5AYSC

Crystal structure of saugi/hsv udg complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
MTLELQLKHYITNLFNLPKDEKWECESIEEIADDILPDQYVRLGALSNKILQTYTYYSDTLHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
publication title Using structural-based protein engineering to modulate the differential inhibition effects of SAUGI on human and HSV uracil DNA glycosylase.
pubmed doi rcsb
source organism Human herpesvirus 1 (strain 17)
total genus 25
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5aysC00
2KCDA 5AYSC 5AYRB 3WDGB
chains in the Genus database with same CATH superfamily
2B1XB 3X40A 1K28A 2F5MA 1YJN3 2OTL3 2BT3A 4XDVA 5CF2A 1BU4A 1BRGA 1BRHA 2ZA4A 2CK3H 1S723 1BNEA 3S67A 3CCV3 3CCM3 1VQO3 1IDPA 1IV7A 1GY5A 3MG2A 1BSEA 1RHLA 4O02B 4WFOA 3KN4A 3Q1CA 3FG3A 4HM3B 4XBYA 1N5HA 1W01A 2Z6BA 3NX0A 1JKGA 1LXEA 3GZRA 1GMRA 4EV2A 4X2OA 1IVUA 2HMLB 3SOYA 1RGHA 4HM7B 4NHFA 2I9WA 1AR0A 1M1XB 3CCJ3 4OUQA 3NUVA 4K61A 1FW7A 2BIRA 1EEJA 3EE1A 3GSPA 3T8UA 1T2IA 1FGTA 3NXJA 3OWUA 2GSPA 4I4KA 2O3OA 1IT7A 2KAAA 1KC84 1CYUA 2IUKA 1ASKA 1ZO2A 2Z7AA 4BTXA 1N9JA 1ULJB 2QA43 3FCSB 4FMCA 1BUQA 3KCHA 3S27A 4IIAA 1UCJA 1MWRA 3K63A 2JDIH 3PYJA 2HMKB 1BIRA 3Q3FA 1QMAA 1RCKA 3WHOA 3LT8A 5M1AA 1RLSA 1GD4A 1GD3A 3FF0A 1RGCA 1W6CA 5BXQA 1OPYA 2XGNA 2M7OA 1B2ZA 1GSPA 4WYKB 3SXXA 3PCSA 1G96A 3FG4A 3JUNA 4N6NB 4GB5A 3ZG0A 3X3ZA 1EUIC 3B4PA 3ZG5A 2ZHXB 4FR9A 1K734 1SARA 2GU3A 2RFRA 3WMDA 4EW5A 1BRIA 2GU1A 4EC6A 3I553 2GBWB 2CKFB 3EF8A 1FGOA 3HX8A 1BUJA 1U8CB 2BMRB 1MWTA 5D82A 2OQEC 2XH9A 2MF7A 3FKAA 3JVCA 5EQLA 3CCL3 1CH0A 3EN8A 4FCZA 3LTDA 1WMPA 8RNTA 1FA3A 1JRQA 4WWUC 6STDA 3U97A 1W4NA 4RNZA 3CCR3 1IYYA 4EYCA 1OUNA 3WDGB 1TJDA 1BSCA 1UUVB 1LNIA 2XSOB 3CNMA 1DYUA 1YNVX 1TFOA 2CFGA 2FXTA 2WOHA 2CX0A 3BU4A 1TP6A 1A2VA 3MWZA 3NBJA 1RNBA 1DVDA 1TUHA 3DY5A 1EKMA 4H61A 3U1WA 1YIT3 3HIGA 5STDA 2FGTA 2UGIA 1ISKA 1RGFA 3I563 1VQ83 1BAOA 1RGEA 1TRPA 2E2UA 1B21A 2KF5A 3ER7A 2W56A 2GXFA 1AV4A 1EA2A 2E2VA 4I5QA 4LYLB 5DREA 1BNGA 5AIIA 4N6LA 2ML6A 1I2FA 1BGSA 1OHOA 3KZTA 4HYZA 1W02A 3NHXA 1Y4KA 1QVF2 3DZLA 1VQ53 1W2ZA 2E2TA 1GY7A 3EN1B 1N9EA 1QVG2 4ZM8A 1B20A 2CWTA 1MNLA 3NBRA 3F7SA 4HJLB 5IF6A 5M19A 3CC73 4OK0A 3LOYA 1O7NB 1OHSA 1WQLB 3CNXA 1A90A 3UL5A 4L7KA 1NU3A 3WODG 5I97A 4RBNA 1HKXA 4CDLA 1STDA 1VQN3 1SQWA 2RNTA 5GSPA 3UB1A 3J7Yd 3CD63 1YVBI 3KSED 4WHAA 4BU4A 2C11A 2L1SA 4L8OA 1NB5I 1K41A 4CJNA 2LYXA 2CWUA 1G0TA 1JN5B 2ML5A 5AIHA 4LMIA 2J8XB 4IT7A 1YJ93 2HOHA 2P09A 3SYUA 1JZOA 1KWIA 2F56A 1O7PB 3MHEA 1PU4A 3K9MC 1UW1A 5CXOA 4J5KA 2INXA 3HK4A 3PCRA 4OVMA 4JF8A 3BNCA 3D3LA 3RGAA 1FUWA 3DGMA 1M1K4 4HOHA 3LTCA 1JB4A 1JJ22 3QRDA 2A15A 3DM8A 2Q07A 2RBIA 2SBLA 3KSPA 2UUGC 3SLUA 3N54B 2D42A 1OF5B 4XBTA 2MC8A 1JV2B 5FW5A 3RNTA 2O9UX 7GSPA 1W7CA 2XF3A 2YFLB 5ELJA 5IG4A 1YGEA 1FUTA 9RNTA 2SARA 2RSXA 1C54A 2KXGA 1VQL3 2W6JH 1FZUA 1GMPA 2CFWA 4K1UA 3JUMA 4R1KA 3JUQA 3X41A 1NO3A 1IVWA 1CQSA 4EV5A 1W5ZA 2IMJA 1NWWA 3F40A 2KF4A 2P38A 3RDEA 3LTAA 4HVNA 3WOEB 1NDOB 4BTYA 2BHMA 2R41A 3AGNA 3D9RA 3EX9A 3F9SA 1C7HA 3NV0B 1DE3A 3CCE3 1N8R4 3F8XA 5JPUA 1VQ43 2CH9A 2FNQA 4BL2A 1UGHI 4J5GA 5DRVA 4ORLA 3MSOA 3NM7A 1SJWA 2R4IA 1UCKA 1E3VA 1LQMB 3NQYA 1YGWA 1YI23 1S5AA 2BMOB 5BU4A 1WMOA 2GEYA 1RN1A 1D6UA 3M8CA 3K0ZA 1DVCA 3FG1A 3X42A 3A5EA 2CFDA 1Q814 4HM0B 2BMQB 2W2CA 4KFDA 2Z77A 1BANA 3CU3A 3MPHA 3BNEA 2PNCA 3LXUX 4H3UA 3FGYA 2W9PA 2ZDJA 5HGRA 7STDA 3Q2PA 1A2KA 1VQ93 1KQS2 3GWRA 4HM2B 5JBSA 4N6MA 1YJW3 1TIJA 2H0HA 4AKZA 2IYJA 1QJGA 2CWVA 2L4VA 4WP5A 1QAKA 2K54A 3NM2A 3MYTA 4HM1B 3V98A 5BVBA 1W6YA 5LC6A 3KFQC 2OWPA 5ELUA 3X3YA 3CC43 1IV9A 4J9AA 3FLJA 3WR2A 