1LQGC

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
TGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 9
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqgC00
2J8XB 2UGIA 1UDII 1UGIA 2ZHXB 1EUIC 1UGHI 1UUGB 2UUGC 1LQGC 4LYLB 1LQMB
chains in the Genus database with same CATH superfamily
1BNFA 3NV0A 3FKAA 3NBRA 4RNZA 3SXXA 1LXEA 3V98A 1GMRA 2QIYA 3NX0A 1QMAA 2GSPA 5CF2A 2KAAA 1FUTA 4CDLA 3KFQC 5BVBA 4U13A 2HMNB 3BB9A 3V92A 1DVCA 1GOVA 3F9SA 1GY7A 4MMYB 1BNSA 2F86B 3DGOA 2WOFA 2Z76A 3Q3FA 4O8SA 1RGKA 2H0GA 3EF8A 5D83A 1OHOA 3I553 1VQ73 3AHWA 3CCV3 2YFLB 4K90B 3Q90A 5EEOA 2GU1A 6STDA 2R4IA 4STDA 1TRQA 4LZIA 2OQEC 1VQL3 1WMNA 1I3IA 3ZG5A 1MWTA 1QVF2 2F4YA 2OOVC 3D9RA 3CCE3 3LTCA 3CCR3 3FG4A 3RGRA 1HU9A 1JN5A 4WP5A 1YGWA 1ZX2A 1BIRA 1BRSA 3DGLA 3GWRA 1CYVA 1X1UA 5FW5A 3F7XA 3S28A 1B20A 1W6GA 4HZBB 1JN5B 4TX4A 1B2XA 4XBXA 3S27A 5KP1A 1MWSA 1VQP3 1BUJA 1O7NB 1BUQA 4LGQA 5KP3A 2CX1A 2FGTA 2OCTA 2RFRA 6RNTA 2W9PA 1RCKA 1RN4A 3K63A 3CPW2 4FCJA 3IMAB 1I8VA 2UX0A 4BTXA 1R4YA 4HAAA 5A0OB 1W00A 2BMRB 3QRDA 2CFKA 1TFKA 1CYUA 1AQZA 1TTOA 1UI8A 2W56B 1B2UA 2CC3A 1MWUA 3MSOA 4I4KA 5DREA 3UL6A 3FCSB 1GY6A 2P0XA 5GSPA 3DY5A 2INXA 2C11A 1LRAA 3QK9A 4BU4A 1KQS2 1WMOA 5IG5A 2QEX3 1VQ83 1OF5B 3JUPA 4HM4B 4AKZA 1ASKA 1FW7A 5G1KA 3URPA 1B27A 2SARA 2J8XB 1JBTA 1ZO2A 2CWVA 1JZDA 2L4VA 3DUKA 1TP6A 3OV4A 1ROVA 4GSPA 4IIAA 1RGAA 4NHFA 1EQKA 1LOWA 1PFPA 5BIRA 1VQN3 1JB2A 2I9WA 1JJ22 3LOYA 4OK0A 2HMLB 2Z6BA 1C7HA 1RJOA 2FXTA 6GSPA 1VQM3 1STFI 2F98A 3FZWA 4R80A 3UNLA 1K28A 3OXAA 1VQ53 1VQ93 2P38A 2O9UX 2KCDA 2W6JH 3PCRA 4N3VA 4KVHA 1YVSA 2CFWA 2HOHA 2RBIA 2SBLA 3U97A 1QJGA 3CCJ3 3GZXB 1RGFA 1I0XA 2GU3A 4RNTA 1FYSA 3KSPA 3B7CA 2XRXB 1UGHI 1IYYA 4FMCA 3MWZA 3NBJA 3NUVA 2GBWB 3KKGA 1EA2A 2K54A 1N8QA 2WOHA 2XH9A 4LSOA 4OVMA 4GL6A 4J9AA 1DETA 2CWUA 1JB5A 5IG0A 2W0QA 3G4S3 1AVLA 3PCSA 1JKGB 3H51A 1X1WA 4X2HA 5IG4A 1AR0A 2XGNA 4G1MB 3PS8A 5AYRB 3LT8A 3OW22 2XEPA 4ORLA 3SX1A 3V99A 3LH4A 4NREA 2C10A 4H61A 5M1AA 3FLJA 8CHOA 1RMSA 3BIRA 3WMDA 1VQK3 1M9GA 4EC6A 1DE3A 2W9QA 3HX8A 5ELJA 3WR2A 1Q40A 