2I9WA

Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
177
Chain Sequence
MLFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQAIRADTAEHLMRTRYSAFVLVKPEYIVKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVSMSVTQKQPCICGSGEKFKRCCGMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_265345.1) from Psychrobacter Arcticum 273-4 at 1.75 A resolution
rcsb
source organism Psychrobacter arcticus
total genus 39
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02810 SEC-C SEC-C motif
A PF17775 UPF0225 UPF0225 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2i9wA00
2R4IA 5EVHA 3GWRA 3DM8A 4LEHA 2HMJB 1O7PB 1O7HB 2F86B 3Q90A 4XBXA 2IMJA 4WYKA 1E97A 2BMOB 2CHCA 5IENA 5AIFA 1QJGA 3CU3A 3F8HA 2RCDA 1DMMA 4IIAA 4LGQA 5CK6A 2GEYA 4I4KA 3T8NA 4GB5A 1JN5B 3CPOA 3EN1B 1UUWB 4HM6B 1W6YA 5KP3A 3EQQB 3JUPA 3RGRA 1GS3A 4HKVB 1ASKA 5AEUB 3VSYA 2RGQA 2RFRA 3OWYA 4N3VA 4WYKB 5IG5A 3GZBA 3EC9A 1NU3A 2A15A 4H3UA 3BB9A 5CF2A 3HK4A 3SOAA 1ULIB 1GYBA 3F14A 3NUVA 4HVNA 3H51A 3KE7A 8CHOA 1DMQA 2YFIB 3B7CA 2GXFA 5IG0A 3NV0A 3G0KA 3GRDA 3VGNA 5KP4A 5D83A 4K1VA 3EF8A 1JB5A 3DZLA 3B8LA 4CDLA 4LMIA 3DXOA 5FW5A 5JPPA 5AI1A 1ULJB 5CLKA 1E3RA 4KVHA 1STDA 2XR8B 5KP1A 4WWUC 4J8TA 1OHOA 5BVBA 4L8OA 2XRXB 3WMDA 4FCMA 3GZYB 1JKGB 5IEPA 4HJLB 3JUMA 6STDA 1HKXA 2UX0A 3D9RA 4OVMA 2K54A 4R1KA 4HM4B 5BXQA 4U13A 2B24B 1OH0A 3SOYA 1Q40A 3NM2A 7STDA 1OPYA 1UUVB 4MJDA 4XM4A 1TP6A 2PZVA 3FGYA 5IEOA 3UJMA 3B4OA 5CXOA 4HM7B 4XDWA 3OX9A 5AIIA 2JQ5A 1S5AA 2CKFB 2Z7AA 3MG3A 3FF2A 2XSHB 3F7XA 2F99A 1DMNA 3GZXB 4FCJA 2Z77A 1K41A 3KKGA 3T8UA 5CF1A 4R9KA 2OWPA 5JPUA 3NBRA 3EBTA 3ROBA 4HM1B 1E3VA 3JUQA 5D81A 1EG9B 3H3HA 2HMLB 5IG4A 3FLJA 3CNXA 3MG2A 3SEDA 4HM2B 3IPTA 3LZAA 1JB4A 4L7KA 5STDA 1AR0A 4X2HA 1NDOB 1IDPA 3EBYA 4HZ9B 4HM0B 3FZWA 1WQLB 3RGAA 3BLZA 3A76A 2INXA 3OWSA 1W01A 4HZBB 3MKIA 4OUQA 4STDA 4ORLA 3NXJA 1TUHA 3MSOA 5IERA 1GY5A 1C7HA 2HMNB 3NV0B 3JUNA 3G16A 1SJWA 2QIYA 1ISKA 4XBYA 3EX9A 1Q42A 5DRVA 3LYGA 1QMAA 1ZX2A 2HMOB 3F8XA 5IF6A 3FKAA 1JN5A 3KZTA 1A2KA 3K0ZA 3HZPA 3JUOA 3NHXA 1OF5A 4Q53A 1U5OA 5HGRA 3K7CA 1GY7A 3OXAA 3CNMA 3MHEA 3DUKA 4RZMA 5DREA 5AIHA 2GBWB 3FF0A 2BNGA 1W00A 4K1UA 4HM3B 3OV4A 3UNLA 1OHPA 3I0YA 5AEWB 1O7NB 1VZZA 1OGXA 2STDA 1O7GB 3ER7A 4PEJA 1O7MB 4XB5A 3M8CA 3FSDA 1Q40B 4XBTA 1OF5B 2HMMB 3F9SA 3DMCA 1OUNA 5G2GA 3E99A 3KSPA 1NWWA 1CQSA 5D82A 3F7SA 4J9AA 3STDA 2YFJB 3S5CA 4X2OA 3MYTA 4WP5A 2F98A 2Z76A 1OGZA 1EA2A 2QGUA 5AIGA 2W2CA 3EHCA 1O7WB 2GBXB 1JKGA 3EJVA 2I9WA 3OWUA 2B1XB 4XDVA 3B4PA 1OCVA 1GY6A 3EN8A 3FH1A 3F40A 2BMRB 2XSOB 3HX8A 3GZRA 1ZO2A 3G8ZA 3ECFA 1OHSA 1JB2A 4R9LA 1Z1SA 5TGNA 1BUQA 4HM5B 3MG1A 5IG3A 2GEXA 4HM8B 2HMKB 2YFLB 2BMQB 1W02A 4L8PA
chains in the Genus database with same CATH superfamily
3NBBA 1R4YA 1S723 1ROVA 2FNQA 4K90B 4LSOA 1I8VA 2OQEC 2R4IA 5EVHA 2CIUA 1X1XA 4I5QA 5EQLA 1IVXA 2ML6A 3GWRA 3DM8A 5LC7A 1B2SA 4LEHA 4QWTA 1VQ43 1A90A 3DGNA 3KSED 3AGOA 2HMJB 1O7PB 1EQKA 4IPBA 3CC73 1O7HB 1IT8A 2F86B 2RBIA 2KF3A 3Q90A 4XBXA 7GSPA 1RSNA 4EV2A 2IMJA 4WYKA 2K3DA 1E97A 2BMOB 1L5GB 2CC3A 2CHCA 1IU7A 2P05A 1FUTA 2CWTA 1UGIA 5AIFA 5IENA 4G1MB 4BU4A 1NO3A 1QJGA 2FXTA 3CU3A 3F8HA 1CYVA 3PS8A 1GOUA 1LQMB 1LOXA 1DMMA 2H0HA 2RCDA 2Q07A 3D4AA 4IIAA 4LGQA 5CK6A 3U1WA 1G0TA 4BL3A 1VQ53 5EEOA 2GEYA 3LTAA 5BIRA 5RNTA 2F56A 3IJEB 4I4KA 1GOVA 3FG3A 1YI23 3T8NA 1AVLA 1KWIA 1W6CA 1JN5B 1LVNA 2WGOA 3CPOA 4GB5A 1VQ93 3EN1B 1UUWB 2JDIH 4JRFA 5M18A 4HM6B 1W6YA 3D3LA 4HYZA 3LTCA 2W0QA 5KP3A 1I2GA 2OCTA 3EQQB 3JUPA 3RGRA 3OW22 1GS3A 1TIJA 4BL2A 1QALA 2IY2A 4HKVB 1B21A 4MEIA 5G1KA 3S67A 1R4CA 1ASKA 2WOFA 2IUJA 3VSYA 5AEUB 2RGQA 2RFRA 4KT3B 1W2B2 3OWYA 3K9MC 4N3VA 4WYKB 5IG5A 3QK9A 1VQN3 3GZBA 3EC9A 2IYJA 1NU3A 2A15A 1HYFA 4JF8A 1RNBA 1BRKA 4HAAA 6RNTA 2RSXA 2E2UA 3N8BA 4KFEA 4H3UA 4N6LA 1K9M4 2M7OA 2UGIA 1TRQA 2BT3A 3BB9A 1N9JA 5ELJA 5CF2A 4FMCA 3HK4A 4H61A 3SOAA 1SARA 1ULIB 2GU1A 1GYBA 3CCS3 4AKZA 3F14A 4N6TA 1BRIA 2W03A 2CFLA 3NUVA 4HVNA 4AEQA 1WMPA 1EUIC 2BHMA 1DVDA 1JBSA 1YHQ3 3H51A 2OTL3 5HOHA 3KE7A 1NB5I 8CHOA 3T0UA 1BIRA 2CH9A 1DMQA 2YFIB 3B7CA 1FW7A 1PFPA 5IG4A 1Y4KA 3PXMA 3K63A 2GXFA 2WGQA 5IG0A 4L8PA 3NV0A 3X40A 1FA3A 1WNHA 3G0KA 3EE1A 3GRDA 3VGNA 3HOHA 5KP4A 3SYUA 3HIGA 1LNHA 5D83A 1TFKA 3EF8A 4K1VA 3CMA3 4WFOA 3D79A 3HI7A 