2I9WA

Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
177
Chain Sequence
b'MLFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQAIRADTAEHLMRTRYSAFVLVKPEYIVKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVSMSVTQKQPCICGSGEKFKRCCGMYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_265345.1) from Psychrobacter Arcticum 273-4 at 1.75 A resolution
rcsb
source organism Psychrobacter arcticus
molecule tags Metal binding protein
total genus 39
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02810 SEC-C SEC-C motif
A PF17775 UPF0225 UPF0225 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2i9wA00
3JUPA 4STDA 1GS3A 4XDWA 1Z1SA 3JUMA 2JQ5A 2W2CA 3G8ZA 1OGZA 4XDVA 2XRXB 4HM3B 5D81A 4KVHA 3MG1A 2Z77A 3IPTA 3MG2A 3JUOA 1JN5B 1UUVB 1ZO2A 3E99A 4HZBB 3B4PA 7STDA 3DMCA 1U5OA 4I4KA 4Q53A 2A15A 4L8OA 2PZVA 3CNMA 3BLZA 1GYBA 3HK4A 3NBRA 1OHSA 3NM2A 4K1VA 4ORLA 3FGYA 3EC9A 2QGUA 4R9KA 3T8UA 2OWPA 1JKGB 4RZMA 3STDA 2GBXB 2RCDA 3B4OA 1CQSA 2UX0A 1JN5A 1W01A 1O7WB 2GEYA 1DMMA 5AEUB 4CDLA 1UUWB 1DMQA 1NWWA 3DM8A 4J8TA 3EQQB 2HMMB 4HM7B 4GB5A 1TP6A 1E3VA 1Q40B 4FCMA 4HM5B 5JPPA 3NV0B 3OWYA 2I9WA 3KE7A 3ECFA 3EF8A 2B24B 2GEXA 5AEWB 3RGRA 1EG9B 4LEHA 5D83A 3GRDA 5DREA 3CPOA 4OVMA 1WQLB 4X2HA 4HM4B 1STDA 5AIIA 3EX9A 1OF5A 1Q40A 1GY5A 3NV0A 1S5AA 1E3RA 3H51A 1NDOB 2R4IA 3MG3A 3MKIA 3EBYA 3MYTA 4HM6B 3FZWA 2RGQA 1ULIB 4R9LA 4XBYA 8CHOA 5IG4A 3FLJA 1TUHA 3HX8A 4XBXA 3LYGA 1JB2A 5CLKA 3HZPA 2HMKB 5BVBA 1Q42A 3MHEA 3GZYB 2GXFA 4H3UA 2HMOB 3LZAA 5AI1A 4HZ9B 5STDA 5IG3A 1ISKA 5IEPA 1ASKA 3UNLA 2XR8B 3SOAA 3CNXA 5KP1A 3K0ZA 1AR0A 1JB5A 5JPUA 2CHCA 3VSYA 5CXOA 5IG0A 3EN8A 3CU3A 1JB4A 5IERA 2YFJB 1O7HB 3FH1A 2XSHB 3JUNA 3GZRA 3OX9A 4HKVB 4MJDA 2STDA 4HM0B 1OF5B 1OHPA 2HMNB 1GY6A 1EA2A 2YFIB 3GZBA 3FF2A 1K41A 6STDA 3B8LA 4FCJA 1O7NB 3GZXB 3ROBA 2XSOB 2QIYA 5AIGA 1ZX2A 1DMNA 4IIAA 5IG5A 5IENA 2BMQB 2BMOB 5FW5A 5CK6A 3Q90A 4XBTA 3F7XA 3F8XA 5BXQA 1IDPA 3EN1B 3M8CA 2HMJB 4HM1B 4LMIA 3NXJA 3H3HA 3OXAA 3KSPA 2B1XB 2K54A 4R1KA 5HGRA 1O7PB 4OUQA 5G2GA 3SEDA 2BNGA 3FF0A 4PEJA 2F86B 4X2OA 1O7MB 1OH0A 2BMRB 3G16A 3F7SA 5DRVA 3S5CA 3DUKA 2Z7AA 4K1UA 3KZTA 4WYKB 3GWRA 3UJMA 1ULJB 2Z76A 3G0KA 1QJGA 3T8NA 2CKFB 3OWUA 4WP5A 2INXA 4L8PA 3FSDA 1VZZA 1W6YA 4HM8B 3OV4A 1OPYA 1GY7A 4J9AA 3FKAA 4XB5A 3DXOA 3F14A 1E97A 5D82A 1OHOA 2IMJA 5KP4A 1SJWA 3F40A 4HM2B 4XM4A 4HJLB 3EBTA 3WMDA 3EHCA 4U13A 4WYKA 3B7CA 2F98A 4HVNA 3MSOA 3KKGA 3A76A 1NU3A 3DZLA 3ER7A 5AIFA 2F99A 2RFRA 4WWUC 3NUVA 5KP3A 1BUQA 5TGNA 3NHXA 3RGAA 1W02A 1O7GB 2GBWB 4N3VA 1OGXA 5CF1A 3EJVA 3F8HA 1HKXA 5IF6A 1C7HA 1JKGA 3SOYA 4L7KA 1OCVA 3JUQA 1W00A 5EVHA 1OUNA 3BB9A 5AIHA 1QMAA 5CF2A 3I0YA 3D9RA 3OWSA 5IEOA 1A2KA 3K7CA 2HMLB 3VGNA 2YFLB 4LGQA 3F9SA
chains in the Genus database with same CATH superfamily
3JUPA 1B27A 1VQQA 3U1WA 2F5WA 4STDA 4I5QA 3D79A 1VQ43 1GS3A 4XDWA 3CCM3 1B20A 1FUTA 2CG0A 1JRQA 2WOFA 4BTXA 1W2B2 1M904 1Z1SA 3JUMA 2JQ5A 2W2CA 1JJ22 3T0UA 3G8ZA 1OGZA 4XDVA 2XRXB 2OOVA 3CCU3 1WTHA 4HM3B 5D81A 4KVHA 1YHQ3 3MG1A 3PZWA 2RNTA 2Z77A 3IPTA 1NO3A 1I8VA 3NX0A 3IMAB 3MG2A 3JUOA 4FMDA 1JN5B 2WO0A 1UUVB 3X40A 3CD63 2CX0A 4EV2A 1ZO2A 1NB5I 1IQYA 1DYUA 3E99A 3PGBA 2LYXA 4CJNA 1QVF2 2XFTA 3V98A 2UUGC 3N9HA 4EXRA 4HZBB 3B4PA 7STDA 1IT8A 3DMCA 1U5OA 1FGRA 3WHOA 2KXGA 3EB8A 1JNQA 1BNSA 4FMAA 2A15A 2F56A 4I4KA 4L8OA 4Q53A 1GMPA 2PZVA 1BAOA 1UDII 3S67A 3ZFZA 3I563 3CC23 3CNMA 3BLZA 1GYBA 3HK4A 4JF8A 1T5YA 4BTWA 3WODG 1MWUA 1RGKA 1RGGA 6GSPA 2KCDA 3CCE3 1BNGA 1PY3A 1ZGXA 2IYJA 2OOVC 4N6NB 1KQS2 1QVG2 5HOHA 3NBRA 1OHSA 2OQEA 1LNHA 1I3FA 1QALA 1TRQA 1UI7A 3NM2A 3X3ZA 6RNTA 1B3SA 1MGRA 3VF1A 4K1VA 1CYVA 4ORLA 3FGYA 3HI7A 3RDEA 3CC73 3EC9A 3LH4A 2QGUA 4R9KA 3T8UA 4LYLB 2OWPA 3FCSB 3NBJA 4MEIA 1JKGB 4RZMA 3STDA 1BRSA 2GBXB 3LT8A 4EC6A 3KFQC 2W56B 1WMNA 2BU4A 1FW7A 2RCDA 3G4S3 2P38A 3V99A 3B4OA 1CQSA 2UX0A 1G02A 1RGAA 3CCV3 1JN5A 1TU5A 2W9QA 1W01A 1WMPA 1AVLA 4KFEA 1O7WB 1VQL3 2GSPA 2GEYA 1PYLA 3PCRA 1VQK3 1DMMA 3ZG5A 5AEUB 1V74A 4CDLA 1I70A 1UUWB 4CPKA 1I3IA 1DMQA 1NWWA 1RGEA 3DM8A 4CCVA 1MWSA 1KWIA 4J8TA 4RNZA 1JBSA 3EQQB 2HMMB 4HM7B 3X3YA 3CC43 4GB5A 1Q824 1TP6A 1T2IA 1E3VA 1Q40B 4FCMA 1JV2B 4HM5B 3L0RA 5JPPA 4EYCA 2CIUA 1N5PA 3NV0B 3KN4A 4J5GA 3MWZA 3OWYA 2I9WA 3KE7A 3V92A 1BOXA 3ECFA 1BRGA 