1IV7A 1UUVB 2CFLA 2GBXB 1LQMB 2D42A 1STDA 4HJLB 2F5MA 1EKMA 1ZS7A 2L1SA 1I70A 2KF4A 1GS3A 1OGZA 2YFIB 3N54B 4N6UA 2KF6A 3KZTA 4ILFA 3J7Yd 1YHQ3 2K3DA 3AHSA 1MNLA 2STDA 3DZLA 3H3HA 3OWSA 2ML5A 2GXFA 4L8OA 4HBRA 1BGSA 1LOYA 4N6LA 2P05A 5LC7A 4XBYA 1WMPA 2Z77A 1N8R4 1DVDA 3S5CA 2BMOB 2XFSA 4IPBA 1UDII 4HYZA 3G16A 4WYKB 5AIHA 1LOVA 2RCDA 3MKIA 1FGTA 1W6CA 1BSBA 2B1XB 5BU4A 3DGMA 1WNHA 5HOHA 1RN7A 3WOFB 2ZHXB 1ULJB 2KF3A 4EBGA 1BSEA 2CW9A 3JUMA 1WTHA 4HZ9B 1NB3I 7GSPA 1BRKA 1W2ZA 3CD63 3UB1A 2ML6A 4LEHA 3F8HA 4R9KA 1RGGA 2IMJA 2BHMA 4CJNA 5FGOA 4HM7B 1UGIA 3BLZA 5CF1A 1EUIC 2IA7A 4KT3B 2OOVA 2HMKB 1FGQA 2CKFB 3ZG0A 3BU4A 3GRDA 3HOHA 4L7KA 1OUNA 3MPHA 2W56A 2PZVA 2MC8A 1LNIA 1X1XA 3FG3A 2XSHB 1F8NA 1QAFA 2JQ5A 4J5GA 1W01A 3EN1B 3T8UA 1Q7HA 1S723 4EV5A 1UW1A 1PY3A 5STDA 3AGOA 3NM2A 3ALAA 3UL5A 3FG1A 5D82A 3DM8A 3NBBA 1ZGXA 4FMBA 1YJN3 1AVKA 3HI7A 3RDEA 3K0ZA 4HKVB 3S29A 3MHEA 4AEQA 3KIIA 4RZMA 5CK6A 1UI7A 1W4NA 3JVCA 1BRNL 1A67A 3L0RA 1UUGB 2F5WA 1LOXA 4KFFA 1GYBA 1GOUA 1W5ZA 4O02B 1JNQA 3CNXA 3CXC2 3MG2A 5D81A 3GZBA 3X3XA 3A5EA 4FR9A 1JKGA 4LYLB 5AEWB 3PXMA 1IVXA 1NNVA 3EB8A 3PYJA 4HM0B 1YJ93 1B2SA 2LQVA 2OTJ3 3LYGA 3U1WA 5KP4A 4O3VA 1IVUA 1BNRA 1OHSA 2CG0A 3GAXA 2JDIH 2IUJA 4N6NB 3WHOA 1W02A 5AIGA 2CK3H 3EQQB 2W03A 4BL2A 1CEWI 2MF7A 1YJW3 1IT7A 4EV2A 1LVNA 1HYFA 3N8BA 1NDOB 3EJVA 4WFOA 3WODG 3CC43 1ULIB 1RRLA 1Q9EA 4K1VA 1B2MA 1MGWA 1FGMA 1W2B2 1KWIA 3K9MC 4X2OA 4CPKA 3NXJA 3SOYA 3HZPA 4GHOA 3CMA3 3FH1A 3OWUA 1D6ZA 1N9EA 1OH0A 1G0TA 4XM4A 1JB4A 1BRGA 3NM7A 1DYUA 3TDGA 4BIRA 5CXOA 1PU4A 1E3VA 3LTDA 2BO9B 3JUQA 2H0HA 1Q40B 1M1K4 3GZYB 3B8LA 1NJI4 3ER7A 4CCVA 3WA3A 2CFDA 1K9M4 3LXUX 2F56A 3EN8A 3CPOA 4WHAA 1OGXA 3I0YA 1CH0A 2BT3A 2BU4A 3ROBA 1VQ63 1O7WB 2ZA4A 3FF2A 3RGAA 2W2CA 2P0MA 4N6TA 1V58A 1I2FA 1G96A 1CQSA 2R41A 3HIGA 1GD4A 5BXQA 2RSXA 1UCJA 2PNCA 4HVNA 1OPYA 3BNDA 1SIHA 1K734 2QGUA 4FMAA 2OQEA 1BRHA 1YNVX 1GY5A 2RGQA 4PEJA 3X3ZA 1O7HB 2E2VA 3AGNA 3JUOA 1U8CB 3Q2PA 3VF1A 5JBSA 1JBSA 3DGYA 1UCIA 3D79A 3LTBA 5M19A 1GMPA 1IQYA 4R9LA 3B4PA 4K1UA 3CCQ3 1FUWA 1BNIA 4XDVA 4K61A 4MMZB 