1BRSA 3WOEB 1JV2B 2CK3H 4WHAA 1RN1A 4NREA 1PU4A 1JB5A 3DZLA 1AY7A 3B8LA 4FMDA 1FGOA 4RNYA 4CDLA 2MC8A 4LMIA 2Y73A 3DXOA 3KCHA 1I3FA 1W6GA 5FW5A 5AI1A 3ZG5A 5JPPA 1ULJB 5CLKA 1E3RA 1GMQA 4KVHA 1STDA 2XR8B 3UL5A 5KP1A 1DVCA 1EEJA 4CJNA 4WWUC 4J8TA 1OHOA 1EKMA 2LQVA 3KN4A 2BU4A 5BVBA 4L8OA 3KFQC 2XEPA 2XRXB 1IQXA 3WMDA 4FCMA 2KRTA 1YVBI 3GZYB 4HOHA 3VF1A 2OQEA 1W4NA 4FMBA 1RGAA 2OTJ3 1QVF2 1UW1A 4ILFA 4LYLB 1JKGB 5IEPA 3CCR3 4HJLB 3JUMA 4J5KA 3FCSB 4DKIA 6STDA 3WA2X 1HKXA 2UX0A 4N6UA 3AMOB 1BRGA 3D9RA 1RJOA 1BNJA 1TRPA 4OVMA 4KFFA 2K54A 3PZWA 1TJDA 4R1KA 4HM4B 1ZGXA 1AVKA 4RBNA 3X42A 1A2VA 5BXQA 2K0MA 4U13A 2XFSA 3N9HA 1B2XA 1BRNL 3CCJ3 1BNIA 2L4VA 1RKYA 2F4YA 1BNGA 2B24B 2P38A 3DY5A 2Y74A 1I2FA 1B2MA 1LQGC 1W5ZA 3SLUA 1OH0A 3SOYA 2CW9A 2P0MA 4IT7A 4O3VA 1YJN3 1Q7HA 5BU4A 3LOYA 1Q7Y4 1Q40A 3NM2A 7STDA 1N5HA 3ZFZA 1AQZA 1LOWA 2GU3A 1VQQA 1WTHA 2W56B 2CFGA 1GMPA 1RRLA 1OPYA 3SXXA 2MF7A 1X1YA 1UUVB 1JZDA 4EYCA 4MJDA 1SIIA 4MMXB 3S29A 1PY3A 1RGGA 4XM4A 4OK0A 1TP6A 1PYLA 2PZVA 1D6YA 1K28A 1RN7A 3BU4A 3FGYA 2O9UX 5IEOA 3O8YA 3UJMA 3AGNA 5CXOA 4HM7B 8RNTA 4XDWA 1IYYA 1B20A 3J7Yd 3OX9A 1SIHA 5ELUA 3SVAA 2ZL8A 3Q2PA 2H0GA 1YGEA 2JQ5A 5AIIA 1JBTA 1S5AA 2CKFB 1K8A4 2Z7AA 7RNTA 1BANA 1DYUA 1STFI 2KF5A 3MG3A 4O2HA 3CXC2 3FF2A 3NM7A 3CCQ3 3HIIA 2ML5A 2XSHB 3F7XA 1BSEA 1YVSA 3G4S3 2KF4A 1FUWA 1IT7A 1I70A 1RHLA 2C10A 2F99A 2CFKA 4BTXA 1JBRA 1DMNA 2HOHA 2E2TA 3GZXB 3L0RA 4FCJA 4MMYB 4KFDA 2Z77A 1K41A 2XFTA 1VQO3 3KKGA 3CC23 1BSCA 4FCZA 5STDA 1FGRA 3T8UA 1ZS7A 5CF1A 1UCKA 4R9KA 2OWPA 1QAKA 4N6NB 3CD63 4EC6A 5JPUA 2QA43 3GSPA 4K61A 1NB3I 1LOVA 4LZIA 3FG1A 3LMLA 3X3XA 3NBRA 1RGHA 3EBTA 3ROBA 3A5EA 5M1AA 4HM1B 1E3VA 3JUQA 5D81A 1SPUA 4KZ1A 1EG9B 1LOYA 1RGCA 3H3HA 1NNVA 2C4BA 2HMLB 1W7CA 9RNTA 1QAFA 2O3OA 2CFWA 1FUSA 2OOVC 3FLJA 4ZM8A 3BNDA 1VQM3 4NHFA 1DETA 3CNXA 3MG2A 1G96A 2IUKA 1QVG2 4MMZB 3SEDA 3V99A 1YIT3 2L1SA 4HM2B 3IPTA 1B3SA 1JB4A 3LZAA 2XGNA 3NX0A 4L7KA 1BSBA 1AR0A 3D5IA 3WA3A 4X2HA 1VQ63 2RNTA 3TDGA 1NDOB 1IDPA 3EBYA 1JNQA 2ZA4A 2SARA 4HZ9B 5AYRB 4GSPA 5G1LA 4HM0B 3FZWA 1WQLB 2CWUA 1MWRA 3RGAA 2QEX3 2D1WA 1VQ73 4TX4A 3PGBA 5GSPA 3BLZA 1NJI4 3A76A 2F5MA 2INXA 1W01A 3OWSA 4HZBB 3WHOA 3JVCA 3UB1A 3PCRA 5JBSA 1I3IA 5IW9A 3G713 3CC43 3MKIA 4OUQA 2W9QA 4STDA 1K734 4RNZA 4ORLA 3NXJA 1T2IA 1FGMA 3Q3FA 3WDGB 2XF3A 1UDII 1YIJ3 2CG1A 4N6MA 3EB8A 1N5PA 1TUHA 3MSOA 5IERA 3GAXA 5LC6A 1GY5A 1IQYA 1GD4A 1UCIA 3X3YA 1C7HA 2HMNB 3CCV3 3NV0B 1M1K4 1VQ83 3JUNA 5FGOA 3X3ZA 1LXEA 3AHWA 3PYJA 4HBRA 3G16A 1SJWA 1RLSA 2QIYA 1GMRA 3S28A 1T5YA 1ISKA 4XBYA 4GHOA 3MPHA 3LTBA 2W04A 3EX9A 1Q42A 3I553 1BSAA 1UCJA 1DE3A 5DRVA 3LYGA 1QMAA 1WMOA 1FYSA 2KXGA 3RNTA 1ZX2A 4O02B 1HU9A 2HMOB 3DGOA 3F8XA 5IF6A 1YJW3 3X41A 1MOLA 1SQWA 3BNCA 3FKAA 3DH2A 1JN5A 3KZTA 1IVUA 1MWTA 4EW5A 4EBGA 3NQYA 1A2KA 3K0ZA 3S27A 3HZPA 1RGEA 3JUOA 1N8QA 3NHXA 1OF5A 1BGSA 4Q53A 1U5OA 3DGLA 3D5GA 5HGRA 3G6E3 1KQS2 1J2BA 2ZDJA 4GL6A 3K7CA 1GY7A 2H0IA 3OXAA 1V58A 4EV5A 1RNTA 2CFDA 1RGLA 1B2UA 1BAOA 1RN4A 3CNMA 2LYXA 3MHEA 1M9GA 3DUKA 4RZMA 5DREA 3LH4A 3WODG 2P0XA 5AIHA 3SX1A 1BVIA 1RDSA 2GBWB 3IMAB 3FF0A 2UUGC 2BNGA 3DGYA 1W00A 4K1UA 2R41A 4O8SA 4BTWA 4R80A 1CEWI 1D6ZA 1BNFA 3OV4A 1MWSA 4HM3B 3UNLA 3ZG0A 4NPBA 1OHPA 2ZHXB 3I0YA 5AEWB 1O7NB 1RCLA 1Q9EA 1VZZA 1JZOA 2J8XB 3LT9A 1OGXA 1Q814 2STDA 1KC84 1O7GB 1I0XA 1M904 3LT8A 3ER7A 4PEJA 1O7MB 4XB5A 2C11A 1ROAA 3M8CA 1C54A 1JJ22 3FSDA 1Q40B 1JRQA 4XBTA 1OF5B 2CWVA 2HMMB 3F9SA 1MNLA 1WMNA 3DMCA 1KSIA 5M19A 1OUNA 5G2GA 1US1A 2WO0A 3E99A 1KD14 4N6OB 1W2ZA 1BNRA 1BOXA 1BSDA 1BNEA 1F8NA 1RCKA 2BIRA 3KSPA 2OOVA 3CCM3 1V57A 3CCU3 1BRHA 1T2HA 1NWWA 1Q864 1RGFA 2CX0A 1CQSA 6GSPA 1A67A 5D82A 3F7SA 4J9AA 1UI7A 1IV7A 1RRHA 3FG4A 3DGMA 3STDA 2YFJB 1G02A 1IVVA 2CX1A 3BNBA 3S5CA 4X2OA 3U97A 1N8R4 3MYTA 4WP5A 2F98A 1V74A 1MGRA 1T3BA 1TU5A 3WR2A 1I2EA 1GD3A 1VQK3 3QRDA 3UL6A 4AKYA 1BUJA 3V92A 2Z6BA 1BRJA 1X1UA 3BIRA 1RTUA 3K5TA 1FGQA 1M1XB 1IQ8A 1YNVX 2P09A 3URPA 2Z76A 3CME3 1VQL3 3LXUX 1OGZA 1EA2A 1IV9A 1TFOA 2QGUA 2XH9A 3NQZA 5AIGA 4R4KA 4J5GA 2W2CA 3Q1CA 4N6V0 1OACA 1IVWA 2V1LA 3EHCA 4FMAA 4BIRA 1O7WB 2GBXB 1AV4A 2GSPA 2SBLA 1HZ1A 2W6JH 3PCSA 3V98A 5A0OB 1VQP3 3LTDA 1MWUA 1CH0A 1JKGA 2YX9A 1B2ZA 3ALAA 3EJVA 3BNEA 1MGWA 2I9WA 1FGTA 2WOHA 3CCE3 3AMOA 2W9PA 2KF6A 1B27A 2E2VA 2D42A 3OWUA 2KAAA 2B1XB 4FR9A 4XDVA 2CG0A 3B4PA 1LNIA 1CYUA 1OCVA 1GY6A 3EN8A 4RNTA 1N9EA 1UCLA 3KIIA 3FH1A 1IK3A 1D6UA 3F40A 3N54B 2AAEA 2BMRB 3WOFB 3I563 3CPW2 3MWZA 4CPKA 1I0VA 2XSOB 1FZUA 3CCL3 1GOYA 3HX8A 2PNCA 4EXRA 1A2PA 1RMSA 2XGLA 1U8CB 2F5WA 3GZRA 1BU4A 1ZO2A 4CCVA 3RDEA 3G8ZA 1Q824 1GSPA 3ECFA 1X1WA 1OHSA 1JB2A 1YGWA 4R9LA 1UUGB 5AYSC 1Z1SA 2W56A 2FGTA 3NBJA 5TGNA 1LRAA 5I97A 1BUQA 4HM5B 1UI8A 1BNSA 2IA7A 4BTYA 3MG1A 5IG3A 1TTOA 2GEXA 3AHSA 4HM8B 1YJ93 2HMKB 2YFLB 2BMQB 2BO9B 2KCDA 1W02A 1UGHI 2AADA 3B4OA 1RGKA