4ILFA 1BRJA 3LMLA 3BNDA 3F8HA 1RGGA 1BRKA 3DH2A 2F99A 3D4AA 5A0OB 1WNHA 2W04A 4CCVA 2XR8B 1E3RA 3AMOB 2HMNB 1OCVA 3DMCA 1JN5A 2UX0A 2H0GA 3BLZA 1RJOA 4PEJA 3A76A 2KF6A 3DGNA 1VQP3 5D83A 4EXRA 2BU4A 2HMMB 1RSNA 2F98A 1RGLA 4MMXB 1CYVA 3OWYA 3T0UA 4KFEA 3D5GA 4HM4B 3V92A 3SEDA 5IG3A 3UL6A 1JB2A 1VZZA 3B4OA 1I2GA 1IU7A 1RKYA 2B24B 5HOHA 1JB5A 1Q40B 3VGNA 1OH0A 1BRSA 3V99A 1I0VA 1LOYA 5IG5A 2C10A 3WA3A 3E99A 4LEHA 3FSDA 4BTWA 1OF5A 1BRNL 1KSIA 3H3HA 5G1LA 1TFKA 1UDII 1U5OA 5M18A 3DGLA 1R4CA 1UUGB 3GZBA 3L0RA 1YHQ3 1ROVA 1IT8A 1MWUA 1UCIA 1DETA 3OXAA 4LSOA 1GOYA 4HZBB 1IQ8A 3VSYA 3EC9A 3G4S3 2OTJ3 1O7MB 2H0IA 3AGOA 1RGKA 2W03A 1QALA 3OX9A 3CPW2 3DGOA 3CPOA 5CLKA 1AQZA 1CEWI 2OCTA 5JPPA 1FUSA 3NV0A 5EEOA 1I3IA 1OGXA 5TGNA 4BL3A 1Q9EA 1ROAA 3KIIA 4KZ1A 4IPBA 1X1WA 1IVVA 1X1YA 2BO9B 3BNBA 2W9QA 4KVHA 3G16A 1STFI 1IVXA 4FCJA 2P05A 4N6OB 4J8TA 3LTBA 3Q90A 2QEX3 4WYKA 1MGWA 2ZL8A 3AHWA 3FZWA 5FGOA 2OOVA 3CCQ3 1RGAA 4FMBA 1Q824 5CF1A 2WO0A 4R4KA 3EB8A 1N8QA 8CHOA 3EQQB 3GAXA 3B8LA 1Q864 5IG0A 3ECFA 1HZ1A 1D6ZA 1OHPA 3G0KA 5KP4A 3ZFZA 2PZVA 1ZS7A 1B3SA 1T5YA 5IENA 1FGRA 1HU9A 5IEOA 1BOXA 1B2UA 1DMNA 2KCDA 4KT3B 4MEIA 4Q53A 1RRHA 1JZDA 2KRTA 2GEXA 2W56B 4RNYA 3D5IA 1K8A4 1QAFA 3HZPA 3CC23 1M904 2AADA 3HI7A 1ZGXA 2V1LA 2HMOB 4GSPA 4O8SA 1SIIA 5D81A 1VQ63 3OWSA 1LOVA 2CX1A 1W2B2 3NQZA 2K3DA 5RNTA 1BNSA 3GZXB 3AMOA 3H51A 1M9GA 3DGYA 4O2HA 1JBRA 5LC7A 3N8BA 4MMYB 1HYFA 4XM4A 3ROBA 4XB5A 1T2HA 4R80A 1D6YA 2LQVA 6GSPA 2Y73A 3LZAA 3NBBA 4HZ9B 3PGBA 2STDA 1FGQA 2CHCA 4N6V0 4QWTA 1A67A 7RNTA 3N9HA 3K5TA 1NJI4 1MGRA 1RDSA 1V58A 3G713 3D79A 1US1A 1KD14 6RNTA 2XSHB 4G1MB 1I8VA 5AIGA 1I2EA 3WA2X 1TRQA 4GL6A 5AYRB 1Q40A 1GOUA 2IA7A 2F4YA 3O8YA 3OV4A 1O7GB 1BNRA 1SPUA 3BIRA 1J2BA 1GY6A 4KFFA 3OW22 4R9LA 1A2PA 3FF2A 1B2SA 4AKYA 4LZIA 5IERA 4JRFA 2XGLA 2Z76A 1UCLA 4HM6B 1Q7Y4 2C4BA 3KKGA 3GRDA 1UI7A 1EG9B 2GBXB 4N6TA 2BNGA 2XEPA 3GZYB 4U13A 3MG3A 5KP3A 5KP1A 1BSAA 1VQQA 1OGZA 3CMA3 1MOLA 2JQ5A 1TU5A 3DUKA 3JUPA 3X3XA 3ALAA 3IJEB 4FMAA 3K7CA 1BVIA 2IUJA 5BIRA 5G2GA 1V74A 4L8PA 3G8ZA 2Y74A 1JKGB 1G02A 1JNQA 3JUOA 3UNLA 1B27A 3IPTA 2RCDA 4K90B 1SIHA 3SOAA 1GMQA 1LOWA 1E97A 2WOFA 3CME3 4K1VA 1I0XA 1DMMA 2YX9A 3LT9A 3PXMA 1I3FA 1BSDA 2XFTA 4HM8B 4AEQA 3TDGA 2CG1A 1Q42A 1RTUA 1T3BA 2CG0A 3AHSA 1MWSA 1UI8A 3EJVA 1RN7A 1W6GA 4TX4A 4DKIA 4STDA 1BNJA 2OQEA 1VQ73 2K0MA 2CFLA 3IMAB 2XRXB 4MMZB 1O7HB 2F86B 3EHCA 3PS8A 4BIRA 5AEUB 2WGOA 1JBTA 4N6UA 2RGQA 1UUWB 1X1UA 3EBYA 3STDA 1IK3A 2P0MA 1I70A 1VQM3 2KF3A 4R9KA 4FMDA 3FH1A 4XBXA 1DMQA 2QIYA 1LQGC 2YFJB 1BSBA 4FCMA 5G1KA 4HKVB 1X1XA 3F14A 5IW9A 1WTHA 3G6E3 3RGRA 2W0QA 3MG1A 3WOFB 1VQK3 3LH4A 5AIFA 3S29A 1GYBA 1UGIA 1PYLA 1LVNA 2CC3A 3DXOA 1FGMA 2XFSA 4HAAA 3B7CA 1WMNA 1GOVA 1R4YA 2IY2A 4HBRA 5CK6A 3PZWA 4X2HA 1GS3A 1RN4A 2D1WA 3EBTA 4NPBA 2WGQA 2HMJB 1AVLA 3LYGA 1L5GB 3CXC2 1FYSA 4HM5B 3HIIA 4LGQA 2OOVC 3T8NA 1K9M4 1Z1SA 4MJDA 3S5CA 1AY7A 1RCLA 1RNTA 3CCU3 1LRAA 4EBGA 3F7XA 4N3VA 3CCS3 1IQYA 3URPA 1F8NA 3HOHA 1ZX2A 3SVAA 1V57A 1RRLA 1NB3I 1YIJ3 2CW9A 1RMSA 4RZMA 1LNHA 5AYSC 1TTOA 1YVSA 3S28A 1ULIB 2CFKA 1AVKA 5IEPA 2QGUA 1O7WB 1B2XA 1IQXA 2F5WA 4NREA 3UJMA 3MKIA 1PY3A 1JBSA 1LOXA 2P0XA 4GHOA 1BNFA 5AEWB 4CPKA 1B2MA 1Q7HA 2YFIB 3BB9A 1PFPA 1NNVA 2CIUA 2AAEA 3KE7A 4O3VA 1EQKA 5AI1A 1N5PA 3VF1A 5EVHA 1BNIA 3I0YA 1OACA 3SX1A 4RNTA 4XDWA 3QK9A 1W00A
chains in the Genus database with same CATH topology
