1LQGC

Escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
TGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Domain closure and action of uracil DNA glycosylase (UDG): structures of new crystal forms containing the Escherichia coli enzyme and a comparative study of the known structures involving UDG.
pubmed doi rcsb
source organism Escherichia coli
total genus 9
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1lqgC00
2ZHXB 1EUIC 1UGIA 2UUGC 1UDII 1UGHI 2J8XB 1LQGC 1UUGB 2UGIA 4LYLB 1LQMB
chains in the Genus database with same CATH superfamily
5AYRB 3B7CA 2I9WA 3OV4A 2SARA 2KF6A 3EC9A 1VZZA 3GRDA 1N9JA 1VQ93 1OACA 1RGKA 5I97A 3G16A 1RGEA 3PS8A 1N9EA 4AKYA 1CEWI 5KP3A 4AKZA 5IG5A 1YVBI 3NX0A 1Q7HA 1OHPA 1RNBA 5D81A 3FGYA 1PU4A 1E3RA 4H61A 1Q864 3L0RA 2Z77A 3CNXA 1X1YA 2IA7A 2HMJB 2R41A 2LYXA 4R1KA 3DGYA 3LH4A 3NBBA 3S67A 3WHOA 3CCE3 2W6JH 3LTAA 4RNYA 3CCL3 4MMYB 1GY7A 3HOHA 4R9LA 2GU1A 4HVNA 2HMOB 2CW9A 2H0IA 2M7OA 1FGTA 4BL3A 1VQM3 1MWTA 3HX8A 4FMCA 1T3BA 1AVLA 4N6NB 1BRJA 1F8NA 2F5MA 2Z7AA 2RGQA 4R9KA 1K9M4 3BIRA 1RRHA 4FCZA 1BGSA 3KCHA 3O8YA 3UB1A 3FZWA 1QALA 4LZIA 1LQGC 1YGEA 3GZBA 7STDA 1MGRA 2IUJA 3SYUA 2OTL3 1IV7A 1W2B2 5G2GA 1BUJA 1W4NA 3JUPA 5G1LA 3K5TA 4EV2A 2A15A 1HU9A 1T2IA 2KF5A 2H0HA 3KZTA 2INXA 2FNQA 3KKGA 1NNVA 1E97A 3EN8A 1MWUA 1LNIA 3A76A 1JBRA 3CNMA 1V74A 1ULIB 3S5CA 1I0VA 1BRNL 3CME3 1GD4A 1KQS2 1STFI 1BSEA 1DMMA 1FA3A 1W6CA 2BT3A 1BIRA 1I2GA 1M1XB 1O7NB 3OX9A 3CCV3 1ROAA 2L1SA 1BANA 1TFOA 1B2UA 1VQ73 1AR0A 2BO9B 4FMAA 2CHCA 1BNSA 3A5EA 5M1AA 3IJEB 1RNTA 3EHCA 1BSDA 3D5GA 3G8ZA 1BSAA 3UJMA 4N6UA 3WA2X 3I553 1BNIA 3MYTA 1B2SA 2UUGC 1PFPA 1W7CA 2W0QA 3FG1A 1RGLA 1BNEA 1RMSA 1RN1A 2RCDA 5EQLA 4R4KA 1JKGB 2GXFA 6GSPA 2OOVC 2CG1A 1B2XA 2Y74A 4HOHA 1T2HA 1WMPA 2STDA 2W9PA 5CXOA 3RDEA 6RNTA 1K8A4 1I70A 3ZG5A 7RNTA 1VQ83 4K90B 4LEHA 3E99A 2P38A 1VQ63 1EA2A 2RFRA 1BSBA 4LMIA 5TGNA 5LC7A 3S27A 5AEUB 1YIJ3 3EBTA 3UL6A 1HYFA 4N6MA 4N3VA 4L7KA 2F99A 3X3YA 1GOVA 2CWTA 1JZOA 5ELJA 3MPHA 2XSOB 4HM3B 2MC8A 3JUOA 1QAKA 3DMCA 1FUTA 4BTYA 4ZM8A 1B27A 5KP1A 2AADA 2FXTA 2YFJB 2OTJ3 1DETA 3CC43 