chains in the Genus database with same CATH topology
3NBBA 1S723 1ROVA 2FNQA 4K90B 4LSOA 2OQEC 2R4IA 5EVHA 2CIUA 5EQLA 1IVXA 2ML6A 3GWRA 3DM8A 5LC7A 1VQ43 4LEHA 4QWTA 1A90A 3DGNA 3KSED 1EQKA 2HMJB 1O7PB 4IPBA 3CC73 1O7HB 1IT8A 2F86B 3Q90A 4XBXA 4EV2A 2IMJA 4WYKA 1E97A 2BMOB 1L5GB 2CC3A 2CHCA 1IU7A 2P05A 2CWTA 5AIFA 5IENA 4G1MB 1NO3A 1QJGA 2FXTA 3CU3A 3F8HA 1CYVA 3PS8A 1LOXA 1DMMA 2RCDA 4IIAA 2Q07A 4LGQA 5CK6A 3U1WA 3CME3 1VQ53 5EEOA 2GEYA 3LTAA 3IJEB 4I4KA 1YI23 3FG3A 3T8NA 1AVLA 1KWIA 1W6CA 1JN5B 1LVNA 2WGOA 3CPOA 4GB5A 1VQ93 3EN1B 1UUWB 2JDIH 4JRFA 4HM6B 1W6YA 3D3LA 4HYZA 3LTCA 2W0QA 5KP3A 2OCTA 3EQQB 3JUPA 3RGRA 3OW22 1GS3A 1TIJA 1QALA 4HKVB 4MEIA 3S67A 1R4CA 1ASKA 2WOFA 2IUJA 3VSYA 5AEUB 2RGQA 2RFRA 1W2B2 3OWYA 3K9MC 4N3VA 4WYKB 5IG5A 3QK9A 1VQN3 3GZBA 3EC9A 1NU3A 2A15A 4JF8A 2RSXA 2E2UA 3N8BA 4KFEA 4H3UA 4N6LA 1K9M4 2M7OA 3BB9A 2BT3A 5CF2A 5ELJA 1N9JA 4FMCA 3HK4A 4H61A 3SOAA 1ULIB 2GU1A 1GYBA 3CCS3 4AKZA 3F14A 4N6TA 2W03A 2CFLA 3NUVA 4HVNA 4AEQA 1WMPA 2BHMA 1DVDA 1YHQ3 3H51A 2OTL3 3KE7A 1NB5I 8CHOA 3T0UA 2CH9A 1DMQA 2YFIB 3B7CA 1PFPA 1Y4KA 3PXMA 3K63A 2GXFA 2WGQA 5IG0A 4L8PA 3NV0A 3X40A 1FA3A 1WNHA 3G0KA 3EE1A 3GRDA 3VGNA 5KP4A 3HIGA 1LNHA 5D83A 1TFKA 3EF8A 4K1VA 3CMA3 4WFOA 3HI7A 3WOEB 1JV2B 2CK3H 4WHAA 4NREA 1PU4A 1JB5A 3DZLA 3B8LA 4FMDA 1FGOA 4RNYA 4CDLA 2MC8A 4LMIA 2Y73A 3DXOA 1W6GA 5FW5A 5JPPA 5AI1A 1ULJB 5CLKA 1E3RA 4KVHA 1STDA 2XR8B 3UL5A 5KP1A 1DVCA 4WWUC 4J8TA 1OHOA 1EKMA 2LQVA 3KN4A 5BVBA 4L8OA 3KFQC 2XEPA 2XRXB 1IQXA 3WMDA 4FCMA 2KRTA 1YVBI 3GZYB 3VF1A 2OQEA 1W4NA 4FMBA 2OTJ3 1QVF2 1UW1A 1JKGB 5IEPA 3CCR3 4HJLB 3JUMA 3FCSB 6STDA 3WA2X 1HKXA 2UX0A 4N6UA 3AMOB 3D9RA 1RJOA 4OVMA 4KFFA 2K54A 3PZWA 4R1KA 4HM4B 3X42A 1AVKA 4RBNA 1A2VA 5BXQA 2K0MA 4U13A 2XFSA 3N9HA 3CCJ3 1RKYA 2L4VA 2B24B 2P38A 3DY5A 2Y74A 1W5ZA 3SLUA 1OH0A 3SOYA 2CW9A 2P0MA 4IT7A 4O3VA 1YJN3 3LOYA 1Q7Y4 1Q40A 3NM2A 7STDA 1N5HA 2GU3A 1WTHA 2W56B 2CFGA 3SXXA 1RRLA 1OPYA 2MF7A 1UUVB 4EYCA 4MJDA 1SIIA 4MMXB 3S29A 4XM4A 4OK0A 1TP6A 2PZVA 1D6YA 1K28A 1RN7A 3FGYA 2O9UX 5IEOA 3O8YA 3UJMA 5CXOA 4HM7B 4XDWA 3J7Yd 3OX9A 1SIHA 5ELUA 3SVAA 2ZL8A 3Q2PA 2JQ5A 1YGEA 5AIIA 1S5AA 2CKFB 1K8A4 2Z7AA 1DYUA 1STFI 3MG3A 4O2HA 3CXC2 3FF2A 3NM7A 3CCQ3 3HIIA 2ML5A 2XSHB 3F7XA 3G4S3 1FUWA 1IT7A 2C10A 2F99A 2CFKA 4BTXA 1DMNA 2E2TA 3GZXB 3L0RA 4FCJA 4MMYB 4KFDA 2Z77A 1K41A 2XFTA 1VQO3 3KKGA 3CC23 4FCZA 1FGRA 3T8UA 5CF1A 4R9KA 2OWPA 1QAKA 4N6NB 3CD63 4EC6A 5JPUA 2QA43 4K61A 1NB3I 4LZIA 3FG1A 3LMLA 3X3XA 3NBRA 3EBTA 3ROBA 4HM1B 1E3VA 3JUQA 5D81A 1SPUA 4KZ1A 1EG9B 3H3HA 2HMLB 1W7CA 5IG4A 1QAFA 2O3OA 2CFWA 2OOVC 3FLJA 4ZM8A 1VQM3 3BNDA 4NHFA 3CNXA 1QVG2 3MG2A 1G96A 2IUKA 4MMZB 3SEDA 3V99A 1YIT3 4HM2B 3IPTA 3LZAA 1JB4A 3NX0A 2XGNA 4L7KA 5STDA 3WA3A 1AR0A 4X2HA 1VQ63 3TDGA 1NDOB 1IDPA 3EBYA 1JNQA 4HZ9B 5AYRB 4HM0B 3FZWA 1WQLB 2CWUA 3RGAA 2QEX3 2D1WA 1VQ73 4TX4A 3PGBA 3BLZA 1NJI4 3A76A 2INXA 3OWSA 1W01A 4HZBB 3JVCA 3UB1A 3PCRA 5JBSA 5IW9A 3G713 3CC43 3MKIA 4OUQA 2W9QA 4STDA 1K734 4RNZA 4ORLA 3NXJA 1FGMA 3WDGB 2XF3A 1YIJ3 2CG1A 4N6MA 3EB8A 1N5PA 1TUHA 3MSOA 5IERA 3GAXA 5LC6A 1GY5A 1IQYA 1GD4A 3CCV3 3X3YA 1C7HA 2HMNB 1M1K4 3NV0B 1VQ83 3JUNA 5FGOA 3X3ZA 1LXEA 3PYJA 4HBRA 3G16A 1SJWA 2QIYA 3S28A 1T5YA 1ISKA 4XBYA 3MPHA 3LTBA 2W04A 3EX9A 1Q42A 3I553 5DRVA 3LYGA 1QMAA 1WMOA 2KXGA 1ZX2A 4O02B 2HMOB 3DGOA 3F8XA 5IF6A 1YJW3 3X41A 1MOLA 1SQWA 3BNCA 3FKAA 1JN5A 3KZTA 1IVUA 4EBGA 3NQYA 1A2KA 3K0ZA 3S27A 3HZPA 3JUOA 1N8QA 3NHXA 1OF5A 4Q53A 1U5OA 3DGLA 5HGRA 3G6E3 1KQS2 1J2BA 2ZDJA 4GL6A 3K7CA 1GY7A 3OXAA 4EV5A 2CFDA 3CNMA 2LYXA 3MHEA 1M9GA 3DUKA 4RZMA 5DREA 3LH4A 3WODG 2P0XA 5AIHA 3SX1A 2GBWB 3IMAB 3FF0A 2BNGA 4O8SA 1W00A 4K1UA 4BTWA 4R80A 1CEWI 1D6ZA 3OV4A 