2B1XB 3X40A 1K28A 1YJN3 2OTL3 2BT3A 4XDVA 5CF2A 1S723 2CK3H 3CCV3 3S67A 1VQO3 3CCM3 1IDPA 1IV7A 1GY5A 3MG2A 4O02B 4WFOA 3KN4A 3Q1CA 3FG3A 4HM3B 4XBYA 1N5HA 1W01A 2Z6BA 3NX0A 1JKGA 1LXEA 3GZRA 4EV2A 4X2OA 1IVUA 2HMLB 3SOYA 4HM7B 4NHFA 2I9WA 1AR0A 1M1XB 3CCJ3 4OUQA 3NUVA 4K61A 3EE1A 3T8UA 1FGTA 3NXJA 3OWUA 4I4KA 2O3OA 1IT7A 1KC84 1CYUA 2IUKA 1ASKA 1ZO2A 2Z7AA 4BTXA 1N9JA 1ULJB 2QA43 3FCSB 4FMCA 1BUQA 3S27A 4IIAA 3K63A 2JDIH 3PYJA 2HMKB 1QMAA 3LT8A 1GD4A 1GD3A 3FF0A 1W6CA 5BXQA 1OPYA 2XGNA 2M7OA 4WYKB 3SXXA 3PCSA 1G96A 3FG4A 3JUNA 4N6NB 4GB5A 3X3ZA 3B4PA 4FR9A 1K734 2GU3A 2RFRA 3WMDA 4EC6A 2GU1A 3I553 2GBWB 2CKFB 3EF8A 1FGOA 3HX8A 1U8CB 2BMRB 5D82A 2OQEC 2XH9A 2MF7A 3FKAA 3JVCA 5EQLA 3CCL3 3EN8A 4FCZA 3LTDA 1WMPA 1FA3A 1JRQA 4WWUC 6STDA 3U97A 1W4NA 4RNZA 3CCR3 4EYCA 1OUNA 3WDGB 1UUVB 2XSOB 3CNMA 3CPOA 1DYUA 1TFOA 2CFGA 2WOHA 2FXTA 1TP6A 1A2VA 3MWZA 3NBJA 1DVDA 1TUHA 3DY5A 1EKMA 4H61A 3U1WA 1YIT3 3HIGA 5STDA 2FGTA 1ISKA 3I563 1VQ83 2E2UA 3ER7A 2W56A 2GXFA 1AV4A 1EA2A 2E2VA 5DREA 5AIIA 4N6LA 2ML6A 1OHOA 3KZTA 4HYZA 1W02A 3NHXA 1Y4KA 1QVF2 3DZLA 1VQ53 1W2ZA 2E2TA 1GY7A 3EN1B 1N9EA 1QVG2 4ZM8A 2CWTA 1MNLA 3NBRA 3F7SA 4HJLB 5IF6A 3CC73 4OK0A 3LOYA 1O7NB 1OHSA 1WQLB 3CNXA 1A90A 3UL5A 4L7KA 1NU3A 3WODG 5I97A 4RBNA 1HKXA 4CDLA 1STDA 1VQN3 1SQWA 3UB1A 3J7Yd 3CD63 1YVBI 3KSED 4WHAA 2C11A 4L8OA 1NB5I 1K41A 2LYXA 2CWUA 1JN5B 2ML5A 5AIHA 4LMIA 1YJ93 4IT7A 2P09A 1KWIA 1O7PB 3MHEA 1PU4A 3K9MC 1UW1A 5CXOA 2INXA 3HK4A 3PCRA 4OVMA 4JF8A 3BNCA 3D3LA 3RGAA 1FUWA 3DGMA 1M1K4 3LTCA 1JB4A 1JJ22 3QRDA 2A15A 3DM8A 2Q07A 2SBLA 3KSPA 3SLUA 3N54B 2D42A 1OF5B 4XBTA 2MC8A 1JV2B 5FW5A 2O9UX 1W7CA 2XF3A 2YFLB 5ELJA 5IG4A 1YGEA 2RSXA 2KXGA 1VQL3 2W6JH 2CFWA 4K1UA 3JUMA 4R1KA 3JUQA 3X41A 1NO3A 1IVWA 1CQSA 4EV5A 1W5ZA 2IMJA 1NWWA 3F40A 2P38A 3RDEA 3LTAA 4HVNA 3WOEB 1NDOB 4BTYA 2BHMA 3D9RA 3EX9A 3F9SA 1C7HA 3NV0B 3CCE3 1N8R4 3F8XA 5JPUA 1VQ43 2CH9A 2FNQA 5DRVA 4ORLA 3MSOA 3NM7A 1SJWA 2R4IA 1E3VA 3NQYA 1YI23 1S5AA 2BMOB 1WMOA 2GEYA 1D6UA 3M8CA 3K0ZA 1DVCA 3FG1A 3X42A 2CFDA 1Q814 4HM0B 2BMQB 2W2CA 4KFDA 2Z77A 3CU3A 3MPHA 3BNEA 2PNCA 3LXUX 4H3UA 3FGYA 2W9PA 2ZDJA 5HGRA 7STDA 3Q2PA 1A2KA 1VQ93 1KQS2 3GWRA 4HM2B 5JBSA 4N6MA 1YJW3 1TIJA 4AKZA 2L4VA 1QJGA 2CWVA 4WP5A 1QAKA 2K54A 3NM2A 3MYTA 4HM1B 3V98A 5BVBA 1W6YA 5LC6A 3KFQC 2OWPA 5ELUA 3X3YA 3CC43 1IV9A 4J9AA 3FLJA 3LMLA 3BNDA 3F8HA 2F99A 5A0OB 1WNHA 2W04A 4CCVA 2XR8B 1E3RA 3AMOB 2HMNB 1OCVA 3DMCA 2UX0A 1JN5A 3BLZA 1RJOA 4PEJA 3A76A 1VQP3 3DGNA 5D83A 4EXRA 2HMMB 2F98A 4MMXB 1CYVA 3OWYA 3T0UA 4KFEA 4HM4B 3V92A 3SEDA 5IG3A 3UL6A 1JB2A 1VZZA 3B4OA 1RKYA 1IU7A 2B24B 1JB5A 1Q40B 3VGNA 1OH0A 3V99A 5IG5A 2C10A 3WA3A 3E99A 4LEHA 3FSDA 4BTWA 1OF5A 1KSIA 3H3HA 1TFKA 1U5OA 3DGLA 1R4CA 3GZBA 3L0RA 1YHQ3 1ROVA 1IT8A 3OXAA 4LSOA 4HZBB 3VSYA 1IQ8A 3EC9A 3G4S3 2OTJ3 1O7MB 3OX9A 2W03A 1QALA 3CPW2 3DGOA 5CLKA 1CEWI 2OCTA 5JPPA 3NV0A 5EEOA 1OGXA 5TGNA 1ROAA 3KIIA 4KZ1A 4IPBA 2BO9B 1IVVA 3BNBA 2W9QA 4KVHA 3G16A 1STFI 1IVXA 4FCJA 2P05A 4N6OB 4J8TA 3LTBA 3Q90A 2QEX3 4WYKA 2ZL8A 2OOVA 3FZWA 5FGOA 3CCQ3 4FMBA 1Q824 5CF1A 2WO0A 4R4KA 3EB8A 1N8QA 8CHOA 3EQQB 3GAXA 3B8LA 1Q864 5IG0A 3ECFA 1D6ZA 1OHPA 3G0KA 5KP4A 2PZVA 1T5YA 5IENA 1FGRA 1HU9A 5IEOA 1DMNA 2KCDA 4MEIA 4RNYA 4Q53A 1RRHA 2KRTA 2W56B 2GEXA 1K8A4 1QAFA 3HZPA 3CC23 1M904 3HI7A 2V1LA 2HMOB 4O8SA 1SIIA 5D81A 1VQ63 3OWSA 1W2B2 3NQZA 3GZXB 3AMOA 3H51A 1M9GA 4O2HA 5LC7A 3N8BA 4MMYB 4XM4A 3ROBA 4XB5A 4R80A 1D6YA 2LQVA 2Y73A 3LZAA 3NBBA 4HZ9B 3PGBA 2STDA 1FGQA 2CHCA 4N6V0 4QWTA 1A67A 3N9HA 3K5TA 1NJI4 3G713 1US1A 1KD14 2XSHB 4G1MB 5AIGA 3WA2X 4GL6A 5AYRB 2IA7A 1Q40A 3O8YA 3OV4A 1O7GB 1SPUA 1J2BA 1GY6A 4KFFA 3OW22 4R9LA 3FF2A 4AKYA 4LZIA 5IERA 4JRFA 2XGLA 2Z76A 4HM6B 1Q7Y4 3KKGA 3GRDA 1UI7A 1EG9B 2GBXB 4N6TA 2BNGA 2XEPA 3GZYB 4U13A 3MG3A 5KP3A 5KP1A 3CMA3 1OGZA 1MOLA 