1T2IA 4XDWA 3STDA 1X1YA 8RNTA 3F40A 4O2HA 2UUGC 5G2GA 1Z1SA 4H3UA 3SLUA 2HMJB 5CLKA 1UUWB 4JF8A 3CCU3 1U5OA 2M7OA 3GSPA 2CWTA 3VSYA 4HM8B 3FF0A 3K5TA 1BU4A 1RCLA 4L8PA 5IF6A 5IEPA 4RBNA 1RGCA 3HIIA 2A15A 3F7SA 1O7PB 3UJMA 3EHCA 3G6E3 2WGQA 1BRJA 1I0VA 1W6YA 1K8A4 4FCMA 3PZWA 5AIIA 3CNMA 1RHLA 5EVHA 5IERA 5IEOA 2E2TA 1LNHA 2CH9A 4ZM8A 5AEUB 1IQ8A 4HM1B 4EYCA 1Y4KA 4XB5A 1QVG2 3X41A 1YI23 3DXOA 5IENA 2CFGA 2V1LA 1AV4A 1YGEA 1E3RA 5EQLA 3CME3 1US1A 1RN1A 3BNCA 2HMMB 1HKXA 1OHPA 4DKIA 1MWRA 1T2HA 3KSED 3SOAA 1GSPA 3NHXA 3OX9A 1EG9B 1IVWA 1RGHA 2CIUA 2H0IA 3WA2X 3B4OA 4LMIA 3X40A 9RNTA 2GEXA 5LC6A 1OF5A 3BNEA 1IK3A 3FGYA 1TIJA 1JV2B 4J8TA 2Y74A 4BTYA 5AYSC 3ECFA 1UCLA 3ZFZA 1VQO3 4N6OB 4HM6B 2CX0A 2LYXA 1FZUA 1I2GA 5JPPA 1GD3A 2ZL8A 3LMLA 1TUHA 1A2KA 2O3OA 1BNGA 3NV0B 1VZZA 3MYTA 1D6UA 1OACA 1SJWA 1SQWA 3F8XA 3WDGB 7STDA 2K0MA 1TFOA 2BMQB 1QALA 1T3BA 1W7CA 3EBYA 3BNBA 3SYUA 3X3YA 3G8ZA 1SPUA 3A76A 1KC84 3AMOB 1R4CA 2AAEA 3NQZA 1ISKA 3CU3A 1C54A 3GZRA 1JRQA 1E97A 1BAOA 3CCM3 2OTL3 2WGOA 3DMCA 2WO0A 1V57A 1RGEA 1WQLB 2CHCA 3AMOA 4FCZA 4HOHA 5RNTA 1BNJA 3E99A 3N9HA 3MG3A 4HM5B 4MEIA 1DMNA 1RDSA 3KE7A 2AADA 4JRFA 3LTAA 3S67A 1BVIA 1RSNA 1BRIA 1AY7A 1IQXA 4IT7A 5I97A 3O8YA 3HK4A 4EW5A 1Q42A 2RNTA 4NPBA 1FA3A 3MG1A 1M1XB 3CCS3 1UCKA 5ELUA 1RTUA 1RKYA 1FGOA 1J2BA 1YIT3 2W04A 1HZ1A 1O7MB 4I5QA 1YVBI 3Q1CA 3SEDA 1RRHA 4J5KA 1RNBA 1M904 1YIJ3 1T5YA 1Q7Y4 1BNEA 2KRTA 1BSCA 1IDPA 4RNYA 2YFJB 3D5GA 3F14A 5JPUA 1NU3A 1O7GB 2XF3A 1EEJA 4FMDA 1IT8A 1RNTA 4MJDA 4N6MA 1BANA 1NWWA 1VQQA 5IG3A 1FUSA 4MMXB 1OCVA 2ZDJA 3EBTA 1B3SA 7RNTA 2XFTA 1A2VA 2Y73A 3T8NA 2Z7AA 4BTWA 4HM3B 1TU5A 3T0UA 1B2ZA 2UGIA 4OUQA 2Q07A 1IU7A 3I563 3EE1A 4WYKA 4Q53A 2IYJA 1NO3A 3NQYA 5G1LA 5IW9A 2OWPA 2BNGA 2GEYA 1D6YA 3JUNA 3EC9A 1B21A 1N5HA 3RNTA 3KCHA 1L5GB 1I2EA 1I3FA 2D1WA 1N9JA 1MGRA 2QA43 5AIFA 1DMMA 1A2PA 3G713 1N5PA 1SIIA 3D3LA 3G0KA 1K41A 2C4BA 2HMOB 2P09A 2XSOB 1V74A 1VQ43 2IUKA 4N6V0 3CC23 1KD14 1ROAA 3CC73 3PGBA 1TJDA 1BSAA 1BOXA 2XGLA 3D5IA 4HM2B 4QWTA 2FNQA 5TGNA 1BSDA 3SVAA 3VGNA 3M8CA 2E2UA 2BIRA 3WOEB 