4HM3B 3UNLA 1OHPA 3I0YA 5AEWB 1O7NB 1VZZA 1KC84 3LT9A 1OGXA 1Q814 2STDA 1M904 1O7GB 3LT8A 3ER7A 4PEJA 1O7MB 4XB5A 2C11A 1ROAA 3M8CA 1JJ22 3FSDA 1Q40B 1JRQA 4XBTA 1OF5B 2CWVA 2HMMB 3F9SA 1MNLA 1WMNA 3DMCA 1KSIA 1OUNA 5G2GA 1US1A 2WO0A 3E99A 1KD14 4N6OB 1W2ZA 1F8NA 3KSPA 3CCM3 2OOVA 3CCU3 1NWWA 1Q864 1A67A 1CQSA 5D82A 3F7SA 4J9AA 1UI7A 1IV7A 1RRHA 3FG4A 3DGMA 3STDA 2YFJB 3BNBA 1IVVA 3S5CA 4X2OA 3U97A 1N8R4 3MYTA 4WP5A 2F98A 1V74A 1TU5A 1VQK3 1GD3A 3QRDA 3UL6A 4AKYA 3V92A 2Z6BA 3K5TA 1FGQA 1M1XB 1IQ8A 2P09A 2Z76A 1VQL3 3LXUX 1OGZA 1EA2A 1IV9A 1TFOA 2QGUA 2XH9A 3NQZA 5AIGA 4R4KA 2W2CA 3Q1CA 4N6V0 1OACA 1IVWA 2V1LA 3EHCA 4FMAA 1O7WB 2GBXB 1AV4A 2SBLA 2W6JH 3PCSA 3V98A 5A0OB 1VQP3 3LTDA 1JKGA 2YX9A 3ALAA 3EJVA 3BNEA 2WOHA 2I9WA 1FGTA 3CCE3 3AMOA 2W9PA 2E2VA 2D42A 3OWUA 4FR9A 2B1XB 4XDVA 2CG0A 3B4PA 1CYUA 1OCVA 1GY6A 3EN8A 1N9EA 3KIIA 3FH1A 1IK3A 1D6UA 3F40A 3N54B 2BMRB 3WOFB 3I563 3CPW2 3MWZA 2XSOB 3CCL3 3HX8A 2PNCA 4EXRA 2XGLA 1U8CB 3GZRA 1ZO2A 4CCVA 3RDEA 3G8ZA 1Q824 3ECFA 1OHSA 1JB2A 4R9LA 5AYSC 1Z1SA 2W56A 2FGTA 3NBJA 5TGNA 5I97A 1BUQA 4HM5B 1UI8A 2IA7A 4BTYA 3MG1A 5IG3A 2GEXA 4HM8B 1YJ93 2HMKB 2YFLB 2BMQB 2BO9B 2KCDA 1W02A 3B4OA 1HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4I A;  5EVH A;  3GWR A;  3DM8 A;  4LEH A;  2HMJ B;  1O7P B;  1O7H B;  2F86 B;  3Q90 A;  4XBX A;  2IMJ A;  4WYK A;  1E97 A;  2BMO B;  2CHC A;  5IEN A;  5AIF A;  1QJG A;  3CU3 A;  3F8H A;  2RCD A;  1DMM A;  4IIA A;  4LGQ A;  5CK6 A;  2GEY A;  4I4K A;  3T8N A;  4GB5 A;  1JN5 B;  3CPO A;  3EN1 B;  1UUW B;  4HM6 B;  1W6Y A;  5KP3 A;  3EQQ B;  3JUP A;  3RGR A;  1GS3 A;  4HKV B;  1ASK A;  5AEU B;  3VSY A;  2RGQ A;  2RFR A;  3OWY A;  4N3V A;  4WYK B;  5IG5 A;  3GZB A;  3EC9 A;  1NU3 A;  2A15 A;  4H3U A;  3BB9 A;  5CF2 A;  3HK4 A;  3SOA A;  1ULI B;  1GYB A;  3F14 A;  3NUV A;  4HVN A;  3H51 A;  3KE7 A;  8CHO A;  1DMQ A;  2YFI B;  3B7C A;  2GXF A;  5IG0 A;  3NV0 A;  3G0K A;  3GRD A;  3VGN A;  5KP4 A;  5D83 A;  4K1V A;  3EF8 A;  1JB5 A;  3DZL A;  3B8L A;  4CDL A;  4LMI A;  3DXO A;  5FW5 A;  5JPP A;  5AI1 A;  1ULJ B;  5CLK A;  1E3R A;  4KVH A;  1STD A;  2XR8 B;  5KP1 A;  4WWU C;  4J8T A;  1OHO A;  5BVB A;  4L8O A;  2XRX B;  3WMD A;  4FCM A;  3GZY B;  1JKG B;  5IEP A;  4HJL B;  3JUM A;  6STD A;  1HKX A;  2UX0 A;  3D9R A;  4OVM A;  2K54 A;  4R1K A;  4HM4 B;  5BXQ A;  4U13 A;  2B24 B;  1OH0 A;  3SOY A;  1Q40 A;  3NM2 A;  7STD A;  1OPY A;  1UUV B;  4MJD A;  4XM4 A;  1TP6 A;  2PZV A;  3FGY A;  5IEO A;  3UJM A;  3B4O A;  5CXO A;  4HM7 B;  4XDW A;  3OX9 A;  5AII A;  2JQ5 A;  1S5A A;  2CKF B;  2Z7A A;  3MG3 A;  3FF2 A;  2XSH B;  3F7X A;  2F99 A;  1DMN A;  3GZX B;  4FCJ A;  2Z77 A;  1K41 A;  3KKG A;  3T8U A;  5CF1 A;  4R9K A;  2OWP A;  5JPU A;  3NBR A;  3EBT A;  3ROB A;  4HM1 B;  1E3V A;  3JUQ A;  5D81 A;  1EG9 B;  3H3H A;  2HML B;  5IG4 A;  3FLJ A;  3CNX A;  3MG2 A;  3SED A;  4HM2 B;  3IPT A;  3LZA A;  1JB4 A;  4L7K A;  5STD A;  1AR0 A;  4X2H A;  1NDO B;  1IDP A;  3EBY A;  4HZ9 B;  4HM0 B;  3FZW A;  1WQL B;  3RGA A;  3BLZ A;  3A76 A;  2INX A;  3OWS A;  1W01 A;  4HZB B;  3MKI A;  4OUQ A;  4STD A;  4ORL A;  3NXJ A;  1TUH A;  3MSO A;  5IER A;  1GY5 A;  1C7H A;  2HMN B;  3NV0 B;  3JUN A;  3G16 A;  1SJW A;  2QIY A;  1ISK A;  4XBY A;  3EX9 A;  1Q42 A;  5DRV A;  3LYG A;  1QMA A;  1ZX2 A;  2HMO B;  3F8X A;  5IF6 A;  3FKA A;  1JN5 A;  3KZT A;  1A2K A;  3K0Z A;  3HZP A;  3JUO A;  3NHX A;  1OF5 A;  4Q53 A;  1U5O A;  5HGR A;  3K7C A;  1GY7 A;  3OXA A;  3CNM A;  3MHE A;  3DUK A;  4RZM A;  5DRE A;  5AIH A;  2GBW B;  3FF0 A;  2BNG A;  1W00 A;  4K1U A;  4HM3 B;  3OV4 A;  3UNL A;  1OHP A;  3I0Y A;  5AEW B;  1O7N B;  1VZZ A;  1OGX A;  2STD A;  1O7G B;  3ER7 A;  4PEJ A;  1O7M B;  4XB5 A;  3M8C A;  3FSD A;  1Q40 B;  4XBT A;  1OF5 B;  2HMM B;  3F9S A;  3DMC A;  1OUN A;  5G2G A;  3E99 A;  3KSP A;  1NWW A;  1CQS A;  5D82 A;  3F7S A;  4J9A A;  3STD A;  2YFJ B;  3S5C A;  4X2O A;  3MYT A;  4WP5 A;  2F98 A;  2Z76 A;  1OGZ A;  1EA2 A;  2QGU A;  5AIG A;  2W2C A;  3EHC A;  1O7W B;  2GBX B;  1JKG A;  3EJV A;  2I9W A;  3OWU A;  2B1X B;  4XDV A;  3B4P A;  1OCV A;  1GY6 A;  3EN8 A;  3FH1 A;  3F40 A;  2BMR B;  2XSO B;  3HX8 A;  3GZR A;  1ZO2 A;  3G8Z A;  3ECF A;  1OHS A;  1JB2 A;  4R9L A;  1Z1S A;  5TGN A;  1BUQ A;  4HM5 B;  3MG1 A;  5IG3 A;  2GEX A;  4HM8 B;  2HMK B;  2YFL B;  2BMQ B;  1W02 A;  4L8P A; 
