2I9WA

Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
177
Chain Sequence
MLFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQAIRADTAEHLMRTRYSAFVLVKPEYIVKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVSMSVTQKQPCICGSGEKFKRCCGMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_265345.1) from Psychrobacter Arcticum 273-4 at 1.75 A resolution
rcsb
source organism Psychrobacter arcticus
molecule tags Metal binding protein
total genus 39
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02810 SEC-C SEC-C motif
A PF17775 UPF0225 UPF0225 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2i9wA00
4STDA 2OWPA 3FSDA 3ECFA 3OWUA 3JUOA 1W01A 3B8LA 4OUQA 4HM2B 2HMNB 3HZPA 2GEYA 1S5AA 4J9AA 2HMOB 1TUHA 4HM1B 1OH0A 4XBXA 3NUVA 5AIHA 3ROBA 1NDOB 5D82A 4K1UA 1JN5A 3MG3A 3NV0A 4U13A 3Q90A 5FW5A 5IG4A 5IEPA 4XM4A 4FCMA 3KKGA 3WMDA 3EHCA 4XBTA 3JUMA 3GZRA 1Q40B 2XR8B 4KVHA 1A2KA 3FGYA 1ZX2A 5HGRA 3KE7A 1OCVA 4HM8B 5EVHA 1O7NB 4HM7B 1UUWB 1ASKA 3VGNA 3G16A 2RGQA 3E99A 4HZ9B 5AEUB 4K1VA 3OV4A 1C7HA 1EG9B 3JUQA 2YFJB 3F7SA 3NBRA 2Z76A 3SOYA 5G2GA 3FF2A 3K7CA 2B1XB 2YFLB 3GWRA 3GZBA 2XSOB 1HKXA 3JUNA 4HKVB 3BB9A 3DMCA 3CU3A 3ER7A 1GYBA 3GZYB 5STDA 4HM0B 3OWSA 2B24B 3GRDA 1GY6A 4WWUC 1AR0A 3FKAA 4XDWA 4IIAA 4R1KA 1GY7A 2Z7AA 2CHCA 1JN5B 2K54A 3MYTA 4ORLA 3NXJA 1ZO2A 3VSYA 3T8UA 3H51A 3KZTA 3NHXA 3EN1B 3DUKA 3B7CA 5JPUA 1JKGA 3D9RA 3F40A 4XDVA 5CF2A 3EX9A 5IERA 3JUPA 2RCDA 5AIIA 3SOAA 1E97A 2YFIB 3F7XA 3FZWA 2F98A 1SJWA 5IG3A 2I9WA 4HJLB 5AI1A 4HZBB 1JB2A 4H3UA 3EQQB 2UX0A 4GB5A 2GEXA 4LEHA 1IDPA 3F8HA 3OXAA 4PEJA 5BXQA 4XB5A 2CKFB 4WYKB 3BLZA 2GXFA 3KSPA 4X2HA 2XRXB 1UUVB 3H3HA 1E3VA 5DREA 5TGNA 4MJDA 4I4KA 2R4IA 3FH1A 3SEDA 4FCJA 3F8XA 3LYGA 5CF1A 3EBTA 4R9LA 1QJGA 4HM3B 1WQLB 2HMLB 4RZMA 1VZZA 5IEOA 4OVMA 3MHEA 4L8PA 5CK6A 2JQ5A 3CNXA 3HX8A 3F14A 5IF6A 2W2CA 1JKGB 1OUNA 2PZVA 1W02A 5AIGA 1OGZA 4WYKA 3IPTA 5CXOA 4LGQA 1QMAA 4R9KA 3B4PA 2BMRB 2GBXB 2HMJB 1JB4A 3CPOA 4L7KA 1TP6A 2IMJA 3OWYA 1O7GB 4HM5B 3B4OA 3F9SA 4LMIA 3GZXB 3I0YA 5IG5A 2F99A 1DMNA 4HVNA 3UJMA 1EA2A 1DMMA 1OHSA 5KP4A 4J8TA 5CLKA 3EBYA 1OHPA 1JB5A 3FLJA 3EJVA 3FF0A 5AIFA 8CHOA 3T8NA 2STDA 3NM2A 1OHOA 3STDA 2BMOB 3EF8A 1O7MB 4HM4B 1O7WB 5AEWB 1BUQA 3G8ZA 4N3VA 2Z77A 1OF5A 2QGUA 1ULIB 5IENA 5JPPA 4CDLA 5KP1A 3DM8A 3OX9A 1ULJB 2GBWB 2F86B 4XBYA 3MG1A 1K41A 1OGXA 3DXOA 4Q53A 7STDA 2HMKB 5DRVA 3MG2A 1NU3A 4L8OA 5KP3A 4WP5A 1ISKA 2RFRA 2INXA 1NWWA 2QIYA 3S5CA 3MKIA 3RGAA 1GS3A 6STDA 1U5OA 2HMMB 3CNMA 4X2OA 3EN8A 1E3RA 1CQSA 1OPYA 2XSHB 1DMQA 3LZAA 1W6YA 3UNLA 3M8CA 2BMQB 1OF5B 3RGRA 3HK4A 3MSOA 3DZLA 1STDA 3K0ZA 2BNGA 4HM6B 2A15A 1Q40A 1GY5A 5IG0A 1O7HB 1O7PB 3G0KA 3NV0B 1Q42A 3A76A 5D83A 3EC9A 5BVBA 1W00A 5D81A 1Z1SA
chains in the Genus database with same CATH superfamily
2CG0A 2SBLA 2Z6BA 1RMSA 4GL6A 4STDA 2OWPA 1A2VA 3FSDA 3X3ZA 1CYVA 1UCLA 2CK3H 3SX1A 3X3XA 1LOXA 4EXRA 1BOXA 2WOFA 2WO0A 1B2MA 3N8BA 3ECFA 1RGGA 2XFTA 3MWZA 3OWUA 3JUOA 1RCLA 1ZGXA 2CH9A 3AMOB 3NBBA 6RNTA 1W01A 1X1XA 3B8LA 4OUQA 1SPUA 1QVF2 4BL2A 4HM2B 3CXC2 2HMNB 3HZPA 1BRIA 1Y4KA 2GEYA 4RNZA 5M1AA 2FNQA 3UB1A 1S5AA 3WOFB 4J9AA 1I70A 2HMOB 2OTL3 1TUHA 4HM1B 4ZM8A 1ROAA 1OH0A 1YVSA 3D79A 3LTCA 2W04A 4XBXA 4BIRA 4LSOA 1I2FA 3NUVA 1FGRA 5AIHA 3ROBA 1M904 3N9HA 1NDOB 5D82A 4BTXA 1KQS2 4K1UA 1CYUA 1SIHA 2RBIA 1W6GA 3KCHA 1B2SA 4RNYA 3FG1A 1FGTA 1JN5A 3MG3A 3NV0A 1BIRA 1TRPA 4O02B 1BGSA 4U13A 1VQ73 3Q90A 4KT3B 5FW5A 3TDGA 5IG4A 4EV2A 5IEPA 1JBRA 1B2UA 2CW9A 4AKZA 1UDII 4XM4A 3HOHA 1AQZA 1BNIA 3FCSB 4FCMA 4NHFA 2BIRA 3KKGA 3AGNA 3LTAA 3WMDA 3PZWA 1FGMA 3EHCA 3V99A 2FGTA 4XBTA 3JUMA 2C10A 3OW22 1VQM3 1IQ8A 1JNQA 1EQKA 2C4BA 2CWVA 3CCV3 1X1WA 1FGQA 1RJOA 3GZRA 3QK9A 1Q40B 1U8CB 2XR8B 1G96A 1VQK3 1MNLA 1YJW3 4KVHA 1A2KA 2KF3A 3FGYA 1ZX2A 1IV7A 1YHQ3 3AMOA 2H0IA 5HGRA 1N8R4 2XGNA 4CPKA 3KE7A 1IVUA 1VQ43 1I8VA 1OCVA 4HM8B 5EVHA 1JRQA 1O7NB 2ZDJA 3LMLA 4ILFA 1TFOA 3X42A 4HM7B 6GSPA 1A90A 2W56A 1R4YA 1UUWB 1ASKA 3S67A 1HU9A 3VGNA 1I0VA 5BIRA 3G16A 4EV5A 2RGQA 3E99A 1KC84 3DGYA 3CCJ3 1IU7A 4HZ9B 1BAOA 1DETA 1LQGC 3OV4A 4K1VA 2CX1A 5AEUB 1K8A4 3KFQC 1LNHA 1C7HA 1EG9B 1FUTA 1RN7A 1UUGB 1Q814 1WTHA 3JUQA 2YFJB 3F7SA 1N8QA 2AAEA 5RNTA 2MF7A 1B3SA 2W6JH 3NBRA 4BU4A 2Z76A 1W7CA 1FA3A 3SOYA 5G2GA 3FF2A 3K7CA 4KFEA 