1LQGC

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
TGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 9
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqgC00
1UGHI 2ZHXB 1EUIC 2UUGC 1LQMB 2UGIA 1LQGC 4LYLB 2J8XB 1UGIA 1UUGB 1UDII
chains in the Genus database with same CATH superfamily
3QRDA 2INXA 5AYSC 3T8UA 1W02A 1BSBA 2ML6A 3FH1A 3I0YA 1V57A 3NV0B 5EQLA 3JUMA 3NBRA 1QAKA 1JB2A 3NV0A 2KRTA 2OOVC 2RGQA 1OGZA 3EE1A 4MMZB 2BIRA 3OX9A 1NO3A 3FF0A 3CPOA 1HZ1A 1B2SA 1O7MB 2BO9B 2YFIB 2KAAA 2F99A 2BHMA 2CK3H 1VQN3 3D79A 1BVIA 4QWTA 1MWSA 1LXEA 2CKFB 2P0XA 1VQM3 3LYGA 4CCVA 5EVHA 1NDOB 1WMOA 1ZGXA 2Y74A 1BSAA 1BSCA 1LQMB 1UCKA 1LQGC 1WMNA 3MG3A 2RSXA 1BSDA 2XF3A 2H0HA 1BGSA 1R4CA 1IVWA 1R4YA 3JUNA 3G16A 3ALAA 4HAAA 3CMA3 3CU3A 5GSPA 1VQ63 1YGWA 3FLJA 4R9LA 2GU3A 4MMYB 1IT7A 4R80A 3X40A 1WNHA 3AMOB 1U5OA 3LXUX 1I70A 4GL6A 4LYLB 3AMOA 3Q90A 1Q7HA 1YJN3 3JUOA 3N8BA 1I2EA 4BTYA 2SBLA 2WOFA 1X1YA 3KKGA 1E3RA 3T0UA 1FGMA 1TP6A 1MWRA 4J9AA 1L5GB 1UCIA 1EA2A 1CYUA 3K5TA 4IIAA 5AIIA 2QIYA 6STDA 2W56B 4LGQA 4CJNA 1FZUA 3F7SA 5IG3A 4OUQA 2W56A 2O9UX 4BU4A 1BRKA 1LOVA 2E2UA 3MYTA 3OXAA 2C11A 3ZFZA 4BTWA 2MC8A 4DKIA 2CWTA 3G8ZA 2IA7A 5CF2A 1B21A 1JBTA 1KC84 1IT8A 1D6YA 2QA43 1JKGB 1K8A4 1W01A 1E3VA 1TTOA 3NBJA 4MEIA 2J8XB 3D5GA 1JKGA 3RDEA 1UCJA 1OHPA 1RGGA 2CC3A 3S67A 2YX9A 4ORLA 5IG4A 1RSNA 2UUGC 3DH2A 1Q9EA 1QAFA 2GEXA 3ROBA 1Q864 5RNTA 3DGLA 1G0TA 5FW5A 2OTL3 3X3ZA 1GMPA 1IVUA 1SPUA 2XH9A 2HOHA 1VQO3 4H3UA 2GEYA 1EG9B 1RKYA 1M1XB 1Q7Y4 4BL3A 2FGTA 1EEJA 2OTJ3 2W6JH 4BIRA 1AQZA 3B4OA 3S29A 3DGYA 5IF6A 1FGOA 1B2ZA 1I8VA 5LC6A 1FUSA 3KFQC 1W5ZA 1J2BA 4XM4A 1W00A 1IK3A 3O8YA 5CXOA 3KE7A 3CCL3 3K63A 4HZBB 1OGXA 4O3VA 2PNCA 2YFLB 5EEOA 4FMBA 1BRSA 3CCV3 3DGMA 4HYZA 5JPPA 3NUVA 2CFGA 1OH0A 1GMQA 3E99A 1IV7A 1QALA 3F7XA 4L8OA 5IW9A 3HZPA 1FW7A 1BAOA 2W2CA 3BB9A 5BXQA 3Q2PA 1YIT3 4KFEA 1B2XA 2RNTA 3HK4A 3G6E3 1BNRA 1T2IA 1DVCA 3RGAA 2L1SA 4EV5A 4HJLB 1NJI4 1N5PA 1GY6A 1TRQA 4HZ9B 4EYCA 4GHOA 3G0KA 4LZIA 5I97A 4CPKA 3HX8A 4O2HA 4RNYA 3CCJ3 2CFKA 4GSPA 1TFOA 3EF8A 2W9QA 2GXFA 