4BTXA 5CLKA 1NWWA 3K9MC 1NDOB 1Y4KA 4EYCA 1MWRA 3DUKA 1X1WA 2FGTA 4DKIA 1BRKA 1QJGA 4EV5A 1QVG2 1Q42A 2QEX3 1R4CA 1RSNA 2W56B 4K61A 1IT8A 1CYVA 2JQ5A 5BVBA 2K54A 3BNCA 1OF5B 4BU4A 3NM2A 1VQ43 1DMNA 1B20A 2QIYA 4JRFA 1DYUA 1IT7A 3D4AA 3EN1B 1IQ8A 5IERA 1JKGA 1RCLA 1UW1A 3Q90A 4KFEA 4STDA 5JPUA 2YFLB 1KSIA 1OUNA 3MG3A 1A67A 1W5ZA 5BXQA 1IK3A 3NV0B 3G0KA 4XDVA 3WDGB 1I8VA 3IMAB 1JN5B 3WOFB 1JJ22 2P0MA 1RGGA 2MF7A 1TIJA 3ALAA 3X3ZA 2W04A 2PZVA 1AVKA 3HI7A 3CCU3 4HM0B 3DH2A 3MWZA 3LYGA 1W01A 4R80A 1IV9A 5IENA 1UUVB 1LRAA 2C11A 2R4IA 4BIRA 2CFLA 1LOVA 1RDSA 2ZA4A 2XSHB 4KFFA 1YHQ3 1O7PB 3URPA 3F7XA 2XR8B 3JUMA 3LTCA 4XBTA 3PYJA 4LSOA 1VQQA 3DGMA 3EX9A 3MSOA 1SARA 3V98A 1T5YA 2XEPA 1B2ZA 1FGMA 3RNTA 3D5IA 3DZLA 4BL2A 1M1K4 1EQKA 5AI1A 3CCS3 3FG4A 3CC23 5CK6A 1VQN3 3OXAA 2E2TA 1Q9EA 2H0GA 2CWUA 1A2PA 3KE7A 3LTDA 3MKIA 5DREA 5HGRA 1OF5A 3LMLA 3NBRA 1A2KA 3Q3FA 3BNDA 1GY6A 2K0MA 3NXJA 3ZFZA 1UI8A 1RN4A 1Q7Y4 3X41A 3D3LA 1G96A 4WFOA 2CFKA 1RGHA 1ZO2A 2KCDA 4G1MB 5AIHA 5IG4A 4U13A 3NUVA 1BOXA 3CD63 2P0XA 1FUSA 1RGAA 3FF2A 3EF8A 4IT7A 5ELUA 1W02A 1JN5A 3LOYA 4FMDA 3BNBA 4OVMA 5LC6A 2C4BA 3AMOB 3FF0A 1HZ1A 2WGOA 4OUQA 2WO0A 3SX1A 3OWYA 1FW7A 2B24B 5DRVA 3FG3A 1BNRA 1D6UA 4ORLA 1IQXA 3PGBA 4NHFA 3G6E3 3FKAA 3AHWA 5GSPA 4Q53A 1BAOA 1W6GA 1U5OA 3PXMA 2D42A 1JB5A 1UCKA 3NM7A 1RGFA 1LNHA 1YVSA 3AHSA 4FCMA 1Q824 1NJI4 5AIIA 4N6LA 2ZL8A 1IVXA 3KSED 3N9HA 5RNTA 1JV2B 2IUKA 4LGQA 1GYBA 1JZDA 2GBWB 2XFSA 2HMNB 2W03A 2WGQA 5FGOA 1JBTA 3LT8A 4XB5A 4XM4A 2P09A 4HM8B 1I0XA 1SIHA 1HKXA 4HM7B 1PY3A 4HKVB 3CXC2 4I5QA 2XH9A 2AAEA 1UI7A 1Q40B 2WOFA 4GB5A 4FCJA 1M9GA 4ILFA 1VQO3 1ZS7A 1A90A 1JRQA 1D6ZA 2CG0A 3EJVA 5G1KA 2CFGA 1GMRA 1QMAA 4HAAA 1RLSA 4JF8A 3X40A 2KXGA 2XF3A 1OGXA 1S5AA 4X2OA 5AIFA 3J7Yd 1LOYA 4HM1B 3K7CA 1C54A 5IW9A 3X3XA 1O7GB 2WOHA 4HJLB 3AGOA 3DGLA 5JBSA 3FSDA 4NPBA 2O9UX 5AEWB 3UL5A 1IQYA 3N8BA 4J5GA 1B3SA 1SIIA 2W2CA 3MG2A 4KFDA 1I2EA 3FLJA 1GD3A 1E3VA 3QRDA 3T8UA 2BIRA 4RZMA 5STDA 4X2HA 1Q814 2OWPA 3S29A 1RRLA 1I2FA 1MWSA 3HK4A 4L8PA 2W9QA 3RGAA 3CCQ3 1WNHA 1ZGXA 1V58A 1WMNA 2OOVA 5JPPA 3NBJA 2O3OA 3LZAA 4RBNA 3DM8A 