4WWUC 1Q814 3CCL3 1Q864 4R1KA 1LQGC 1RGLA 1IVVA 5DRVA 3X42A 5M18A 1PYLA 3OWYA 2KXGA 3K7CA 1DMQA 1IV9A 4EXRA 1S5AA 2XR8B 2F99A 3DH2A 1JZOA 1GOYA 4KFEA 5AI1A 3DGNA 2YX9A 2CG1A 1KSIA 1SARA 1MOLA 2KF5A 3LT9A 4AKYA 4R4KA 1Q824 3KN4A 4XBTA 1A90A 1QAKA 1FGRA 3LZAA 5HGRA 2IY2A 3FSDA 3D4AA 4KZ1A 1NB5I 1G02A 4GB5A 4KFDA 1GMQA 3EX9A 1JBRA 1RLSA 3IPTA 2B24B 4BL3A 1TRPA 3IJEB
chains in the Genus database with same CATH topology
2J8XB 2UGIA 1UDII 1UGIA 2ZHXB 1EUIC 1UGHI 1UUGB 2UUGC 1LQGC 4LYLB 1LQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8X B;  2UGI A;  1UDI I;  1UGI A;  2ZHX B;  1EUI C;  1UGH I;  1UUG B;  2UUG C;  1LQG C;  4LYL B;  1LQM B; 
#chains in the Genus database with same CATH topology
 1BNF A;  3NV0 A;  3FKA A;  3NBR A;  4RNZ A;  3SXX A;  1LXE A;  3V98 A;  1GMR A;  2QIY A;  3NX0 A;  1QMA A;  2GSP A;  5CF2 A;  2KAA A;  1FUT A;  4CDL A;  3KFQ C;  5BVB A;  4U13 A;  2HMN B;  3BB9 A;  3V92 A;  1DVC A;  1GOV A;  3F9S A;  1GY7 A;  4MMY B;  1BNS A;  2F86 B;  3DGO A;  2WOF A;  2Z76 A;  3Q3F A;  4O8S A;  1RGK A;  2H0G A;  3EF8 A;  5D83 A;  1OHO A;  3I55 3;  1VQ7 3;  3AHW A;  3CCV 3;  2YFL B;  4K90 B;  3Q90 A;  5EEO A;  2GU1 A;  6STD A;  2R4I A;  4STD A;  1TRQ A;  4LZI A;  2OQE C;  1VQL 3;  1WMN A;  1I3I A;  3ZG5 A;  1MWT A;  1QVF 2;  2F4Y A;  2OOV C;  3D9R A;  3CCE 3;  3LTC A;  3CCR 3;  3FG4 A;  3RGR A;  1HU9 A;  1JN5 A;  4WP5 A;  1YGW A;  1ZX2 A;  1BIR A;  1BRS A;  3DGL A;  3GWR A;  1CYV A;  1X1U A;  5FW5 A;  3F7X A;  3S28 A;  1B20 A;  1W6G A;  4HZB B;  1JN5 B;  4TX4 A;  1B2X A;  4XBX A;  3S27 A;  5KP1 A;  1MWS A;  1VQP 3;  1BUJ A;  1O7N B;  1BUQ A;  4LGQ A;  5KP3 A;  2CX1 A;  2FGT A;  2OCT A;  2RFR A;  6RNT A;  2W9P A;  1RCK A;  1RN4 A;  3K63 A;  3CPW 2;  4FCJ A;  3IMA B;  1I8V A;  2UX0 A;  4BTX A;  1R4Y A;  4HAA A;  5A0O B;  1W00 A;  2BMR B;  3QRD A;  2CFK A;  1TFK A;  1CYU A;  1AQZ A;  1TTO A;  1UI8 A;  2W56 B;  1B2U A;  2CC3 A;  1MWU A;  3MSO A;  4I4K A;  5DRE A;  3UL6 A;  3FCS B;  1GY6 A;  2P0X A;  5GSP A;  3DY5 A;  2INX A;  2C11 A;  1LRA A;  3QK9 A;  4BU4 A;  1KQS 2;  