2OQEC 1IQ8A 3HIIA 1W2ZA 3EF8A 1VQ63 1SPUA 2B24B 2GEXA 5AEWB 3RGRA 1V57A 1W5ZA 1FUWA 3CMA3 3DGLA 1EG9B 1AV4A 1FYSA 1J2BA 3SVAA 1IV7A 1BSCA 4LEHA 1WNHA 1T3BA 5D83A 4ILFA 1B2SA 3CME3 1R4YA 5M18A 2W56A 1HYFA 4RNYA 1YVBI 4O2HA 3CXC2 2CWTA 1GMQA 4G1MB 1A67A 1W6GA 1US1A 1FGTA 1F8NA 3GRDA 2CFDA 1I2FA 3MPHA 5DREA 4BL3A 3CPOA 1GOVA 1YVSA 4OVMA 2XGNA 2D1WA 1GMRA 1WQLB 4X2HA 4RNTA 4HM4B 1STDA 1L5GB 1B2MA 4AEQA 3S27A 2MF7A 4QWTA 3D3LA 5G1KA 3PXMA 5AIIA 1LOYA 2Z6BA 2Y73A 3I553 3EX9A 1IU7A 1OF5A 1Q40A 2KF6A 1K734 1GY5A 1BU4A 3N54B 3NV0A 1S5AA 2KRTA 3AGNA 4N6OB 1E3RA 1UCIA 3H51A 3WOFB 1S723 3CCQ3 1YGEA 4O3VA 1NDOB 1WMOA 2R4IA 1GOYA 3MG3A 3MKIA 3WA3A 3EBYA 1EUIC 3MYTA 4HM6B 3FZWA 2RGQA 4EBGA 1KSIA 2XF3A 4NPBA 4KFDA 3WDGB 1D6ZA 1LNIA 1ULIB 3NQZA 4R9LA 4EV5A 4XBYA 8CHOA 5IG4A 2W9PA 3WOEB 3FLJA 1EEJA 1UGIA 3BNBA 2PNCA 1TUHA 3LTBA 3HX8A 4WHAA 1VQ83 4XBXA 3LYGA 1JB2A 5CLKA 3HIGA 3HZPA 5LC6A 2HMKB 5JBSA 2AAEA 5BVBA 1RRLA 3AGOA 1JZDA 1Q42A 3MHEA 1UW1A 3G6E3 3GZYB 1GD4A 2GXFA 4H3UA 1BNRA 2HMOB 4N6TA 3LZAA 4TX4A 5AI1A 5ELUA 3G713 1RGHA 2P0MA 4HZ9B 2J8XB 1TJDA 3CCS3 5STDA 5AYRB 3ALAA 1N8R4 3J7Yd 1RCKA 5IG3A 2H0HA 1UCKA 1ISKA 5IEPA 1M1K4 2R41A 2ML5A 3UL6A 1ASKA 2BHMA 1TFOA 4LZIA 3UNLA 2XR8B 3SOAA 1LOXA 1ROVA 4AKYA 2CX1A 2W03A 3CNXA 4BL2A 5KP1A 2K3DA 2KAAA 3BNEA 3K0ZA 2O3OA 1IYYA 1AR0A 1TRPA 3X41A 3FG4A 1JB5A 1BRIA 5JPUA 1IVWA 4NREA 1RDSA 3D5IA 5M19A 1K28A 2YX9A 2CHCA 4GL6A 3WR2A 3S29A 3VSYA 3X42A 4N6V0 5AYSC 5CXOA 4GSPA 1IT7A 5IG0A 1SIIA 2CFLA 1AY7A 2RBIA 3EN8A 3KCHA 1C54A 2H0GA 1NNVA 2M7OA 4KFFA 5GSPA 1TIJA 3D4AA 1DVCA 1Q7Y4 3AMOA 3CU3A 1JB4A 3HOHA 1B2ZA 4JRFA 5IERA 1B2UA 2OTL3 3DGYA 2ZA4A 2YFJB 3EE1A 5G1LA 1O7HB 1RGLA 3BNCA 4H61A 3FH1A 1NJI4 2XSHB 2GU3A 1OACA 3JUNA 1GOUA 1LQGC 3GZRA 3OX9A 4HKVB 3URPA 4MJDA 2STDA 2OCTA 4HM0B 1JBTA 1OF5B 4NHFA 1AQZA 1R4CA 1OHPA 2HMNB 1RTUA 1BUJA 1BNJA 1GY6A 1RLSA 3UB1A 1EA2A 2YFIB 1U8CB 2FNQA 3IJEB 5M1AA 3Q1CA 2E2VA 3GZBA 4O8SA 1MGWA 2JDIH 2KF3A 3FF2A 1K41A 6STDA 1UCJA 3B8LA 1QAKA 2UGIA 4FCJA 1O7NB 3DGNA 4EW5A 2XH9A 1T2HA 3GZXB 5RNTA 2BIRA 3ROBA 4KZ1A 4AKZA 4K90B 2XSOB 1MNLA 2QIYA 5AIGA 1IK3A 1ZX2A 1DMNA 2XGLA 1D6YA 1MOLA 4IIAA 2XFSA 5IG5A 1UGHI 3UL5A 1I0XA 5IENA 3UJMA 3K5TA 1FZUA 2BMQB 1RRHA 1LOWA 2BMOB 3QK9A 5FW5A 2CWUA 4BTYA 5CK6A 3Q90A 4XBTA 1LXEA 3LTAA 1N9EA 2QA43 3F7XA 2ZDJA 3F8XA 4K61A 5BXQA 1IDPA 1BRNL 1AVKA 2OTJ3 3EN1B 3M8CA 4FMBA 2HMJB 4O02B 3DH2A 4WFOA 4HM1B 4LMIA 3NXJA 1Q9EA 3D5GA 3SXXA 1RNBA 1SIHA 1X1YA 3H3HA 3KSPA 3OXAA 4KT3B 3SLUA 1CEWI 4BU4A 1YI23 1VQN3 2B1XB 3NM7A 1LVNA 2K54A 1X1UA 2HOHA 1VQP3 4R1KA 1BGSA 1RJOA 3PCSA 2LQVA 5ELJA 1BNEA 5HGRA 1BNFA 3Q2PA 1MWRA 1O7PB 1YIT3 3BIRA 4IPBA 4OUQA 2E2UA 5FGOA 5G2GA 1BRJA 2BNGA 3SEDA 3U97A 2BO9B 2FXTA 3FF0A 4HYZA 1GD3A 2L4VA 4PEJA 1B2XA 3GSPA 1G96A 1RN7A 1Y4KA 2FGTA 1JBRA 1STFI 2F86B 1CH0A 1O7MB 3GAXA 4X2OA 5I97A 1OH0A 3LT9A 5BU4A 2CG1A 2BMRB 4N6MA 3CPW2 3G16A 3O8YA 3RNTA 3AMOB 2CH9A 1M1XB 1X1XA 2C10A 2Y74A 2W6JH 1FA3A 1YIJ3 3F7SA 1BRHA 2RSXA 1A2PA 3Q3FA 5DRVA 1RNTA 1YGWA 3S5CA 2MC8A 3OW22 1W6CA 1FGQA 3DUKA 2C11A 2CC3A 2Z7AA 2SARA 2WGQA 4K1UA 1X1WA 3A5EA 3KZTA 4WYKB 3DGMA 3GWRA 1K8A4 3QRDA 3PS8A 2IUKA 4OK0A 2W0QA 2L1SA 4LSOA 1ULJB 2KF4A 1JZOA 2Z76A 3G0KA 1QJGA 3T8NA 2CKFB 4BIRA 3CCJ3 3LOYA 5A0OB 3OWUA 3SYUA 1VQ53 2O9UX 1QAFA 2P0XA 4WP5A 4DKIA 2CFGA 2INXA 4HOHA 4L8PA 3FSDA 2Q07A 1VZZA 2W04A 1IV9A 3K9MC 1W6YA 4HM8B 1I2GA 2CFKA 3WA2X 3OV4A 4IT7A 1TFKA 3DY5A 1BRKA 1OPYA 3FG1A 4MMXB 1BANA 1NB3I 3K63A 1GY7A 1RCLA 4J9AA 3FKAA 4XB5A 1HU9A 2IY2A 2SBLA 2IUJA 3DGOA 3N8BA 1SQWA 3DXOA 2ZL8A 3CCL3 3F14A 1E97A 2CFWA 5D82A 2E2TA 1I0VA 8RNTA 5BIRA 1VQM3 2ZHXB 1OHOA 2IMJA 1CYUA 2P05A 5KP4A 1A90A 1SJWA 2BT3A 1RKYA 3F40A 4HAAA 4HM2B 4XM4A 4HJLB 1LRAA 1ROAA 7RNTA 3EBTA 2K0MA 3LMLA 4MMZB 3WMDA 3NBBA 4MMYB 1EQKA 1MWTA 3EHCA 4R80A 4U13A 4WYKA 1DETA 3SX1A 1W4NA 3TDGA 1YNVX 3B7CA 2F98A 1KD14 1YJW3 1FGMA 4HVNA 3MSOA 2XEPA 3AHWA 1UCLA 1SARA 3KKGA 4R4KA 1BSBA 1D6UA 4ZM8A 3A76A 3LTCA 4FCZA 1NU3A 2H0IA 3DZLA 3NQYA 4GHOA 3AHSA 3ER7A 3KIIA 5AIFA 2F99A 2CK3H 4FMCA 4FR9A 1M9GA 3LTDA 1IVVA 1FUSA 2F5MA 2ML6A 1EKMA 3S28A 1DE3A 1BSDA 2RFRA 1A2VA 4WWUC 1LQMB 1YJ93 1VQ93 1IVXA 3KSED 1BVIA 3NUVA 5KP3A 1BUQA 5TGNA 1RN1A 1PU4A 3NHXA 1W7CA 3RGAA 2AADA 1KC84 2V1LA 1RGCA 2WGOA 4J5KA 3ZG0A 2F4YA 1VQ73 1TTOA 1W02A 1UUGB 1O7GB 5IW9A 2GBWB 1RMSA 2CW9A 4N3VA 2D42A 5EQLA 2QEX3 1OGXA 1RHLA 2IA7A 2P09A 1UI8A 2GU1A 2KF5A 3EJVA 4N6LA 4RBNA 5CF1A 1B21A 1ZS7A 1LOVA 3BNDA 3JVCA 1Q864 3F8HA 5EEOA 3X3XA 2C4BA 1BNIA 1HKXA 5IF6A 1I2EA 1RSNA 1C7HA 1JKGA 1N5HA 3SOYA 4L7KA 1PFPA 1RGFA 1HZ1A 3PYJA 1OCVA 1V58A 1IQXA 1Q7HA 3JUQA 3FG3A 9RNTA 1W00A 1K9M4 1N8QA 1FGOA 5EVHA 1OUNA 2WOHA 3LXUX 1N9JA 3BB9A 1BIRA 1YJN3 3CCR3 4N6UA 1IVUA 4HBRA 1BSEA 1BSAA 5AIHA 1QMAA 5CF2A 3I0YA 3D9RA 1G0TA 3OWSA 1GSPA 1RN4A 1DVDA 5IEOA 1A2KA 3K7CA 1Q814 2HMLB 7GSPA 1VQO3 3BU4A 3VGNA 2YFLB 4LGQA 3F9SA 5LC7A 2CWVA