2B1XB 2YFLB 3GWRA 3GZBA 3U1WA 2XSOB 1RNBA 3CMA3 1SIIA 2E2TA 1HKXA 3BNBA 5LC7A 4K61A 3JUNA 4I5QA 4HKVB 1UI7A 3BB9A 3DMCA 4IPBA 9RNTA 1K9M4 2OOVA 3CU3A 3ER7A 1EKMA 1DE3A 1VQ83 1GYBA 3GZYB 5STDA 4HM0B 1C54A 3CCQ3 2CFLA 3GAXA 1RNTA 3K5TA 2B24B 1N9EA 3GRDA 3OWSA 1IQYA 1GY6A 4WWUC 3JVCA 3K9MC 1AR0A 3FKAA 3DGNA 4MMZB 4XDWA 4NREA 1NB3I 4IIAA 1BNEA 1N9JA 1D6YA 4R1KA 1GY7A 2GSPA 2L4VA 2Z7AA 4WFOA 2CHCA 1JN5B 2K54A 1BRHA 1UCKA 1Q7HA 3MYTA 3X3YA 3N54B 1YJ93 3V92A 1JBTA 2CG1A 4ORLA 4WHAA 4TX4A 3NXJA 1BRJA 2R41A 1RHLA 2V1LA 2HOHA 2W9QA 1ZO2A 3VSYA 3T8UA 3D3LA 3PYJA 3S28A 3LXUX 3BU4A 3H51A 3KZTA 3NHXA 4FMCA 4H61A 4BL3A 1A67A 1Q7Y4 3EN1B 3DUKA 5BU4A 2Y74A 1PY3A 3B7CA 5G1KA 1JKGA 1RGHA 4J5KA 3D9RA 3HIGA 5JPUA 3F40A 3PGBA 3FG3A 2OQEA 4XDVA 1RN1A 5CF2A 4AEQA 2FXTA 3EX9A 5IERA 1RSNA 4HOHA 3JUPA 2F56A 4JF8A 2SARA 2RCDA 1B27A 2XFSA 5AYRB 2W56B 3WOEB 1YJN3 5AIIA 3SOAA 1MWRA 2IYJA 1GMPA 1T5YA 1NO3A 1E97A 2YFIB 3F7XA 5M18A 1WMNA 2H0HA 2P05A 1IYYA 4FMAA 5EEOA 2KAAA 2F98A 3A5EA 3FZWA 1SJWA 5IG3A 1BSEA 2I9WA 2CX0A 2YX9A 4HJLB 4O2HA 3EE1A 4QWTA 5AI1A 1BRSA 5EQLA 2RSXA 3KSED 4HZBB 1JB2A 4EBGA 2XEPA 4H3UA 3EQQB 4EW5A 3RDEA 2CWUA 3LH4A 2UX0A 4GB5A 2GEXA 3BIRA 1YI23 4LEHA 3LT9A 1IDPA 1N5HA 1BRKA 2Y73A 3F8HA 1UCJA 3LTBA 1GSPA 3OXAA 2CWTA 5JBSA 4PEJA 5BXQA 4XB5A 2ZHXB 1RN4A 1LOWA 2CKFB 2ZL8A 1K28A 1QAFA 3BLZA 4WYKB 3CCR3 2GXFA 3I553 1VQ63 1UCIA 2OOVC 2GU3A 3KSPA 3LT8A 4X2HA 1YNVX 2XRXB 1LOVA 1UUVB 3H3HA 1BSCA 3PS8A 2QA43 2P0XA 4HYZA 4O8SA 4N6LA 5G1LA 1VQ53 1B2ZA 1YGWA 1E3VA 5FGOA 1IVXA 2JDIH 1PYLA 2OCTA 5DREA 1T3BA 1BNJA 5TGNA 1I0XA 1VQ93 4MJDA 4I4KA 2R4IA 3FH1A 3SEDA 3AGOA 1PU4A 1STFI 1AVKA 1QAKA 2KXGA 3T0UA 1X1UA 4FCJA 3F8XA 4LZIA 3LYGA 5CF1A 1ROVA 2KF6A 1JBSA 3D5IA 3EBTA 4G1MB 1UW1A 1RLSA 2ML6A 1G02A 1GOUA 4R9LA 3CME3 1BSBA 1QJGA 2L1SA 4HM3B 2Q07A 1WQLB 1UGIA 2IUJA 4CCVA 3BNDA 1M9GA 2HMLB 2UGIA 4RZMA 1VZZA 1D6ZA 1RDSA 4K90B 1JV2B 5IEOA 4OVMA 1B20A 3MHEA 4L8PA 1AY7A 5CK6A 2JQ5A 3CNXA 1VQO3 4LYLB 4AKYA 1W6CA 3LOYA 2D42A 3HX8A 1QVG2 3F14A 2F5MA 2UUGC 5IF6A 2C11A 3AHSA 4MMXB 3CD63 1RTUA 1VQP3 2O9UX 2W2CA 1US1A 2OQEC 1JKGB 1UGHI 1OUNA 8RNTA 2PZVA 3DH2A 1IQXA 1W02A 2RNTA 5AIGA 1GOYA 1OGZA 1N5PA 4WYKA 1VQN3 3IPTA 2F5WA 5CXOA 1FGOA 1TIJA 2PNCA 1QMAA 4KZ1A 2LQVA 4LGQA 3ZFZA 2CC3A 4R9KA 1S723 1HYFA 3RNTA 1NJI4 3B4PA 2BMRB 3WDGB 4J5GA 3URPA 1V58A 2GBXB 3NBJA 3PCSA 1F8NA 1DVDA 1TU5A 2HMJB 1JB4A 4IT7A 1RGLA 1BSDA 1RKYA 4N6MA 3CPOA 2BO9B 2OTJ3 1GMQA 4FR9A 1TP6A 4L7KA 1JJ22 1V74A 4NPBA 3CCU3 1RGKA 2CFGA 1O7GB 2CFKA 2IMJA 2CFDA 3OWYA 1MOLA 3SYUA 1K734 2IA7A 3U97A 1BNFA 2M7OA 3MPHA 1I2GA 4FMDA 1RGCA 3ZG5A 2F4YA 1BUJA 4HM5B 3B4OA 3F9SA 3Q2PA 1Q9EA 4R4KA 4LMIA 2W9PA 2LYXA 1Q864 3GZXB 3I0YA 5IG5A 3ZG0A 2F99A 4BTWA 4DKIA 4JRFA 3CC43 1DMNA 4CJNA 2K3DA 3D4AA 4HVNA 1EA2A 1I3IA 1DMMA 4RBNA 3UJMA 1AVLA 1OHSA 3AHWA 5KP4A 4FMBA 1GOVA 4J8TA 3V98A 4RNTA 3BNCA 3Q3FA 5CLKA 1PFPA 3WR2A 3CCL3 1D6UA 3EBYA 1OHPA 3GSPA 4N6TA 4MMYB 1W5ZA 3PXMA 3CCS3 1JB5A 5A0OB 1WNHA 3FLJA 3EJVA 3FF0A 3SLUA 5AIFA 2XF3A 3IJEB 8CHOA 3S29A 7RNTA 1EUIC 1M1XB 3T8NA 2STDA 3NM2A 3HI7A 3DY5A 1OHOA 2XGLA 3KN4A 5M19A 2CIUA 1BNSA 3STDA 2BMOB 3EF8A 1O7MB 4HM4B 1O7WB 1BRGA 1JZOA 3NX0A 1FUWA 1IVVA 5AEWB 1BUQA 1A2PA 3D5GA 3G8ZA 1KSIA 4N3VA 1LOYA 2Z77A 5LC6A 1G0TA 1MGRA 2P09A 1IK3A 2H0GA 1OF5A 4KFFA 1GD3A 1FZUA 2ML5A 1JZDA 1BU4A 3X41A 1YVBI 2QGUA 1BNGA 1ULIB 1IT7A 2KCDA 1TFKA 5IENA 5JPPA 2O3OA 3S27A 5ELUA 4CDLA 1W4NA 1UI8A 5KP1A 1FYSA 1IT8A 2IY2A 1BVIA 1MWTA 3DM8A 4EC6A 3OX9A 1ULJB 3HIIA 4HBRA 1VQQA 5HOHA 2GBWB 1RCKA 2F86B 4N6NB 4XBYA 1LNIA 1T2IA 1W2B2 3LTDA 2P38A 2BU4A 3MG1A 3UL6A 1K41A 3G713 3PCRA 1OGXA 3DGMA 2W0QA 3DXOA 2WOHA 4Q53A 7STDA 2HMKB 3NQYA 5DRVA 2WGQA 3K63A 1KWIA 3MG2A 1NU3A 3ALAA 4L8OA 1BSAA 4WP5A 5KP3A 1VQL3 1ISKA 7GSPA 2RFRA 1WMPA 4KFDA 2INXA 2W03A 2KRTA 1NWWA 2QIYA 2IUKA 3WODG 2BT3A 1TRQA 1BANA 3MKIA 4GHOA 3RGAA 3S5CA 1GS3A 1DVCA 4OK0A 6STDA 3J7Yd 1U5OA 2HMMB 3I563 3CNMA 1YIJ3 4X2OA 1MWUA 1EEJA 1I2EA 3UL5A 2E2UA 5I97A 3FG4A 5IW9A 1Q824 1ZS7A 2WGOA 3EN8A 1E3RA 2KF5A 1CQSA 3CCE3 1OPYA 2XSHB 4GSPA 3CPW2 1LXEA 4HAAA 3X40A 1IV9A 1SARA 3NQZA 2E2VA 4N6OB 1AV4A 1GMRA 1L5GB 1LRAA 2KF4A 1DMQA 2GU1A 4BTYA 2ZA4A 3LZAA 1W6YA 1X1YA 2K0MA 3UNLA 1NNVA 4FCZA 1BNRA 5AYSC 2MC8A 3G4S3 3M8CA 3EB8A 1YGEA 1RGAA 1LQMB 1KD14 1DYUA 2AADA 1J2BA 1LVNA 1OACA 1WMOA 1B21A 4EYCA 2BMQB 1RRHA 3SXXA 3CCM3 1MWSA 4O3VA 3QRDA 1NB5I 1OF5B 3RGRA 2D1WA 1RGEA 3HK4A 3MSOA 3DZLA 3WHOA 3KIIA 1M1K4 1STDA 3IMAB 3BNEA 1BRNL 3VF1A 3K0ZA 3WA3A 3DGOA 2BHMA 1TTOA 2BNGA 3O8YA 2A15A 4HM6B 4MEIA 1Q40A 3CC73 1GY5A 5IG0A 1IVWA 2P0MA 1O7HB 1SQWA 2XH9A 1O7PB 4R80A 1CH0A 1RRLA 1MGWA 3G0KA 4N6V0 2QEX3 1I3FA 1V57A 3WA2X 3CC23 1YIT3 1TJDA 1GD4A 1W2ZA 5GSPA 1FUSA 2CFWA 3NV0B 3SVAA 1Q42A 3A76A 5D83A 3G6E3 4N6UA 1RGFA 3DGLA 3L0RA 2J8XB 1QALA 3EC9A 5BVBA 1T2HA 1FW7A 1W00A 1CEWI 5D81A 1Z1SA 3NM7A 3Q1CA 1HZ1A 5ELJA 1B2XA 1R4CA