1WMO A;  5IG5 A;  2QEX 3;  1VQ8 3;  1OF5 B;  3JUP A;  4HM4 B;  4AKZ A;  1ASK A;  1FW7 A;  5G1K A;  3URP A;  1B27 A;  2SAR A;  2J8X B;  1JBT A;  1ZO2 A;  2CWV A;  1JZD A;  2L4V A;  3DUK A;  1TP6 A;  3OV4 A;  1ROV A;  4GSP A;  4IIA A;  1RGA A;  4NHF A;  1EQK A;  1LOW A;  1PFP A;  5BIR A;  1VQN 3;  1JB2 A;  2I9W A;  1JJ2 2;  3LOY A;  4OK0 A;  2HML B;  2Z6B A;  1C7H A;  1RJO A;  2FXT A;  6GSP A;  1VQM 3;  1STF I;  2F98 A;  3FZW A;  4R80 A;  3UNL A;  1K28 A;  3OXA A;  1VQ5 3;  1VQ9 3;  2P38 A;  2O9U X;  2KCD A;  2W6J H;  3PCR A;  4N3V A;  4KVH A;  1YVS A;  2CFW A;  2HOH A;  2RBI A;  2SBL A;  3U97 A;  1QJG A;  3CCJ 3;  3GZX B;  1RGF A;  1I0X A;  2GU3 A;  4RNT A;  1FYS A;  3KSP A;  3B7C A;  2XRX B;  1UGH I;  1IYY A;  4FMC A;  3MWZ A;  3NBJ A;  3NUV A;  2GBW B;  3KKG A;  1EA2 A;  2K54 A;  1N8Q A;  2WOH A;  2XH9 A;  4LSO A;  4OVM A;  4GL6 A;  4J9A A;  1DET A;  2CWU A;  1JB5 A;  5IG0 A;  2W0Q A;  3G4S 3;  1AVL A;  3PCS A;  1JKG B;  3H51 A;  1X1W A;  4X2H A;  5IG4 A;  1AR0 A;  2XGN A;  4G1M B;  3PS8 A;  5AYR B;  3LT8 A;  3OW2 2;  2XEP A;  4ORL A;  3SX1 A;  3V99 A;  3LH4 A;  4NRE A;  2C10 A;  4H61 A;  5M1A A;  3FLJ A;  8CHO A;  1RMS A;  3BIR A;  3WMD A;  1VQK 3;  1M9G A;  4EC6 A;  1DE3 A;  2W9Q A;  3HX8 A;  5ELJ A;  3WR2 A;  1Q40 A;  1IV7 A;  1UUV B;  2CFL A;  2GBX B;  1LQM B;  2D42 A;  1STD A;  4HJL B;  2F5M A;  1EKM A;  1ZS7 A;  2L1S A;  1I70 A;  2KF4 A;  1GS3 A;  1OGZ A;  2YFI B;  3N54 B;  4N6U A;  2KF6 A;  3KZT A;  4ILF A;  3J7Y d;  1YHQ 3;  2K3D A;  3AHS A;  1MNL A;  2STD A;  3DZL A;  3H3H A;  3OWS A;  2ML5 A;  2GXF A;  4L8O A;  4HBR A;  1BGS A;  1LOY A;  4N6L A;  2P05 A;  5LC7 A;  4XBY A;  1WMP A;  2Z77 A;  1N8R 4;  1DVD A;  3S5C A;  2BMO B;  2XFS A;  4IPB A;  1UDI I;  4HYZ A;  3G16 A;  4WYK B;  5AIH A;  1LOV A;  2RCD A;  3MKI A;  1FGT A;  1W6C A;  1BSB A;  2B1X B;  5BU4 A;  3DGM A;  1WNH A;  5HOH A;  1RN7 A;  3WOF B;  2ZHX B;  1ULJ B;  2KF3 A;  4EBG A;  1BSE A;  2CW9 A;  3JUM A;  1WTH A;  4HZ9 B;  1NB3 I;  7GSP A;  1BRK A;  1W2Z A;  3CD6 3;  3UB1 A;  2ML6 A;  4LEH A;  3F8H A;  