2JQ5A 1TU5A 3DUKA 3JUPA 3X3XA 3ALAA 3IJEB 4FMAA 3K7CA 2IUJA 5G2GA 1V74A 4L8PA 3G8ZA 2Y74A 1JKGB 1JNQA 3JUOA 3UNLA 3IPTA 2RCDA 4K90B 1SIHA 3SOAA 2WOFA 1E97A 3CME3 4K1VA 1DMMA 2YX9A 3LT9A 3PXMA 2XFTA 4HM8B 4AEQA 3TDGA 2CG1A 1Q42A 2CG0A 1UI8A 3EJVA 1RN7A 1W6GA 4TX4A 4STDA 2OQEA 1VQ73 2K0MA 2CFLA 3IMAB 2XRXB 4MMZB 1O7HB 2F86B 3EHCA 3PS8A 5AEUB 2WGOA 4N6UA 2RGQA 1UUWB 3STDA 3EBYA 1IK3A 2P0MA 1VQM3 4R9KA 4FMDA 3FH1A 4XBXA 1DMQA 2QIYA 2YFJB 4FCMA 4HKVB 5IW9A 3F14A 3G6E3 1WTHA 3RGRA 2W0QA 3MG1A 3WOFB 1VQK3 3LH4A 5AIFA 3S29A 1GYBA 3DXOA 2CC3A 1LVNA 1FGMA 2XFSA 3B7CA 1WMNA 5CK6A 4HBRA 3PZWA 4X2HA 1GS3A 2D1WA 3EBTA 1L5GB 2WGQA 2HMJB 1AVLA 3LYGA 3CXC2 4HM5B 3HIIA 4LGQA 2OOVC 3T8NA 1K9M4 1Z1SA 4MJDA 3S5CA 3CCU3 4EBGA 3F7XA 4N3VA 3CCS3 1IQYA 1F8NA 1ZX2A 3SVAA 1RRLA 1NB3I 1YIJ3 2CW9A 4RZMA 1LNHA 5AYSC 3S28A 1ULIB 2CFKA 1AVKA 5IEPA 2QGUA 1O7WB 1IQXA 4NREA 3UJMA 3MKIA 1LOXA 2P0XA 5AEWB 2YFIB 3BB9A 1PFPA 2CIUA 3KE7A 4O3VA 1EQKA 5AI1A 1N5PA 3VF1A 5EVHA 3I0YA 1OACA 3SX1A 4XDWA 3QK9A 1W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCD A;  5AYS C;  5AYR B;  3WDG B; 
#chains in the Genus database with same CATH topology
 2B1X B;  3X40 A;  1K28 A;  2F5M A;  1YJN 3;  2OTL 3;  2BT3 A;  4XDV A;  5CF2 A;  1BU4 A;  1BRG A;  1BRH A;  2ZA4 A;  2CK3 H;  1S72 3;  1BNE A;  3S67 A;  3CCV 3;  3CCM 3;  1VQO 3;  1IDP A;  1IV7 A;  1GY5 A;  3MG2 A;  1BSE A;  1RHL A;  4O02 B;  4WFO A;  3KN4 A;  3Q1C A;  3FG3 A;  4HM3 B;  4XBY A;  1N5H A;  1W01 A;  2Z6B A;  3NX0 A;  1JKG A;  1LXE A;  3GZR A;  1GMR A;  4EV2 A;  4X2O A;  1IVU A;  2HML B;  3SOY A;  1RGH A;  4HM7 B;  4NHF A;  2I9W A;  1AR0 A;  1M1X B;  3CCJ 3;  4OUQ A;  3NUV A;  4K61 A;  1FW7 A;  2BIR A;  1EEJ A;  3EE1 A;  3GSP A;  3T8U A;  1T2I A;  1FGT A;  3NXJ A;  3OWU A;  2GSP A;  4I4K A;  2O3O A;  1IT7 A;  2KAA A;  1KC8 4;  1CYU A;  2IUK A;  1ASK A;  1ZO2 A;  2Z7A A;  4BTX A;  1N9J A;  1ULJ B;  2QA4 3;  3FCS B;  4FMC A;  1BUQ A;  3KCH A;  3S27 A;  4IIA A;  1UCJ A;  1MWR A;  3K63 A;  2JDI H;  3PYJ A;  2HMK B;  1BIR A;  3Q3F A;  1QMA A;  1RCK A;  3WHO A;  3LT8 A;  5M1A A;  1RLS A;  1GD4 A;  1GD3 A;  3FF0 A;  1RGC A;  1W6C A;  5BXQ A;  1OPY A;  2XGN A;  2M7O A;  1B2Z A;  1GSP A;  4WYK B;  3SXX A;  3PCS A;  1G96 A;  3FG4 A;  3JUN A;  4N6N B;  4GB5 A;  3ZG0 A;  3X3Z A;  1EUI C;  3B4P A;  3ZG5 A;  2ZHX B;  4FR9 A;  1K73 4;  1SAR A;  2GU3 A;  2RFR A;  3WMD A;  4EW5 A;  1BRI A;  2GU1 A;  4EC6 A;  3I55 3;  2GBW B;  2CKF B;  3EF8 A;  1FGO A;  3HX8 A;  1BUJ A;  1U8C B;  2BMR B;  1MWT A;  5D82 A;  2OQE C;  2XH9 A;  2MF7 A;  3FKA A;  3JVC A;  5EQL A;  3CCL 3;  1CH0 A;  3EN8 A;  4FCZ A;  3LTD A;  1WMP A;  8RNT A;  1FA3 A;  1JRQ A;  4WWU C;  6STD A;  3U97 A;  1W4N A;  4RNZ A;  3CCR 3;  1IYY A;  4EYC A;  1OUN A;  3WDG B;  1TJD A;  1BSC A;  1UUV B;  1LNI A;  2XSO B;  3CNM A;  1DYU A;  1YNV X;  1TFO A;  2CFG A;  2FXT A;  2WOH A;  2CX0 A;  3BU4 A;  1TP6 A;  1A2V A;  3MWZ A;  3NBJ A;  1RNB A;  1DVD A;  1TUH A;  3DY5 A;  1EKM A;  4H61 A;  3U1W A;  1YIT 3;  3HIG A;  5STD A;  2FGT A;  2UGI A;  1ISK A;  1RGF A;  3I56 3;  1VQ8 3;  1BAO A;  1RGE A;  1TRP A;  2E2U A;  1B21 A;  2KF5 A;  3ER7 A;  2W56 A;  2GXF A;  1AV4 A;  1EA2 A;  2E2V A;  4I5Q A;  4LYL B;  5DRE A;  1BNG A;  5AII A;  4N6L A;  2ML6 A;  1I2F A;  1BGS A;  1OHO A;  3KZT A;  4HYZ A;  1W02 A;  3NHX A;  1Y4K A;  1QVF 2;  3DZL A;  1VQ5 3;  1W2Z A;  2E2T A;  1GY7 A;  3EN1 B;  1N9E A;  1QVG 2;  4ZM8 A;  1B20 A;  2CWT A;  1MNL A;  3NBR A;  3F7S A;  4HJL B;  5IF6 A;  5M19 A;  3CC7 3;  4OK0 A;  3LOY A;  1O7N B;  1OHS A;  1WQL B;  3CNX A;  1A90 A;  3UL5 A;  