2STDA 4K61A 4LEHA 5M18A 5LC7A 3BNCA 1SJWA 2PZVA 1N5HA 2YFJB 3OWUA 5DRVA 1DMNA 1VQQA 3PCSA 4NREA 4XBYA 2ML5A 2BMOB 1YJW3 2XSOB 2I9WA 1W7CA 2IY2A 2LYXA 1Q42A 3DUKA 4IPBA 3SVAA 3UL5A 1K734 2UX0A 3FSDA 1STDA 1HKXA 1OPYA 1WMPA 1BNEA 1VZZA 1YVBI 1RRHA 1JB5A 1OCVA 1IVXA 1I2FA 1JJ22 3I553 1BANA 2XGLA 2O3OA 4EV2A 2HMLB 3MG2A 1VQP3 3DGOA 1IQ8A 3FG4A 3GZYB 2Q07A 4BL2A 1CYVA 2ZL8A 2WGOA 3FG1A 3IJEB 1D6UA 1FGTA 3KSED 1GOYA 1A90A 5G1KA 4HM6B 3FG3A 4HM4B 1UUVB 4HVNA 3UL6A 4HKVB 1NWWA 3OV4A 1T2HA 3N54B 1EKMA 2C4BA 2E2TA 3HIGA 4N6V0 2L4VA 3WR2A 3MPHA 3CCU3 1FGQA 3LTBA 2CH9A 1NB3I 1BOXA 1MWTA 2WGQA 2D1WA 2FNQA 3EN1B 1UCLA 3S5CA 1ZS7A 1PFPA 4J5GA 1STFI 3LOYA 1TRPA 3NM7A 4O02B 1MWUA 3AGOA 1SIHA 2XGNA 4CDLA 5BIRA 3G713 3UNLA 1UGIA 4ILFA 1B2UA 1MGWA 3MKIA 3PCRA 3BNBA 1KWIA 1BRHA 5M19A 1OF5B 4WYKB 1JV2B 3N9HA 4X2OA 1O7NB 3WOFB 1OF5A 3U1WA 4WYKA 1GSPA 4LSOA 1VQ73 1AR0A 3EBTA 3DGNA 2W03A 3MHEA 3OWYA 3X3XA 3CCS3 3Q3FA 1LNIA 1T3BA 4J8TA 3HOHA 4OK0A 6GSPA 1ROVA 1MGRA 3NBBA 1BUJA 2P05A 4AKYA 1OHSA 4HM8B 1BNJA 1X1XA 1RGCA 2CG0A 1JBSA 4N6MA 5TGNA 3DY5A 5AIFA 1MOLA 4GB5A 1RGFA 3K7CA 5M1AA 4FCJA 1GYBA 1RHLA 2E2VA 1JZDA 4N6UA 1UI7A 3D5IA 1TFKA 5CF1A 1M1K4 1M9GA 2CX1A 2CX0A 4EXRA 1IVVA 1FYSA 3GZXB 2GBXB 1HU9A 3X42A 1RRLA 4FMAA 3B4PA 4HM5B 3Q1CA 3DXOA 1NNVA 3EX9A 2ZA4A 1RGKA 1YI23 4H61A 1WTHA 2XRXB 5IG0A 2OOVA 2IUJA 3SLUA 3CPW2 1YJ93 1FGRA 1YGEA 2BT3A 1RN1A 3BU4A 1BSEA 1RLSA 1UDII 5D81A 3LTDA 2OQEA 4RBNA 3WOEB 8RNTA 3I563 3U97A 5A0OB 3VF1A 1B20A 4O8SA 3NHXA 2CHCA 3ZG5A 1CQSA 3PS8A 4KZ1A 1RCLA 3F8HA 4NHFA 3F8XA 4N6TA 3CC73 4EC6A 1SIIA 2ZDJA 1QJGA 1IQYA 2HMJB 1CEWI 5IEOA 1A2PA 1SARA 2V1LA 2K0MA 3H51A 4NPBA 3D3LA 3CME3 1GMRA 1OHOA 1BNFA 3BNEA 3CNXA 3GWRA 8CHOA 3GRDA 4MJDA 4JF8A 3QK9A 4KT3B 2A15A 2F5WA 1ULIB 7STDA 4XBXA 1VQK3 3K9MC 5IG5A 1S723 4XDVA 2KF5A 1B27A 4K1UA 5STDA 2F86B 3WDGB 1LRAA 1Q40B 5IENA 5HOHA 4R9KA 3GAXA 2HMMB 1Q40A 3SOAA 3WODG 2BU4A 6RNTA 2XFTA 1AVLA 2IMJA 3OW22 1RGHA 1UW1A 2JDIH 2Z77A 4WHAA 3FKAA 4KFFA 2CG1A 3SEDA 2QEX3 2P09A 3EN8A 4RNTA 2GU1A 1LOWA 1LNHA 2Y73A 3DM8A 1N8QA 1AV4A 3JUPA 1S5AA 5G2GA 