#chains in the Genus database with same CATH topology
 3NBB A;  1R4Y A;  1S72 3;  1ROV A;  2FNQ A;  4K90 B;  4LSO A;  1I8V A;  2OQE C;  2R4I A;  5EVH A;  2CIU A;  1X1X A;  4I5Q A;  5EQL A;  1IVX A;  2ML6 A;  3GWR A;  3DM8 A;  5LC7 A;  1B2S A;  4LEH A;  4QWT A;  1VQ4 3;  1A90 A;  3DGN A;  3KSE D;  3AGO A;  2HMJ B;  1O7P B;  1EQK A;  4IPB A;  3CC7 3;  1O7H B;  1IT8 A;  2F86 B;  2RBI A;  2KF3 A;  3Q90 A;  4XBX A;  7GSP A;  1RSN A;  4EV2 A;  2IMJ A;  4WYK A;  2K3D A;  1E97 A;  2BMO B;  1L5G B;  2CC3 A;  2CHC A;  1IU7 A;  2P05 A;  1FUT A;  2CWT A;  1UGI A;  5AIF A;  5IEN A;  4G1M B;  4BU4 A;  1NO3 A;  1QJG A;  2FXT A;  3CU3 A;  3F8H A;  1CYV A;  3PS8 A;  1GOU A;  1LQM B;  1LOX A;  1DMM A;  2H0H A;  2RCD A;  2Q07 A;  3D4A A;  4IIA A;  4LGQ A;  5CK6 A;  3U1W A;  1G0T A;  4BL3 A;  1VQ5 3;  5EEO A;  2GEY A;  3LTA A;  5BIR A;  5RNT A;  2F56 A;  3IJE B;  4I4K A;  1GOV A;  3FG3 A;  1YI2 3;  3T8N A;  1AVL A;  1KWI A;  1W6C A;  1JN5 B;  1LVN A;  2WGO A;  3CPO A;  4GB5 A;  1VQ9 3;  3EN1 B;  1UUW B;  2JDI H;  4JRF A;  5M18 A;  4HM6 B;  1W6Y A;  3D3L A;  4HYZ A;  3LTC A;  2W0Q A;  5KP3 A;  1I2G A;  2OCT A;  3EQQ B;  3JUP A;  3RGR A;  3OW2 2;  1GS3 A;  1TIJ A;  4BL2 A;  1QAL A;  2IY2 A;  4HKV B;  1B21 A;  4MEI A;  5G1K A;  3S67 A;  1R4C A;  1ASK A;  2WOF A;  2IUJ A;  3VSY A;  5AEU B;  2RGQ A;  2RFR A;  4KT3 B;  1W2B 2;  3OWY A;  3K9M C;  4N3V A;  4WYK B;  5IG5 A;  3QK9 A;  1VQN 3;  3GZB A;  3EC9 A;  2IYJ A;  1NU3 A;  2A15 A;  1HYF A;  4JF8 A;  1RNB A;  1BRK A;  4HAA A;  6RNT A;  2RSX A;  2E2U A;  3N8B A;  4KFE A;  4H3U A;  4N6L A;  1K9M 4;  2M7O A;  2UGI A;  1TRQ A;  2BT3 A;  3BB9 A;  1N9J A;  5ELJ A;  5CF2 A;  4FMC A;  3HK4 A;  4H61 A;  3SOA A;  1SAR A;  1ULI B;  2GU1 A;  1GYB A;  3CCS 3;  4AKZ A;  3F14 A;  4N6T A;  1BRI A;  2W03 A;  2CFL A;  3NUV A;  4HVN A;  4AEQ A;  1WMP A;  1EUI C;  2BHM A;  1DVD A;  1JBS A;  1YHQ 3;  3H51 A;  2OTL 3;  5HOH A;  3KE7 A;  1NB5 I;  8CHO A;  3T0U A;  1BIR A;  2CH9 A;  1DMQ A;  2YFI B;  3B7C A;  1FW7 A;  1PFP A;  5IG4 A;  1Y4K A;  3PXM A;  3K63 A;  2GXF A;  2WGQ A;  5IG0 A;  4L8P A;  3NV0 A;  3X40 A;  1FA3 A;  1WNH A;  3G0K A;  3EE1 A;  3GRD A;  3VGN A;  3HOH A;  5KP4 A;  3SYU A;  3HIG A;  1LNH A;  5D83 A;  1TFK A;  3EF8 A;  4K1V A;  3CMA 3;  4WFO A;  3D79 A;  3HI7 A;  1BRS A;  3WOE B;  1JV2 B;  2CK3 H;  4WHA A;  1RN1 A;  4NRE A;  1PU4 A;  1JB5 A;  3DZL A;  1AY7 A;  3B8L A;  4FMD A;  1FGO A;  4RNY A;  4CDL A;  2MC8 A;  4LMI A;  2Y73 A;  3DXO A;  3KCH A;  1I3F A;  1W6G A;  5FW5 A;  5AI1 A;  3ZG5 A;  5JPP A;  1ULJ B;  5CLK A;  1E3R A;  1GMQ A;  4KVH A;  1STD A;  2XR8 B;  3UL5 A;  5KP1 A;  1DVC A;  1EEJ A;  4CJN A;  4WWU C;  4J8T A;  1OHO A;  1EKM A;  2LQV A;  3KN4 A;  2BU4 A;  5BVB A;  4L8O A;  3KFQ C;  2XEP A;  2XRX B;  1IQX A;  3WMD A;  4FCM A;  2KRT A;  1YVB I;  3GZY B;  4HOH A;  3VF1 A;  2OQE A;  1W4N A;  4FMB A;  1RGA A;  2OTJ 3;  1QVF 2;  1UW1 A;  4ILF A;  4LYL B;  1JKG B;  5IEP A;  3CCR 3;  4HJL B;  3JUM A;  4J5K A;  3FCS B;  4DKI A;  6STD A;  3WA2 X;  1HKX A;  2UX0 A;  4N6U A;  3AMO B;  1BRG A;  3D9R A;  1RJO A;  1BNJ A;  1TRP A;  4OVM A;  4KFF A;  2K54 A;  3PZW A;  1TJD A;  4R1K A;  4HM4 B;  1ZGX A;  1AVK A;  4RBN A;  3X42 A;  1A2V A;  5BXQ A;  2K0M A;  4U13 A;  2XFS A;  3N9H A;  1B2X A;  1BRN L;  3CCJ 3;  1BNI A;  2L4V A;  1RKY A;  2F4Y A;  1BNG A;  2B24 B;  2P38 A;  3DY5 A;  2Y74 A;  1I2F A;  1B2M A;  1LQG C;  1W5Z A;  3SLU A;  1OH0 A;  3SOY A;  2CW9 A;  2P0M A;  4IT7 A;  4O3V A;  1YJN 3;  1Q7H A;  5BU4 A;  3LOY A;  1Q7Y 4;  1Q40 A;  3NM2 A;  7STD A;  1N5H A;  3ZFZ A;  1AQZ A;  1LOW A;  2GU3 A;  1VQQ A;  1WTH A;  2W56 B;  2CFG A;  1GMP A;  1RRL A;  1OPY A;  3SXX A;  2MF7 A;  1X1Y A;  1UUV B;  1JZD A;  4EYC A;  4MJD A;  1SII A;  4MMX B;  3S29 A;  1PY3 A;  1RGG A;  4XM4 A;  4OK0 A;  1TP6 A;  1PYL A;  2PZV A;  1D6Y A;  1K28 A;  1RN7 A;  3BU4 A;  3FGY A;  2O9U X;  5IEO A;  3O8Y A;  3UJM A;  3AGN A;  5CXO A;  4HM7 B;  8RNT A;  4XDW A;  1IYY A;  1B20 A;  3J7Y d;  3OX9 A;  1SIH A;  5ELU A;  3SVA A;  2ZL8 A;  3Q2P A;  2H0G A;  1YGE A;  2JQ5 A;  5AII A;  1JBT A;  1S5A A;  2CKF B;  1K8A 4;  