4L7K A;  1NU3 A;  3WOD G;  5I97 A;  4RBN A;  1HKX A;  4CDL A;  1STD A;  1VQN 3;  1SQW A;  2RNT A;  5GSP A;  3UB1 A;  3J7Y d;  3CD6 3;  1YVB I;  3KSE D;  4WHA A;  4BU4 A;  2C11 A;  2L1S A;  4L8O A;  1NB5 I;  1K41 A;  4CJN A;  2LYX A;  2CWU A;  1G0T A;  1JN5 B;  2ML5 A;  5AIH A;  4LMI A;  2J8X B;  4IT7 A;  1YJ9 3;  2HOH A;  2P09 A;  3SYU A;  1JZO A;  1KWI A;  2F56 A;  1O7P B;  3MHE A;  1PU4 A;  3K9M C;  1UW1 A;  5CXO A;  4J5K A;  2INX A;  3HK4 A;  3PCR A;  4OVM A;  4JF8 A;  3BNC A;  3D3L A;  3RGA A;  1FUW A;  3DGM A;  1M1K 4;  4HOH A;  3LTC A;  1JB4 A;  1JJ2 2;  3QRD A;  2A15 A;  3DM8 A;  2Q07 A;  2RBI A;  2SBL A;  3KSP A;  2UUG C;  3SLU A;  3N54 B;  2D42 A;  1OF5 B;  4XBT A;  2MC8 A;  1JV2 B;  5FW5 A;  3RNT A;  2O9U X;  7GSP A;  1W7C A;  2XF3 A;  2YFL B;  5ELJ A;  5IG4 A;  1YGE A;  1FUT A;  9RNT A;  2SAR A;  2RSX A;  1C54 A;  2KXG A;  1VQL 3;  2W6J H;  1FZU A;  1GMP A;  2CFW A;  4K1U A;  3JUM A;  4R1K A;  3JUQ A;  3X41 A;  1NO3 A;  1IVW A;  1CQS A;  4EV5 A;  1W5Z A;  2IMJ A;  1NWW A;  3F40 A;  2KF4 A;  2P38 A;  3RDE A;  3LTA A;  4HVN A;  3WOE B;  1NDO B;  4BTY A;  2BHM A;  2R41 A;  3AGN A;  3D9R A;  3EX9 A;  3F9S A;  1C7H A;  3NV0 B;  1DE3 A;  3CCE 3;  1N8R 4;  3F8X A;  5JPU A;  1VQ4 3;  2CH9 A;  2FNQ A;  4BL2 A;  1UGH I;  4J5G A;  5DRV A;  4ORL A;  3MSO A;  3NM7 A;  1SJW A;  2R4I A;  1UCK A;  1E3V A;  1LQM B;  3NQY A;  1YGW A;  1YI2 3;  1S5A A;  2BMO B;  5BU4 A;  1WMO A;  2GEY A;  1RN1 A;  1D6U A;  3M8C A;  3K0Z A;  1DVC A;  3FG1 A;  3X42 A;  3A5E A;  2CFD A;  1Q81 4;  4HM0 B;  2BMQ B;  2W2C A;  4KFD A;  2Z77 A;  1BAN A;  3CU3 A;  3MPH A;  3BNE A;  2PNC A;  3LXU X;  4H3U A;  3FGY A;  2W9P A;  2ZDJ A;  5HGR A;  7STD A;  3Q2P A;  1A2K A;  1VQ9 3;  1KQS 2;  3GWR A;  4HM2 B;  5JBS A;  4N6M A;  1YJW 3;  1TIJ A;  2H0H A;  4AKZ A;  2IYJ A;  1QJG A;  2CWV A;  2L4V A;  4WP5 A;  1QAK A;  2K54 A;  3NM2 A;  3MYT A;  4HM1 B;  3V98 A;  5BVB A;  1W6Y A;  5LC6 A;  3KFQ C;  2OWP A;  5ELU A;  3X3Y A;  3CC4 3;  1IV9 A;  4J9A A;  3FLJ A;  3WR2 A;  4ILF A;  1BRJ A;  3LML A;  3BND A;  3F8H A;  1RGG A;  1BRK A;  3DH2 A;  2F99 A;  3D4A A;  5A0O B;  1WNH A;  2W04 A;  4CCV A;  2XR8 B;  1E3R A;  3AMO B;  2HMN B;  1OCV A;  3DMC A;  1JN5 A;  2UX0 A;  2H0G A;  3BLZ A;  1RJO A;  4PEJ A;  3A76 A;  2KF6 A;  3DGN A;  1VQP 3;  5D83 A;  4EXR A;  2BU4 A;  2HMM B;  1RSN A;  2F98 A;  1RGL A;  4MMX B;  1CYV A;  3OWY A;  3T0U A;  4KFE A;  3D5G A;  4HM4 B;  3V92 A;  3SED A;  5IG3 A;  3UL6 A;  1JB2 A;  1VZZ A;  3B4O A;  1I2G A;  1IU7 A;  1RKY A;  2B24 B;  5HOH A;  1JB5 A;  1Q40 B;  3VGN A;  1OH0 A;  1BRS A;  3V99 A;  1I0V A;  1LOY A;  5IG5 A;  2C10 A;  3WA3 A;  3E99 A;  4LEH A;  3FSD A;  4BTW A;  1OF5 A;  1BRN L;  1KSI A;  3H3H A;  5G1L A;  1TFK A;  1UDI I;  1U5O A;  5M18 A;  3DGL A;  1R4C A;  1UUG B;  3GZB A;  3L0R A;  1YHQ 3;  1ROV A;  1IT8 A;  1MWU A;  1UCI A;  1DET A;  3OXA A;  4LSO A;  1GOY A;  4HZB B;  1IQ8 A;  3VSY A;  3EC9 A;  3G4S 3;  2OTJ 3;  1O7M B;  2H0I A;  3AGO A;  1RGK A;  2W03 A;  1QAL A;  3OX9 A;  3CPW 2;  3DGO A;  3CPO A;  5CLK A;  1AQZ A;  1CEW I;  2OCT A;  5JPP A;  1FUS A;  3NV0 A;  5EEO A;  1I3I A;  1OGX A;  5TGN A;  4BL3 A;  1Q9E A;  1ROA A;  3KII A;  4KZ1 A;  4IPB A;  1X1W A;  1IVV A;  1X1Y A;  2BO9 B;  3BNB A;  2W9Q A;  4KVH A;  3G16 A;  1STF I;  1IVX A;  4FCJ A;  2P05 A;  4N6O B;  4J8T A;  3LTB A;  3Q90 A;  2QEX 3;  4WYK A;  1MGW A;  2ZL8 A;  3AHW A;  3FZW A;  5FGO A;  2OOV A;  3CCQ 3;  1RGA A;  4FMB A;  1Q82 4;  5CF1 A;  2WO0 A;  4R4K A;  3EB8 A;  1N8Q A;  8CHO A;  3EQQ B;  3GAX A;  3B8L A;  1Q86 4;  5IG0 A;  3ECF A;  