1GSPA 1FYSA 1UUWB 3I0YA 2IY2A 2D1WA 2GSPA 3MHEA 4XBXA 3CPOA 3WMDA 1U8CB 2YX9A 2XRXB 4OK0A 1W6YA 1TRQA 4TX4A 3WOEB 5M18A 1OGZA 4QWTA 2IYJA 3NQZA 2K3DA 5EVHA 5HOHA 2E2VA 3QK9A 2L4VA 3NHXA 2QGUA 2QA43 2CWVA 2GBXB 1FUWA 4MEIA 3SXXA 1MGWA 2BU4A 4GHOA 3TDGA 2KAAA 1S723 1EG9B 2RSXA 4KZ1A 4EW5A 3GZYB 2SBLA 4L8OA 3WR2A 2CK3H 1KWIA 4O2HA 3CCR3 1YIT3 2UGIA 5CF1A 3Q2PA 4WWUC 1YGWA 1BNJA 2KF3A 1BUQA 2YFIB 4MMXB 1RHLA 1JNQA 1IYYA 2BNGA 2XGNA 1NB5I 1JB2A 3SEDA 1BVIA 3T8NA 1LVNA 2CH9A 2CX1A 1IVWA 3CU3A 1WTHA 4CJNA 1K28A 1MOLA 2Y73A 2OQEA 1YI23 4HM2B 1UDII 1X1UA 1DMQA 1G02A 1PYLA 2P05A 4KT3B 5CF2A 4WHAA 1TP6A 5M19A 1VQP3 4HZBB 3KFQC 5AIGA 3GSPA 3I563 3ER7A 3OWUA 1JB4A 2ZDJA 3RGRA 2GEYA 1GY5A 1AV4A 4XDWA 2W56A 2RBIA 1OH0A 1STDA 1EKMA 1IVUA 3ROBA 3GZRA 2GU3A 3GZXB 1I3FA 1MNLA 3CCJ3 1ASKA 4CCVA 2HMLB 4AEQA 2Q07A 3B4PA 5D82A 1K734 4N6V0 1I3IA 4WYKB 1B2MA 3NV0A 5FW5A 3BNEA 1UCJA 2Z6BA 1X1XA 2BHMA 1UUGB 1FGOA 8CHOA 1US1A 1ROVA 2F98A 3GAXA 3OW22 2OCTA 2BMRB 1FGRA 1BRGA 4J9AA 1YJ93 1TUHA 3MG1A 2XGLA 1AY7A 4EBGA 1QVF2 4O02B 3CCM3 1UGIA 4N6OB 2ML5A 1VQ53 1ZX2A 5D83A 3WODG 1DVCA 3Q1CA 1SJWA 4MMZB 2KF4A 3KIIA 1N5PA 1UCLA 2BMQB 1NO3A 2KRTA 4PEJA 3FH1A 3KN4A 3LTBA 3BLZA 3HZPA 1TRPA 1ISKA 2F56A 1BRHA 1SPUA 4RNZA 1D6YA 1NB3I 3ZG0A 1BSCA 2UX0A 2LQVA 2CFDA 3F9SA 3OWSA 4J5KA 1Z1SA 3CMA3 1R4YA 3AGNA 3STDA 1O7MB 5BU4A 3DGNA 1RJOA 4IPBA 3SVAA 3JUNA 3D9RA 5IEOA 1IDPA 2CX0A 1W00A 2C10A 3D79A 2F5WA 3SOYA 3VSYA 4H3UA 4EC6A 3F8XA 3PCSA 1W2ZA 3WA3A 2HMKB 1RCKA 3M8CA 3KSPA 4IIAA 1KC84 1IVVA 1OPYA 1TJDA 1SQWA 1V57A 3G4S3 2CKFB 4WYKA 3X42A 3SOAA 4EXRA 4RNTA 4N6TA 1YJN3 3CC73 8RNTA 5IG3A 1O7HB 1A2VA 3AMOA 3H51A 1YJW3 1GS3A 2CC3A 1RKYA 1GMPA 1C7HA 4NREA 4CDLA 4HM4B 3HIIA 1LQMB 1OHSA 3F14A 1LXEA 3EBYA 1BRSA 3LT9A 3G713 2E2UA 1CQSA 3B4OA 1JBSA 1N5HA 1O7WB 1AQZA 1N8QA 2HOHA 4HBRA 5A0OB 2XFTA 3EQQB 5BIRA 4HM5B 3BU4A 7GSPA 1RGCA 1BNGA 5EEOA 3EB8A 4J8TA 1LOWA 1RTUA 4XBYA 1LOXA 1K41A 4GSPA 4O3VA 1FGQA 1N8R4 3EE1A 1UCIA 1EUIC 2HMMB 1GOUA 3UNLA 1GOYA 1NU3A 2RNTA 4K1VA 3VGNA 1CYUA 3T0UA 3JUQA 3K63A 3S28A 1EEJA 2IMJA 3DGOA 3GWRA 2GEXA 3F8HA 4O8SA 5AYSC 1ULJB 