3T8NA 1FUWA 1US1A 1CH0A 2HMKB 3EHCA 1ULJB 4HM2B 5HGRA 4HM0B 2KF4A 3LTCA 5FGOA 5BU4A 4HM1B 1GY7A 1I3FA 1KD14 1VQ93 1W4NA 1W6GA 1DVDA 3AHSA 3JVCA 3F14A 1EUIC 5ELUA 1RGEA 1YNVX 1RGLA 1BRGA 2K54A 4FCMA 3A76A 4AKZA 1BNSA 3CCR3 4RNZA 3PXMA 2OCTA 5AYRB 5JBSA 2GBWB 1LVNA 4N6OB 1JZOA 4STDA 1VQ53 3WMDA 3F40A 1A2KA 1UI8A 3NQYA 1KSIA 3SOYA 1X1UA 2GSPA 4HOHA 1I2GA 1K9M4 1RCKA 1TU5A 1MNLA 4L8PA 1ISKA 1N8R4 3FCSB 3BIRA 2CWUA 3NX0A 4I5QA 3CC23 3B8LA 5AIGA 1HYFA 2IUKA 2P0MA 3V98A 1JRQA 2OWPA 3NXJA 5IEPA 1OACA 3M8CA 3GZBA 1I3IA 2OQEC 3LTAA 1IYYA 4KFDA 2KCDA 1VQL3 4FCZA 1JBRA 2RFRA 1DETA 4U13A 4AEQA 1IDPA 3ER7A 5D82A 4N6NB 3KIIA 2JQ5A 3STDA 5CLKA 1ZX2A 3BLZA 7GSPA 3MWZA 1TUHA 3H3HA 1F8NA 1I0XA 3PYJA 1O7PB 2QGUA 2B1XB 2C10A 1W6CA 2BMQB 1C7HA 1LOXA 1G02A 2CFLA 2H0IA 1B2MA 3CD63 2Z6BA 3WA3A 1WQLB 1BRIA 3DZLA 3KZTA 4N6LA 4LMIA 3J7Yd 2F4YA 2XEPA 1O7GB 2BNGA 2H0GA 3FF2A 3CNMA 3PGBA 1KQS2 2XFSA 1U8CB 1UUWB 2KXGA 3TDGA 1DMMA 3UB1A 5BVBA 3WHOA 3B7CA 1UGHI 2KF3A 2AAEA 1NU3A 4OVMA 3G4S3 3A5EA 4R1KA 3LH4A 4FMCA 5AEWB 1BRNL 1JN5B 2LQVA 1BNIA 1IU7A 1G96A 2HMOB 3EQQB 3LMLA 3MG1A 2CFWA 4I4KA 1JN5A 4WP5A 3FGYA 7RNTA 2R4IA 2W0QA 1OUNA 3HI7A 5DREA 3PZWA 1FUTA 3EB8A 1RN4A 1W2ZA 1V58A 2ZHXB 5KP1A 4RZMA 1M904 4XDWA 1GOUA 5AEUB 2IYJA 5D83A 3RGRA 1DMQA 1ROAA 3D4AA 3ECFA 5KP4A 1Q824 1A67A 1BUQA 3DMCA 1IQXA 2R41A 2XR8B 1RMSA 9RNTA 1GD4A 1IV9A 5CK6A 1RN7A 2CWVA 3K0ZA 3VGNA 3CCQ3 3CCM3 3AHWA 1RNBA 2M7OA 3X41A 3NM2A 2CFDA 1AY7A 3KN4A 1TJDA 3CC43 4G1MB 1N9JA 2Z76A 4J5KA 3EBYA 4L7KA 1RNTA 4Q53A 3LT8A 4BTXA 3X3YA 4KVHA 2AADA 3V92A 1EQKA 1O7HB 3JUQA 3GZRA 3KCHA 4K90B 3VSYA 5JPUA 3FZWA 1W2B2 1LOYA 3RNTA 3CXC2 1Q814 1GOVA 5ELJA 1VQ83 3NQZA 2RCDA 4HBRA 1T5YA 4MMXB 3F9SA 1YVSA 3EC9A 2FXTA 4FMDA 3OWSA 4HM7B 5AIHA 2KF6A 3D9RA 1JB4A 1YHQ3 1RTUA 3WA2X 5AI1A 1PU4A 1ZO2A 1NB5I 2F56A 1TIJA 1JNQA 2XSHB 1Y4KA 4EBGA 1RGAA 2SARA 2MF7A 3SXXA 1QVG2 3L0RA 3IMAB 1UUGB 4XB5A 3S28A 1B3SA 1BRJA 2UGIA 1O7WB 2B24B 3CCE3 1YIJ3 1E97A 2P38A 2K3DA 1X1WA 3GSPA 1A2VA 4FR9A 2D42A 4HM3B 1ASKA 1GD3A 3MSOA 3ZG0A 1N9EA 4WFOA 1RJOA 5KP3A 3LT9A 1GY5A 4JRFA 