chains in the Genus database with same CATH topology
3JUPA 3U1WA 4STDA 1VQ43 1GS3A 4XDWA 3CCM3 2CG0A 1JRQA 2WOFA 4BTXA 1W2B2 1M904 1Z1SA 3JUMA 2JQ5A 2W2CA 1JJ22 3T0UA 3G8ZA 1OGZA 4XDVA 2XRXB 2OOVA 3CCU3 1WTHA 4HM3B 5D81A 4KVHA 1YHQ3 3MG1A 3PZWA 2Z77A 3IPTA 1NO3A 3NX0A 3IMAB 3MG2A 3JUOA 4FMDA 1JN5B 2WO0A 1UUVB 3X40A 3CD63 4EV2A 1ZO2A 1NB5I 1IQYA 1DYUA 3E99A 3PGBA 2LYXA 1QVF2 2XFTA 3V98A 4EXRA 3N9HA 4HZBB 3B4PA 7STDA 1IT8A 3DMCA 1U5OA 1FGRA 2KXGA 3EB8A 1JNQA 4I4KA 4FMAA 2A15A 4L8OA 4Q53A 2PZVA 3I563 3CC23 3S67A 3CNMA 3BLZA 1GYBA 3HK4A 4JF8A 1T5YA 4BTWA 3WODG 2KCDA 3CCE3 2OOVC 1KQS2 4N6NB 1QVG2 3NBRA 1OHSA 2OQEA 1LNHA 1QALA 3X3ZA 1UI7A 3NM2A 3VF1A 4K1VA 1CYVA 4ORLA 3FGYA 3HI7A 3RDEA 3CC73 3EC9A 3LH4A 2QGUA 4R9KA 3T8UA 2OWPA 3FCSB 3NBJA 4MEIA 1JKGB 4RZMA 3STDA 2GBXB 3LT8A 4EC6A 3KFQC 2W56B 1WMNA 2RCDA 3G4S3 2P38A 3V99A 3B4OA 1CQSA 2UX0A 3CCV3 1JN5A 1TU5A 2W9QA 1W01A 1WMPA 1AVLA 4KFEA 1O7WB 1VQL3 2GEYA 3PCRA 1VQK3 1DMMA 5AEUB 1V74A 4CDLA 1UUWB 1DMQA 1NWWA 3DM8A 4CCVA 4J8TA 1KWIA 4RNZA 3EQQB 2HMMB 4HM7B 3X3YA 3CC43 4GB5A 1Q824 1TP6A 1E3VA 1Q40B 4FCMA 1JV2B 4HM5B 3L0RA 5JPPA 4EYCA 2CIUA 1N5PA 3NV0B 3KN4A 3MWZA 3OWYA 2I9WA 3KE7A 3V92A 3ECFA 2OQEC 3HIIA 1IQ8A 1W2ZA 3EF8A 1VQ63 1SPUA 2B24B 2GEXA 5AEWB 3RGRA 1FUWA 1W5ZA 3CMA3 3DGLA 1EG9B 1AV4A 1J2BA 3SVAA 1IV7A 4LEHA 1WNHA 5D83A 3CME3 2W56A 4RNYA 1YVBI 4O2HA 3CXC2 2CWTA 4G1MB 1A67A 1W6GA 1US1A 1FGTA 1F8NA 3GRDA 2CFDA 3MPHA 5DREA 3CPOA 4OVMA 2XGNA 2D1WA 1WQLB 4X2HA 1L5GB 4HM4B 1STDA 4AEQA 3S27A 2MF7A 4QWTA 3D3LA 3PXMA 5AIIA 2Z6BA 2Y73A 3I553 3EX9A 1IU7A 1OF5A 1Q40A 1K734 1GY5A 3N54B 3NV0A 1S5AA 2KRTA 4N6OB 1E3RA 3H51A 3WOFB 1S723 3CCQ3 1YGEA 4O3VA 1NDOB 1WMOA 2R4IA 3MG3A 3MKIA 3WA3A 3EBYA 3MYTA 4HM6B 3FZWA 2RGQA 4EBGA 1KSIA 2XF3A 4KFDA 3WDGB 1D6ZA 1ULIB 3NQZA 4R9LA 4EV5A 4XBYA 8CHOA 5IG4A 2W9PA 3WOEB 3FLJA 3LTBA 4WHAA 3BNBA 2PNCA 1TUHA 1VQ83 3HX8A 4XBXA 3LYGA 1JB2A 5CLKA 3HIGA 3HZPA 5LC6A 2HMKB 5JBSA 5BVBA 1RRLA 1Q42A 3MHEA 1UW1A 3G6E3 3GZYB 1GD4A 2GXFA 4H3UA 2HMOB 4N6TA 3LZAA 4TX4A 5AI1A 5ELUA 3G713 2P0MA 4HZ9B 3CCS3 5STDA 5AYRB 3ALAA 1N8R4 3J7Yd 5IG3A 1ISKA 5IEPA 1M1K4 2ML5A 3UL6A 1ASKA 2BHMA 1TFOA 4LZIA 3UNLA 2XR8B 3SOAA 1LOXA 1ROVA 4AKYA 3CNXA 2W03A 5KP1A 3K0ZA 3BNEA 2O3OA 1AR0A 3X41A 3FG4A 1JB5A 5JPUA 1IVWA 4NREA 1K28A 2YX9A 2CHCA 4GL6A 3S29A 3VSYA 3X42A 4N6V0 5AYSC 5CXOA 1IT7A 5IG0A 1SIIA 2CFLA 3EN8A 2M7OA 4KFFA 1TIJA 1DVCA 1Q7Y4 3AMOA 3CU3A 1JB4A 4JRFA 5IERA 2OTL3 2YFJB 3EE1A 1O7HB 4H61A 3BNCA 1NJI4 3FH1A 2XSHB 2GU3A 1OACA 3JUNA 3GZRA 3OX9A 4HKVB 4MJDA 2STDA 2OCTA 4HM0B 1OF5B 4NHFA 1R4CA 1OHPA 2HMNB 1GY6A 3UB1A 1EA2A 2YFIB 1U8CB 2FNQA 3IJEB 3Q1CA 2E2VA 3GZBA 4O8SA 2JDIH 3FF2A 1K41A 6STDA 3B8LA 1QAKA 4FCJA 1O7NB 3DGNA 2XH9A 3GZXB 3ROBA 4KZ1A 4AKZA 4K90B 2XSOB 1MNLA 2QIYA 5AIGA 1IK3A 1ZX2A 1DMNA 2XGLA 1D6YA 1MOLA 4IIAA 2XFSA 5IG5A 3UL5A 5IENA 3K5TA 2BMQB 1RRHA 2BMOB 3QK9A 5FW5A 2CWUA 4BTYA 5CK6A 3Q90A 4XBTA 1LXEA 3LTAA 1N9EA 2QA43 3F7XA 2ZDJA 3F8XA 4K61A 5BXQA 1IDPA 1AVKA 2OTJ3 3EN1B 3M8CA 4FMBA 2HMJB 4O02B 4WFOA 4HM1B 4LMIA 3NXJA 3SXXA 1SIHA 3H3HA 3OXAA 3KSPA 3SLUA 1CEWI 1YI23 1VQN3 2B1XB 3NM7A 1LVNA 2K54A 1VQP3 4R1KA 1RJOA 3PCSA 2LQVA 5ELJA 5HGRA 3Q2PA 1O7PB 1YIT3 4IPBA 4OUQA 2E2UA 5FGOA 5G2GA 3SEDA 2BNGA 3U97A 2BO9B 2FXTA 3FF0A 4HYZA 1GD3A 2L4VA 4PEJA 1G96A 1RN7A 1Y4KA 2FGTA 1STFI 2F86B 3GAXA 1O7MB 4X2OA 5I97A 1OH0A 3LT9A 2CG1A 2BMRB 4N6MA 3CPW2 3G16A 3O8YA 3AMOB 2CH9A 1M1XB 2C10A 2Y74A 2W6JH 1YIJ3 3F7SA 2RSXA 5DRVA 3S5CA 2MC8A 3OW22 1W6CA 1FGQA 3DUKA 2C11A 2CC3A 2Z7AA 2WGQA 4K1UA 3KZTA 4WYKB 3DGMA 3GWRA 1K8A4 3QRDA 3PS8A 2IUKA 4OK0A 2W0QA 3UJMA 4LSOA 1ULJB 3CCJ3 2Z76A 3G0KA 1QJGA 3T8NA 2CKFB 3LOYA 5A0OB 3OWUA 1VQ53 