4 A;  4WYK B;  4N6U A;  2O9U X;  4BTY A;  2C10 A;  5I97 A;  1Q40 A;  1RGF A;  1STD A;  1OF5 B;  1MWR A;  2CG0 A;  2QGU A;  2HOH A;  1JN5 B;  1B2M A;  2BU4 A;  2XGL A;  4WYK A;  3CCR 3;  3X3Y A;  2H0I A;  4RBN A;  5KP1 A;  3D79 A;  1S72 3;  3FF0 A;  3EBT A;  2F86 B;  3V99 A;  2J8X B;  3PCR A;  1OF5 A;  1AVK A;  1A90 A;  1JZO A;  3D5I A;  1B2Z A;  2CWT A;  3DGN A;  2F99 A;  1T5Y A;  1JN5 A;  2H0G A;  3DM8 A;  3PXM A;  5G1L A;  1WMN A;  4H3U A;  1V57 A;  1D6Z A;  3K7C A;  1BOX A;  1W00 A;  2IA7 A;  1TJD A;  5BIR A;  3MSO A;  4BL2 A;  4HM7 B;  2CFG A;  1YVB I;  3LZA A;  4R80 A;  3WOE B;  4N3V A;  2BHM A;  2KF6 A;  3EF8 A;  3K0Z A;  1HZ1 A;  5G2G A;  3CPW 2;  4EW5 A;  2CWU A;  3T8N A;  3CCE 3;  2CKF B;  1PU4 A;  1AR0 A;  4BIR A;  3Q3F A;  1SJW A;  2ML5 A;  3BLZ A;  3NXJ A;  1BRH A;  3DGO A;  1IQY A;  1RN7 A;  3NHX A;  4R4K A;  3HIG A;  1BNS A;  2KF3 A;  2MF7 A;  3EN8 A;  3FKA A;  3GSP A;  3OWS A;  5IF6 A;  2W6J H;  2F5W A;  5BXQ A;  3DGL A;  3NM2 A;  3SED A;  1EQK A;  4OVM A;  1T2H A;  1KC8 4;  1I2G A;  2XSH B;  7RNT A;  1G02 A;  1OCV A;  1OPY A;  1WQL B;  1I0V A;  2CFW A;  1I3I A;  1BSD A;  6STD A;  3RDE A;  3NUV A;  1BNF A;  1YJN 3;  1JB2 A;  2CHC A;  5JPP A;  1YJW 3;  1RDS A;  2AAE A;  2HMK B;  2W56 B;  3EN1 B;  4L8P A;  2GSP A;  4N6M A;  4AEQ A;  2OQE C;  1YNV X;  3KE7 A;  2OWP A;  1BRN L;  4KT3 B;  3F14 A;  2BO9 B;  4GSP A;  1VQL 3;  4Q53 A;  1E3R A;  1DVD A;  1BIR A;  1QAL A;  2W56 A;  1I2E A;  3EJV A;  3OXA A;  1L5G B;  3URP A;  3SXX A;  1W2B 2;  1ROV A;  1W02 A;  4MMY B;  4WHA A;  3WOF B;  4CDL A;  3AHW A;  3WMD A;  4AKY A;  3MPH A;  1DMM A;  1RHL A;  1ULI B;  1IT7 A;  3F8X A;  2KAA A;  4K1V A;  1BNE A;  1TRP A;  3X3Z A;  1UCJ A;  1VQQ A;  1US1 A;  2CX1 A;  2H0H A;  3KCH A;  3GZB A;  1YHQ 3;  5LC6 A;  1FGR A;  1RN1 A;  2QA4 3;  1OHP A;  2CFD A;  4HM5 B;  1T3B A;  3FLJ A;  1UDI I;  2CIU A;  3DMC A;  1IVV A;  4XBT A;  3FG1 A;  2ML6 A;  4KZ1 A;  1LQM B;  3I0Y A;  3EHC A;  3NBJ A;  4NRE A;  3CCV 3;  2CG1 A;  3EB8 A;  4HM1 B;  4KFF A;  1BAO A;  1KSI A;  3BNC A;  1DMN A;  4HM6 B;  4LZI A;  4FR9 A;  1U5O A;  3KSE D;  1I2F A;  1QAF A;  1DMQ A;  2GBW B;  3PZW A;  4GL6 A;  