1I0VA 4ZM8A 3SYUA 3BNDA 2F5MA 4N3VA 1DYUA 4WWUC 3S27A 5IERA 2F98A 1C54A 4PEJA 1BIRA 1PY3A 1D6ZA 3EJVA 2RBIA 4K1VA 3SX1A 1W6YA 1FA3A 3LZAA 1Z1SA 1QMAA 2W9PA 2HMNB 1AVKA 1SQWA 1QVF2 4XBTA 2CW9A 3AGNA 3KSPA 1PYLA 1K28A 4TX4A 1DE3A 1RDSA 2WO0A 4EW5A 1V74A 1BNGA 1K41A 1VQ43 1GS3A 2W04A 3UJMA 4R4KA 1BU4A 2BMRB 3URPA 2WOHA 3V99A 3IPTA 4X2HA 2Z7AA 4IT7A 2CIUA 3HIIA 5G1LA
chains in the Genus database with same CATH topology
1UGHI 2ZHXB 1EUIC 2UUGC 1LQMB 2UGIA 1LQGC 4LYLB 2J8XB 1UGIA 1UUGB 1UDII
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGH I;  2ZHX B;  1EUI C;  2UUG C;  1LQM B;  2UGI A;  1LQG C;  4LYL B;  2J8X B;  1UGI A;  1UUG B;  1UDI I; 
#chains in the Genus database with same CATH topology
 3QRD A;  2INX A;  5AYS C;  3T8U A;  1W02 A;  1BSB A;  2ML6 A;  3FH1 A;  3I0Y A;  1V57 A;  3NV0 B;  5EQL A;  3JUM A;  3NBR A;  1QAK A;  1JB2 A;  3NV0 A;  2KRT A;  2OOV C;  2RGQ A;  1OGZ A;  3EE1 A;  4MMZ B;  2BIR A;  3OX9 A;  1NO3 A;  3FF0 A;  3CPO A;  1HZ1 A;  1B2S A;  1O7M B;  2BO9 B;  2YFI B;  2KAA A;  2F99 A;  2BHM A;  2CK3 H;  1VQN 3;  3D79 A;  1BVI A;  4QWT A;  1MWS A;  1LXE A;  2CKF B;  2P0X A;  1VQM 3;  3LYG A;  4CCV A;  5EVH A;  1NDO B;  1WMO A;  1ZGX A;  2Y74 A;  1BSA A;  1BSC A;  1LQM B;  1UCK A;  1LQG C;  1WMN A;  3MG3 A;  2RSX A;  1BSD A;  2XF3 A;  2H0H A;  1BGS A;  1R4C A;  1IVW A;  1R4Y A;  3JUN A;  3G16 A;  3ALA A;  4HAA A;  3CMA 3;  3CU3 A;  5GSP A;  1VQ6 3;  1YGW A;  3FLJ A;  4R9L A;  2GU3 A;  4MMY B;  1IT7 A;  4R80 A;  3X40 A;  1WNH A;  3AMO B;  1U5O A;  3LXU X;  1I70 A;  4GL6 A;  4LYL B;  3AMO A;  3Q90 A;  1Q7H A;  1YJN 3;  3JUO A;  3N8B A;  1I2E A;  4BTY A;  2SBL A;  2WOF A;  1X1Y A;  3KKG A;  1E3R A;  3T0U A;  1FGM A;  1TP6 A;  1MWR A;  4J9A A;  1L5G B;  1UCI A;  1EA2 A;  1CYU A;  3K5T A;  4IIA A;  5AII A;  2QIY A;  6STD A;  2W56 B;  4LGQ A;  4CJN A;  1FZU A;  3F7S A;  5IG3 A;  4OUQ A;  2W56 A;  2O9U X;  4BU4 A;  1BRK A;  1LOV A;  2E2U A;  3MYT A;  3OXA A;  2C11 A;  3ZFZ A;  4BTW A;  2MC8 A;  4DKI A;  2CWT A;  3G8Z A;  2IA7 A;  5CF2 A;  1B21 A;  1JBT A;  1KC8 4;  