2P0XA 2O9UX 1QAFA 4WP5A 2CFGA 2INXA 4L8PA 3FSDA 2Q07A 1VZZA 2W04A 1IV9A 3K9MC 1W6YA 4HM8B 2CFKA 3WA2X 3OV4A 4IT7A 1TFKA 3DY5A 1OPYA 3FG1A 4MMXB 1NB3I 3K63A 1GY7A 4J9AA 3FKAA 4XB5A 1HU9A 2SBLA 2IUJA 3CCL3 3DGOA 3N8BA 1SQWA 3DXOA 2ZL8A 3F14A 1E97A 2CFWA 5D82A 2E2TA 1VQM3 1OHOA 2IMJA 1CYUA 2P05A 5KP4A 1A90A 1SJWA 2BT3A 1RKYA 3F40A 4HM2B 4XM4A 4HJLB 1ROAA 3EBTA 2K0MA 3LMLA 4MMZB 3WMDA 3NBBA 4MMYB 1EQKA 3EHCA 4R80A 4U13A 4WYKA 3SX1A 1W4NA 3TDGA 3B7CA 2F98A 1KD14 1YJW3 1FGMA 4HVNA 3MSOA 2XEPA 3KKGA 4R4KA 1D6UA 4ZM8A 3A76A 3LTCA 4FCZA 1NU3A 3DZLA 3NQYA 3ER7A 3KIIA 5AIFA 2F99A 2CK3H 4FMCA 4FR9A 1M9GA 3LTDA 1IVVA 2ML6A 1EKMA 3S28A 2RFRA 1A2VA 4WWUC 1YJ93 1VQ93 1IVXA 3KSED 3NUVA 5KP3A 1BUQA 5TGNA 1PU4A 3NHXA 1W7CA 3RGAA 1KC84 2V1LA 2WGOA 1VQ73 1W02A 1O7GB 5IW9A 2GBWB 2CW9A 4N3VA 2D42A 5EQLA 2QEX3 1OGXA 2IA7A 2P09A 5CF1A 1UI8A 2GU1A 4RBNA 3EJVA 4N6LA 1Q864 1FA3A 3BNDA 3JVCA 3F8HA 5EEOA 3X3XA 1HKXA 5IF6A 1C7HA 1JKGA 1N5HA 3SOYA 4L7KA 1PFPA 3PYJA 1OCVA 1IQXA 3JUQA 3FG3A 1W00A 1K9M4 1N8QA 1FGOA 5EVHA 1OUNA 2WOHA 3LXUX 1N9JA 3BB9A 1YJN3 3CCR3 4N6UA 1IVUA 4HBRA 5AIHA 1QMAA 5CF2A 3I0YA 3D9RA 3OWSA 1DVDA 5IEOA 1A2KA 3K7CA 1Q814 2HMLB 1VQO3 3VGNA 2YFLB 4LGQA 3F9SA 5LC7A 2CWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUP A;  4STD A;  1GS3 A;  4XDW A;  1Z1S A;  3JUM A;  2JQ5 A;  2W2C A;  3G8Z A;  1OGZ A;  4XDV A;  2XRX B;  4HM3 B;  5D81 A;  4KVH A;  3MG1 A;  2Z77 A;  3IPT A;  3MG2 A;  3JUO A;  1JN5 B;  1UUV B;  1ZO2 A;  3E99 A;  4HZB B;  3B4P A;  7STD A;  3DMC A;  1U5O A;  4I4K A;  4Q53 A;  2A15 A;  4L8O A;  2PZV A;  3CNM A;  3BLZ A;  1GYB A;  3HK4 A;  3NBR A;  1OHS A;  3NM2 A;  4K1V A;  4ORL A;  3FGY A;  3EC9 A;  2QGU A;  4R9K A;  3T8U A;  2OWP A;  1JKG B;  4RZM A;  3STD A;  2GBX B;  2RCD A;  3B4O A;  1CQS A;  2UX0 A;  1JN5 A;  1W01 A;  1O7W B;  2GEY A;  1DMM A;  5AEU B;  4CDL A;  1UUW B;  1DMQ A;  1NWW A;  3DM8 A;  4J8T A;  3EQQ B;  2HMM B;  4HM7 B;  4GB5 A;  1TP6 A;  1E3V A;  1Q40 B;  4FCM A;  4HM5 B;  5JPP A;  3NV0 B;  3OWY A;  2I9W A;  3KE7 A;  3ECF A;  3EF8 A;  2B24 B;  2GEX A;  5AEW B;  3RGR A;  1EG9 B;  4LEH A;  5D83 A;  3GRD A;  5DRE A;  3CPO A;  4OVM A;  1WQL B;  4X2H A;  4HM4 B;  1STD A;  5AII A;  3EX9 A;  1OF5 A;  1Q40 A;  1GY5 A;  3NV0 A;  1S5A A;  1E3R A;  3H51 A;  1NDO B;  2R4I A;  3MG3 A;  3MKI A;  3EBY A;  3MYT A;  4HM6 B;  3FZW A;  2RGQ A;  1ULI B;  4R9L A;  4XBY A;  8CHO A;  5IG4 A;  3FLJ A;  1TUH A;  3HX8 A;  4XBX A;  3LYG A;  1JB2 A;  5CLK A;  3HZP A;  2HMK B;  5BVB A;  1Q42 A;  3MHE A;  3GZY B;  2GXF A;  4H3U A;  2HMO B;  3LZA A;  5AI1 A;  4HZ9 B;  5STD A;  5IG3 A;  1ISK A;  5IEP A;  1ASK A;  3UNL A;  2XR8 B;  3SOA A;  3CNX A;  5KP1 A;  3K0Z A;  1AR0 A;  1JB5 A;  5JPU A;  2CHC A;  3VSY A;  5CXO A;  5IG0 A;  3EN8 A;  3CU3 A;  1JB4 A;  5IER A;  2YFJ B;  1O7H B;  3FH1 A;  2XSH B;  3JUN A;  3GZR A;  3OX9 A;  4HKV B;  4MJD A;  2STD A;  4HM0 B;  1OF5 B;  1OHP A;  2HMN B;  1GY6 A;  1EA2 A;  2YFI B;  3GZB A;  3FF2 A;  1K41 A;  6STD A;  3B8L A;  4FCJ A;  1O7N B;  3GZX B;  3ROB A;  2XSO B;  2QIY A;  5AIG A;  1ZX2 A;  1DMN A;  4IIA A;  5IG5 A;  5IEN A;  2BMQ B;  2BMO B;  5FW5 A;  5CK6 A;  3Q90 A;  4XBT A;  3F7X A;  3F8X A;  5BXQ A;  1IDP A;  3EN1 B;  3M8C A;  2HMJ B;  4HM1 B;  4LMI A;  3NXJ A;  3H3H A;  3OXA A;  3KSP A;  2B1X B;  2K54 A;  4R1K A;  5HGR A;  1O7P B;  4OUQ A;  5G2G A;  3SED A;  2BNG A;  3FF0 A;  4PEJ A;  2F86 B;  4X2O A;  1O7M B;  1OH0 A;  2BMR B;  3G16 A;  3F7S A;  5DRV A;  3S5C A;  3DUK A;  2Z7A A;  4K1U A;  3KZT A;  4WYK B;  3GWR A;  3UJM A;  1ULJ B;  2Z76 A;  3G0K A;  1QJG A;  3T8N A;  2CKF B;  3OWU A;  4WP5 A;  2INX A;  4L8P A;  3FSD A;  1VZZ A;  1W6Y A;  4HM8 B;  3OV4 A;  1OPY A;  1GY7 A;  4J9A A;  3FKA A;  4XB5 A;  3DXO A;  3F14 A;  1E97 A;  5D82 A;  1OHO A;  2IMJ A;  5KP4 A;  1SJW A;  3F40 A;  4HM2 B;  4XM4 A;  4HJL B;  3EBT A;  3WMD A;  3EHC A;  4U13 A;  4WYK A;  3B7C A;  2F98 A;  4HVN A;  3MSO A;  3KKG A;  3A76 A;  1NU3 A;  3DZL A;  3ER7 A;  5AIF A;  2F99 A;  2RFR A;  4WWU C;  3NUV A;  5KP3 A;  1BUQ A;  5TGN A;  3NHX A;  3RGA A;  1W02 A;  1O7G B;  2GBW B;  4N3V A;  1OGX A;  5CF1 A;  3EJV A;  3F8H A;  1HKX A;  5IF6 A;  1C7H A;  1JKG A;  3SOY A;  4L7K A;  1OCV A;  3JUQ A;  1W00 A;  5EVH A;  1OUN A;  3BB9 A;  5AIH A;  1QMA A;  5CF2 A;  3I0Y A;  3D9R A;  3OWS A;  5IEO A;  1A2K A;  3K7C A;  2HML B;  3VGN A;  2YFL B;  4LGQ A;  3F9S A; 