2Z76A 3DY5A 1YNVX 2CFWA 1Q40A 3IPTA 3H3HA 3V99A 4BTWA 3F7SA 1CH0A 4CPKA 1BNFA 1DE3A 1J2BA 1DVDA 1IU7A 2F4YA 3PCRA 4FR9A 2ML6A 4WP5A 3V92A 3BB9A 1M904 1FZUA 2ZHXB 1RN7A 3VF1A 1B21A 1BU4A 1VQL3 1L5GB 2OQEC 3PZWA 3CPW2 3U1WA 4HZ9B 2BMOB 3F40A 4LYLB 1OHOA 2CIUA 1KD14 3NQYA 2J8XB 5IEPA 6STDA 1VQK3 1GMQA 4HYZA 3DXOA 5IF6A 3ECFA 2JDIH 4GL6A 3N54B 1UGHI 2V1LA 1TU5A 3U97A 2PNCA 3SLUA 1TTOA 3K0ZA 3B8LA 4I4KA 4HM6B 4K1UA 4MJDA 9RNTA 1G0TA 3FCSB 1WQLB 1TFKA 5KP4A 1BRIA 3LXUX 4FMBA 4KVHA 3JVCA 5IG0A 1OCVA 1QAFA 3HIGA 2B1XB 2F86B 1WMOA
chains in the Genus database with same CATH topology
2ZHXB 1EUIC 1UGIA 2UUGC 1UDII 1UGHI 2J8XB 1LQGC 1UUGB 2UGIA 4LYLB 1LQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZHX B;  1EUI C;  1UGI A;  2UUG C;  1UDI I;  1UGH I;  2J8X B;  1LQG C;  1UUG B;  2UGI A;  4LYL B;  1LQM B; 
#chains in the Genus database with same CATH topology
 5AYR B;  3B7C A;  2I9W A;  3OV4 A;  2SAR A;  2KF6 A;  3EC9 A;  1VZZ A;  3GRD A;  1N9J A;  1VQ9 3;  1OAC A;  1RGK A;  5I97 A;  3G16 A;  1RGE A;  3PS8 A;  1N9E A;  4AKY A;  1CEW I;  5KP3 A;  4AKZ A;  5IG5 A;  1YVB I;  3NX0 A;  1Q7H A;  1OHP A;  1RNB A;  5D81 A;  3FGY A;  1PU4 A;  1E3R A;  4H61 A;  1Q86 4;  3L0R A;  2Z77 A;  3CNX A;  1X1Y A;  2IA7 A;  2HMJ B;  2R41 A;  2LYX A;  4R1K A;  3DGY A;  3LH4 A;  3NBB A;  3S67 A;  3WHO A;  3CCE 3;  2W6J H;  3LTA A;  4RNY A;  3CCL 3;  4MMY B;  1GY7 A;  3HOH A;  4R9L A;  2GU1 A;  4HVN A;  2HMO B;  2CW9 A;  2H0I A;  2M7O A;  1FGT A;  4BL3 A;  1VQM 3;  1MWT A;  3HX8 A;  4FMC A;  1T3B A;  1AVL A;  4N6N B;  1BRJ A;  1F8N A;  2F5M A;  2Z7A A;  2RGQ A;  4R9K A;  1K9M 4;  3BIR A;  1RRH A;  4FCZ A;  1BGS A;  3KCH A;  3O8Y A;  3UB1 A;  3FZW A;  1QAL A;  4LZI A;  1LQG C;  1YGE A;  3GZB A;  7STD A;  1MGR A;  2IUJ A;  3SYU A;  2OTL 3;  1IV7 A;  1W2B 2;  5G2G A;  1BUJ A;  1W4N A;  3JUP A;  5G1L A;  3K5T A;  4EV2 A;  2A15 A;  1HU9 A;  1T2I A;  2KF5 A;  2H0H A;  3KZT A;  2INX A;  2FNQ A;  3KKG A;  1NNV A;  1E97 A;  3EN8 A;  1MWU A;  1LNI A;  3A76 A;  1JBR A;  3CNM A;  1V74 A;  1ULI B;  3S5C A;  1I0V A;  1BRN L;  3CME 3;  1GD4 A;  1KQS 