1IT8 A;  1D6Y A;  2QA4 3;  1JKG B;  1K8A 4;  1W01 A;  1E3V A;  1TTO A;  3NBJ A;  4MEI A;  2J8X B;  3D5G A;  1JKG A;  3RDE A;  1UCJ A;  1OHP A;  1RGG A;  2CC3 A;  3S67 A;  2YX9 A;  4ORL A;  5IG4 A;  1RSN A;  2UUG C;  3DH2 A;  1Q9E A;  1QAF A;  2GEX A;  3ROB A;  1Q86 4;  5RNT A;  3DGL A;  1G0T A;  5FW5 A;  2OTL 3;  3X3Z A;  1GMP A;  1IVU A;  1SPU A;  2XH9 A;  2HOH A;  1VQO 3;  4H3U A;  2GEY A;  1EG9 B;  1RKY A;  1M1X B;  1Q7Y 4;  4BL3 A;  2FGT A;  1EEJ A;  2OTJ 3;  2W6J H;  4BIR A;  1AQZ A;  3B4O A;  3S29 A;  3DGY A;  5IF6 A;  1FGO A;  1B2Z A;  1I8V A;  5LC6 A;  1FUS A;  3KFQ C;  1W5Z A;  1J2B A;  4XM4 A;  1W00 A;  1IK3 A;  3O8Y A;  5CXO A;  3KE7 A;  3CCL 3;  3K63 A;  4HZB B;  1OGX A;  4O3V A;  2PNC A;  2YFL B;  5EEO A;  4FMB A;  1BRS A;  3CCV 3;  3DGM A;  4HYZ A;  5JPP A;  3NUV A;  2CFG A;  1OH0 A;  1GMQ A;  3E99 A;  1IV7 A;  1QAL A;  3F7X A;  4L8O A;  5IW9 A;  3HZP A;  1FW7 A;  1BAO A;  2W2C A;  3BB9 A;  5BXQ A;  3Q2P A;  1YIT 3;  4KFE A;  1B2X A;  2RNT A;  3HK4 A;  3G6E 3;  1BNR A;  1T2I A;  1DVC A;  3RGA A;  2L1S A;  4EV5 A;  4HJL B;  1NJI 4;  1N5P A;  1GY6 A;  1TRQ A;  4HZ9 B;  4EYC A;  4GHO A;  3G0K A;  4LZI A;  5I97 A;  4CPK A;  3HX8 A;  4O2H A;  4RNY A;  3CCJ 3;  2CFK A;  4GSP A;  1TFO A;  3EF8 A;  2W9Q A;  2GXF A;  2STD A;  4K61 A;  4LEH A;  5M18 A;  5LC7 A;  3BNC A;  1SJW A;  2PZV A;  1N5H A;  2YFJ B;  3OWU A;  5DRV A;  1DMN A;  1VQQ A;  3PCS A;  4NRE A;  4XBY A;  2ML5 A;  2BMO B;  1YJW 3;  2XSO B;  2I9W A;  1W7C A;  2IY2 A;  2LYX A;  1Q42 A;  3DUK A;  4IPB A;  3SVA A;  3UL5 A;  1K73 4;  2UX0 A;  3FSD A;  1STD A;  1HKX A;  1OPY A;  1WMP A;  1BNE A;  1VZZ A;  1YVB I;  1RRH A;  1JB5 A;  1OCV A;  1IVX A;  1I2F A;  1JJ2 2;  3I55 3;  1BAN A;  2XGL A;  2O3O A;  4EV2 A;  2HML B;  3MG2 A;  1VQP 3;  3DGO A;  1IQ8 A;  3FG4 A;  3GZY B;  2Q07 A;  4BL2 A;  1CYV A;  2ZL8 A;  2WGO A;  3FG1 A;  3IJE B;  1D6U A;  1FGT A;  3KSE D;  1GOY A;  1A90 A;  5G1K A;  4HM6 B;  3FG3 A;  4HM4 B;  1UUV B;  4HVN A;  3UL6 A;  4HKV B;  1NWW A;  3OV4 A;  1T2H A;  3N54 B;  1EKM A;  2C4B A;  2E2T A;  