#chains in the Genus database with same CATH topology
 3JUP A;  1B27 A;  1VQQ A;  3U1W A;  2F5W A;  4STD A;  4I5Q A;  3D79 A;  1VQ4 3;  1GS3 A;  4XDW A;  3CCM 3;  1B20 A;  1FUT A;  2CG0 A;  1JRQ A;  2WOF A;  4BTX A;  1W2B 2;  1M90 4;  1Z1S A;  3JUM A;  2JQ5 A;  2W2C A;  1JJ2 2;  3T0U A;  3G8Z A;  1OGZ A;  4XDV A;  2XRX B;  2OOV A;  3CCU 3;  1WTH A;  4HM3 B;  5D81 A;  4KVH A;  1YHQ 3;  3MG1 A;  3PZW A;  2RNT A;  2Z77 A;  3IPT A;  1NO3 A;  1I8V A;  3NX0 A;  3IMA B;  3MG2 A;  3JUO A;  4FMD A;  1JN5 B;  2WO0 A;  1UUV B;  3X40 A;  3CD6 3;  2CX0 A;  4EV2 A;  1ZO2 A;  1NB5 I;  1IQY A;  1DYU A;  3E99 A;  3PGB A;  2LYX A;  4CJN A;  1QVF 2;  2XFT A;  3V98 A;  2UUG C;  3N9H A;  4EXR A;  4HZB B;  3B4P A;  7STD A;  1IT8 A;  3DMC A;  1U5O A;  1FGR A;  3WHO A;  2KXG A;  3EB8 A;  1JNQ A;  1BNS A;  4FMA A;  2A15 A;  2F56 A;  4I4K A;  4L8O A;  4Q53 A;  1GMP A;  2PZV A;  1BAO A;  1UDI I;  3S67 A;  3ZFZ A;  3I56 3;  3CC2 3;  3CNM A;  3BLZ A;  1GYB A;  3HK4 A;  4JF8 A;  1T5Y A;  4BTW A;  3WOD G;  1MWU A;  1RGK A;  1RGG A;  6GSP A;  2KCD A;  3CCE 3;  1BNG A;  1PY3 A;  1ZGX A;  2IYJ A;  2OOV C;  4N6N B;  1KQS 2;  1QVG 2;  5HOH A;  3NBR A;  1OHS A;  2OQE A;  1LNH A;  1I3F A;  1QAL A;  1TRQ A;  1UI7 A;  3NM2 A;  3X3Z A;  6RNT A;  1B3S A;  1MGR A;  3VF1 A;  4K1V A;  1CYV A;  4ORL A;  3FGY A;  3HI7 A;  3RDE A;  3CC7 3;  3EC9 A;  3LH4 A;  2QGU A;  4R9K A;  3T8U A;  4LYL B;  2OWP A;  3FCS B;  3NBJ A;  4MEI A;  1JKG B;  4RZM A;  3STD A;  1BRS A;  2GBX B;  3LT8 A;  4EC6 A;  3KFQ C;  2W56 B;  1WMN A;  2BU4 A;  1FW7 A;  2RCD A;  3G4S 3;  2P38 A;  3V99 A;  3B4O A;  1CQS A;  2UX0 A;  1G02 A;  1RGA A;  3CCV 3;  1JN5 A;  1TU5 A;  2W9Q A;  1W01 A;  1WMP A;  1AVL A;  4KFE A;  1O7W B;  1VQL 3;  2GSP A;  2GEY A;  1PYL A;  3PCR A;  1VQK 3;  1DMM A;  3ZG5 A;  5AEU B;  1V74 A;  4CDL A;  1I70 A;  1UUW B;  4CPK A;  1I3I A;  1DMQ A;  1NWW A;  1RGE A;  3DM8 A;  4CCV A;  1MWS A;  1KWI A;  4J8T A;  4RNZ A;  1JBS A;  3EQQ B;  2HMM B;  4HM7 B;  3X3Y A;  3CC4 3;  4GB5 A;  1Q82 4;  1TP6 A;  1T2I A;  1E3V A;  1Q40 B;  4FCM A;  1JV2 B;  4HM5 B;  3L0R A;  5JPP A;  4EYC A;  2CIU A;  1N5P A;  3NV0 B;  3KN4 A;  4J5G A;  3MWZ A;  3OWY A;  2I9W A;  3KE7 A;  3V92 A;  1BOX A;  3ECF A;  1BRG A;  2OQE C;  1IQ8 A;  3HII A;  1W2Z A;  3EF8 A;  1VQ6 3;  1SPU A;  2B24 B;  2GEX A;  5AEW B;  3RGR A;  1V57 A;  1W5Z A;  1FUW A;  3CMA 3;  3DGL A;  1EG9 B;  1AV4 A;  1FYS A;  1J2B A;  3SVA A;  1IV7 A;  1BSC A;  4LEH A;  1WNH A;  1T3B A;  5D83 A;  4ILF A;  1B2S A;  3CME 3;  1R4Y A;  5M18 A;  2W56 A;  1HYF A;  4RNY A;  1YVB I;  4O2H A;  3CXC 2;  2CWT A;  1GMQ A;  4G1M B;  1A67 A;  1W6G A;  1US1 A;  1FGT A;  1F8N A;  3GRD A;  2CFD A;  1I2F A;  3MPH A;  5DRE A;  4BL3 A;  3CPO A;  1GOV A;  1YVS A;  4OVM A;  2XGN A;  2D1W A;  1GMR A;  1WQL B;  4X2H A;  4RNT A;  4HM4 B;  1STD A;  1L5G B;  1B2M A;  4AEQ A;  3S27 A;  2MF7 A;  4QWT A;  3D3L A;  5G1K A;  3PXM A;  5AII A;  1LOY A;  2Z6B A;  2Y73 A;  3I55 3;  3EX9 A;  1IU7 A;  1OF5 A;  1Q40 A;  2KF6 A;  1K73 4;  1GY5 A;  1BU4 A;  3N54 B;  3NV0 A;  1S5A A;  2KRT A;  3AGN A;  4N6O B;  1E3R A;  1UCI A;  3H51 A;  3WOF B;  1S72 3;  3CCQ 3;  1YGE A;  4O3V A;  1NDO B;  1WMO A;  2R4I A;  1GOY A;  3MG3 A;  3MKI A;  3WA3 A;  3EBY A;  1EUI C;  3MYT A;  4HM6 B;  3FZW A;  2RGQ A;  4EBG A;  1KSI A;  2XF3 A;  4NPB A;  4KFD A;  3WDG B;  1D6Z A;  1LNI A;  1ULI B;  3NQZ A;  4R9L A;  4EV5 A;  4XBY A;  8CHO A;  5IG4 A;  2W9P A;  3WOE B;  3FLJ A;  1EEJ A;  1UGI A;  3BNB A;  2PNC A;  1TUH A;  3LTB A;  3HX8 A;  4WHA A;  1VQ8 3;  4XBX A;  3LYG A;  1JB2 A;  5CLK A;  3HIG A;  3HZP A;  5LC6 A;  2HMK B;  5JBS A;  2AAE A;  5BVB A;  1RRL A;  3AGO A;  1JZD A;  1Q42 A;  3MHE A;  1UW1 A;  3G6E 3;  3GZY B;  1GD4 A;  2GXF A;  4H3U A;  1BNR A;  2HMO B;  4N6T A;  3LZA A;  4TX4 A;  5AI1 A;  5ELU A;  3G71 3;  1RGH A;  2P0M A;  4HZ9 B;  2J8X B;  1TJD A;  3CCS 3;  5STD A;  5AYR B;  3ALA A;  1N8R 4;  3J7Y d;  1RCK A;  5IG3 A;  2H0H A;  1UCK A;  1ISK A;  5IEP A;  1M1K 4;  2R41 A;  2ML5 A;  3UL6 A;  1ASK A;  2BHM A;  1TFO A;  4LZI A;  3UNL A;  2XR8 B;  3SOA A;  1LOX A;  1ROV A;  4AKY A;  2CX1 A;  2W03 A;  3CNX A;  4BL2 A;  5KP1 A;  2K3D A;  2KAA A;  3BNE A;  3K0Z A;  2O3O A;  1IYY A;  1AR0 A;  1TRP A;  3X41 A;  3FG4 A;  1JB5 A;  1BRI A;  5JPU A;  1IVW A;  4NRE A;  1RDS A;  3D5I A;  5M19 A;  1K28 A;  2YX9 A;  2CHC A;  4GL6 A;  3WR2 A;  3S29 A;  3VSY A;  3X42 A;  4N6V 0;  5AYS C;  5CXO A;  4GSP A;  1IT7 A;  5IG0 A;  1SII A;  2CFL A;  1AY7 A;  2RBI A;  3EN8 A;  3KCH A;  1C54 A;  2H0G A;  1NNV A;  2M7O A;  4KFF A;  5GSP A;  1TIJ A;  3D4A A;  1DVC A;  1Q7Y 4;  3AMO A;  3CU3 A;  1JB4 A;  3HOH A;  1B2Z A;  4JRF A;  5IER A;  1B2U A;  2OTL 3;  3DGY A;  2ZA4 A;  2YFJ B;  3EE1 A;  5G1L A;  1O7H B;  1RGL A;  3BNC A;  4H61 A;  3FH1 A;  1NJI 4;  2XSH B;  2GU3 A;  1OAC A;  3JUN A;  1GOU A;  1LQG C;  3GZR A;  3OX9 A;  4HKV B;  3URP A;  4MJD A;  2STD A;  2OCT A;  4HM0 B;  1JBT A;  1OF5 B;  4NHF A;  1AQZ A;  1R4C A;  1OHP A;  2HMN B;  1RTU A;  1BUJ A;  1BNJ A;  1GY6 A;  1RLS A;  3UB1 A;  1EA2 A;  2YFI B;  1U8C B;  2FNQ A;  3IJE B;  5M1A A;  3Q1C A;  2E2V A;  3GZB A;  4O8S A;  1MGW A;  2JDI H;  2KF3 A;  3FF2 A;  1K41 A;  6STD A;  1UCJ A;  3B8L A;  1QAK A;  2UGI A;  4FCJ A;  1O7N B;  3DGN A;  4EW5 A;  2XH9 A;  1T2H A;  3GZX B;  5RNT A;  2BIR A;  3ROB A;  4KZ1 A;  4AKZ A;  4K90 B;  2XSO B;  1MNL A;  2QIY A;  5AIG A;  1IK3 A;  1ZX2 A;  1DMN A;  2XGL A;  1D6Y A;  1MOL A;  4IIA A;  2XFS A;  5IG5 A;  1UGH I;  3UL5 A;  1I0X A;  5IEN A;  3UJM A;  3K5T A;  1FZU A;  2BMQ B;  1RRH A;  1LOW A;  2BMO B;  3QK9 A;  5FW5 A;  2CWU A;  4BTY A;  5CK6 A;  3Q90 A;  4XBT A;  1LXE A;  3LTA A;  1N9E A;  2QA4 3;  3F7X A;  2ZDJ A;  3F8X A;  4K61 A;  5BXQ A;  1IDP A;  1BRN L;  1AVK A;  2OTJ 3;  3EN1 B;  3M8C A;  4FMB A;  2HMJ B;  4O02 B;  3DH2 A;  4WFO A;  4HM1 B;  4LMI A;  3NXJ A;  1Q9E A;  3D5G A;  3SXX A;  1RNB A;  1SIH A;  1X1Y A;  3H3H A;  3KSP A;  3OXA A;  4KT3 B;  3SLU A;  1CEW I;  4BU4 A;  1YI2 3;  1VQN 3;  2B1X B;  3NM7 A;  1LVN A;  2K54 A;  1X1U A;  2HOH A;  1VQP 3;  4R1K A;  1BGS A;  1RJO A;  3PCS A;  2LQV A;  5ELJ A;  1BNE A;  5HGR A;  1BNF A;  3Q2P A;  1MWR A;  1O7P B;  1YIT 3;  3BIR A;  4IPB A;  4OUQ A;  2E2U A;  5FGO A;  5G2G A;  1BRJ A;  2BNG A;  3SED A;  3U97 A;  2BO9 B;  2FXT A;  3FF0 A;  4HYZ A;  1GD3 A;  2L4V A;  4PEJ A;  1B2X A;  3GSP A;  1G96 A;  1RN7 A;  1Y4K A;  2FGT A;  1JBR A;  1STF I;  2F86 B;  1CH0 A;  1O7M B;  3GAX A;  4X2O A;  5I97 A;  1OH0 A;  3LT9 A;  5BU4 A;  2CG1 A;  2BMR B;  4N6M A;  3CPW 2;  3G16 A;  3O8Y A;  3RNT A;  3AMO B;  2CH9 A;  1M1X B;  1X1X A;  2C10 A;  2Y74 A;  2W6J H;  1FA3 A;  1YIJ 3;  3F7S A;  1BRH A;  2RSX A;  1A2P A;  3Q3F A;  5DRV A;  1RNT A;  1YGW A;  3S5C A;  2MC8 A;  3OW2 2;  1W6C A;  1FGQ A;  3DUK A;  2C11 A;  2CC3 A;  2Z7A A;  2SAR A;  2WGQ A;  4K1U A;  1X1W A;  3A5E A;  3KZT A;  4WYK B;  3DGM A;  3GWR A;  1K8A 4;  3QRD A;  3PS8 A;  2IUK A;  4OK0 A;  2W0Q A;  2L1S A;  4LSO A;  1ULJ B;  2KF4 A;  1JZO A;  2Z76 A;  3G0K A;  1QJG A;  3T8N A;  2CKF B;  4BIR A;  3CCJ 3;  3LOY A;  5A0O B;  3OWU A;  3SYU A;  1VQ5 3;  2O9U X;  1QAF A;  2P0X A;  4WP5 A;  4DKI A;  2CFG A;  2INX A;  4HOH A;  4L8P A;  3FSD A;  2Q07 A;  1VZZ A;  2W04 A;  1IV9 A;  3K9M C;  1W6Y A;  4HM8 B;  1I2G A;  2CFK A;  3WA2 X;  3OV4 A;  4IT7 A;  1TFK A;  3DY5 A;  1BRK A;  1OPY A;  3FG1 A;  4MMX B;  1BAN A;  1NB3 I;  3K63 A;  1GY7 A;  1RCL A;  4J9A A;  3FKA A;  4XB5 A;  1HU9 A;  2IY2 A;  2SBL A;  2IUJ A;  3DGO A;  3N8B A;  1SQW A;  3DXO A;  2ZL8 A;  3CCL 3;  3F14 A;  1E97 A;  2CFW A;  5D82 A;  2E2T A;  1I0V A;  8RNT A;  5BIR A;  1VQM 3;  2ZHX B;  1OHO A;  2IMJ A;  1CYU A;  2P05 A;  5KP4 A;  1A90 A;  1SJW A;  2BT3 A;  1RKY A;  3F40 A;  4HAA A;  4HM2 B;  4XM4 A;  4HJL B;  1LRA A;  1ROA A;  7RNT A;  3EBT A;  2K0M A;  3LML A;  4MMZ B;  3WMD A;  3NBB A;  4MMY B;  1EQK A;  1MWT A;  3EHC A;  4R80 A;  4U13 A;  4WYK A;  1DET A;  3SX1 A;  1W4N A;  3TDG A;  1YNV X;  3B7C A;  2F98 A;  1KD1 4;  1YJW 3;  1FGM A;  4HVN A;  3MSO A;  2XEP A;  3AHW A;  1UCL A;  1SAR A;  3KKG A;  4R4K A;  1BSB A;  1D6U A;  4ZM8 A;  3A76 A;  3LTC A;  4FCZ A;  1NU3 A;  2H0I A;  3DZL A;  3NQY A;  4GHO A;  3AHS A;  3ER7 A;  3KII A;  5AIF A;  2F99 A;  2CK3 H;  4FMC A;  4FR9 A;  1M9G A;  3LTD A;  1IVV A;  1FUS A;  2F5M A;  2ML6 A;  1EKM A;  3S28 A;  1DE3 A;  1BSD