2;  1STF I;  1BSE A;  1DMM A;  1FA3 A;  1W6C A;  2BT3 A;  1BIR A;  1I2G A;  1M1X B;  1O7N B;  3OX9 A;  3CCV 3;  1ROA A;  2L1S A;  1BAN A;  1TFO A;  1B2U A;  1VQ7 3;  1AR0 A;  2BO9 B;  4FMA A;  2CHC A;  1BNS A;  3A5E A;  5M1A A;  3IJE B;  1RNT A;  3EHC A;  1BSD A;  3D5G A;  3G8Z A;  1BSA A;  3UJM A;  4N6U A;  3WA2 X;  3I55 3;  1BNI A;  3MYT A;  1B2S A;  2UUG C;  1PFP A;  1W7C A;  2W0Q A;  3FG1 A;  1RGL A;  1BNE A;  1RMS A;  1RN1 A;  2RCD A;  5EQL A;  4R4K A;  1JKG B;  2GXF A;  6GSP A;  2OOV C;  2CG1 A;  1B2X A;  2Y74 A;  4HOH A;  1T2H A;  1WMP A;  2STD A;  2W9P A;  5CXO A;  3RDE A;  6RNT A;  1K8A 4;  1I70 A;  3ZG5 A;  7RNT A;  1VQ8 3;  4K90 B;  4LEH A;  3E99 A;  2P38 A;  1VQ6 3;  1EA2 A;  2RFR A;  1BSB A;  4LMI A;  5TGN A;  5LC7 A;  3S27 A;  5AEU B;  1YIJ 3;  3EBT A;  3UL6 A;  1HYF A;  4N6M A;  4N3V A;  4L7K A;  2F99 A;  3X3Y A;  1GOV A;  2CWT A;  1JZO A;  5ELJ A;  3MPH A;  2XSO B;  4HM3 B;  2MC8 A;  3JUO A;  1QAK A;  3DMC A;  1FUT A;  4BTY A;  4ZM8 A;  1B27 A;  5KP1 A;  2AAD A;  2FXT A;  2YFJ B;  2OTJ 3;  1DET A;  3CC4 3;  4BTX A;  5CLK A;  1NWW A;  3K9M C;  1NDO B;  1Y4K A;  4EYC A;  1MWR A;  3DUK A;  1X1W A;  2FGT A;  4DKI A;  1BRK A;  1QJG A;  4EV5 A;  1QVG 2;  1Q42 A;  2QEX 3;  1R4C A;  1RSN A;  2W56 B;  4K61 A;  1IT8 A;  1CYV A;  2JQ5 A;  5BVB A;  2K54 A;  3BNC A;  1OF5 B;  4BU4 A;  3NM2 A;  1VQ4 3;  1DMN A;  1B20 A;  2QIY A;  4JRF A;  1DYU A;  1IT7 A;  3D4A A;  3EN1 B;  1IQ8 A;  5IER A;  1JKG A;  1RCL A;  1UW1 A;  3Q90 A;  4KFE A;  4STD A;  5JPU A;  2YFL B;  1KSI A;  1OUN A;  3MG3 A;  1A67 A;  1W5Z A;  5BXQ A;  1IK3 A;  3NV0 B;  3G0K A;  4XDV A;  3WDG B;  1I8V A;  3IMA B;  1JN5 B;  3WOF B;  1JJ2 2;  2P0M A;  1RGG A;  2MF7 A;  1TIJ A;  3ALA A;  3X3Z A;  2W04 A;  2PZV A;  1AVK A;  3HI7 A;  3CCU 3;  4HM0 B;  3DH2 A;  3MWZ A;  3LYG A;  1W01 A;  4R80 A;  1IV9 A;  5IEN A;  1UUV B;  1LRA A;  2C11 A;  2R4I A;  4BIR A;  2CFL A;  1LOV A;  1RDS A;  2ZA4 A;  2XSH B;  4KFF A;  1YHQ 3;  1O7P B;  3URP A;  3F7X A;  2XR8 B;  3JUM A;  3LTC A;  4XBT A;  3PYJ A;  4LSO A;  1VQQ A;  3DGM A;  3EX9 A;  3MSO A;  1SAR A;  