chains in the Genus database with same CATH topology
2CG0A 2SBLA 2Z6BA 4GL6A 4STDA 2OWPA 1A2VA 3FSDA 3X3ZA 1CYVA 2CK3H 3SX1A 3X3XA 4EXRA 1LOXA 2WOFA 2WO0A 3N8BA 3ECFA 2XFTA 3MWZA 3OWUA 3JUOA 3AMOB 2CH9A 3NBBA 1W01A 3B8LA 4OUQA 1SPUA 1QVF2 4HM2B 3CXC2 2HMNB 3HZPA 1Y4KA 4RNZA 2GEYA 3WOFB 2FNQA 3UB1A 1S5AA 4J9AA 2HMOB 2OTL3 1TUHA 4HM1B 4ZM8A 1ROAA 1OH0A 3LTCA 4XBXA 2W04A 4LSOA 3NUVA 1FGRA 5AIHA 3ROBA 1M904 3N9HA 1NDOB 5D82A 4BTXA 1KQS2 4K1UA 1CYUA 1SIHA 1W6GA 4RNYA 3FG1A 1FGTA 1JN5A 3MG3A 3NV0A 4O02B 4U13A 1VQ73 3Q90A 5FW5A 3TDGA 5IG4A 4EV2A 5IEPA 2CW9A 4AKZA 4XM4A 3FCSB 4FCMA 4NHFA 3KKGA 3LTAA 3WMDA 3PZWA 1FGMA 3EHCA 3V99A 2FGTA 4XBTA 3JUMA 2C10A 3OW22 1VQM3 1IQ8A 1JNQA 1EQKA 2CWVA 3CCV3 1FGQA 1RJOA 3GZRA 3QK9A 1Q40B 1U8CB 2XR8B 1G96A 1VQK3 1MNLA 1YJW3 4KVHA 1A2KA 3FGYA 1YHQ3 1ZX2A 1IV7A 3AMOA 5HGRA 1N8R4 2XGNA 3KE7A 1IVUA 1VQ43 1OCVA 4HM8B 5EVHA 1JRQA 1O7NB 2ZDJA 3LMLA 3X42A 1TFOA 4HM7B 2W56A 1UUWB 1ASKA 3S67A 1HU9A 3VGNA 3G16A 4EV5A 2RGQA 3E99A 1KC84 3CCJ3 1IU7A 4HZ9B 1K8A4 5AEUB 4K1VA 3OV4A 1J2BA 3KFQC 1LNHA 1C7HA 1EG9B 1RN7A 1Q814 1WTHA 3JUQA 2YFJB 3F7SA 1N8QA 2MF7A 2W6JH 3NBRA 2Z76A 1W7CA 1FA3A 3SOYA 5G2GA 3FF2A 3K7CA 4KFEA 2B1XB 2YFLB 3GWRA 3GZBA 3U1WA 2XSOB 3CMA3 1SIIA 2E2TA 1HKXA 3BNBA 5LC7A 4K61A 3JUNA 4HKVB 1UI7A 3BB9A 3DMCA 4IPBA 1K9M4 2OOVA 3CU3A 3ER7A 1EKMA 1VQ83 1GYBA 3GZYB 5STDA 4HM0B 3CCQ3 2CFLA 3GAXA 3K5TA 3OWSA 2B24B 1N9EA 3GRDA 1IQYA 1GY6A 4WWUC 3JVCA 3K9MC 1AR0A 3FKAA 3DGNA 4MMZB 4XDWA 4NREA 1NB3I 4IIAA 1N9JA 1D6YA 4R1KA 1GY7A 2L4VA 4WFOA 2Z7AA 2CHCA 1JN5B 2K54A 3MYTA 3X3YA 1YJ93 3N54B 3V92A 2CG1A 4ORLA 4WHAA 4TX4A 3NXJA 2V1LA 2W9QA 1ZO2A 3VSYA 3T8UA 3D3LA 3PYJA 3S28A 3LXUX 3H51A 3KZTA 4FMCA 3NHXA 4H61A 1A90A 1A67A 1Q7Y4 3EN1B 3DUKA 2Y74A 3B7CA 5JPUA 1JKGA 3D9RA 3HIGA 3F40A 3PGBA 3FG3A 2OQEA 4XDVA 5CF2A 4AEQA 2FXTA 3EX9A 5IERA 3JUPA 4JF8A 2RCDA 2XFSA 5AYRB 2W56B 3WOEB 1YJN3 5AIIA 3SOAA 1T5YA 1NO3A 1E97A 2YFIB 3F7XA 1WMNA 2P05A 4FMAA 5EEOA 3FZWA 2F98A 1SJWA 5IG3A 2I9WA 2YX9A 4HJLB 4O2HA 4QWTA 3EE1A 5AI1A 5EQLA 2RSXA 3KSED 4HZBB 1JB2A 4EBGA 2XEPA 4H3UA 3EQQB 3RDEA 2CWUA 3LH4A 2UX0A 4GB5A 2GEXA 1YI23 4LEHA 3LT9A 1IDPA 1N5HA 2Y73A 3F8HA 3LTBA 3OXAA 2CWTA 5JBSA 4PEJA 5BXQA 4XB5A 2CKFB 2ZL8A 1K28A 1QAFA 3BLZA 4WYKB 3CCR3 2GXFA 3I553 1VQ63 2OOVC 2GU3A 3KSPA 3LT8A 4X2HA 2XRXB 1UUVB 3H3HA 3PS8A 2QA43 2P0XA 4HYZA 4O8SA 4N6LA 1VQ53 1E3VA 5FGOA 1IVXA 2JDIH 5DREA 2OCTA 5TGNA 1VQ93 4MJDA 4I4KA 2R4IA 3FH1A 3SEDA 1PU4A 1STFI 1AVKA 1QAKA 2KXGA 3T0UA 4FCJA 3F8XA 4LZIA 3LYGA 5CF1A 1ROVA 4G1MB 3EBTA 1UW1A 2ML6A 4R9LA 3CME3 1QJGA 4HM3B 2Q07A 1WQLB 2IUJA 4CCVA 3BNDA 1M9GA 2HMLB 4RZMA 1VZZA 1D6ZA 4K90B 1JV2B 5IEOA 4OVMA 3MHEA 4L8PA 1VQO3 5CK6A 2JQ5A 3CNXA 4AKYA 1W6CA 3LOYA 2D42A 3HX8A 1QVG2 3F14A 5IF6A 2C11A 4MMXB 3CD63 1VQP3 2O9UX 2W2CA 1US1A 2OQEC 1JKGB 1OUNA 2PZVA 1IQXA 1W02A 5AIGA 1OGZA 1N5PA 4WYKA 1VQN3 3IPTA 5CXOA 1FGOA 1TIJA 2PNCA 1QMAA 4KZ1A 2LQVA 4LGQA 1S723 2CC3A 4R9KA 1NJI4 3B4PA 2BMRB 3WDGB 2GBXB 3NBJA 3PCSA 1F8NA 1DVDA 1TU5A 2HMJB 1JB4A 4IT7A 1RKYA 4N6MA 3CPOA 2BO9B 2OTJ3 4FR9A 1TP6A 4L7KA 1JJ22 1V74A 3CCU3 2CFGA 2IMJA 1O7GB 2CFKA 3OWYA 2CFDA 1MOLA 1K734 2IA7A 3U97A 3MPHA 2M7OA 4FMDA 4HM5B 3B4OA 3F9SA 3Q2PA 4R4KA 4LMIA 2W9PA 2LYXA 1Q864 3GZXB 3I0YA 5IG5A 2F99A 4BTWA 4JRFA 3CC43 1DMNA 4HVNA 3UJMA 1EA2A 1DMMA 4RBNA 1AVLA 1OHSA 5KP4A 4FMBA 4J8TA 3V98A 3BNCA 5CLKA 1PFPA 3CCL3 1D6UA 3EBYA 1OHPA 4N6TA 4MMYB 1W5ZA 3PXMA 3CCS3 1JB5A 5A0OB 1WNHA 3FLJA 3EJVA 3FF0A 3SLUA 5AIFA 2XF3A 3IJEB 8CHOA 3S29A 1M1XB 3T8NA 2STDA 3NM2A 3HI7A 3DY5A 1OHOA 2XGLA 3KN4A 2CIUA 3STDA 2BMOB 3EF8A 1O7MB 4HM4B 1O7WB 3NX0A 1FUWA 1IVVA 5AEWB 1BUQA 3G8ZA 1KSIA 4N3VA 2Z77A 5LC6A 2P09A 1IK3A 