1HZ1 A;  1D6Z A;  1OHP A;  3G0K A;  5KP4 A;  3ZFZ A;  2PZV A;  1ZS7 A;  1B3S A;  1T5Y A;  5IEN A;  1FGR A;  1HU9 A;  5IEO A;  1BOX A;  1B2U A;  1DMN A;  2KCD A;  4KT3 B;  4MEI A;  4Q53 A;  1RRH A;  1JZD A;  2KRT A;  2GEX A;  2W56 B;  4RNY A;  3D5I A;  1K8A 4;  1QAF A;  3HZP A;  3CC2 3;  1M90 4;  2AAD A;  3HI7 A;  1ZGX A;  2V1L A;  2HMO B;  4GSP A;  4O8S A;  1SII A;  5D81 A;  1VQ6 3;  3OWS A;  1LOV A;  2CX1 A;  1W2B 2;  3NQZ A;  2K3D A;  5RNT A;  1BNS A;  3GZX B;  3AMO A;  3H51 A;  1M9G A;  3DGY A;  4O2H A;  1JBR A;  5LC7 A;  3N8B A;  4MMY B;  1HYF A;  4XM4 A;  3ROB A;  4XB5 A;  1T2H A;  4R80 A;  1D6Y A;  2LQV A;  6GSP A;  2Y73 A;  3LZA A;  3NBB A;  4HZ9 B;  3PGB A;  2STD A;  1FGQ A;  2CHC A;  4N6V 0;  4QWT A;  1A67 A;  7RNT A;  3N9H A;  3K5T A;  1NJI 4;  1MGR A;  1RDS A;  1V58 A;  3G71 3;  3D79 A;  1US1 A;  1KD1 4;  6RNT A;  2XSH B;  4G1M B;  1I8V A;  5AIG A;  1I2E A;  3WA2 X;  1TRQ A;  4GL6 A;  5AYR B;  1Q40 A;  1GOU A;  2IA7 A;  2F4Y A;  3O8Y A;  3OV4 A;  1O7G B;  1BNR A;  1SPU A;  3BIR A;  1J2B A;  1GY6 A;  4KFF A;  3OW2 2;  4R9L A;  1A2P A;  3FF2 A;  1B2S A;  4AKY A;  4LZI A;  5IER A;  4JRF A;  2XGL A;  2Z76 A;  1UCL A;  4HM6 B;  1Q7Y 4;  2C4B A;  3KKG A;  3GRD A;  1UI7 A;  1EG9 B;  2GBX B;  4N6T A;  2BNG A;  2XEP A;  3GZY B;  4U13 A;  3MG3 A;  5KP3 A;  5KP1 A;  1BSA A;  1VQQ A;  1OGZ A;  3CMA 3;  1MOL A;  2JQ5 A;  1TU5 A;  3DUK A;  3JUP A;  3X3X A;  3ALA A;  3IJE B;  4FMA A;  3K7C A;  1BVI A;  2IUJ A;  5BIR A;  5G2G A;  1V74 A;  4L8P A;  3G8Z A;  2Y74 A;  1JKG B;  1G02 A;  1JNQ A;  3JUO A;  3UNL A;  1B27 A;  3IPT A;  2RCD A;  4K90 B;  1SIH A;  3SOA A;  1GMQ A;  1LOW A;  1E97 A;  2WOF A;  3CME 3;  4K1V A;  1I0X A;  1DMM A;  2YX9 A;  3LT9 A;  3PXM A;  1I3F A;  1BSD A;  2XFT A;  4HM8 B;  4AEQ A;  3TDG A;  2CG1 A;  1Q42 A;  1RTU A;  1T3B A;  2CG0 A;  3AHS A;  1MWS A;  1UI8 A;  3EJV A;  1RN7 A;  1W6G A;  4TX4 A;  4DKI A;  4STD A;  1BNJ A;  2OQE A;  1VQ7 3;  2K0M A;  2CFL A;  3IMA B;  2XRX B;  4MMZ B;  1O7H B;  2F86 B;  3EHC A;  3PS8 A;  4BIR A;  5AEU B;  2WGO A;  1JBT A;  4N6U A;  2RGQ A;  1UUW B;  1X1U A;  3EBY A;  3STD A;  1IK3 A;  2P0M A;  1I70 A;  1VQM 3;  2KF3 A;  4R9K A;  4FMD A;  3FH1 A;  4XBX A;  1DMQ A;  2QIY A;  1LQG C;  2YFJ B;  1BSB A;  4FCM A;  5G1K A;  4HKV B;  1X1X A;  3F14 A;  5IW9 A;  1WTH A;  3G6E 3;  3RGR A;  2W0Q A;  3MG1 A;  3WOF B;  1VQK 3;  3LH4 A;  5AIF A;  3S29 A;  1GYB A;  1UGI A;  1PYL A;  1LVN A;  2CC3 A;  3DXO A;  1FGM A;  2XFS A;  4HAA A;  3B7C A;  1WMN A;  1GOV A;  1R4Y A;  2IY2 A;  4HBR A;  5CK6 A;  3PZW A;  4X2H A;  1GS3 A;  1RN4 A;  2D1W A;  3EBT A;  4NPB A;  2WGQ A;  2HMJ B;  1AVL A;  3LYG A;  1L5G B;  3CXC 2;  1FYS A;  4HM5 B;  3HII A;  4LGQ A;  2OOV C;  3T8N A;  1K9M 4;  1Z1S A;  4MJD A;  3S5C A;  1AY7 A;  1RCL A;  1RNT A;  3CCU 3;  1LRA A;  4EBG A;  3F7X A;  4N3V A;  3CCS 3;  1IQY A;  3URP A;  1F8N A;  3HOH A;  1ZX2 A;  3SVA A;  1V57 A;  1RRL A;  1NB3 I;  1YIJ 3;  2CW9 A;  1RMS A;  4RZM A;  1LNH A;  5AYS C;  1TTO A;  1YVS A;  3S28 A;  1ULI B;  2CFK A;  1AVK A;  5IEP A;  2QGU A;  1O7W B;  1B2X A;  1IQX A;  2F5W A;  4NRE A;  3UJM A;  3MKI A;  1PY3 A;  1JBS A;  1LOX A;  2P0X A;  4GHO A;  1BNF A;  5AEW B;  4CPK A;  1B2M A;  1Q7H A;  2YFI B;  3BB9 A;  1PFP A;  1NNV A;  2CIU A;  2AAE A;  3KE7 A;  4O3V A;  1EQK A;  5AI1 A;  1N5P A;  3VF1 A;  5EVH A;  1BNI A;  3I0Y A;  1OAC A;  3SX1 A;  4RNT A;  4XDW A;  3QK9 A;  1W00 A; 
#chains in the Genus database with same CATH homology