3V98 A;  1T5Y A;  2XEP A;  1B2Z A;  1FGM A;  3RNT A;  3D5I A;  3DZL A;  4BL2 A;  1M1K 4;  1EQK A;  5AI1 A;  3CCS 3;  3FG4 A;  3CC2 3;  5CK6 A;  1VQN 3;  3OXA A;  2E2T A;  1Q9E A;  2H0G A;  2CWU A;  1A2P A;  3KE7 A;  3LTD A;  3MKI A;  5DRE A;  5HGR A;  1OF5 A;  3LML A;  3NBR A;  1A2K A;  3Q3F A;  3BND A;  1GY6 A;  2K0M A;  3NXJ A;  3ZFZ A;  1UI8 A;  1RN4 A;  1Q7Y 4;  3X41 A;  3D3L A;  1G96 A;  4WFO A;  2CFK A;  1RGH A;  1ZO2 A;  2KCD A;  4G1M B;  5AIH A;  5IG4 A;  4U13 A;  3NUV A;  1BOX A;  3CD6 3;  2P0X A;  1FUS A;  1RGA A;  3FF2 A;  3EF8 A;  4IT7 A;  5ELU A;  1W02 A;  1JN5 A;  3LOY A;  4FMD A;  3BNB A;  4OVM A;  5LC6 A;  2C4B A;  3AMO B;  3FF0 A;  1HZ1 A;  2WGO A;  4OUQ A;  2WO0 A;  3SX1 A;  3OWY A;  1FW7 A;  2B24 B;  5DRV A;  3FG3 A;  1BNR A;  1D6U A;  4ORL A;  1IQX A;  3PGB A;  4NHF A;  3G6E 3;  3FKA A;  3AHW A;  5GSP A;  4Q53 A;  1BAO A;  1W6G A;  1U5O A;  3PXM A;  2D42 A;  1JB5 A;  1UCK A;  3NM7 A;  1RGF A;  1LNH A;  1YVS A;  3AHS A;  4FCM A;  1Q82 4;  1NJI 4;  5AII A;  4N6L A;  2ZL8 A;  1IVX A;  3KSE D;  3N9H A;  5RNT A;  1JV2 B;  2IUK A;  4LGQ A;  1GYB A;  1JZD A;  2GBW B;  2XFS A;  2HMN B;  2W03 A;  2WGQ A;  5FGO A;  1JBT A;  3LT8 A;  4XB5 A;  4XM4 A;  2P09 A;  4HM8 B;  1I0X A;  1SIH A;  1HKX A;  4HM7 B;  1PY3 A;  4HKV B;  3CXC 2;  4I5Q A;  2XH9 A;  2AAE A;  1UI7 A;  1Q40 B;  2WOF A;  4GB5 A;  4FCJ A;  1M9G A;  4ILF A;  1VQO 3;  1ZS7 A;  1A90 A;  1JRQ A;  1D6Z A;  2CG0 A;  3EJV A;  5G1K A;  2CFG A;  1GMR A;  1QMA A;  4HAA A;  1RLS A;  4JF8 A;  3X40 A;  2KXG A;  2XF3 A;  1OGX A;  1S5A A;  4X2O A;  5AIF A;  3J7Y d;  1LOY A;  4HM1 B;  3K7C A;  1C54 A;  5IW9 A;  3X3X A;  1O7G B;  2WOH A;  4HJL B;  3AGO A;  3DGL A;  5JBS A;  3FSD A;  4NPB A;  2O9U X;  5AEW B;  3UL5 A;  1IQY A;  3N8B A;  4J5G A;  1B3S A;  1SII A;  2W2C A;  3MG2 A;  4KFD A;  1I2E A;  3FLJ A;  1GD3 A;  1E3V A;  3QRD A;  3T8U A;  2BIR A;  4RZM A;  5STD A;  4X2H A;  1Q81 4;  2OWP A;  3S29 A;  1RRL A;  1I2F A;  1MWS A;  3HK4 A;  4L8P A;  2W9Q A;  3RGA A;  3CCQ 3;  1WNH A;  1ZGX A;  1V58 A;  1WMN A;  2OOV A;  5JPP A;  3NBJ A;  2O3O A;  3LZA