2Z7A A;  7RNT A;  1BAN A;  1DYU A;  1STF I;  2KF5 A;  3MG3 A;  4O2H A;  3CXC 2;  3FF2 A;  3NM7 A;  3CCQ 3;  3HII A;  2ML5 A;  2XSH B;  3F7X A;  1BSE A;  1YVS A;  3G4S 3;  2KF4 A;  1FUW A;  1IT7 A;  1I70 A;  1RHL A;  2C10 A;  2F99 A;  2CFK A;  4BTX A;  1JBR A;  1DMN A;  2HOH A;  2E2T A;  3GZX B;  3L0R A;  4FCJ A;  4MMY B;  4KFD A;  2Z77 A;  1K41 A;  2XFT A;  1VQO 3;  3KKG A;  3CC2 3;  1BSC A;  4FCZ A;  5STD A;  1FGR A;  3T8U A;  1ZS7 A;  5CF1 A;  1UCK A;  4R9K A;  2OWP A;  1QAK A;  4N6N B;  3CD6 3;  4EC6 A;  5JPU A;  2QA4 3;  3GSP A;  4K61 A;  1NB3 I;  1LOV A;  4LZI A;  3FG1 A;  3LML A;  3X3X A;  3NBR A;  1RGH A;  3EBT A;  3ROB A;  3A5E A;  5M1A A;  4HM1 B;  1E3V A;  3JUQ A;  5D81 A;  1SPU A;  4KZ1 A;  1EG9 B;  1LOY A;  1RGC A;  3H3H A;  1NNV A;  2C4B A;  2HML B;  1W7C A;  9RNT A;  1QAF A;  2O3O A;  2CFW A;  1FUS A;  2OOV C;  3FLJ A;  4ZM8 A;  3BND A;  1VQM 3;  4NHF A;  1DET A;  3CNX A;  3MG2 A;  1G96 A;  2IUK A;  1QVG 2;  4MMZ B;  3SED A;  3V99 A;  1YIT 3;  2L1S A;  4HM2 B;  3IPT A;  1B3S A;  1JB4 A;  3LZA A;  2XGN A;  3NX0 A;  4L7K A;  1BSB A;  1AR0 A;  3D5I A;  3WA3 A;  4X2H A;  1VQ6 3;  2RNT A;  3TDG A;  1NDO B;  1IDP A;  3EBY A;  1JNQ A;  2ZA4 A;  2SAR A;  4HZ9 B;  5AYR B;  4GSP A;  5G1L A;  4HM0 B;  3FZW A;  1WQL B;  2CWU A;  1MWR A;  3RGA A;  2QEX 3;  2D1W A;  1VQ7 3;  4TX4 A;  3PGB A;  5GSP A;  3BLZ A;  1NJI 4;  3A76 A;  2F5M A;  2INX A;  1W01 A;  3OWS A;  4HZB B;  3WHO A;  3JVC A;  3UB1 A;  3PCR A;  5JBS A;  1I3I A;  5IW9 A;  3G71 3;  3CC4 3;  3MKI A;  4OUQ A;  2W9Q A;  4STD A;  1K73 4;  4RNZ A;  4ORL A;  3NXJ A;  1T2I A;  1FGM A;  3Q3F A;  3WDG B;  2XF3 A;  1UDI I;  1YIJ 3;  2CG1 A;  4N6M A;  3EB8 A;  1N5P A;  1TUH A;  3MSO A;  5IER A;  3GAX A;  5LC6 A;  1GY5 A;  1IQY A;  1GD4 A;  1UCI A;  3X3Y A;  1C7H A;  2HMN B;  3CCV 3;  3NV0 B;  1M1K 4;  1VQ8 3;  3JUN A;  5FGO A;  3X3Z A;  1LXE A;  3AHW A;  3PYJ A;  4HBR A;  3G16 A;  1SJW A;  1RLS A;  2QIY A;  1GMR A;  3S28 A;  1T5Y A;  1ISK A;  4XBY A;  4GHO A;  3MPH A;  3LTB A;  2W04 A;  3EX9 A;  1Q42 A;  3I55 3;  1BSA A;  1UCJ A;  1DE3 A;  5DRV A;  3LYG A;  1QMA A;  1WMO A;  1FYS A;  2KXG A;  3RNT A;  1ZX2 A;  4O02 B;  1HU9 A;  2HMO B;  3DGO A;  3F8X A;  5IF6 A;  1YJW 3;  3X41 A;  1MOL A;  1SQW A;  3BNC A;  3FKA A;  3DH2 A;  1JN5 A;  3KZT A;  1IVU A;  1MWT A;  4EW5 A;  4EBG A;  3NQY A;  1A2K A;  3K0Z A;  3S27 A;  3HZP A;  1RGE A;  3JUO A;  1N8Q A;  3NHX A;  1OF5 A;  1BGS A;  4Q53 A;  1U5O A;  3DGL A;  3D5G A;  5HGR A;  3G6E 3;  1KQS 2;  1J2B A;  2ZDJ A;  4GL6 A;  3K7C A;  1GY7 A;  2H0I A;  3OXA A;  1V58 A;  4EV5 A;  1RNT A;  2CFD A;  1RGL A;  1B2U A;  1BAO A;  1RN4 A;  3CNM A;  2LYX A;  3MHE A;  1M9G A;  3DUK A;  4RZM A;  5DRE A;  3LH4 A;  3WOD G;  2P0X A;  5AIH A;  3SX1 A;  1BVI A;  1RDS A;  2GBW B;  3IMA B;  3FF0 A;  2UUG C;  2BNG A;  3DGY A;  1W00 A;  4K1U A;  2R41 A;  4O8S A;  4BTW A;  4R80 A;  1CEW I;  1D6Z A;  1BNF A;  3OV4 A;  1MWS A;  4HM3 B;  3UNL A;  3ZG0 A;  4NPB A;  1OHP A;  2ZHX B;  3I0Y A;  5AEW B;  1O7N B;  1RCL A;  1Q9E A;  1VZZ A;  1JZO A;  2J8X B;  3LT9 A;  1OGX A;  1Q81 4;  2STD A;  1KC8 4;  1O7G B;  1I0X A;  1M90 4;  3LT8 A;  3ER7 A;  4PEJ A;  1O7M B;  4XB5 A;  2C11 A;  1ROA A;  3M8C A;  1C54 A;  1JJ2 2;  3FSD A;  1Q40 B;  1JRQ A;  4XBT A;  1OF5 B;  2CWV A;  2HMM B;  3F9S A;  1MNL A;  1WMN A;  3DMC A;  1KSI A;  5M19 A;  1OUN A;  5G2G A;  1US1 A;  2WO0 A;  3E99 A;  1KD1 4;  4N6O B;  1W2Z A;  1BNR A;  1BOX A;  1BSD A;  1BNE A;  1F8N A;  1RCK A;  2BIR A;  3KSP A;  2OOV A;  3CCM 3;  1V57 A;  3CCU 3;  1BRH A;  1T2H A;  1NWW A;  1Q86 4;  1RGF A;  2CX0 A;  1CQS A;  6GSP A;  1A67 A;  5D82 A;  3F7S A;  4J9A A;  1UI7 A;  1IV7 A;  1RRH A;  3FG4 A;  3DGM A;  3STD A;  2YFJ B;  1G02 A;  1IVV A;  2CX1 A;  3BNB A;  3S5C A;  4X2O A;  3U97 A;  1N8R 4;  3MYT A;  4WP5 A;  2F98 A;  1V74 A;  1MGR A;  1T3B A;  1TU5 A;  3WR2 A;  1I2E A;  1GD3 A;  1VQK 3;  3QRD A;  3UL6 A;  4AKY A;  1BUJ A;  3V92 A;  2Z6B A;  1BRJ A;  1X1U A;  3BIR A;  1RTU A;  3K5T A;  1FGQ A;  1M1X B;  1IQ8 A;  1YNV X;  2P09 A;  3URP A;  2Z76 A;  3CME 3;  1VQL 3;  3LXU X;  1OGZ A;  1EA2 A;  1IV9 A;  1TFO A;  2QGU A;  2XH9 A;  3NQZ A;  5AIG A;  4R4K A;  4J5G A;  2W2C A;  3Q1C A;  4N6V 0;  1OAC A;  1IVW