A;  2RFR A;  1A2V A;  4WWU C;  1LQM B;  1YJ9 3;  1VQ9 3;  1IVX A;  3KSE D;  1BVI A;  3NUV A;  5KP3 A;  1BUQ A;  5TGN A;  1RN1 A;  1PU4 A;  3NHX A;  1W7C A;  3RGA A;  2AAD A;  1KC8 4;  2V1L A;  1RGC A;  2WGO A;  4J5K A;  3ZG0 A;  2F4Y A;  1VQ7 3;  1TTO A;  1W02 A;  1UUG B;  1O7G B;  5IW9 A;  2GBW B;  1RMS A;  2CW9 A;  4N3V A;  2D42 A;  5EQL A;  2QEX 3;  1OGX A;  1RHL A;  2IA7 A;  2P09 A;  1UI8 A;  2GU1 A;  2KF5 A;  3EJV A;  4N6L A;  4RBN A;  5CF1 A;  1B21 A;  1ZS7 A;  1LOV A;  3BND A;  3JVC A;  1Q86 4;  3F8H A;  5EEO A;  3X3X A;  2C4B A;  1BNI A;  1HKX A;  5IF6 A;  1I2E A;  1RSN A;  1C7H A;  1JKG A;  1N5H A;  3SOY A;  4L7K A;  1PFP A;  1RGF A;  1HZ1 A;  3PYJ A;  1OCV A;  1V58 A;  1IQX A;  1Q7H A;  3JUQ A;  3FG3 A;  9RNT A;  1W00 A;  1K9M 4;  1N8Q A;  1FGO A;  5EVH A;  1OUN A;  2WOH A;  3LXU X;  1N9J A;  3BB9 A;  1BIR A;  1YJN 3;  3CCR 3;  4N6U A;  1IVU A;  4HBR A;  1BSE A;  1BSA A;  5AIH A;  1QMA A;  5CF2 A;  3I0Y A;  3D9R A;  1G0T A;  3OWS A;  1GSP A;  1RN4 A;  1DVD A;  5IEO A;  1A2K A;  3K7C A;  1Q81 4;  2HML B;  7GSP A;  1VQO 3;  3BU4 A;  3VGN A;  2YFL B;  4LGQ A;  3F9S A;  5LC7 A;  2CWV A; 
#chains in the Genus database with same CATH homology
 3JUP A;  3U1W A;  4STD A;  1VQ4 3;  1GS3 A;  4XDW A;  3CCM 3;  2CG0 A;  1JRQ A;  2WOF A;  4BTX A;  1W2B 2;  1M90 4;  1Z1S A;  3JUM A;  2JQ5 A;  2W2C A;  1JJ2 2;  3T0U A;  3G8Z A;  1OGZ A;  4XDV A;  2XRX B;  2OOV A;  3CCU 3;  1WTH A;  4HM3 B;  5D81 A;  4KVH A;  1YHQ 3;  3MG1 A;  3PZW A;  2Z77 A;  3IPT A;  1NO3 A;  3NX0 A;  3IMA B;  3MG2 A;  3JUO A;  4FMD A;  1JN5 B;  2WO0 A;  1UUV B;  3X40 A;  3CD6 3;  4EV2 A;  1ZO2 A;  1NB5 I;  1IQY A;  1DYU A;  3E99 A;  3PGB A;  2LYX A;  1QVF 2;  2XFT A;  3V98 A;  4EXR A;  3N9H A;  4HZB B;  3B4P A;  7STD A;  1IT8 A;  3DMC A;  1U5O A;  1FGR A;  2KXG A;  3EB8 A;  1JNQ A;  4I4K A;  4FMA A;  2A15 A;  4L8O A;  4Q53 A;  2PZV A;  3I56 3;  3CC2 3;  3S67 A;  3CNM A;  3BLZ A;  1GYB A;  3HK4 A;  4JF8 A;  1T5Y A;  4BTW A;  3WOD G;  2KCD A;  3CCE 3;  2OOV C;  1KQS 2;  4N6N B;  1QVG 2;  3NBR A;  1OHS A;  2OQE A;  1LNH A;  1QAL A;  3X3Z A;  1UI7 A;  3NM2 A;  3VF1 A;  4K1V A;  1CYV A;  4ORL A;  3FGY A;  3HI7 A;  3RDE A;  3CC7 3;  3EC9 A;  3LH4 A;  2QGU A;  4R9K A;  3T8U A;  2OWP A;  3FCS B;  3NBJ A;  4MEI A;  1JKG B;  4RZM A;  3STD A;  2GBX B;  3LT8 A;  4EC6 A;  3KFQ C;  2W56 B;  1WMN A;  2RCD A;  3G4S 3;  2P38 A;  3V99 A;  3B4O A;  1CQS A;  2UX0 A;  3CCV 3;  1JN5 A;  1TU5 A;  2W9Q A;  1W01 A;  1WMP A;  1AVL A;  4KFE A;  1O7W B;  1VQL 3;  2GEY A;  3PCR A;  1VQK 3;  1DMM A;  5AEU B;  1V74 A;  4CDL A;  1UUW B;  1DMQ A;  1NWW A;  3DM8 A;  4CCV A;  4J8T A;  1KWI A;  4RNZ A;  3EQQ B;  2HMM B;  4HM7 B;  3X3Y A;  3CC4 3;  4GB5 A;  1Q82 4;  1TP6 A;  1E3V A;  1Q40 B;  4FCM A;  1JV2 B;  4HM5 B;  3L0R A;  5JPP A;  4EYC A;  2CIU A;  1N5P A;  3NV0 B;  3KN4 A;  3MWZ A;  3OWY A;  2I9W A;  3KE7 A;  3V92 A;  3ECF A;  2OQE C;  3HII A;  1IQ8 A;  1W2Z A;  3EF8 A;  1VQ6 3;  1SPU A;  2B24 B;  2GEX A;  5AEW B;  3RGR A;  1FUW A;  1W5Z A;  3CMA 3;  3DGL A;  1EG9 B;  1AV4 A;  1J2B A;  3SVA A;  1IV7 A;  4LEH A;  1WNH A;  5D83 A;  3CME 3;  2W56 A;  4RNY A;  1YVB I;  4O2H A;  3CXC 2;  2CWT A;  4G1M B;  1A67 A;  1W6G A;  1US1 A;  1FGT A;  1F8N A;  3GRD A;  2CFD A;  3MPH A;  5DRE A;  3CPO A;  4OVM A;  2XGN A;  2D1W A;  1WQL B;  4X2H A;  1L5G B;  4HM4 B;  1STD A;  4AEQ A;  3S27 A;  2MF7 A;  4QWT A;  3D3L A;  3PXM A;  5AII A;  2Z6B A;  2Y73 A;  3I55 3;  3EX9 A;  1IU7 A;  1OF5 A;  1Q40 A;  1K73 4;  1GY5 A;  3N54 B;  3NV0 A;  1S5A A;  2KRT A;  4N6O B;  1E3R A;  3H51 A;  3WOF B;  1S72 3;  3CCQ 3;  1YGE A;  4O3V A;  1NDO B;  1WMO A;  2R4I A;  3MG3 A;  3MKI A;  3WA3 A;  3EBY A;  3MYT A;  4HM6 B;  3FZW A;  2RGQ A;  4EBG A;  1KSI A;  2XF3 A;  4KFD A;  3WDG B;  1D6Z A;  1ULI B;  3NQZ A;  4R9L A;  4EV5 A;  4XBY A;  8CHO A;  5IG4 A;  2W9P A;  3WOE B;  3FLJ A;  3LTB A;  4WHA A;  3BNB A;  2PNC A;  1TUH A;  1VQ8 3;  3HX8 A;  4XBX A;  3LYG A;  1JB2 A;  5CLK A;  3HIG A;  3HZP A;  5LC6 A;  2HMK B;  5JBS A;  5BVB A;  1RRL A;  1Q42 A;  3MHE A;  1UW1 A;  3G6E 3;  3GZY B;  1GD4 A;  2GXF A;  4H3U A;  2HMO B;  4N6T A;  3LZA A;  4TX4 A;  5AI1 A;  5ELU A;  3G71 3;  2P0M A;  4HZ9 B;  3CCS 3;  5STD A;  5AYR B;  3ALA A;  1N8R 4;  3J7Y d;  5IG3 A;  1ISK A;  5IEP A;  1M1K 4;  2ML5 A;  3UL6 A;  1ASK A;  2BHM A;  1TFO A;  4LZI A;  3UNL A;  2XR8 B;  3SOA A;  1LOX A;  1ROV A;  4AKY A;  3CNX A;  2W03 A;  5KP1 A;  3K0Z A;  3BNE A;  2O3O A;  1AR0 A;  3X41 A;  3FG4 A;  1JB5 A;  5JPU A;  1IVW A;  4NRE A;  1K28 A;  2YX9 A;  2CHC A;  4GL6 A;  3S29 A;  3VSY A;  3X42 A;  4N6V 0;  5AYS C;  5CXO A;  1IT7 A;  5IG0 A;  1SII A;  2CFL A;  3EN8 A;  2M7O A;  4KFF A;  1TIJ A;  1DVC A;  1Q7Y 4;  3AMO A;  3CU3 A;  1JB4 A;  4JRF A;  5IER A;  2OTL 3;  2YFJ B;  3EE1 A;  1O7H B;  4H61 A;  3BNC A;  1NJI 4;  3FH1 A;  2XSH B;  2GU3 A;  1OAC A;  3JUN A;  3GZR A;  3OX9 A;  4HKV B;  4MJD A;  2STD A;  2OCT A;  4HM0 B;  1OF5 B;  4NHF A;  1R4C A;  1OHP A;  2HMN B;  1GY6 A;  3UB1 A;  1EA2 A;  2YFI B;  1U8C B;  2FNQ A;  3IJE B;  3Q1C A;  2E2V A;  3GZB A;  4O8S A;  2JDI H;  3FF2 A;  1K41 A;  6STD A;  3B8L A;  1QAK A;  4FCJ A;  1O7N B;  3DGN A;  2XH9 A;  3GZX B;  3ROB A;  4KZ1 A;  4AKZ A;  4K90 B;  2XSO B;  1MNL A;  2QIY A;  5AIG A;  1IK3 A;  1ZX2 A;  1DMN A;  2XGL A;  1D6Y A;  1MOL A;  4IIA A;  2XFS A;  5IG5 A;  3UL5 A;  5IEN A;  3K5T A;  2BMQ B;  1RRH A;  2BMO B;  3QK9 A;  5FW5 A;  2CWU A;  4BTY A;  5CK6 A;  3Q90 A;  4XBT A;  1LXE A;  3LTA A;  1N9E A;  2QA4 3;  3F7X A;  2ZDJ A;  3F8X A;  4K61 A;  5BXQ A;  1IDP A;  1AVK A;  2OTJ 3;  3EN1 B;  3M8C A;  4FMB A;  2HMJ B;  4O02 B;  4WFO A;  4HM1 B;  4LMI A;  3NXJ A;  3SXX A;  1SIH A;  3H3H A;  3OXA A;  3KSP A;  3SLU A;  1CEW I;  1YI2 3;  1VQN 3;  2B1X B;  3NM7 A;  1LVN A;  2K54 A;  1VQP 3;  4R1K A;  1RJO A;  3PCS A;  2LQV A;  5ELJ A;  5HGR A;  3Q2P A;  1O7P B;  1YIT 3;  4IPB A;  4OUQ A;  2E2U A;  5FGO A;  5G2G A;  3SED A;  2BNG A;  3U97 A;  2BO9 B;  2FXT A;  3FF0 A;  4HYZ A;  1GD3 A;  2L4V A;  4PEJ A;  1G96 A;  1RN7 A;  1Y4K A;  2FGT A;  1STF I;  2F86 B;  3GAX A;  1O7M B;  4X2O A;  5I97 A;  1OH0 A;  3LT9 A;  2CG1 A;  2BMR B;  4N6M A;  3CPW 2;  3G16 A;  3O8Y A;  3AMO B;  2CH9 A;  1M1X B;  2C10 A;  2Y74 A;  2W6J H;  1YIJ 3;  3F7S A;  2RSX A;  5DRV A;  3S5C A;  2MC8 A;  3OW2 2;  1W6C A;  1FGQ A;  3DUK A;  2C11 A;  2CC3 A;  2Z7A A;  2WGQ A;  4K1U A;  3KZT A;  4WYK B;  3DGM A;  3GWR A;  1K8A 4;  3QRD A;  3PS8 A;  2IUK A;  4OK0 A;  2W0Q A;  3UJM A;  4LSO A;  1ULJ B;  3CCJ 3;  2Z76 A;  3G0K A;  1QJG A;  3T8N A;  2CKF B;  3LOY A;  5A0O B;  3OWU A;  1VQ5 3;  2P0X A;  2O9U X;  1QAF A;  4WP5 A;  2CFG A;  2INX A;  4L8P A;  3FSD A;  2Q07 A;  1VZZ A;  2W04 A;  1IV9 A;  3K9M C;  1W6Y A;  4HM8 B;  2CFK A;  3WA2 X;  3OV4 A;  4IT7 A;  1TFK A;  3DY5 A;  1OPY A;  3FG1 A;  4MMX B;  1NB3 I;  3K63 A;  1GY7 A;  4J9A A;  3FKA A;  4XB5 A;  1HU9 A;  2SBL A;  2IUJ A;  3CCL 3;  3DGO A;  3N8B A;  1SQW A;  3DXO A;  2ZL8 A;  3F14 A;  1E97 A;  2CFW A;  5D82 A;  2E2T A;  1VQM 3;  1OHO A;  2IMJ A;  1CYU A;  2P05 A;  5KP4 A;  1A90 A;  1SJW A;  2BT3 A;  1RKY A;  3F40 A;  4HM2 B;  4XM4 A;  4HJL B;  1ROA A;  3EBT A;  2K0M A;  3LML A;  4MMZ B;  3WMD A;  3NBB A;  4MMY B;  1EQK A;  3EHC A;  4R80 A;  4U13 A;  4WYK A;  3SX1 A;  1W4N A;  3TDG A;  3B7C A;  2F98 A;  1KD1 4;  1YJW 3;  1FGM A;  4HVN A;  3MSO A;  2XEP A;  3KKG A;  4R4K A;  1D6U A;  4ZM8 A;  3A76 A;  3LTC A;  4FCZ A;  1NU3 A;  3DZL A;  3NQY A;  3ER7 A;  3KII A;  5AIF A;  2F99 A;  2CK3 H;  4FMC A;  4FR9 A;  1M9G A;  3LTD A;  1IVV A;  2ML6 A;  1EKM A;  3S28 A;  2RFR A;  1A2V A;  4WWU C;  1YJ9 3;  1VQ9 3;  1IVX A;  3KSE D;  3NUV A;  5KP3 A;  1BUQ A;  5TGN A;  1PU4 A;  3NHX A;  1W7C A;  3RGA A;  1KC8 4;  2V1L A;  2WGO A;  1VQ7 3;  1W02 A;  1O7G B;  5IW9 A;  2GBW B;  2CW9 A;  4N3V A;  2D42 A;  5EQL A;  2QEX 3;  1OGX A;  2IA7 A;  2P09 A;  5CF1 A;  1UI8 A;  2GU1 A;  4RBN A;  3EJV A;  4N6L A;  1Q86 4;  1FA3 A;  3BND A;  3JVC A;  3F8H A;  5EEO A;  3X3X A;  1HKX A;  5IF6 A;  1C7H A;  1JKG A;  1N5H A;  3SOY A;  4L7K A;  1PFP A;  3PYJ A;  1OCV A;  1IQX A;  3JUQ A;  3FG3 A;  1W00 A;  1K9M 4;  1N8Q A;  1FGO A;  5EVH A;  1OUN A;  2WOH A;  3LXU X;  1N9J A;  3BB9 A;  1YJN 3;  3CCR 3;  4N6U A;  1IVU A;  4HBR A;  5AIH A;  1QMA A;  5CF2 A;  3I0Y A;  3D9R A;  3OWS A;  1DVD A;  5IEO A;  1A2K A;  3K7C A;  1Q81 4;  2HML B;  1VQO 3;  3VGN A;  2YFL B;  4LGQ A;  3F9S A;  5LC7 A;  2CWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...