A;  4RBN A;  3DM8 A;  1GSP A;  1FYS A;  1UUW B;  3I0Y A;  2IY2 A;  2D1W A;  2GSP A;  3MHE A;  4XBX A;  3CPO A;  3WMD A;  1U8C B;  2YX9 A;  2XRX B;  4OK0 A;  1W6Y A;  1TRQ A;  4TX4 A;  3WOE B;  5M18 A;  1OGZ A;  4QWT A;  2IYJ A;  3NQZ A;  2K3D A;  5EVH A;  5HOH A;  2E2V A;  3QK9 A;  2L4V A;  3NHX A;  2QGU A;  2QA4 3;  2CWV A;  2GBX B;  1FUW A;  4MEI A;  3SXX A;  1MGW A;  2BU4 A;  4GHO A;  3TDG A;  2KAA A;  1S72 3;  1EG9 B;  2RSX A;  4KZ1 A;  4EW5 A;  3GZY B;  2SBL A;  4L8O A;  3WR2 A;  2CK3 H;  1KWI A;  4O2H A;  3CCR 3;  1YIT 3;  2UGI A;  5CF1 A;  3Q2P A;  4WWU C;  1YGW A;  1BNJ A;  2KF3 A;  1BUQ A;  2YFI B;  4MMX B;  1RHL A;  1JNQ A;  1IYY A;  2BNG A;  2XGN A;  1NB5 I;  1JB2 A;  3SED A;  1BVI A;  3T8N A;  1LVN A;  2CH9 A;  2CX1 A;  1IVW A;  3CU3 A;  1WTH A;  4CJN A;  1K28 A;  1MOL A;  2Y73 A;  2OQE A;  1YI2 3;  4HM2 B;  1UDI I;  1X1U A;  1DMQ A;  1G02 A;  1PYL A;  2P05 A;  4KT3 B;  5CF2 A;  4WHA A;  1TP6 A;  5M19 A;  1VQP 3;  4HZB B;  3KFQ C;  5AIG A;  3GSP A;  3I56 3;  3ER7 A;  3OWU A;  1JB4 A;  2ZDJ A;  3RGR A;  2GEY A;  1GY5 A;  1AV4 A;  4XDW A;  2W56 A;  2RBI A;  1OH0 A;  1STD A;  1EKM A;  1IVU A;  3ROB A;  3GZR A;  2GU3 A;  3GZX B;  1I3F A;  1MNL A;  3CCJ 3;  1ASK A;  4CCV A;  2HML B;  4AEQ A;  2Q07 A;  3B4P A;  5D82 A;  1K73 4;  4N6V 0;  1I3I A;  4WYK B;  1B2M A;  3NV0 A;  5FW5 A;  3BNE A;  1UCJ A;  2Z6B A;  1X1X A;  2BHM A;  1UUG B;  1FGO A;  8CHO A;  1US1 A;  1ROV A;  2F98 A;  3GAX A;  3OW2 2;  2OCT A;  2BMR B;  1FGR A;  1BRG A;  4J9A A;  1YJ9 3;  1TUH A;  3MG1 A;  2XGL A;  1AY7 A;  4EBG A;  1QVF 2;  4O02 B;  3CCM 3;  1UGI A;  4N6O B;  2ML5 A;  1VQ5 3;  1ZX2 A;  5D83 A;  3WOD G;  1DVC A;  3Q1C A;  1SJW A;  4MMZ B;  2KF4 A;  3KII A;  1N5P A;  1UCL A;  2BMQ B;  1NO3 A;  2KRT A;  4PEJ A;  3FH1 A;  3KN4 A;  3LTB A;  3BLZ A;  3HZP A;  1TRP A;  1ISK A;  2F56 A;  1BRH A;  1SPU A;  4RNZ A;  1D6Y A;  1NB3 I;  3ZG0 A;  1BSC A;  2UX0 A;  2LQV A;  2CFD A;  3F9S A;  3OWS A;  4J5K A;  1Z1S A;  3CMA 3;  1R4Y A;  3AGN A;  3STD A;  1O7M B;  5BU4 A;  3DGN A;  1RJO A;  4IPB A;  3SVA A;  3JUN A;  3D9R A;  5IEO A;  