A;  2V1L A;  3EHC A;  4FMA A;  4BIR A;  1O7W B;  2GBX B;  1AV4 A;  2GSP A;  2SBL A;  1HZ1 A;  2W6J H;  3PCS A;  3V98 A;  5A0O B;  1VQP 3;  3LTD A;  1MWU A;  1CH0 A;  1JKG A;  2YX9 A;  1B2Z A;  3ALA A;  3EJV A;  3BNE A;  1MGW A;  2I9W A;  1FGT A;  2WOH A;  3CCE 3;  3AMO A;  2W9P A;  2KF6 A;  1B27 A;  2E2V A;  2D42 A;  3OWU A;  2KAA A;  2B1X B;  4FR9 A;  4XDV A;  2CG0 A;  3B4P A;  1LNI A;  1CYU A;  1OCV A;  1GY6 A;  3EN8 A;  4RNT A;  1N9E A;  1UCL A;  3KII A;  3FH1 A;  1IK3 A;  1D6U A;  3F40 A;  3N54 B;  2AAE A;  2BMR B;  3WOF B;  3I56 3;  3CPW 2;  3MWZ A;  4CPK A;  1I0V A;  2XSO B;  1FZU A;  3CCL 3;  1GOY A;  3HX8 A;  2PNC A;  4EXR A;  1A2P A;  1RMS A;  2XGL A;  1U8C B;  2F5W A;  3GZR A;  1BU4 A;  1ZO2 A;  4CCV A;  3RDE A;  3G8Z A;  1Q82 4;  1GSP A;  3ECF A;  1X1W A;  1OHS A;  1JB2 A;  1YGW A;  4R9L A;  1UUG B;  5AYS C;  1Z1S A;  2W56 A;  2FGT A;  3NBJ A;  5TGN A;  1LRA A;  5I97 A;  1BUQ A;  4HM5 B;  1UI8 A;  1BNS A;  2IA7 A;  4BTY A;  3MG1 A;  5IG3 A;  1TTO A;  2GEX A;  3AHS A;  4HM8 B;  1YJ9 3;  2HMK B;  2YFL B;  2BMQ B;  2BO9 B;  2KCD A;  1W02 A;  1UGH I;  2AAD A;  3B4O A;  1RGK A; 
#chains in the Genus database with same CATH homology
 3NBB A;  1S72 3;  1ROV A;  2FNQ A;  4K90 B;  4LSO A;  2OQE C;  2R4I A;  5EVH A;  2CIU A;  5EQL A;  1IVX A;  2ML6 A;  3GWR A;  3DM8 A;  5LC7 A;  1VQ4 3;  4LEH A;  4QWT A;  1A90 A;  3DGN A;  3KSE D;  1EQK A;  2HMJ B;  1O7P B;  4IPB A;  3CC7 3;  1O7H B;  1IT8 A;  2F86 B;  3Q90 A;  4XBX A;  4EV2 A;  2IMJ A;  4WYK A;  1E97 A;  2BMO B;  1L5G B;  2CC3 A;  2CHC A;  1IU7 A;  2P05 A;  2CWT A;  5AIF A;  5IEN A;  4G1M B;  1NO3 A;  1QJG A;  2FXT A;  3CU3 A;  3F8H A;  1CYV A;  3PS8 A;  1LOX A;  1DMM A;  2RCD A;  4IIA A;  2Q07 A;  4LGQ A;  5CK6 A;  3U1W A;  3CME 3;  1VQ5 3;  5EEO A;  2GEY A;  3LTA A;  3IJE B;  4I4K A;  1YI2 3;  3FG3 A;  3T8N A;  1AVL A;  1KWI A;  1W6C A;  1JN5 B;  1LVN A;  2WGO A;  3CPO A;  4GB5 A;  1VQ9 3;  3EN1 B;  1UUW B;  2JDI H;  4JRF A;  4HM6 B;  1W6Y A;  3D3L A;  4HYZ A;  3LTC A;  2W0Q A;  5KP3 A;  2OCT A;  3EQQ B;  3JUP A;  3RGR A;  3OW2 2;  1GS3 A;  1TIJ A;  1QAL A;  4HKV B;  4MEI A;  3S67 A;  1R4C A;  1ASK A;  2WOF A;  2IUJ A;  3VSY A;  5AEU B;  2RGQ A;  2RFR A;  1W2B 2;  3OWY A;  3K9M C;  4N3V A;  4WYK B;  5IG5 A;  3QK9 A;  1VQN 3;  3GZB A;  3EC9 A;  1NU3 A;  2A15 A;  4JF8 A;  2RSX A;  2E2U A;  3N8B A;  4KFE A;  4H3U A;  4N6L A;  1K9M 4;  2M7O A;  3BB9 A;  2BT3 A;  5CF2 A;  5ELJ A;  1N9J A;  4FMC A;  3HK4 A;  4H61 A;  3SOA A;  1ULI B;  2GU1 A;  1GYB A;  3CCS 3;  4AKZ A;  3F14 A;  4N6T A;  2W03 A;  2CFL A;  3NUV A;  4HVN A;  4AEQ A;  1WMP A;  2BHM A;  1DVD A;  1YHQ 3;  3H51 A;  2OTL 3;  3KE7 A;  1NB5 I;  8CHO A;  3T0U A;  2CH9 A;  1DMQ A;  2YFI B;  3B7C A;  1PFP A;  1Y4K A;  3PXM A;  3K63 A;  2GXF A;  2WGQ A;  5IG0 A;  4L8P A;  3NV0 A;  3X40 A;  1FA3 A;  1WNH A;  3G0K A;  3EE1 A;  3GRD A;  3VGN A;  5KP4 A;  3HIG A;  1LNH A;  5D83 A;  1TFK A;  3EF8 A;  4K1V A;  3CMA 3;  4WFO A;  3HI7 A;  3WOE B;  1JV2 B;  2CK3 H;  4WHA A;  4NRE A;  1PU4 A;  1JB5 A;  3DZL A;  3B8L A;  4FMD A;  1FGO A;  4RNY A;  4CDL A;  2MC8 A;  4LMI A;  2Y73 A;  3DXO A;  1W6G A;  5FW5 A;  5JPP A;  5AI1 A;  1ULJ B;  5CLK A;  1E3R A;  4KVH A;  1STD A;  2XR8 B;  3UL5 A;  5KP1 A;  1DVC A;  4WWU C;  4J8T A;  1OHO A;  1EKM A;  2LQV A;  3KN4 A;  5BVB A;  4L8O A;  3KFQ C;  2XEP A;  2XRX B;  1IQX A;  3WMD A;  4FCM A;  2KRT A;  1YVB I;  3GZY B;  3VF1 A;  2OQE A;  1W4N A;  4FMB A;  2OTJ 3;  1QVF 2;  1UW1 A;  1JKG B;  5IEP A;  3CCR 3;  4HJL B;  3JUM A;  3FCS B;  6STD A;  3WA2 X;  1HKX A;  2UX0 A;  4N6U A;  3AMO B;  3D9R A;  1RJO A;  4OVM A;  4KFF A;  2K54 A;  3PZW A;  4R1K A;  4HM4 B;  3X42 A;  1AVK A;  4RBN A;  1A2V A;  5BXQ A;  2K0M A;  4U13 A;  2XFS A;  3N9H A;  3CCJ 3;  1RKY A;  2L4V A;  2B24 B;  2P38 A;  3DY5 A;  2Y74 A;  1W5Z A;  3SLU A;  1OH0 A;  3SOY A;  2CW9 A;  2P0M A;  4IT7 A;  4O3V A;  1YJN 3;  3LOY A;  1Q7Y 4;  1Q40 A;  3NM2 A;  7STD A;  1N5H A;  2GU3 A;  1WTH A;  2W56 B;  2CFG A;  3SXX A;  1RRL A;  1OPY A;  2MF7 A;  1UUV B;  4EYC A;  4MJD A;  1SII A;  4MMX B;  3S29 A;  4XM4 A;  4OK0 A;  1TP6 A;  2PZV A;  1D6Y A;  1K28 A;  1RN7 A;  3FGY A;  2O9U X;  5IEO A;  3O8Y A;  3UJM A;  5CXO A;  4HM7 B;  4XDW A;  