1OF5A 4KFFA 1GD3A 2ML5A 3X41A 1YVBI 2QGUA 1ULIB 2KCDA 1IT7A 1TFKA 5IENA 5JPPA 2O3OA 3S27A 5ELUA 4CDLA 1W4NA 1UI8A 5KP1A 1IT8A 3DM8A 4EC6A 3OX9A 1ULJB 3HIIA 4HBRA 2GBWB 2F86B 4N6NB 4XBYA 1W2B2 3LTDA 2P38A 3MG1A 3UL6A 1K41A 3G713 3PCRA 1OGXA 3DGMA 2W0QA 3DXOA 2WOHA 4Q53A 7STDA 2HMKB 3NQYA 5DRVA 2WGQA 3K63A 1KWIA 3MG2A 1NU3A 3ALAA 4L8OA 4WP5A 5KP3A 1VQL3 1ISKA 2RFRA 1WMPA 4KFDA 2INXA 2W03A 2KRTA 1NWWA 2QIYA 2IUKA 3WODG 2BT3A 3S5CA 3MKIA 3RGAA 1GS3A 1DVCA 4OK0A 6STDA 3J7Yd 1U5OA 2HMMB 3I563 3CNMA 1YIJ3 4X2OA 3UL5A 2E2UA 5I97A 3FG4A 5IW9A 1Q824 2WGOA 3EN8A 1E3RA 1CQSA 3CCE3 1OPYA 2XSHB 3CPW2 1LXEA 3X40A 1IV9A 3NQZA 2E2VA 4N6OB 1AV4A 1L5GB 1DMQA 2GU1A 4BTYA 3LZAA 1W6YA 2K0MA 3UNLA 4FCZA 5AYSC 2MC8A 3G4S3 3M8CA 3EB8A 1YGEA 1KD14 1DYUA 1LVNA 1OACA 1WMOA 4EYCA 2BMQB 1RRHA 3SXXA 3CCM3 1NB5I 4O3VA 3QRDA 1OF5B 3RGRA 2D1WA 3HK4A 3MSOA 3DZLA 3KIIA 1M1K4 1STDA 3IMAB 3BNEA 3VF1A 3K0ZA 3WA3A 3DGOA 2BHMA 2BNGA 3O8YA 2A15A 4HM6B 4MEIA 1Q40A 3CC73 1GY5A 5IG0A 1IVWA 2P0MA 1O7HB 1SQWA 2XH9A 1O7PB 4R80A 1RRLA 3G0KA 4N6V0 2QEX3 3WA2X 3CC23 1YIT3 1GD4A 1W2ZA 2CFWA 3NV0B 3SVAA 1Q42A 3A76A 5D83A 3G6E3 4N6UA 3DGLA 3L0RA 3EC9A 1QALA 5BVBA 1W00A 1CEWI 5D81A 1Z1SA 3NM7A 3Q1CA 5ELJA 1R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4STD A;  2OWP A;  3FSD A;  3ECF A;  3OWU A;  3JUO A;  1W01 A;  3B8L A;  4OUQ A;  4HM2 B;  2HMN B;  3HZP A;  2GEY A;  1S5A A;  4J9A A;  2HMO B;  1TUH A;  4HM1 B;  1OH0 A;  4XBX A;  3NUV A;  5AIH A;  3ROB A;  1NDO B;  5D82 A;  4K1U A;  1JN5 A;  3MG3 A;  3NV0 A;  4U13 A;  3Q90 A;  5FW5 A;  5IG4 A;  5IEP A;  4XM4 A;  4FCM A;  3KKG A;  3WMD A;  3EHC A;  4XBT A;  3JUM A;  3GZR A;  1Q40 B;  2XR8 B;  4KVH A;  1A2K A;  3FGY A;  1ZX2 A;  5HGR A;  3KE7 A;  1OCV A;  4HM8 B;  5EVH A;  1O7N B;  4HM7 B;  1UUW B;  1ASK A;  3VGN A;  3G16 A;  2RGQ A;  3E99 A;  4HZ9 B;  5AEU B;  4K1V A;  3OV4 A;  1C7H A;  1EG9 B;  3JUQ A;  2YFJ B;  3F7S A;  3NBR A;  2Z76 A;  3SOY A;  5G2G A;  3FF2 A;  3K7C A;  2B1X B;  2YFL B;  3GWR A;  3GZB A;  2XSO B;  1HKX A;  3JUN A;  4HKV B;  3BB9 A;  3DMC A;  3CU3 A;  3ER7 A;  1GYB A;  3GZY B;  5STD A;  4HM0 B;  3OWS A;  2B24 B;  3GRD A;  1GY6 A;  4WWU C;  1AR0 A;  3FKA A;  4XDW A;  4IIA A;  4R1K A;  1GY7 A;  2Z7A A;  2CHC A;  1JN5 B;  2K54 A;  3MYT A;  4ORL A;  3NXJ A;  1ZO2 A;  3VSY A;  3T8U A;  3H51 A;  3KZT A;  3NHX A;  3EN1 B;  3DUK A;  3B7C A;  5JPU A;  1JKG A;  3D9R A;  3F40 A;  4XDV A;  5CF2 A;  3EX9 A;  5IER A;  3JUP A;  2RCD A;  5AII A;  3SOA A;  1E97 A;  2YFI B;  3F7X A;  3FZW A;  2F98 A;  1SJW A;  5IG3 A;  2I9W A;  4HJL B;  5AI1 A;  4HZB B;  1JB2 A;  4H3U A;  3EQQ B;  2UX0 A;  4GB5 A;  2GEX A;  4LEH A;  1IDP A;  3F8H A;  3OXA A;  4PEJ A;  5BXQ A;  4XB5 A;  2CKF B;  4WYK B;  3BLZ A;  2GXF A;  3KSP A;  4X2H A;  2XRX B;  1UUV B;  3H3H A;  1E3V A;  5DRE A;  5TGN A;  4MJD A;  4I4K A;  2R4I A;  3FH1 A;  3SED A;  4FCJ A;  3F8X A;  3LYG A;  5CF1 A;  3EBT A;  4R9L A;  1QJG A;  4HM3 B;  1WQL B;  2HML B;  4RZM A;  1VZZ A;  5IEO A;  4OVM A;  3MHE A;  4L8P A;  5CK6 A;  2JQ5 A;  3CNX A;  3HX8 A;  3F14 A;  5IF6 A;  2W2C A;  1JKG B;  1OUN A;  2PZV A;  1W02 A;  5AIG A;  1OGZ A;  4WYK A;  3IPT A;  5CXO A;  4LGQ A;  1QMA A;  4R9K A;  3B4P A;  2BMR B;  2GBX B;  2HMJ B;  1JB4 A;  3CPO A;  4L7K A;  1TP6 A;  2IMJ A;  3OWY A;  1O7G B;  4HM5 B;  3B4O A;  3F9S A;  4LMI A;  3GZX B;  3I0Y A;  5IG5 A;  2F99 A;  1DMN A;  4HVN A;  3UJM A;  1EA2 A;  1DMM A;  1OHS A;  5KP4 A;  4J8T A;  5CLK A;  3EBY A;  1OHP A;  1JB5 A;  3FLJ A;  3EJV A;  3FF0 A;  5AIF A;  8CHO A;  3T8N A;  2STD A;  3NM2 A;  1OHO A;  3STD A;  2BMO B;  3EF8 A;  1O7M B;  4HM4 B;  1O7W B;  5AEW B;  1BUQ A;  3G8Z A;  4N3V A;  2Z77 A;  1OF5 A;  2QGU A;  1ULI B;  5IEN A;  5JPP A;  4CDL A;  5KP1 A;  3DM8 A;  3OX9 A;  1ULJ B;  2GBW B;  2F86 B;  4XBY A;  3MG1 A;  1K41 A;  1OGX A;  3DXO A;  4Q53 A;  7STD A;  2HMK B;  5DRV A;  3MG2 A;  1NU3 A;  4L8O A;  5KP3 A;  4WP5 A;  1ISK A;  2RFR A;  2INX A;  1NWW A;  2QIY A;  3S5C A;  3MKI A;  3RGA A;  1GS3 A;  6STD A;  1U5O A;  2HMM B;  3CNM A;  4X2O A;  3EN8 A;  1E3R A;  1CQS A;  1OPY A;  2XSH B;  1DMQ A;  3LZA A;  1W6Y A;  3UNL A;  3M8C A;  2BMQ B;  1OF5 B;  3RGR A;  3HK4 A;  3MSO A;  3DZL A;  1STD A;  3K0Z A;  2BNG A;  4HM6 B;  2A15 A;  1Q40 A;  1GY5 A;  5IG0 A;  1O7H B;  1O7P B;  3G0K A;  3NV0 B;  1Q42 A;  3A76 A;  5D83 A;  3EC9 A;  5BVB A;  1W00 A;  5D81 A;  1Z1S A; 