3HIG A;  4N6V 0;  2L4V A;  3WR2 A;  3MPH A;  3CCU 3;  1FGQ A;  3LTB A;  2CH9 A;  1NB3 I;  1BOX A;  1MWT A;  2WGQ A;  2D1W A;  2FNQ A;  3EN1 B;  1UCL A;  3S5C A;  1ZS7 A;  1PFP A;  4J5G A;  1STF I;  3LOY A;  1TRP A;  3NM7 A;  4O02 B;  1MWU A;  3AGO A;  1SIH A;  2XGN A;  4CDL A;  5BIR A;  3G71 3;  3UNL A;  1UGI A;  4ILF A;  1B2U A;  1MGW A;  3MKI A;  3PCR A;  3BNB A;  1KWI A;  1BRH A;  5M19 A;  1OF5 B;  4WYK B;  1JV2 B;  3N9H A;  4X2O A;  1O7N B;  3WOF B;  1OF5 A;  3U1W A;  4WYK A;  1GSP A;  4LSO A;  1VQ7 3;  1AR0 A;  3EBT A;  3DGN A;  2W03 A;  3MHE A;  3OWY A;  3X3X A;  3CCS 3;  3Q3F A;  1LNI A;  1T3B A;  4J8T A;  3HOH A;  4OK0 A;  6GSP A;  1ROV A;  1MGR A;  3NBB A;  1BUJ A;  2P05 A;  4AKY A;  1OHS A;  4HM8 B;  1BNJ A;  1X1X A;  1RGC A;  2CG0 A;  1JBS A;  4N6M A;  5TGN A;  3DY5 A;  5AIF A;  1MOL A;  4GB5 A;  1RGF A;  3K7C A;  5M1A A;  4FCJ A;  1GYB A;  1RHL A;  2E2V A;  1JZD A;  4N6U A;  1UI7 A;  3D5I A;  1TFK A;  5CF1 A;  1M1K 4;  1M9G A;  2CX1 A;  2CX0 A;  4EXR A;  1IVV A;  1FYS A;  3GZX B;  2GBX B;  1HU9 A;  3X42 A;  1RRL A;  4FMA A;  3B4P A;  4HM5 B;  3Q1C A;  3DXO A;  1NNV A;  3EX9 A;  2ZA4 A;  1RGK A;  1YI2 3;  4H61 A;  1WTH A;  2XRX B;  5IG0 A;  2OOV A;  2IUJ A;  3SLU A;  3CPW 2;  1YJ9 3;  1FGR A;  1YGE A;  2BT3 A;  1RN1 A;  3BU4 A;  1BSE A;  1RLS A;  1UDI I;  5D81 A;  3LTD A;  2OQE A;  4RBN A;  3WOE B;  8RNT A;  3I56 3;  3U97 A;  5A0O B;  3VF1 A;  1B20 A;  4O8S A;  3NHX A;  2CHC A;  3ZG5 A;  1CQS A;  3PS8 A;  4KZ1 A;  1RCL A;  3F8H A;  4NHF A;  3F8X A;  4N6T A;  3CC7 3;  4EC6 A;  1SII A;  2ZDJ A;  1QJG A;  1IQY A;  2HMJ B;  1CEW I;  5IEO A;  1A2P A;  1SAR A;  2V1L A;  2K0M A;  3H51 A;  4NPB A;  3D3L A;  3CME 3;  1GMR A;  1OHO A;  1BNF A;  3BNE A;  3CNX A;  3GWR A;  8CHO A;  3GRD A;  4MJD A;  4JF8 A;  3QK9 A;  4KT3 B;  2A15 A;  2F5W A;  1ULI B;  7STD A;  4XBX A;  1VQK 3;  3K9M C;  5IG5 A;  1S72 3;  4XDV A;  2KF5 A;  1B27 A;  4K1U A;  5STD A;  2F86 B;  3WDG B;  1LRA A;  1Q40 B;  5IEN A;  5HOH A;  4R9K A;  3GAX A;  2HMM B;  1Q40 A;  3SOA A;  3WOD G;  2BU4 A;  6RNT A;  2XFT A;  1AVL A;  2IMJ A;  3OW2 2;  1RGH A;  1UW1 A;  2JDI H;  2Z77 A;  4WHA A;  3FKA A;  4KFF A;  2CG1 A;  3SED A;  2QEX 3;  2P09 A;  3EN8 A;  4RNT A;  2GU1 A;  1LOW A;  1LNH A;  2Y73 A;  3DM8 A;  1N8Q A;  1AV4 A;  3JUP A;  1S5A A;  5G2G A;  3T8N A;  1FUW A;  1US1 A;  1CH0 A;  2HMK B;  3EHC A;  1ULJ B;  4HM2 B;  5HGR A;  4HM0 B;  2KF4 A;  3LTC A;  5FGO A;  5BU4 A;  4HM1 B;  1GY7 A;  1I3F A;  1KD1 4;  1VQ9 3;  1W4N A;  1W6G A;  1DVD A;  3AHS A;  3JVC A;  3F14 A;  1EUI C;  5ELU A;  1RGE A;  1YNV X;  1RGL A;  1BRG A;  2K54 A;  4FCM A;  3A76 A;  4AKZ A;  1BNS A;  3CCR 3;  4RNZ A;  3PXM A;  2OCT A;  5AYR B;  5JBS A;  2GBW B;  1LVN A;  4N6O B;  1JZO A;  4STD A;  1VQ5 3;  3WMD A;  3F40 A;  1A2K A;  1UI8 A;  3NQY A;  1KSI A;  3SOY A;  1X1U A;  2GSP A;  4HOH A;  1I2G A;  1K9M 4;  1RCK A;  1TU5 A;  1MNL A;  4L8P A;  1ISK A;  1N8R 4;  3FCS B;  3BIR A;  2CWU A;  3NX0 A;  4I5Q A;  3CC2 3;  3B8L A;  5AIG A;  1HYF A;  2IUK A;  2P0M A;  3V98 A;  1JRQ A;  2OWP A;  3NXJ A;  5IEP A;  1OAC A;  3M8C A;  3GZB A;  1I3I A;  2OQE C;  3LTA A;  1IYY A;  4KFD A;  2KCD A;  1VQL 3;  4FCZ A;  1JBR A;  2RFR A;  1DET A;  4U13 A;  4AEQ A;  1IDP A;  3ER7 A;  5D82 A;  4N6N B;  3KII A;  2JQ5 A;  3STD A;  5CLK A;  1ZX2 A;  3BLZ A;  7GSP A;  3MWZ A;  1TUH A;  3H3H A;  1F8N A;  1I0X A;  3PYJ A;  1O7P B;  2QGU A;  2B1X B;  2C10 A;  1W6C A;  2BMQ B;  1C7H A;  1LOX A;  1G02 A;  2CFL A;  2H0I A;  1B2M A;  3CD6 3;  2Z6B A;  3WA3 A;  1WQL B;  1BRI A;  3DZL A;  3KZT A;  4N6L A;  4LMI A;  3J7Y d;  2F4Y A;  2XEP A;  1O7G B;  2BNG A;  2H0G A;  3FF2 A;  3CNM A;  3PGB A;  1KQS 2;  2XFS A;  1U8C B;  1UUW B;  2KXG A;  3TDG A;  1DMM A;  3UB1 A;  5BVB A;  3WHO A;  3B7C A;  1UGH I;  2KF3 A;  2AAE A;  1NU3 A;  4OVM A;  3G4S 3;  3A5E A;  4R1K A;  3LH4 A;  4FMC A;  5AEW B;  1BRN L;  1JN5 B;  2LQV A;  1BNI A;  1IU7 A;  1G96 A;  2HMO B;  3EQQ B;  3LML A;  3MG1 A;  2CFW A;  4I4K A;  1JN5 A;  4WP5 A;  3FGY A;  7RNT A;  2R4I A;  2W0Q A;  1OUN A;  3HI7 A;  5DRE A;  3PZW A;  1FUT A;  3EB8 A;  1RN4 A;  1W2Z A;  1V58 A;  2ZHX B;  5KP1 A;  