2I9WA

Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
177
Chain Sequence
MLFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQAIRADTAEHLMRTRYSAFVLVKPEYIVKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVSMSVTQKQPCICGSGEKFKRCCGMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (YP_265345.1) from Psychrobacter Arcticum 273-4 at 1.75 A resolution
rcsb
source organism Psychrobacter arcticus
molecule tags Metal binding protein
molecule keywords Hypothetical protein
total genus 39
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02810 SEC-C SEC-C motif
A PF17775 UPF0225 UPF0225 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2i9wA00
3NBRA 5AIHA 5FW5A 4GB5A 5JPPA 3B8LA 3DMCA 5IENA 4XBYA 1JN5B 5BVBA 1JB2A 2QIYA 3F7SA 3GRDA 3CPOA 1JKGA 2HMOB 4HM5B 1W00A 1JN5A 2UX0A 2XSHB 3JUOA 3T8UA 1W01A 1ISKA 1TP6A 1EA2A 1GY6A 3Q90A 4HKVB 3F8XA 4WWUC 4HZ9B 1K41A 3NV0B 3G0KA 4PEJA 4RZMA 2A15A 2YFIB 2Z77A 4HM2B 3EQQB 5CK6A 5IERA 3NV0A 3JUQA 3B4OA 3BB9A 4KVHA 5CLKA 5CF2A 2HMJB 3FF2A 3DZLA 3FH1A 1GS3A 3VSYA 2CKFB 4N3VA 1Q40A 3GZYB 4MJDA 2GEYA 3KE7A 2F86B 3EN8A 4WP5A 2HMNB 5KP1A 6STDA 1Q40B 3FZWA 1E3VA 3IPTA 3MG2A 2YFLB 3NM2A 4HM1B 3F9SA 1O7PB 4K1VA 4XBTA 3I0YA 1U5OA 3SOYA 3T8NA 3VGNA 5IEPA 1GY7A 1OHOA 3H51A 4I4KA 1OHPA 1W02A 3G16A 3HX8A 5DRVA 3K7CA 5AIFA 2K54A 3CNXA 3SOAA 1W6YA 4FCJA 1ASKA 1UUVB 1EG9B 4LMIA 4WYKA 4HZBB 1DMNA 3DXOA 3OXAA 4L8OA 3EN1B 1Q42A 1Z1SA 2Z76A 3ECFA 3K0ZA 1BUQA 1NWWA 1IDPA 3E99A 1VZZA 3JUNA 4HM7B 5HGRA 3DUKA 1O7NB 2JQ5A 3FSDA 1O7MB 1OF5B 3EJVA 4J8TA 2GBXB 2QGUA 4HM8B 2R4IA 2OWPA 2IMJA 2PZVA 3RGRA 5D81A 5AIIA 3KSPA 1WQLB 5IG3A 4R9KA 3EF8A 5EVHA 5D83A 2HMLB 2F98A 2HMMB 1DMQA 3MHEA 5TGNA 1AR0A 1OUNA 2YFJB 3JUMA 3FGYA 3WMDA 1S5AA 4U13A 1A2KA 4STDA 5IG0A 1O7GB 1CQSA 1GYBA 3EC9A 1E3RA 4J9AA 5D82A 1TUHA 5G2GA 3SEDA 2BMQB 1C7HA 3CU3A 3MSOA 3LZAA 4WYKB 4XB5A 1JKGB 3DM8A 1ZX2A 2BMOB 1NDOB 3FLJA 1OGXA 3EBYA 3OX9A 3MG3A 3JUPA 2GXFA 3H3HA 2RFRA 3NXJA 2INXA 2XSOB 5AEWB 5KP4A 4IIAA 3OWSA 3UNLA 3S5CA 2HMKB 3B7CA 3MYTA 3NUVA 4R9LA 3EHCA 4XBXA 4X2HA 3MG1A 3OWYA 3B4PA 4HJLB 1E97A 3EX9A 3GZBA 2STDA 4OVMA 2XRXB 1ULIB 2GEXA 3NHXA 5IEOA 3KZTA 2BMRB 3KKGA 4H3UA 2XR8B 3HK4A 3GZRA 5IG5A 2B24B 3F7XA 7STDA 4X2OA 1HKXA 1OPYA 3F8HA 1OGZA 3GWRA 4OUQA 1NU3A 3MKIA 4CDLA 5AEUB 2GBWB 4HM0B 3FF0A 5AI1A 3M8CA 4ORLA 3G8ZA 1UUWB 5STDA 3A76A 3EBTA 3ROBA 4XM4A 1DMMA 2Z7AA 4HM6B 3RGAA 3FKAA 3F14A 5CXOA 3ER7A 1ULJB 2RCDA 1OF5A 1QMAA 1JB4A 4LGQA 4HVNA 3CNMA 1O7HB 4XDVA 1OH0A 4FCMA 2CHCA 2BNGA 4K1UA 5BXQA 1O7WB 5CF1A 3D9RA 1GY5A 1JB5A 2W2CA 4L7KA 4R1KA 4Q53A 5IG4A 2I9WA 1STDA 3BLZA 4L8PA 3STDA 3OV4A 2B1XB 5AIGA 5IF6A 1OHSA 2RGQA 3OWUA 5DREA 1QJGA 3LYGA 3UJMA 8CHOA 4LEHA 5JPUA 1ZO2A 3GZXB 1SJWA 2F99A 5KP3A 3F40A 4HM4B 3HZPA 1OCVA 4XDWA 4HM3B