#chains in the Genus database with same CATH topology
 2CG0 A;  2SBL A;  2Z6B A;  1RMS A;  4GL6 A;  4STD A;  2OWP A;  1A2V A;  3FSD A;  3X3Z A;  1CYV A;  1UCL A;  2CK3 H;  3SX1 A;  3X3X A;  1LOX A;  4EXR A;  1BOX A;  2WOF A;  2WO0 A;  1B2M A;  3N8B A;  3ECF A;  1RGG A;  2XFT A;  3MWZ A;  3OWU A;  3JUO A;  1RCL A;  1ZGX A;  2CH9 A;  3AMO B;  3NBB A;  6RNT A;  1W01 A;  1X1X A;  3B8L A;  4OUQ A;  1SPU A;  1QVF 2;  4BL2 A;  4HM2 B;  3CXC 2;  2HMN B;  3HZP A;  1BRI A;  1Y4K A;  2GEY A;  4RNZ A;  5M1A A;  2FNQ A;  3UB1 A;  1S5A A;  3WOF B;  4J9A A;  1I70 A;  2HMO B;  2OTL 3;  1TUH A;  4HM1 B;  4ZM8 A;  1ROA A;  1OH0 A;  1YVS A;  3D79 A;  3LTC A;  2W04 A;  4XBX A;  4BIR A;  4LSO A;  1I2F A;  3NUV A;  1FGR A;  5AIH A;  3ROB A;  1M90 4;  3N9H A;  1NDO B;  5D82 A;  4BTX A;  1KQS 2;  4K1U A;  1CYU A;  1SIH A;  2RBI A;  1W6G A;  3KCH A;  1B2S A;  4RNY A;  3FG1 A;  1FGT A;  1JN5 A;  3MG3 A;  3NV0 A;  1BIR A;  1TRP A;  4O02 B;  1BGS A;  4U13 A;  1VQ7 3;  3Q90 A;  4KT3 B;  5FW5 A;  3TDG A;  5IG4 A;  4EV2 A;  5IEP A;  1JBR A;  1B2U A;  2CW9 A;  4AKZ A;  1UDI I;  4XM4 A;  3HOH A;  1AQZ A;  1BNI A;  3FCS B;  4FCM A;  4NHF A;  2BIR A;  3KKG A;  3AGN A;  3LTA A;  3WMD A;  3PZW A;  1FGM A;  3EHC A;  3V99 A;  2FGT A;  4XBT A;  3JUM A;  2C10 A;  3OW2 2;  1VQM 3;  1IQ8 A;  1JNQ A;  1EQK A;  2C4B A;  2CWV A;  3CCV 3;  1X1W A;  1FGQ A;  1RJO A;  3GZR A;  3QK9 A;  1Q40 B;  1U8C B;  2XR8 B;  1G96 A;  1VQK 3;  1MNL A;  1YJW 3;  4KVH A;  1A2K A;  2KF3 A;  3FGY A;  1ZX2 A;  1IV7 A;  1YHQ 3;  3AMO A;  2H0I A;  5HGR A;  1N8R 4;  2XGN A;  4CPK A;  3KE7 A;  1IVU A;  1VQ4 3;  1I8V A;  1OCV A;  4HM8 B;  5EVH A;  1JRQ A;  1O7N B;  2ZDJ A;  3LML A;  4ILF A;  1TFO A;  3X42 A;  4HM7 B;  6GSP A;  1A90 A;  2W56 A;  1R4Y A;  1UUW B;  1ASK A;  3S67 A;  1HU9 A;  3VGN A;  1I0V A;  5BIR A;  3G16 A;  4EV5 A;  2RGQ A;  3E99 A;  1KC8 4;  3DGY A;  3CCJ 3;  1IU7 A;  4HZ9 B;  1BAO A;  1DET A;  1LQG C;  3OV4 A;  4K1V A;  2CX1 A;  5AEU B;  1K8A 4;  3KFQ C;  1LNH A;  1C7H A;  1EG9 B;  1FUT A;  1RN7 A;  1UUG B;  1Q81 4;  1WTH A;  3JUQ A;  2YFJ B;  3F7S A;  1N8Q A;  2AAE A;  5RNT A;  2MF7 A;  1B3S A;  2W6J H;  3NBR A;  4BU4 A;  2Z76 A;  1W7C A;  1FA3 A;  3SOY A;  5G2G A;  3FF2 A;  3K7C A;  4KFE A;  2B1X B;  2YFL B;  3GWR A;  3GZB A;  3U1W A;  2XSO B;  1RNB A;  3CMA 3;  1SII A;  2E2T A;  1HKX A;  3BNB A;  5LC7 A;  4K61 A;  3JUN A;  4I5Q A;  4HKV B;  1UI7 A;  3BB9 A;  3DMC A;  4IPB A;  9RNT A;  1K9M 4;  2OOV A;  3CU3 A;  3ER7 A;  1EKM A;  1DE3 A;  1VQ8 3;  1GYB A;  3GZY B;  5STD A;  4HM0 B;  1C54 A;  3CCQ 3;  2CFL A;  3GAX A;  1RNT A;  3K5T A;  2B24 B;  1N9E A;  3GRD A;  3OWS A;  1IQY A;  1GY6 A;  4WWU C;  3JVC A;  3K9M C;  1AR0 A;  3FKA A;  3DGN A;  4MMZ B;  4XDW A;  4NRE A;  1NB3 I;  4IIA A;  1BNE A;  1N9J A;  1D6Y A;  4R1K A;  1GY7 A;  2GSP A;  2L4V A;  2Z7A A;  4WFO A;  2CHC A;  1JN5 B;  2K54 A;  1BRH A;  1UCK A;  1Q7H A;  3MYT A;  3X3Y A;  3N54 B;  1YJ9 3;  3V92 A;  1JBT A;  2CG1 A;  4ORL A;  4WHA A;  4TX4 A;  3NXJ A;  1BRJ A;  2R41 A;  1RHL A;  2V1L A;  2HOH A;  2W9Q A;  1ZO2 A;  3VSY A;  3T8U A;  3D3L A;  3PYJ A;  3S28 A;  3LXU X;  3BU4 A;  3H51 A;  3KZT A;  3NHX A;  4FMC A;  4H61 A;  4BL3 A;  1A67 A;  1Q7Y 4;  3EN1 B;  3DUK A;  5BU4 A;  2Y74 A;  1PY3 A;  3B7C A;  5G1K A;  1JKG A;  1RGH A;  4J5K A;  3D9R A;  3HIG A;  5JPU A;  3F40 A;  3PGB A;  3FG3 A;  2OQE A;  4XDV A;  1RN1 A;  5CF2 A;  4AEQ A;  2FXT A;  3EX9 A;  5IER A;  1RSN A;  4HOH A;  3JUP A;  2F56 A;  4JF8 A;  2SAR A;  2RCD A;  1B27 A;  2XFS A;  5AYR B;  2W56 B;  3WOE B;  1YJN 3;  5AII A;  3SOA A;  1MWR A;  2IYJ A;  1GMP A;  1T5Y A;  1NO3 A;  1E97 A;  2YFI B;  3F7X A;  5M18 A;  1WMN A;  2H0H A;  2P05 A;  1IYY A;  4FMA A;  5EEO A;  2KAA A;  2F98 A;  3A5E A;  3FZW A;  1SJW A;  5IG3 A;  1BSE A;  2I9W A;  2CX0 A;  2YX9 A;  4HJL B;  4O2H A;  3EE1 A;  4QWT A;  5AI1 A;  1BRS A;  5EQL A;  2RSX A;  3KSE D;  4HZB B;  1JB2 A;  4EBG A;  2XEP A;  4H3U A;  3EQQ B;  4EW5 A;  3RDE A;  2CWU A;  3LH4 A;  2UX0 A;  4GB5 A;  2GEX A;  3BIR A;  1YI2 3;  4LEH A;  3LT9 A;  1IDP A;  1N5H A;  1BRK A;  2Y73 A;  