3J7Y d;  3OX9 A;  1SIH A;  5ELU A;  3SVA A;  2ZL8 A;  3Q2P A;  2JQ5 A;  1YGE A;  5AII A;  1S5A A;  2CKF B;  1K8A 4;  2Z7A A;  1DYU A;  1STF I;  3MG3 A;  4O2H A;  3CXC 2;  3FF2 A;  3NM7 A;  3CCQ 3;  3HII A;  2ML5 A;  2XSH B;  3F7X A;  3G4S 3;  1FUW A;  1IT7 A;  2C10 A;  2F99 A;  2CFK A;  4BTX A;  1DMN A;  2E2T A;  3GZX B;  3L0R A;  4FCJ A;  4MMY B;  4KFD A;  2Z77 A;  1K41 A;  2XFT A;  1VQO 3;  3KKG A;  3CC2 3;  4FCZ A;  1FGR A;  3T8U A;  5CF1 A;  4R9K A;  2OWP A;  1QAK A;  4N6N B;  3CD6 3;  4EC6 A;  5JPU A;  2QA4 3;  4K61 A;  1NB3 I;  4LZI A;  3FG1 A;  3LML A;  3X3X A;  3NBR A;  3EBT A;  3ROB A;  4HM1 B;  1E3V A;  3JUQ A;  5D81 A;  1SPU A;  4KZ1 A;  1EG9 B;  3H3H A;  2HML B;  1W7C A;  5IG4 A;  1QAF A;  2O3O A;  2CFW A;  2OOV C;  3FLJ A;  4ZM8 A;  1VQM 3;  3BND A;  4NHF A;  3CNX A;  1QVG 2;  3MG2 A;  1G96 A;  2IUK A;  4MMZ B;  3SED A;  3V99 A;  1YIT 3;  4HM2 B;  3IPT A;  3LZA A;  1JB4 A;  3NX0 A;  2XGN A;  4L7K A;  5STD A;  3WA3 A;  1AR0 A;  4X2H A;  1VQ6 3;  3TDG A;  1NDO B;  1IDP A;  3EBY A;  1JNQ A;  4HZ9 B;  5AYR B;  4HM0 B;  3FZW A;  1WQL B;  2CWU A;  3RGA A;  2QEX 3;  2D1W A;  1VQ7 3;  4TX4 A;  3PGB A;  3BLZ A;  1NJI 4;  3A76 A;  2INX A;  3OWS A;  1W01 A;  4HZB B;  3JVC A;  3UB1 A;  3PCR A;  5JBS A;  5IW9 A;  3G71 3;  3CC4 3;  3MKI A;  4OUQ A;  2W9Q A;  4STD A;  1K73 4;  4RNZ A;  4ORL A;  3NXJ A;  1FGM A;  3WDG B;  2XF3 A;  1YIJ 3;  2CG1 A;  4N6M A;  3EB8 A;  1N5P A;  1TUH A;  3MSO A;  5IER A;  3GAX A;  5LC6 A;  1GY5 A;  1IQY A;  1GD4 A;  3CCV 3;  3X3Y A;  1C7H A;  2HMN B;  1M1K 4;  3NV0 B;  1VQ8 3;  3JUN A;  5FGO A;  3X3Z A;  1LXE A;  3PYJ A;  4HBR A;  3G16 A;  1SJW A;  2QIY A;  3S28 A;  1T5Y A;  1ISK A;  4XBY A;  3MPH A;  3LTB A;  2W04 A;  3EX9 A;  1Q42 A;  3I55 3;  5DRV A;  3LYG A;  1QMA A;  1WMO A;  2KXG A;  1ZX2 A;  4O02 B;  2HMO B;  3DGO A;  3F8X A;  5IF6 A;  1YJW 3;  3X41 A;  1MOL A;  1SQW A;  3BNC A;  3FKA A;  1JN5 A;  3KZT A;  1IVU A;  4EBG A;  3NQY A;  1A2K A;  3K0Z A;  3S27 A;  3HZP A;  3JUO A;  1N8Q A;  3NHX A;  1OF5 A;  4Q53 A;  1U5O A;  3DGL A;  5HGR A;  3G6E 3;  1KQS 2;  1J2B A;  2ZDJ A;  4GL6 A;  3K7C A;  1GY7 A;  3OXA A;  4EV5 A;  2CFD A;  3CNM A;  2LYX A;  3MHE A;  1M9G A;  3DUK A;  4RZM A;  5DRE A;  3LH4 A;  3WOD G;  2P0X A;  5AIH A;  3SX1 A;  2GBW B;  3IMA B;  3FF0 A;  2BNG A;  4O8S A;  1W00 A;  4K1U A;  4BTW A;  4R80 A;  1CEW I;  1D6Z A;  3OV4 A;  4HM3 B;  3UNL A;  1OHP A;  3I0Y A;  5AEW B;  1O7N B;  1VZZ A;  1KC8 4;  3LT9 A;  1OGX A;  1Q81 4;  2STD A;  1M90 4;  1O7G B;  3LT8 A;  3ER7 A;  4PEJ A;  1O7M B;  4XB5 A;  2C11 A;  1ROA A;  3M8C A;  1JJ2 2;  3FSD A;  1Q40 B;  1JRQ A;  4XBT A;  1OF5 B;  2CWV A;  2HMM B;  3F9S A;  1MNL A;  1WMN A;  3DMC A;  1KSI A;  1OUN A;  5G2G A;  1US1 A;  2WO0 A;  3E99 A;  1KD1 4;  4N6O B;  1W2Z A;  1F8N A;  3KSP A;  3CCM 3;  2OOV A;  3CCU 3;  1NWW A;  1Q86 4;  1A67 A;  1CQS A;  5D82 A;  3F7S A;  4J9A A;  1UI7 A;  1IV7 A;  1RRH A;  3FG4 A;  3DGM A;  3STD A;  2YFJ B;  3BNB A;  1IVV A;  3S5C A;  4X2O A;  3U97 A;  1N8R 4;  3MYT A;  4WP5 A;  2F98 A;  1V74 A;  1TU5 A;  1VQK 3;  1GD3 A;  3QRD A;  3UL6 A;  4AKY A;  3V92 A;  2Z6B A;  3K5T A;  1FGQ A;  1M1X B;  1IQ8 A;  2P09 A;  2Z76 A;  1VQL 3;  3LXU X;  1OGZ A;  1EA2 A;  1IV9 A;  1TFO A;  2QGU A;  2XH9 A;  3NQZ A;  5AIG A;  4R4K A;  2W2C A;  3Q1C A;  4N6V 0;  1OAC A;  1IVW A;  2V1L A;  3EHC A;  4FMA A;  1O7W B;  2GBX B;  1AV4 A;  2SBL A;  2W6J H;  3PCS A;  3V98 A;  5A0O B;  1VQP 3;  3LTD A;  1JKG A;  2YX9 A;  3ALA A;  3EJV A;  3BNE A;  2WOH A;  2I9W A;  1FGT A;  3CCE 3;  3AMO A;  2W9P A;  2E2V A;  2D42 A;  3OWU A;  4FR9 A;  2B1X B;  4XDV A;  2CG0 A;  3B4P A;  1CYU A;  1OCV A;  1GY6 A;  3EN8 A;  1N9E A;  3KII A;  3FH1 A;  1IK3 A;  1D6U A;  3F40 A;  3N54 B;  2BMR B;  3WOF B;  3I56 3;  3CPW 2;  3MWZ A;  2XSO B;  3CCL 3;  3HX8 A;  2PNC A;  4EXR A;  2XGL A;  1U8C B;  3GZR A;  1ZO2 A;  4CCV A;  3RDE A;  3G8Z A;  1Q82 4;  3ECF A;  1OHS A;  1JB2 A;  4R9L A;  5AYS C;  1Z1S A;  2W56 A;  2FGT A;  3NBJ A;  5TGN A;  5I97 A;  1BUQ A;  4HM5 B;  1UI8 A;  2IA7 A;  4BTY A;  3MG1 A;  5IG3 A;  2GEX A;  4HM8 B;  1YJ9 3;  2HMK B;  2YFL B;  2BMQ B;  2BO9 B;  2KCD A;  1W02 A;  3B4O A;  1HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...