4RZM A;  1M90 4;  4XDW A;  1GOU A;  5AEU B;  2IYJ A;  5D83 A;  3RGR A;  1DMQ A;  1ROA A;  3D4A A;  3ECF A;  5KP4 A;  1Q82 4;  1A67 A;  1BUQ A;  3DMC A;  1IQX A;  2R41 A;  2XR8 B;  1RMS A;  9RNT A;  1GD4 A;  1IV9 A;  5CK6 A;  1RN7 A;  2CWV A;  3K0Z A;  3VGN A;  3CCQ 3;  3CCM 3;  3AHW A;  1RNB A;  2M7O A;  3X41 A;  3NM2 A;  2CFD A;  1AY7 A;  3KN4 A;  1TJD A;  3CC4 3;  4G1M B;  1N9J A;  2Z76 A;  4J5K A;  3EBY A;  4L7K A;  1RNT A;  4Q53 A;  3LT8 A;  4BTX A;  3X3Y A;  4KVH A;  2AAD A;  3V92 A;  1EQK A;  1O7H B;  3JUQ A;  3GZR A;  3KCH A;  4K90 B;  3VSY A;  5JPU A;  3FZW A;  1W2B 2;  1LOY A;  3RNT A;  3CXC 2;  1Q81 4;  1GOV A;  5ELJ A;  1VQ8 3;  3NQZ A;  2RCD A;  4HBR A;  1T5Y A;  4MMX B;  3F9S A;  1YVS A;  3EC9 A;  2FXT A;  4FMD A;  3OWS A;  4HM7 B;  5AIH A;  2KF6 A;  3D9R A;  1JB4 A;  1YHQ 3;  1RTU A;  3WA2 X;  5AI1 A;  1PU4 A;  1ZO2 A;  1NB5 I;  2F56 A;  1TIJ A;  1JNQ A;  2XSH B;  1Y4K A;  4EBG A;  1RGA A;  2SAR A;  2MF7 A;  3SXX A;  1QVG 2;  3L0R A;  3IMA B;  1UUG B;  4XB5 A;  3S28 A;  1B3S A;  1BRJ A;  2UGI A;  1O7W B;  2B24 B;  3CCE 3;  1YIJ 3;  1E97 A;  2P38 A;  2K3D A;  1X1W A;  3GSP A;  1A2V A;  4FR9 A;  2D42 A;  4HM3 B;  1ASK A;  1GD3 A;  3MSO A;  3ZG0 A;  1N9E A;  4WFO A;  1RJO A;  5KP3 A;  3LT9 A;  1GY5 A;  4JRF A;  1I0V A;  4ZM8 A;  3SYU A;  3BND A;  2F5M A;  4N3V A;  1DYU A;  4WWU C;  3S27 A;  5IER A;  2F98 A;  1C54 A;  4PEJ A;  1BIR A;  1PY3 A;  1D6Z A;  3EJV A;  2RBI A;  4K1V A;  3SX1 A;  1W6Y A;  1FA3 A;  3LZA A;  1Z1S A;  1QMA A;  2W9P A;  2HMN B;  1AVK A;  1SQW A;  1QVF 2;  4XBT A;  2CW9 A;  3AGN A;  3KSP A;  1PYL A;  1K28 A;  4TX4 A;  1DE3 A;  1RDS A;  2WO0 A;  4EW5 A;  1V74 A;  1BNG A;  1K41 A;  1VQ4 3;  1GS3 A;  2W04 A;  3UJM A;  4R4K A;  1BU4 A;  2BMR B;  3URP A;  2WOH A;  3V99 A;  3IPT A;  4X2H A;  2Z7A A;  4IT7 A;  2CIU A;  3HII A;  5G1L A; 
#chains in the Genus database with same CATH homology
 1UGH I;  2ZHX B;  1EUI C;  2UUG C;  1LQM B;  2UGI A;  1LQG C;  4LYL B;  2J8X B;  1UGI A;  1UUG B;  1UDI I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...