3F8H A;  1UCJ A;  3LTB A;  1GSP A;  3OXA A;  2CWT A;  5JBS A;  4PEJ A;  5BXQ A;  4XB5 A;  2ZHX B;  1RN4 A;  1LOW A;  2CKF B;  2ZL8 A;  1K28 A;  1QAF A;  3BLZ A;  4WYK B;  3CCR 3;  2GXF A;  3I55 3;  1VQ6 3;  1UCI A;  2OOV C;  2GU3 A;  3KSP A;  3LT8 A;  4X2H A;  1YNV X;  2XRX B;  1LOV A;  1UUV B;  3H3H A;  1BSC A;  3PS8 A;  2QA4 3;  2P0X A;  4HYZ A;  4O8S A;  4N6L A;  5G1L A;  1VQ5 3;  1B2Z A;  1YGW A;  1E3V A;  5FGO A;  1IVX A;  2JDI H;  1PYL A;  2OCT A;  5DRE A;  1T3B A;  1BNJ A;  5TGN A;  1I0X A;  1VQ9 3;  4MJD A;  4I4K A;  2R4I A;  3FH1 A;  3SED A;  3AGO A;  1PU4 A;  1STF I;  1AVK A;  1QAK A;  2KXG A;  3T0U A;  1X1U A;  4FCJ A;  3F8X A;  4LZI A;  3LYG A;  5CF1 A;  1ROV A;  2KF6 A;  1JBS A;  3D5I A;  3EBT A;  4G1M B;  1UW1 A;  1RLS A;  2ML6 A;  1G02 A;  1GOU A;  4R9L A;  3CME 3;  1BSB A;  1QJG A;  2L1S A;  4HM3 B;  2Q07 A;  1WQL B;  1UGI A;  2IUJ A;  4CCV A;  3BND A;  1M9G A;  2HML B;  2UGI A;  4RZM A;  1VZZ A;  1D6Z A;  1RDS A;  4K90 B;  1JV2 B;  5IEO A;  4OVM A;  1B20 A;  3MHE A;  4L8P A;  1AY7 A;  5CK6 A;  2JQ5 A;  3CNX A;  1VQO 3;  4LYL B;  4AKY A;  1W6C A;  3LOY A;  2D42 A;  3HX8 A;  1QVG 2;  3F14 A;  2F5M A;  2UUG C;  5IF6 A;  2C11 A;  3AHS A;  4MMX B;  3CD6 3;  1RTU A;  1VQP 3;  2O9U X;  2W2C A;  1US1 A;  2OQE C;  1JKG B;  1UGH I;  1OUN A;  8RNT A;  2PZV A;  3DH2 A;  1IQX A;  1W02 A;  2RNT A;  5AIG A;  1GOY A;  1OGZ A;  1N5P A;  4WYK A;  1VQN 3;  3IPT A;  2F5W A;  5CXO A;  1FGO A;  1TIJ A;  2PNC A;  1QMA A;  4KZ1 A;  2LQV A;  4LGQ A;  3ZFZ A;  2CC3 A;  4R9K A;  1S72 3;  1HYF A;  3RNT A;  1NJI 4;  3B4P A;  2BMR B;  3WDG B;  4J5G A;  3URP A;  1V58 A;  2GBX B;  3NBJ A;  3PCS A;  1F8N A;  1DVD A;  1TU5 A;  2HMJ B;  1JB4 A;  4IT7 A;  1RGL A;  1BSD A;  1RKY A;  4N6M A;  3CPO A;  2BO9 B;  2OTJ 3;  1GMQ A;  4FR9 A;  1TP6 A;  4L7K A;  1JJ2 2;  1V74 A;  4NPB A;  3CCU 3;  1RGK A;  2CFG A;  1O7G B;  2CFK A;  2IMJ A;  2CFD A;  3OWY A;  1MOL A;  3SYU A;  1K73 4;  2IA7 A;  3U97 A;  1BNF A;  2M7O A;  3MPH A;  1I2G A;  4FMD A;  1RGC A;  3ZG5 A;  2F4Y A;  1BUJ A;  4HM5 B;  3B4O A;  3F9S A;  3Q2P A;  1Q9E A;  4R4K A;  4LMI A;  2W9P A;  2LYX A;  1Q86 4;  3GZX B;  3I0Y A;  5IG5 A;  3ZG0 A;  2F99 A;  4BTW A;  4DKI A;  4JRF A;  3CC4 3;  1DMN A;  4CJN A;  2K3D A;  3D4A A;  4HVN A;  1EA2 A;  1I3I A;  1DMM A;  4RBN A;  3UJM A;  1AVL A;  1OHS A;  3AHW A;  5KP4 A;  4FMB A;  1GOV A;  4J8T A;  3V98 A;  4RNT A;  3BNC A;  3Q3F A;  5CLK A;  1PFP A;  3WR2 A;  3CCL 3;  1D6U A;  3EBY A;  1OHP A;  3GSP A;  4N6T A;  4MMY B;  1W5Z A;  3PXM A;  3CCS 3;  1JB5 A;  5A0O B;  1WNH A;  3FLJ A;  3EJV A;  3FF0 A;  3SLU A;  5AIF A;  2XF3 A;  3IJE B;  8CHO A;  3S29 A;  7RNT A;  1EUI C;  1M1X B;  3T8N A;  2STD A;  3NM2 A;  3HI7 A;  3DY5 A;  1OHO A;  2XGL A;  3KN4 A;  5M19 A;  2CIU A;  1BNS A;  3STD A;  2BMO B;  3EF8 A;  1O7M B;  4HM4 B;  1O7W B;  1BRG A;  1JZO A;  3NX0 A;  1FUW A;  1IVV A;  5AEW B;  1BUQ A;  1A2P A;  3D5G A;  3G8Z A;  1KSI A;  4N3V A;  1LOY A;  2Z77 A;  5LC6 A;  1G0T A;  1MGR A;  2P09 A;  1IK3 A;  2H0G A;  1OF5 A;  4KFF A;  1GD3 A;  1FZU A;  2ML5 A;  1JZD A;  1BU4 A;  3X41 A;  1YVB I;  2QGU A;  1BNG A;  1ULI B;  1IT7 A;  2KCD A;  1TFK A;  5IEN A;  5JPP A;  2O3O A;  3S27 A;  5ELU A;  4CDL A;  1W4N A;  1UI8 A;  5KP1 A;  1FYS A;  1IT8 A;  2IY2 A;  1BVI A;  1MWT A;  3DM8 A;  4EC6 A;  3OX9 A;  1ULJ B;  3HII A;  4HBR A;  1VQQ A;  5HOH A;  2GBW B;  1RCK A;  2F86 B;  4N6N B;  4XBY A;  1LNI A;  1T2I A;  1W2B 2;  3LTD A;  2P38 A;  2BU4 A;  3MG1 A;  3UL6 A;  1K41 A;  3G71 3;  3PCR A;  1OGX A;  3DGM A;  2W0Q A;  3DXO A;  2WOH A;  4Q53 A;  7STD A;  2HMK B;  3NQY A;  5DRV A;  2WGQ A;  3K63 A;  1KWI A;  3MG2 A;  1NU3 A;  3ALA A;  4L8O A;  1BSA A;  4WP5 A;  5KP3 A;  1VQL 3;  1ISK A;  7GSP A;  2RFR A;  1WMP A;  4KFD A;  2INX A;  2W03 A;  2KRT A;  1NWW A;  2QIY A;  2IUK A;  3WOD G;  2BT3 A;  1TRQ A;  1BAN A;  3MKI A;  4GHO A;  3RGA A;  3S5C A;  1GS3 A;  1DVC A;  4OK0 A;  6STD A;  3J7Y d;  1U5O A;  2HMM B;  3I56 3;  3CNM A;  1YIJ 3;  4X2O A;  1MWU A;  1EEJ A;  1I2E A;  3UL5 A;  2E2U A;  5I97 A;  3FG4 A;  5IW9 A;  1Q82 4;  1ZS7 A;  2WGO A;  3EN8 A;  1E3R A;  2KF5 A;  1CQS A;  3CCE 3;  1OPY A;  2XSH B;  4GSP A;  3CPW 2;  1LXE A;  4HAA A;  3X40 A;  1IV9 A;  1SAR A;  3NQZ A;  2E2V A;  4N6O B;  1AV4 A;  1GMR A;  1L5G B;  1LRA A;  2KF4 A;  1DMQ A;  2GU1 A;  4BTY A;  2ZA4 A;  3LZA A;  1W6Y A;  1X1Y A;  2K0M A;  3UNL A;  1NNV A;  4FCZ A;  1BNR A;  5AYS C;  2MC8 A;  3G4S 3;  3M8C A;  3EB8 A;  1YGE A;  1RGA A;  1LQM B;  1KD1 4;  1DYU A;  2AAD A;  1J2B A;  1LVN A;  1OAC A;  1WMO A;  1B21 A;  4EYC A;  2BMQ B;  1RRH A;  3SXX A;  3CCM 3;  1MWS A;  4O3V A;  3QRD A;  1NB5 I;  1OF5 B;  3RGR A;  2D1W A;  1RGE A;  3HK4 A;  3MSO A;  3DZL A;  3WHO A;  3KII A;  1M1K 4;  1STD A;  3IMA B;  3BNE A;  1BRN L;  3VF1 A;  3K0Z A;  3WA3 A;  3DGO A;  2BHM A;  1TTO A;  2BNG A;  3O8Y A;  2A15 A;  4HM6 B;  4MEI A;  1Q40 A;  3CC7 3;  1GY5 A;  5IG0 A;  1IVW A;  2P0M A;  1O7H B;  1SQW A;  2XH9 A;  1O7P B;  4R80 A;  1CH0 A;  1RRL A;  1MGW A;  3G0K A;  4N6V 0;  2QEX 3;  1I3F A;  1V57 A;  3WA2 X;  3CC2 3;  1YIT 3;  1TJD A;  1GD4 A;  1W2Z A;  5GSP A;  1FUS A;  2CFW A;  3NV0 B;  3SVA A;  1Q42 A;  3A76 A;  5D83 A;  3G6E 3;  4N6U A;  1RGF A;  3DGL A;  3L0R A;  2J8X B;  1QAL A;  3EC9 A;  5BVB A;  1T2H A;  1FW7 A;  1W00 A;  1CEW I;  5D81 A;  1Z1S A;  3NM7 A;  3Q1C A;  1HZ1 A;  5ELJ A;  1B2X A;  1R4C A; 
#chains in the Genus database with same CATH homology
 2CG0 A;  2SBL A;  2Z6B A;  4GL6 A;  4STD A;  2OWP A;  1A2V A;  3FSD A;  3X3Z A;  1CYV A;  2CK3 H;  3SX1 A;  3X3X A;  4EXR A;  1LOX A;  2WOF A;  2WO0 A;  3N8B A;  3ECF A;  2XFT A;  3MWZ A;  3OWU A;  3JUO A;  3AMO B;  2CH9 A;  3NBB A;  1W01 A;  3B8L A;  4OUQ A;  1SPU A;  1QVF 2;  4HM2 B;  3CXC 2;  2HMN B;  3HZP A;  1Y4K A;  4RNZ A;  2GEY A;  3WOF B;  2FNQ A;  3UB1 A;  1S5A A;  4J9A A;  2HMO B;  2OTL 3;  1TUH A;  4HM1 B;  4ZM8 A;  1ROA A;  1OH0 A;  3LTC A;  4XBX A;  2W04 A;  4LSO A;  3NUV A;  1FGR A;  5AIH A;  3ROB A;  1M90 4;  3N9H A;  1NDO B;  5D82 A;  4BTX A;  1KQS 2;  4K1U A;  1CYU A;  1SIH A;  1W6G A;  4RNY A;  3FG1 A;  1FGT A;  1JN5 A;  3MG3 A;  3NV0 A;  4O02 B;  4U13 A;  1VQ7 3;  3Q90 A;  5FW5 A;  3TDG A;  5IG4 A;  4EV2 A;  5IEP A;  2CW9 A;  4AKZ A;  4XM4 A;  3FCS B;  4FCM A;  4NHF A;  3KKG A;  3LTA A;  3WMD A;  3PZW A;  1FGM A;  3EHC A;  3V99 A;  2FGT A;  4XBT A;  3JUM A;  2C10 A;  3OW2 2;  1VQM 3;  1IQ8 A;  1JNQ A;  1EQK A;  2CWV A;  3CCV 3;  1FGQ A;  1RJO A;  3GZR A;  3QK9 A;  1Q40 B;  1U8C B;  2XR8 B;  1G96 A;  1VQK 3;  1MNL A;  1YJW 3;  4KVH A;  1A2K A;  3FGY A;  1YHQ 3;  1ZX2 A;  1IV7 A;  3AMO A;  5HGR A;  1N8R 4;  2XGN A;  3KE7 A;  1IVU A;  1VQ4 3;  1OCV A;  4HM8 B;  5EVH A;  1JRQ A;  1O7N B;  2ZDJ A;  3LML A;  3X42 A;  1TFO A;  4HM7 B;  2W56 A;  1UUW B;  1ASK A;  3S67 A;  1HU9 A;  3VGN A;  3G16 A;  4EV5 A;  2RGQ A;  3E99 A;  1KC8 4;  3CCJ 3;  1IU7 A;  4HZ9 B;  1K8A 4;  5AEU B;  4K1V A;  3OV4 A;  1J2B A;  3KFQ C;  1LNH A;  1C7H A;  1EG9 B;  1RN7 A;  1Q81 4;  1WTH A;  3JUQ A;  2YFJ B;  3F7S A;  1N8Q A;  2MF7 A;  2W6J H;  3NBR A;  2Z76 A;  1W7C A;  1FA3 A;  3SOY A;  5G2G A;  3FF2 A;  3K7C A;  4KFE A;  2B1X B;  2YFL B;  3GWR A;  3GZB A;  3U1W A;  2XSO B;  3CMA 3;  1SII A;  2E2T A;  1HKX A;  3BNB A;  5LC7 A;  4K61 A;  3JUN A;  4HKV B;  1UI7 A;  3BB9 A;  3DMC A;  4IPB A;  1K9M 4;  2OOV A;  3CU3 A;  3ER7 A;  1EKM A;  1VQ8 3;  1GYB A;  3GZY B;  5STD A;  4HM0 B;  3CCQ 3;  2CFL A;  3GAX A;  3K5T A;  3OWS A;  2B24 B;  1N9E A;  3GRD A;  1IQY A;  1GY6 A;  4WWU C;  3JVC A;  3K9M C;  1AR0 A;  3FKA A;  3DGN A;  4MMZ B;  4XDW A;  4NRE A;  1NB3 I;  4IIA A;  1N9J A;  1D6Y A;  4R1K A;  1GY7 A;  2L4V A;  4WFO A;  2Z7A A;  2CHC A;  1JN5 B;  2K54 A;  3MYT A;  3X3Y A;  1YJ9 3;  3N54 B;  3V92 A;  2CG1 A;  4ORL A;  4WHA A;  4TX4 A;  3NXJ A;  2V1L A;  2W9Q A;  1ZO2 A;  3VSY A;  3T8U A;  3D3L A;  3PYJ A;  3S28 A;  3LXU X;  3H51 A;  3KZT A;  4FMC A;  3NHX A;  4H61 A;  1A90 A;  1A67 A;  1Q7Y 4;  3EN1 B;  3DUK A;  2Y74 A;  3B7C A;  5JPU A;  1JKG A;  3D9R A;  3HIG A;  3F40 A;  3PGB A;  3FG3 A;  2OQE A;  4XDV A;  5CF2 A;  4AEQ A;  2FXT A;  3EX9 A;  5IER A;  3JUP A;  4JF8 A;  2RCD A;  2XFS A;  5AYR B;  2W56 B;  3WOE B;  1YJN 3;  5AII A;  3SOA A;  1T5Y A;  1NO3 A;  1E97 A;  2YFI B;  3F7X A;  1WMN A;  2P05 A;  4FMA A;  5EEO A;  3FZW A;  2F98 A;  1SJW A;  5IG3 A;  2I9W A;  2YX9 A;  4HJL B;  4O2H A;  4QWT A;  3EE1 A;  5AI1 A;  5EQL A;  2RSX A;  3KSE D;  4HZB B;  1JB2 A;  4EBG A;  2XEP A;  4H3U A;  3EQQ B;  3RDE A;  2CWU A;  3LH4 A;  2UX0 A;  4GB5 A;  2GEX A;  1YI2 3;  4LEH A;  3LT9 A;  1IDP A;  1N5H A;  2Y73 A;  3F8H A;  3LTB A;  3OXA A;  2CWT A;  5JBS A;  4PEJ A;  5BXQ A;  4XB5 A;  2CKF B;  2ZL8 A;  1K28 A;  1QAF A;  3BLZ A;  4WYK B;  3CCR 3;  2GXF A;  3I55 3;  1VQ6 3;  2OOV C;  2GU3 A;  3KSP A;  3LT8 A;  4X2H A;  2XRX B;  1UUV B;  3H3H A;  3PS8 A;  2QA4 3;  2P0X A;  4HYZ A;  4O8S A;  4N6L A;  1VQ5 3;  1E3V A;  5FGO A;  1IVX A;  2JDI H;  5DRE A;  2OCT A;  5TGN A;  1VQ9 3;  4MJD A;  4I4K A;  2R4I A;  3FH1 A;  3SED A;  1PU4 A;  1STF I;  1AVK A;  1QAK A;  2KXG A;  3T0U A;  4FCJ A;  3F8X A;  4LZI A;  3LYG A;  5CF1 A;  1ROV A;  4G1M B;  3EBT A;  1UW1 A;  2ML6 A;  4R9L A;  3CME 3;  1QJG A;  4HM3 B;  2Q07 A;  1WQL B;  2IUJ A;  4CCV A;  3BND A;  1M9G A;  2HML B;  4RZM A;  1VZZ A;  1D6Z A;  4K90 B;  1JV2 B;  5IEO A;  4OVM A;  3MHE A;  4L8P A;  1VQO 3;  5CK6 A;  2JQ5 A;  3CNX A;  4AKY A;  1W6C A;  3LOY A;  2D42 A;  3HX8 A;  1QVG 2;  3F14 A;  5IF6 A;  2C11 A;  4MMX B;  3CD6 3;  1VQP 3;  2O9U X;  2W2C A;  1US1 A;  2OQE C;  1JKG B;  1OUN A;  2PZV A;  1IQX A;  1W02 A;  5AIG A;  1OGZ A;  1N5P A;  4WYK A;  1VQN 3;  3IPT A;  5CXO A;  1FGO A;  1TIJ A;  2PNC A;  1QMA A;  4KZ1 A;  2LQV A;  4LGQ A;  1S72 3;  2CC3 A;  4R9K A;  1NJI 4;  3B4P A;  2BMR B;  3WDG B;  2GBX B;  3NBJ A;  3PCS A;  1F8N A;  1DVD A;  1TU5 A;  2HMJ B;  1JB4 A;  4IT7 A;  1RKY A;  4N6M A;  3CPO A;  2BO9 B;  2OTJ 3;  4FR9 A;  1TP6 A;  4L7K A;  1JJ2 2;  1V74 A;  3CCU 3;  2CFG A;  2IMJ A;  1O7G B;  2CFK A;  3OWY A;  2CFD A;  1MOL A;  1K73 4;  2IA7 A;  3U97 A;  3MPH A;  2M7O A;  4FMD A;  4HM5 B;  3B4O A;  3F9S A;  3Q2P A;  4R4K A;  4LMI A;  2W9P A;  2LYX A;  1Q86 4;  3GZX B;  3I0Y A;  5IG5 A;  2F99 A;  4BTW A;  4JRF A;  3CC4 3;  1DMN A;  4HVN A;  3UJM A;  1EA2 A;  1DMM A;  4RBN A;  1AVL A;  1OHS A;  5KP4 A;  4FMB A;  4J8T A;  3V98 A;  3BNC A;  5CLK A;  1PFP A;  3CCL 3;  1D6U A;  3EBY A;  1OHP A;  4N6T A;  4MMY B;  1W5Z A;  3PXM A;  3CCS 3;  1JB5 A;  5A0O B;  1WNH A;  3FLJ A;  3EJV A;  3FF0 A;  3SLU A;  5AIF A;  2XF3 A;  3IJE B;  8CHO A;  3S29 A;  1M1X B;  3T8N A;  2STD A;  3NM2 A;  3HI7 A;  3DY5 A;  1OHO A;  2XGL A;  3KN4 A;  2CIU A;  3STD A;  2BMO B;  3EF8 A;  1O7M B;  4HM4 B;  1O7W B;  3NX0 A;  1FUW A;  1IVV A;  5AEW B;  1BUQ A;  3G8Z A;  1KSI A;  4N3V A;  2Z77 A;  5LC6 A;  2P09 A;  1IK3 A;  1OF5 A;  4KFF A;  1GD3 A;  2ML5 A;  3X41 A;  1YVB I;  2QGU A;  1ULI B;  2KCD A;  1IT7 A;  1TFK A;  5IEN A;  5JPP A;  2O3O A;  3S27 A;  5ELU A;  4CDL A;  1W4N A;  1UI8 A;  5KP1 A;  1IT8 A;  3DM8 A;  4EC6 A;  3OX9 A;  1ULJ B;  3HII A;  4HBR A;  2GBW B;  2F86 B;  4N6N B;  4XBY A;  1W2B 2;  3LTD A;  2P38 A;  3MG1 A;  3UL6 A;  1K41 A;  3G71 3;  3PCR A;  1OGX A;  3DGM A;  2W0Q A;  3DXO A;  2WOH A;  4Q53 A;  7STD A;  2HMK B;  3NQY A;  5DRV A;  2WGQ A;  3K63 A;  1KWI A;  3MG2 A;  1NU3 A;  3ALA A;  4L8O A;  4WP5 A;  5KP3 A;  1VQL 3;  1ISK A;  2RFR A;  1WMP A;  4KFD A;  2INX A;  2W03 A;  2KRT A;  1NWW A;  2QIY A;  2IUK A;  3WOD G;  2BT3 A;  3S5C A;  3MKI A;  3RGA A;  1GS3 A;  1DVC A;  4OK0 A;  6STD A;  3J7Y d;  1U5O A;  2HMM B;  3I56 3;  3CNM A;  1YIJ 3;  4X2O A;  3UL5 A;  2E2U A;  5I97 A;  3FG4 A;  5IW9 A;  1Q82 4;  2WGO A;  3EN8 A;  1E3R A;  1CQS A;  3CCE 3;  1OPY A;  2XSH B;  3CPW 2;  1LXE A;  3X40 A;  1IV9 A;  3NQZ A;  2E2V A;  4N6O B;  1AV4 A;  1L5G B;  1DMQ A;  2GU1 A;  4BTY A;  3LZA A;  1W6Y A;  2K0M A;  3UNL A;  4FCZ A;  5AYS C;  2MC8 A;  3G4S 3;  3M8C A;  3EB8 A;  1YGE A;  1KD1 4;  1DYU A;  1LVN A;  1OAC A;  1WMO A;  4EYC A;  2BMQ B;  1RRH A;  3SXX A;  3CCM 3;  1NB5 I;  4O3V A;  3QRD A;  1OF5 B;  3RGR A;  2D1W A;  3HK4 A;  3MSO A;  3DZL A;  3KII A;  1M1K 4;  1STD A;  3IMA B;  3BNE A;  3VF1 A;  3K0Z A;  3WA3 A;  3DGO A;  2BHM A;  2BNG A;  3O8Y A;  2A15 A;  4HM6 B;  4MEI A;  1Q40 A;  3CC7 3;  1GY5 A;  5IG0 A;  1IVW A;  2P0M A;  1O7H B;  1SQW A;  2XH9 A;  1O7P B;  4R80 A;  1RRL A;  3G0K A;  4N6V 0;  2QEX 3;  3WA2 X;  3CC2 3;  1YIT 3;  1GD4 A;  1W2Z A;  2CFW A;  3NV0 B;  3SVA A;  1Q42 A;  3A76 A;  5D83 A;  3G6E 3;  4N6U A;  3DGL A;  3L0R A;  3EC9 A;  1QAL A;  5BVB A;  1W00 A;  1CEW I;  5D81 A;  1Z1S A;  3NM7 A;  3Q1C A;  5ELJ A;  1R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...