1GD4 A;  4N6T A;  5DRE A;  1FW7 A;  1CQS A;  2E2U A;  4G1M B;  1OAC A;  1BGS A;  3AGN A;  4OK0 A;  2KXG A;  3G6E 3;  5D81 A;  1GY5 A;  4HM4 B;  3MYT A;  4K90 B;  3HZP A;  3X3X A;  3HII A;  1VQO 3;  3LTD A;  1JJ2 2;  3NBR A;  4X2H A;  3ZG5 A;  1NNV A;  1RCL A;  2WGO A;  4U13 A;  3WOD G;  4BU4 A;  1AVL A;  1HU9 A;  4R9K A;  2GBX B;  1YIT 3;  3VGN A;  1LOY A;  1QAK A;  4HZ9 B;  4BTW A;  3TDG A;  5GSP A;  2E2V A;  4IIA A;  3MKI A;  2GEY A;  1LXE A;  1SIH A;  3KZT A;  6RNT A;  1U8C B;  1BNJ A;  5IG0 A;  2OCT A;  4EC6 A;  1FUW A;  4HKV B;  3ZFZ A;  1G0T A;  2Z6B A;  1Q86 4;  2D1W A;  2MC8 A;  4FMC A;  5FW5 A;  2I9W A;  3SYU A;  2KF5 A;  3WR2 A;  2WOF A;  5EQL A;  1GS3 A;  1JB4 A;  1SPU A;  3X40 A;  1TFK A;  1KWI A;  5AYS C;  1JBS A;  1STF I;  1IK3 A;  1EKM A;  2V1L A;  1V74 A;  1NB3 I;  3U1W A;  2XEP A;  3FSD A;  5KP3 A;  4O2H A;  3F8H A;  1BSC A;  3BND A;  3DXO A;  3GWR A;  2RSX A;  4EV5 A;  1JB5 A;  1GY6 A;  3DGM A;  2RGQ A;  2SBL A;  3LXU X;  2GEX A;  2YFL B;  1CYV A;  3CU3 A;  2XRX B;  3KII A;  4XM4 A;  3S28 A;  3T8U A;  2BMQ B;  2HMJ B;  2BMO B;  3F40 A;  5IG5 A;  1LRA A;  2CW9 A;  3LTC A;  5G1K A;  3T0U A;  3WDG B;  2FGT A;  3U97 A;  2Z7A A;  1QVG 2;  5HOH A;  1Q9E A;  2W2C A;  4EXR A;  1DET A;  1I0X A;  1K41 A;  3F7S A;  1ZO2 A;  4IPB A;  1ZX2 A;  4HOH A;  1RN4 A;  4CJN A;  3UL5 A;  2F56 A;  4K1U A;  4RZM A;  5EEO A;  4PEJ A;  3G4S 3;  1BNG A;  2AAD A;  1BUQ A;  1W6Y A;  1N8Q A;  5KP4 A;  2XR8 B;  3G0K A;  7STD A;  1N9E A;  2W9Q A;  2WGQ A;  4X2O A;  2B24 B;  2HMM B;  1NDO B;  1VQ7 3;  3NM7 A;  3AHS A;  4HM8 B;  1RGC A;  4KFD A;  1IVU A;  1G96 A;  5IER A;  1UGI A;  1IQX A;  5LC7 A;  3HI7 A;  2OTL 3;  2FNQ A;  1LOX A;  1V58 A;  2XF3 A;  5STD A;  2P09 A;  1N5H A;  2IUK A;  3HOH A;  3IMA B;  3QK9 A;  3FF2 A;  2YFI B;  1YIJ 3;  3A76 A;  1GOV A;  1MWU A;  4N6N B;  3EQQ B;  3WHO A;  1A2P A;  2IMJ A;  2KF4 A;  8RNT A;  1B21 A;  4IT7 A;  1HKX A;  2K54 A;  4J9A A;  1IVW A;  1GD3 A;  2YX9 A;  3QRD A;  2LYX A;  1K28 A;  3BIR A;  3LTB A;  1JZD A;  3BNE A;  1IQ8 A;  3V98 A;  3KSP A;  5CLK A;  1KD1 4;  3CCM 3;  4HVN A;  3UL6 A;  3NV0 B;  3CC7 3;  1O7N B;  2OQE A;  2OOV C;  4FMA A;  