4R9K A;  1RGG A;  2IMJ A;  2BHM A;  4CJN A;  5FGO A;  4HM7 B;  1UGI A;  3BLZ A;  5CF1 A;  1EUI C;  2IA7 A;  4KT3 B;  2OOV A;  2HMK B;  1FGQ A;  2CKF B;  3ZG0 A;  3BU4 A;  3GRD A;  3HOH A;  4L7K A;  1OUN A;  3MPH A;  2W56 A;  2PZV A;  2MC8 A;  1LNI A;  1X1X A;  3FG3 A;  2XSH B;  1F8N A;  1QAF A;  2JQ5 A;  4J5G A;  1W01 A;  3EN1 B;  3T8U A;  1Q7H A;  1S72 3;  4EV5 A;  1UW1 A;  1PY3 A;  5STD A;  3AGO A;  3NM2 A;  3ALA A;  3UL5 A;  3FG1 A;  5D82 A;  3DM8 A;  3NBB A;  1ZGX A;  4FMB A;  1YJN 3;  1AVK A;  3HI7 A;  3RDE A;  3K0Z A;  4HKV B;  3S29 A;  3MHE A;  4AEQ A;  3KII A;  4RZM A;  5CK6 A;  1UI7 A;  1W4N A;  3JVC A;  1BRN L;  1A67 A;  3L0R A;  1UUG B;  2F5W A;  1LOX A;  4KFF A;  1GYB A;  1GOU A;  1W5Z A;  4O02 B;  1JNQ A;  3CNX A;  3CXC 2;  3MG2 A;  5D81 A;  3GZB A;  3X3X A;  3A5E A;  4FR9 A;  1JKG A;  4LYL B;  5AEW B;  3PXM A;  1IVX A;  1NNV A;  3EB8 A;  3PYJ A;  4HM0 B;  1YJ9 3;  1B2S A;  2LQV A;  2OTJ 3;  3LYG A;  3U1W A;  5KP4 A;  4O3V A;  1IVU A;  1BNR A;  1OHS A;  2CG0 A;  3GAX A;  2JDI H;  2IUJ A;  4N6N B;  3WHO A;  1W02 A;  5AIG A;  2CK3 H;  3EQQ B;  2W03 A;  4BL2 A;  1CEW I;  2MF7 A;  1YJW 3;  1IT7 A;  4EV2 A;  1LVN A;  1HYF A;  3N8B A;  1NDO B;  3EJV A;  4WFO A;  3WOD G;  3CC4 3;  1ULI B;  1RRL A;  1Q9E A;  4K1V A;  1B2M A;  1MGW A;  1FGM A;  1W2B 2;  1KWI A;  3K9M C;  4X2O A;  4CPK A;  3NXJ A;  3SOY A;  3HZP A;  4GHO A;  3CMA 3;  3FH1 A;  3OWU A;  1D6Z A;  1N9E A;  1OH0 A;  1G0T A;  4XM4 A;  1JB4 A;  1BRG A;  3NM7 A;  1DYU A;  3TDG A;  4BIR A;  5CXO A;  1PU4 A;  1E3V A;  3LTD A;  2BO9 B;  3JUQ A;  2H0H A;  1Q40 B;  1M1K 4;  3GZY B;  3B8L A;  1NJI 4;  3ER7 A;  4CCV A;  3WA3 A;  2CFD A;  1K9M 4;  3LXU X;  2F56 A;  3EN8 A;  3CPO A;  4WHA A;  1OGX A;  3I0Y A;  1CH0 A;  2BT3 A;  2BU4 A;  3ROB A;  1VQ6 3;  1O7W B;  2ZA4 A;  3FF2 A;  3RGA A;  2W2C A;  2P0M A;  4N6T A;  1V58 A;  1I2F A;  1G96 A;  1CQS A;  2R41 A;  3HIG A;  1GD4 A;  5BXQ A;  2RSX A;  1UCJ A;  2PNC A;  4HVN A;  1OPY A;  3BND A;  1SIH A;  1K73 4;  2QGU A;  4FMA A;  2OQE A;  1BRH A;  1YNV X;  1GY5 A;  2RGQ A;  