1IDP A;  2CX0 A;  1W00 A;  2C10 A;  3D79 A;  2F5W A;  3SOY A;  3VSY A;  4H3U A;  4EC6 A;  3F8X A;  3PCS A;  1W2Z A;  3WA3 A;  2HMK B;  1RCK A;  3M8C A;  3KSP A;  4IIA A;  1KC8 4;  1IVV A;  1OPY A;  1TJD A;  1SQW A;  1V57 A;  3G4S 3;  2CKF B;  4WYK A;  3X42 A;  3SOA A;  4EXR A;  4RNT A;  4N6T A;  1YJN 3;  3CC7 3;  8RNT A;  5IG3 A;  1O7H B;  1A2V A;  3AMO A;  3H51 A;  1YJW 3;  1GS3 A;  2CC3 A;  1RKY A;  1GMP A;  1C7H A;  4NRE A;  4CDL A;  4HM4 B;  3HII A;  1LQM B;  1OHS A;  3F14 A;  1LXE A;  3EBY A;  1BRS A;  3LT9 A;  3G71 3;  2E2U A;  1CQS A;  3B4O A;  1JBS A;  1N5H A;  1O7W B;  1AQZ A;  1N8Q A;  2HOH A;  4HBR A;  5A0O B;  2XFT A;  3EQQ B;  5BIR A;  4HM5 B;  3BU4 A;  7GSP A;  1RGC A;  1BNG A;  5EEO A;  3EB8 A;  4J8T A;  1LOW A;  1RTU A;  4XBY A;  1LOX A;  1K41 A;  4GSP A;  4O3V A;  1FGQ A;  1N8R 4;  3EE1 A;  1UCI A;  1EUI C;  2HMM B;  1GOU A;  3UNL A;  1GOY A;  1NU3 A;  2RNT A;  4K1V A;  3VGN A;  1CYU A;  3T0U A;  3JUQ A;  3K63 A;  3S28 A;  1EEJ A;  2IMJ A;  3DGO A;  3GWR A;  2GEX A;  3F8H A;  4O8S A;  5AYS C;  1ULJ B;  2Z76 A;  3DY5 A;  1YNV X;  2CFW A;  1Q40 A;  3IPT A;  3H3H A;  3V99 A;  4BTW A;  3F7S A;  1CH0 A;  4CPK A;  1BNF A;  1DE3 A;  1J2B A;  1DVD A;  1IU7 A;  2F4Y A;  3PCR A;  4FR9 A;  2ML6 A;  4WP5 A;  3V92 A;  3BB9 A;  1M90 4;  1FZU A;  2ZHX B;  1RN7 A;  3VF1 A;  1B21 A;  1BU4 A;  1VQL 3;  1L5G B;  2OQE C;  3PZW A;  3CPW 2;  3U1W A;  4HZ9 B;  2BMO B;  3F40 A;  4LYL B;  1OHO A;  2CIU A;  1KD1 4;  3NQY A;  2J8X B;  5IEP A;  6STD A;  1VQK 3;  1GMQ A;  4HYZ A;  3DXO A;  5IF6 A;  3ECF A;  2JDI H;  4GL6 A;  3N54 B;  1UGH I;  2V1L A;  1TU5 A;  3U97 A;  2PNC A;  3SLU A;  1TTO A;  3K0Z A;  3B8L A;  4I4K A;  4HM6 B;  4K1U A;  4MJD A;  9RNT A;  1G0T A;  3FCS B;  1WQL B;  1TFK A;  5KP4 A;  1BRI A;  3LXU X;  4FMB A;  4KVH A;  3JVC A;  5IG0 A;  1OCV A;  1QAF A;  3HIG A;  2B1X B;  2F86 B;  1WMO A; 
#chains in the Genus database with same CATH homology
 2ZHX B;  1EUI C;  1UGI A;  2UUG C;  1UDI I;  1UGH I;  2J8X B;  1LQG C;  1UUG B;  2UGI A;  4LYL B;  1LQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...