3UNL A;  1W2Z A;  1TRQ A;  2SAR A;  1VQM 3;  5CF2 A;  3H51 A;  2RFR A;  3ZG0 A;  2ZL8 A;  1GOU A;  1GSP A;  3PS8 A;  5D82 A;  3S5C A;  2OOV A;  2CK3 H;  5CK6 A;  3LH4 A;  1E97 A;  5JPU A;  1RNB A;  3NV0 A;  1N9J A;  5AYR B;  1FGO A;  3ALA A;  3D9R A;  1GMR A;  2L4V A;  3X42 A;  1DE3 A;  5IEO A;  4H61 A;  3E99 A;  1BSA A;  2W03 A;  4LSO A;  2B1X B;  3Q1C A;  1R4C A;  1GY7 A;  3GZR A;  1RJO A;  2WO0 A;  1BU4 A;  2UGI A;  2OTJ 3;  4CCV A;  3J7Y d;  1FGM A;  4MEI A;  5CXO A;  3H3H A;  5IEN A;  3OWY A;  4HM2 B;  3SOA A;  1E3V A;  1UUG B;  3D5G A;  3PYJ A;  1D6U A;  2STD A;  5M18 A;  1ASK A;  1O7G B;  2RNT A;  4AKZ A;  1RGG A;  1JV2 B;  1LNI A;  1O7W B;  1ROA A;  1UUV B;  3CXC 2;  1UW1 A;  3G16 A;  1M90 4;  2W04 A;  5AIH A;  3EBY A;  1M1K 4;  3DY5 A;  1RGL A;  4FCZ A;  4NHF A;  3Q90 A;  3RGR A;  2IUJ A;  2ZHX B;  1IU7 A;  1VQ4 3;  3JVC A;  4LEH A;  1NO3 A;  2Q07 A;  4O3V A;  1FA3 A;  1A67 A;  2C11 A;  2JDI H;  1BNR A;  4MMX B;  5ELU A;  2W0Q A;  1TUH A;  4N6O B;  4GHO A;  1N8R 4;  2F4Y A;  3K63 A;  1GMQ A;  3STD A;  2LQV A;  1K73 4;  1BSE A;  3LT8 A;  4BTX A;  1RKY A;  2C4B A;  3F7X A;  1VQK 3;  1UCK A;  3KN4 A;  1IDP A;  1W4N A;  4FMB A;  3Q2P A;  4LMI A;  2XSO B;  1I8V A;  2R41 A;  3G71 3;  3A5E A;  1BVI A;  1N5P A;  3KFQ C;  3LOY A;  1ZGX A;  1FZU A;  3B4P A;  3B8L A;  5M19 A;  1RTU A;  3GZY B;  4XBY A;  3EE1 A;  1TFO A;  3CD6 3;  1LOW A;  2HMN B;  1VQ5 3;  1OH0 A;  1Z1S A;  3DZL A;  1OUN A;  4LGQ A;  2E2T A;  3CC4 3;  1FUS A;  3D3L A;  5EVH A;  1A2K A;  2A15 A;  1O7P B;  3JUQ A;  1UI7 A;  3SX1 A;  1O7H B;  1NJI 4;  3X41 A;  2K3D A;  1FUT A;  1F8N A;  1YGW A;  2L1S A;  4O8S A;  9RNT A;  2UUG C;  2CH9 A;  3MWZ A;  4N6L A;  4HBR A;  1FYS A;  5TGN A;  1RGH A;  2P05 A;  4FCJ A;  4HJL B;  3BB9 A;  2YFJ B;  3FG4 A;  3V92 A;  5AII A;  1IT8 A;  1DVC A;  1YVS A;  4MMZ B;  2M7O A;  4QWT A;  1SQW A;  5IG4 A;  3CCQ 3;  2K0M A;  1RGE A;  3CPO A;  4O02 B;  4GB5 A;  3EX9 A; 
#chains in the Genus database with same CATH homology
 2J8X B;  1UUG B;  1EUI C;  1UGI A;  1LQM B;  2UGI A;  1UGH I;  1LQG C;  4LYL B;  1UDI I;  2ZHX B;  2UUG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...