4PEJ A;  3X3Z A;  1O7H B;  2E2V A;  3AGN A;  3JUO A;  1U8C B;  3Q2P A;  3VF1 A;  5JBS A;  1JBS A;  3DGY A;  1UCI A;  3D79 A;  3LTB A;  5M19 A;  1GMP A;  1IQY A;  4R9L A;  3B4P A;  4K1U A;  3CCQ 3;  1FUW A;  1BNI A;  4XDV A;  4K61 A;  4MMZ B;  1T2I A;  4XDW A;  3STD A;  1X1Y A;  8RNT A;  3F40 A;  4O2H A;  2UUG C;  5G2G A;  1Z1S A;  4H3U A;  3SLU A;  2HMJ B;  5CLK A;  1UUW B;  4JF8 A;  3CCU 3;  1U5O A;  2M7O A;  3GSP A;  2CWT A;  3VSY A;  4HM8 B;  3FF0 A;  3K5T A;  1BU4 A;  1RCL A;  4L8P A;  5IF6 A;  5IEP A;  4RBN A;  1RGC A;  3HII A;  2A15 A;  3F7S A;  1O7P B;  3UJM A;  3EHC A;  3G6E 3;  2WGQ A;  1BRJ A;  1I0V A;  1W6Y A;  1K8A 4;  4FCM A;  3PZW A;  5AII A;  3CNM A;  1RHL A;  5EVH A;  5IER A;  5IEO A;  2E2T A;  1LNH A;  2CH9 A;  4ZM8 A;  5AEU B;  1IQ8 A;  4HM1 B;  4EYC A;  1Y4K A;  4XB5 A;  1QVG 2;  3X41 A;  1YI2 3;  3DXO A;  5IEN A;  2CFG A;  2V1L A;  1AV4 A;  1YGE A;  1E3R A;  5EQL A;  3CME 3;  1US1 A;  1RN1 A;  3BNC A;  2HMM B;  1HKX A;  1OHP A;  4DKI A;  1MWR A;  1T2H A;  3KSE D;  3SOA A;  1GSP A;  3NHX A;  3OX9 A;  1EG9 B;  1IVW A;  1RGH A;  2CIU A;  2H0I A;  3WA2 X;  3B4O A;  4LMI A;  3X40 A;  9RNT A;  2GEX A;  5LC6 A;  1OF5 A;  3BNE A;  1IK3 A;  3FGY A;  1TIJ A;  1JV2 B;  4J8T A;  2Y74 A;  4BTY A;  5AYS C;  3ECF A;  1UCL A;  3ZFZ A;  1VQO 3;  4N6O B;  4HM6 B;  2CX0 A;  2LYX A;  1FZU A;  1I2G A;  5JPP A;  1GD3 A;  2ZL8 A;  3LML A;  1TUH A;  1A2K A;  2O3O A;  1BNG A;  3NV0 B;  1VZZ A;  3MYT A;  1D6U A;  1OAC A;  1SJW A;  1SQW A;  3F8X A;  3WDG B;  7STD A;  2K0M A;  1TFO A;  2BMQ B;  1QAL A;  1T3B A;  1W7C A;  3EBY A;  3BNB A;  3SYU A;  3X3Y A;  3G8Z A;  1SPU A;  3A76 A;  1KC8 4;  3AMO B;  1R4C A;  2AAE A;  3NQZ A;  1ISK A;  3CU3 A;  1C54 A;  3GZR A;  1JRQ A;  1E97 A;  1BAO A;  3CCM 3;  2OTL 3;  2WGO A;  3DMC A;  2WO0 A;  1V57 A;  1RGE A;  1WQL B;  2CHC A;  3AMO A;  4FCZ A;  4HOH A;  5RNT A;  1BNJ A;  3E99 A;  3N9H A;  3MG3 A;  4HM5 B;  4MEI A;  1DMN A;  1RDS A;  3KE7 A;  2AAD A;  4JRF A;  3LTA A;  3S67 A;  1BVI A;  1RSN A;  1BRI A;  1AY7 A;  1IQX A;  4IT7 A;  5I97 