 2B1X B;  3X40 A;  1K28 A;  1YJN 3;  2OTL 3;  2BT3 A;  4XDV A;  5CF2 A;  1S72 3;  2CK3 H;  3CCV 3;  3S67 A;  1VQO 3;  3CCM 3;  1IDP A;  1IV7 A;  1GY5 A;  3MG2 A;  4O02 B;  4WFO A;  3KN4 A;  3Q1C A;  3FG3 A;  4HM3 B;  4XBY A;  1N5H A;  1W01 A;  2Z6B A;  3NX0 A;  1JKG A;  1LXE A;  3GZR A;  4EV2 A;  4X2O A;  1IVU A;  2HML B;  3SOY A;  4HM7 B;  4NHF A;  2I9W A;  1AR0 A;  1M1X B;  3CCJ 3;  4OUQ A;  3NUV A;  4K61 A;  3EE1 A;  3T8U A;  1FGT A;  3NXJ A;  3OWU A;  4I4K A;  2O3O A;  1IT7 A;  1KC8 4;  1CYU A;  2IUK A;  1ASK A;  1ZO2 A;  2Z7A A;  4BTX A;  1N9J A;  1ULJ B;  2QA4 3;  3FCS B;  4FMC A;  1BUQ A;  3S27 A;  4IIA A;  3K63 A;  2JDI H;  3PYJ A;  2HMK B;  1QMA A;  3LT8 A;  1GD4 A;  1GD3 A;  3FF0 A;  1W6C A;  5BXQ A;  1OPY A;  2XGN A;  2M7O A;  4WYK B;  3SXX A;  3PCS A;  1G96 A;  3FG4 A;  3JUN A;  4N6N B;  4GB5 A;  3X3Z A;  3B4P A;  4FR9 A;  1K73 4;  2GU3 A;  2RFR A;  3WMD A;  4EC6 A;  2GU1 A;  3I55 3;  2GBW B;  2CKF B;  3EF8 A;  1FGO A;  3HX8 A;  1U8C B;  2BMR B;  5D82 A;  2OQE C;  2XH9 A;  2MF7 A;  3FKA A;  3JVC A;  5EQL A;  3CCL 3;  3EN8 A;  4FCZ A;  3LTD A;  1WMP A;  1FA3 A;  1JRQ A;  4WWU C;  6STD A;  3U97 A;  1W4N A;  4RNZ A;  3CCR 3;  4EYC A;  1OUN A;  3WDG B;  1UUV B;  2XSO B;  3CNM A;  3CPO A;  1DYU A;  1TFO A;  2CFG A;  2WOH A;  2FXT A;  1TP6 A;  1A2V A;  3MWZ A;  3NBJ A;  1DVD A;  1TUH A;  3DY5 A;  1EKM A;  4H61 A;  3U1W A;  1YIT 3;  3HIG A;  5STD A;  2FGT A;  1ISK A;  3I56 3;  1VQ8 3;  2E2U A;  3ER7 A;  2W56 A;  2GXF A;  1AV4 A;  1EA2 A;  2E2V A;  5DRE A;  5AII A;  4N6L A;  2ML6 A;  1OHO A;  3KZT A;  4HYZ A;  1W02 A;  3NHX A;  1Y4K A;  1QVF 2;  3DZL A;  1VQ5 3;  1W2Z A;  2E2T A;  1GY7 A;  3EN1 B;  1N9E A;  1QVG 2;  4ZM8 A;  2CWT A;  1MNL A;  3NBR A;  3F7S A;  4HJL B;  5IF6 A;  3CC7 3;  4OK0 A;  3LOY A;  1O7N B;  1OHS A;  1WQL B;  3CNX A;  1A90 A;  3UL5 A;  4L7K A;  1NU3 A;  3WOD G;  5I97 A;  4RBN A;  1HKX A;  4CDL A;  1STD A;  1VQN 3;  1SQW A;  3UB1 A;  3J7Y d;  3CD6 3;  1YVB I;  3KSE D;  4WHA A;  2C11 A;  4L8O A;  1NB5 I;  1K41 A;  2LYX A;  2CWU A;  1JN5 B;  2ML5 A;  5AIH A;  4LMI A;  1YJ9 3;  4IT7 A;  2P09 A;  1KWI A;  1O7P B;  3MHE A;  1PU4 A;  3K9M C;  1UW1 A;  5CXO A;  2INX A;  3HK4 A;  3PCR A;  4OVM A;  4JF8 A;  3BNC A;  3D3L A;  3RGA A;  1FUW A;  3DGM A;  1M1K 4;  3LTC A;  1JB4 A;  1JJ2 2;  3QRD A;  2A15 A;  3DM8 A;  2Q07 A;  2SBL A;  3KSP A;  3SLU A;  3N54 B;  2D42 A;  1OF5 B;  4XBT A;  2MC8 A;  1JV2 B;  5FW5 A;  2O9U X;  1W7C A;  2XF3 A;  2YFL B;  5ELJ A;  5IG4 A;  1YGE A;  2RSX A;  2KXG A;  1VQL 3;  2W6J H;  2CFW A;  4K1U A;  3JUM A;  4R1K A;  3JUQ A;  3X41 A;  1NO3 A;  1IVW A;  1CQS A;  4EV5 A;  1W5Z A;  2IMJ A;  1NWW A;  3F40 A;  2P38 A;  3RDE A;  3LTA A;  4HVN A;  3WOE B;  1NDO B;  4BTY A;  2BHM A;  3D9R A;  3EX9 A;  3F9S A;  1C7H A;  3NV0 B;  3CCE 3;  1N8R 4;  3F8X A;  5JPU A;  1VQ4 3;  2CH9 A;  2FNQ A;  5DRV A;  4ORL A;  3MSO A;  3NM7 A;  1SJW A;  2R4I A;  1E3V A;  3NQY A;  1YI2 3;  1S5A A;  2BMO B;  1WMO A;  2GEY A;  1D6U A;  3M8C A;  3K0Z A;  1DVC A;  3FG1 A;  3X42 A;  2CFD A;  1Q81 4;  4HM0 B;  2BMQ B;  2W2C A;  4KFD A;  2Z77 A;  3CU3 A;  3MPH A;  3BNE A;  2PNC A;  3LXU X;  4H3U A;  3FGY A;  2W9P A;  2ZDJ A;  5HGR A;  7STD A;  3Q2P A;  1A2K A;  1VQ9 3;  1KQS 2;  3GWR A;  4HM2 B;  5JBS A;  4N6M A;  1YJW 3;  1TIJ A;  4AKZ A;  2L4V A;  1QJG A;  2CWV A;  4WP5 A;  1QAK A;  2K54 A;  3NM2 A;  3MYT A;  4HM1 B;  3V98 A;  5BVB A;  1W6Y A;  5LC6 A;  3KFQ C;  2OWP A;  5ELU A;  3X3Y A;  3CC4 3;  1IV9 A;  4J9A A;  3FLJ A;  3LML A;  3BND A;  3F8H A;  2F99 A;  5A0O B;  1WNH A;  2W04 A;  4CCV A;  2XR8 B;  1E3R A;  3AMO B;  2HMN B;  1OCV A;  3DMC A;  2UX0 A;  1JN5 A;  3BLZ A;  1RJO A;  4PEJ A;  3A76 A;  1VQP 3;  3DGN A;  5D83 A;  4EXR A;  2HMM B;  2F98 A;  4MMX B;  1CYV A;  3OWY A;  3T0U A;  4KFE A;  4HM4 B;  3V92 A;  3SED A;  5IG3 A;  3UL6 A;  1JB2 A;  1VZZ A;  3B4O A;  1RKY A;  1IU7 A;  2B24 B;  1JB5 A;  1Q40 B;  3VGN A;  1OH0 A;  3V99 A;  5IG5 A;  2C10 A;  3WA3 A;  3E99 A;  4LEH A;  3FSD A;  4BTW A;  1OF5 A;  1KSI A;  3H3H A;  1TFK A;  1U5O A;  3DGL A;  1R4C A;  3GZB A;  3L0R A;  1YHQ 3;  1ROV A;  1IT8 A;  3OXA A;  4LSO A;  4HZB B;  3VSY A;  1IQ8 A;  3EC9 A;  3G4S 3;  2OTJ 3;  1O7M B;  3OX9 A;  2W03 A;  1QAL A;  3CPW 2;  3DGO A;  5CLK A;  1CEW I;  2OCT A;  5JPP A;  3NV0 A;  5EEO A;  1OGX A;  5TGN A;  1ROA A;  3KII A;  4KZ1 A;  4IPB A;  2BO9 B;  1IVV A;  3BNB A;  2W9Q A;  4KVH A;  3G16 A;  1STF I;  1IVX A;  4FCJ A;  2P05 A;  4N6O B;  4J8T A;  3LTB A;  3Q90 A;  2QEX 3;  4WYK A;  2ZL8 A;  2OOV A;  3FZW A;  5FGO A;  3CCQ 3;  4FMB A;  1Q82 4;  5CF1 A;  2WO0 A;  4R4K A;  3EB8 A;  1N8Q A;  8CHO A;  3EQQ B;  3GAX A;  3B8L A;  1Q86 4;  5IG0 A;  3ECF A;  1D6Z A;  1OHP A;  3G0K A;  5KP4 A;  2PZV A;  1T5Y A;  5IEN A;  1FGR A;  1HU9 A;  5IEO A;  1DMN A;  2KCD A;  4MEI A;  4RNY A;  4Q53 A;  1RRH A;  2KRT A;  2W56 B;  2GEX A;  1K8A 4;  1QAF A;  3HZP A;  3CC2 3;  1M90 4;  3HI7 A;  2V1L A;  2HMO B;  4O8S A;  1SII A;  5D81 A;  1VQ6 3;  3OWS A;  1W2B 2;  3NQZ A;  3GZX B;  3AMO A;  3H51 A;  1M9G A;  4O2H A;  5LC7 A;  3N8B A;  4MMY B;  4XM4 A;  3ROB A;  4XB5 A;  4R80 A;  1D6Y A;  2LQV A;  2Y73 A;  3LZA A;  3NBB A;  4HZ9 B;  3PGB A;  2STD A;  1FGQ A;  2CHC A;  4N6V 0;  4QWT A;  1A67 A;  3N9H A;  3K5T A;  1NJI 4;  3G71 3;  1US1 A;  1KD1 4;  2XSH B;  4G1M B;  5AIG A;  3WA2 X;  4GL6 A;  5AYR B;  2IA7 A;  1Q40 A;  3O8Y A;  3OV4 A;  1O7G B;  1SPU A;  1J2B A;  1GY6 A;  4KFF A;  3OW2 2;  4R9L A;  3FF2 A;  4AKY A;  4LZI A;  5IER A;  4JRF A;  2XGL A;  2Z76 A;  4HM6 B;  1Q7Y 4;  3KKG A;  3GRD A;  1UI7 A;  1EG9 B;  2GBX B;  4N6T A;  2BNG A;  2XEP A;  3GZY B;  4U13 A;  3MG3 A;  5KP3 A;  5KP1 A;  3CMA 3;  1OGZ A;  1MOL A;  2JQ5 A;  1TU5 A;  3DUK A;  3JUP A;  3X3X A;  3ALA A;  3IJE B;  4FMA A;  3K7C A;  2IUJ A;  5G2G A;  1V74 A;  4L8P A;  3G8Z A;  2Y74 A;  1JKG B;  1JNQ A;  3JUO A;  3UNL A;  3IPT A;  2RCD A;  4K90 B;  1SIH A;  3SOA A;  2WOF A;  1E97 A;  3CME 3;  4K1V A;  1DMM A;  2YX9 A;  3LT9 A;  3PXM A;  2XFT A;  4HM8 B;  4AEQ A;  3TDG A;  2CG1 A;  1Q42 A;  2CG0 A;  1UI8 A;  3EJV A;  1RN7 A;  1W6G A;  4TX4 A;  4STD A;  2OQE A;  1VQ7 3;  2K0M A;  2CFL A;  3IMA B;  2XRX B;  4MMZ B;  1O7H B;  2F86 B;  3EHC A;  3PS8 A;  5AEU B;  2WGO A;  4N6U A;  2RGQ A;  1UUW B;  3STD A;  3EBY A;  1IK3 A;  2P0M A;  1VQM 3;  4R9K A;  4FMD A;  3FH1 A;  4XBX A;  1DMQ A;  2QIY A;  2YFJ B;  4FCM A;  4HKV B;  5IW9 A;  3F14 A;  3G6E 3;  1WTH A;  3RGR A;  2W0Q A;  3MG1 A;  3WOF B;  1VQK 3;  3LH4 A;  5AIF A;  3S29 A;  1GYB A;  3DXO A;  2CC3 A;  1LVN A;  1FGM A;  2XFS A;  3B7C A;  1WMN A;  5CK6 A;  4HBR A;  3PZW A;  4X2H A;  1GS3 A;  2D1W A;  3EBT A;  1L5G B;  2WGQ A;  2HMJ B;  1AVL A;  3LYG A;  3CXC 2;  4HM5 B;  3HII A;  4LGQ A;  2OOV C;  3T8N A;  1K9M 4;  1Z1S A;  4MJD A;  3S5C A;  3CCU 3;  4EBG A;  3F7X A;  4N3V A;  3CCS 3;  1IQY A;  1F8N A;  1ZX2 A;  3SVA A;  1RRL A;  1NB3 I;  1YIJ 3;  2CW9 A;  4RZM A;  1LNH A;  5AYS C;  3S28 A;  1ULI B;  2CFK A;  1AVK A;  5IEP A;  2QGU A;  1O7W B;  1IQX A;  4NRE A;  3UJM A;  3MKI A;  1LOX A;  2P0X A;  5AEW B;  2YFI B;  3BB9 A;  1PFP A;  2CIU A;  3KE7 A;  4O3V A;  1EQK A;  5AI1 A;  1N5P A;  3VF1 A;  5EVH A;  3I0Y A;  1OAC A;  3SX1 A;  4XDW A;  3QK9 A;  1W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...