A;  3O8Y A;  3HK4 A;  4EW5 A;  1Q42 A;  2RNT A;  4NPB A;  1FA3 A;  3MG1 A;  1M1X B;  3CCS 3;  1UCK A;  5ELU A;  1RTU A;  1RKY A;  1FGO A;  1J2B A;  1YIT 3;  2W04 A;  1HZ1 A;  1O7M B;  4I5Q A;  1YVB I;  3Q1C A;  3SED A;  1RRH A;  4J5K A;  1RNB A;  1M90 4;  1YIJ 3;  1T5Y A;  1Q7Y 4;  1BNE A;  2KRT A;  1BSC A;  1IDP A;  4RNY A;  2YFJ B;  3D5G A;  3F14 A;  5JPU A;  1NU3 A;  1O7G B;  2XF3 A;  1EEJ A;  4FMD A;  1IT8 A;  1RNT A;  4MJD A;  4N6M A;  1BAN A;  1NWW A;  1VQQ A;  5IG3 A;  1FUS A;  4MMX B;  1OCV A;  2ZDJ A;  3EBT A;  1B3S A;  7RNT A;  2XFT A;  1A2V A;  2Y73 A;  3T8N A;  2Z7A A;  4BTW A;  4HM3 B;  1TU5 A;  3T0U A;  1B2Z A;  2UGI A;  4OUQ A;  2Q07 A;  1IU7 A;  3I56 3;  3EE1 A;  4WYK A;  4Q53 A;  2IYJ A;  1NO3 A;  3NQY A;  5G1L A;  5IW9 A;  2OWP A;  2BNG A;  2GEY A;  1D6Y A;  3JUN A;  3EC9 A;  1B21 A;  1N5H A;  3RNT A;  3KCH A;  1L5G B;  1I2E A;  1I3F A;  2D1W A;  1N9J A;  1MGR A;  2QA4 3;  5AIF A;  1DMM A;  1A2P A;  3G71 3;  1N5P A;  1SII A;  3D3L A;  3G0K A;  1K41 A;  2C4B A;  2HMO B;  2P09 A;  2XSO B;  1V74 A;  1VQ4 3;  2IUK A;  4N6V 0;  3CC2 3;  1KD1 4;  1ROA A;  3CC7 3;  3PGB A;  1TJD A;  1BSA A;  1BOX A;  2XGL A;  3D5I A;  4HM2 B;  4QWT A;  2FNQ A;  5TGN A;  1BSD A;  3SVA A;  3VGN A;  3M8C A;  2E2U A;  2BIR A;  3WOE B;  4WWU C;  1Q81 4;  3CCL 3;  1Q86 4;  4R1K A;  1LQG C;  1RGL A;  1IVV A;  5DRV A;  3X42 A;  5M18 A;  1PYL A;  3OWY A;  2KXG A;  3K7C A;  1DMQ A;  1IV9 A;  4EXR A;  1S5A A;  2XR8 B;  2F99 A;  3DH2 A;  1JZO A;  1GOY A;  4KFE A;  5AI1 A;  3DGN A;  2YX9 A;  2CG1 A;  1KSI A;  1SAR A;  1MOL A;  2KF5 A;  3LT9 A;  4AKY A;  4R4K A;  1Q82 4;  3KN4 A;  4XBT A;  1A90 A;  1QAK A;  1FGR A;  3LZA A;  5HGR A;  2IY2 A;  3FSD A;  3D4A A;  4KZ1 A;  1NB5 I;  1G02 A;  4GB5 A;  4KFD A;  1GMQ A;  3EX9 A;  1JBR A;  1RLS A;  3IPT A;  2B24 B;  4BL3 A;  1TRP A;  3IJE B; 
#chains in the Genus database with same CATH homology
 2J8X B;  2UGI A;  1UDI I;  1UGI A;  2ZHX B;  1EUI C;  1UGH I;  1UUG B;  2UUG C;  1LQG C;  4LYL B;  1LQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...