chains in the Genus database with same CATH superfamily
3I563 1I0VA 1GOUA 3WA2X 2WGOA 5IENA 1JNQA 1MWUA 2CWTA 2CWVA 3EE1A 2UX0A 3JUOA 3ZG5A 1W01A 2KF4A 2XF3A 1K41A 2P0XA 3KFQC 1IV7A 1BAOA 4FR9A 4PEJA 1YJ93 1X1YA 3JUQA 3B4OA 4O2HA 5CLKA 2K0MA 3GSPA 4GL6A 3X40A 2ZA4A 1B2SA 2HMJB 1LQMB 3FH1A 1GS3A 1RTUA 4O3VA 4IT7A 1JBRA 1RMSA 2OQEC 3PYJA 3SVAA 1Q40B 1DVDA 1E3VA 1D6ZA 3IPTA 1BSDA 1STFI 1KD14 4TX4A 4XBTA 3SOYA 3T8NA 4LYLB 3WA3A 1OHOA 1UUGB 2KXGA 3AMOA 1QALA 1R4YA 2W0QA 4I4KA 1OHPA 4LSOA 5AYSC 1W02A 3HI7A 1IK3A 3G16A 3HX8A 3CCS3 3DGOA 4LMIA 1ZGXA 1UUVB 1EG9B 1BRNL 3D5IA 4HZBB 1DMNA 3EN1B 3CCM3 2OOVC 1Z1SA 4J5KA 3U1WA 3VF1A 1NWWA 1UGIA 2RSXA 3E99A 1PFPA 1QAFA 1VZZA 3JUNA 5HGRA 3V99A 1VQ43 4G1MB 4J8TA 3LT8A 1LOYA 2W04A 1BNRA 2GBXB 2QGUA 1C54A 1GOYA 1BNJA 5AIIA 1WQLB 5IG3A 1RGGA 3CC73 3RDEA 1MGWA 2HMLB 2HMMB 2YX9A 3Q2PA 1VQ63 2YFJB 1RNTA 1BANA 2H0IA 4EV5A 1UCLA 1K28A 3GAXA 1Q7Y4 4U13A 1GOVA 2XGNA 1B27A 1O7GB 5G1KA 3SEDA 1TUHA 1BRJA 3X3XA 3MSOA 1GD4A 1M904 1ROAA 5LC7A 4XB5A 1VQQA 1JKGB 4N6MA 3DM8A 1L5GB 1G02A 2INXA 2XSOB 4JRFA 1BRIA 1I0XA 1NB3I 4N6OB 3NBBA 4X2HA 1BSBA 1BSCA 3OWYA 2WOHA 4HJLB 4FMBA 2W56A 1N8QA 1V58A 1RHLA 2F5MA 1WMPA 3EX9A 1B2UA 2BHMA 1Q9EA 3A5EA 4OVMA 3UL6A 3X3ZA 1ULIB 2GEXA 3NHXA 3PZWA 3KZTA 1W2ZA 1VQ53 1BRGA 1SIHA 3GZRA 1GMRA 3F7XA 2GU1A 1VQO3 2F4YA 7STDA 4X2OA 1OPYA 1S723 3F8HA 1I70A 3NM7A 2ZHXB 1W6CA 5AI1A 1CYVA 1LRAA 1RCLA 3G8ZA 3NQYA 1BIRA 2CFGA 4XM4A 5AYRB 2CG1A 3RGAA 5CXOA 1Q864 1SQWA 5FGOA 4NPBA 4HVNA 1V57A 1OH0A 2K3DA 1PU4A 5CF1A 4K1UA 3X41A 3BNEA 6GSPA 3D9RA 1JZDA 4R1KA 3FG4A 3S29A 5IG4A 1VQM3 2BIRA 3D3LA 2I9WA 3BLZA 1B20A 3FCSB 2OOVA 1VQ73 3OV4A 2B1XB 5AIGA 1IU7A 3BNDA 1OHSA 1A2VA 4ZM8A 3PCSA 1QJGA 5JPUA 1JBSA 1RGCA 1ZS7A 1SPUA 1ZO2A 2O9UX 1YVBI 1AVLA 3NQZA 5AIHA 2UUGC 4GB5A 5FW5A 5JPPA 4WFOA 3CPW2 3B8LA 1FGQA 1JN5B 1V74A 4EYCA 1JB2A 3CCV3 4HM5B 3T8UA 1JKGA 3N9HA 3UL5A 3WR2A 1VQ83 1BUJA 1GY6A 4WWUC 2XFTA 3QRDA 1X1UA 5JBSA 3NV0B 3AHSA 3G0KA 4QWTA 5CK6A 1QVF2 3EQQB 2QA43 2ZL8A 1G96A 1I2FA 4R4KA 1CEWI 5CF2A 3KCHA 3VSYA 1G0TA 2CKFB 2JDIH 5BXQA 5HOHA 2GEYA 1HZ1A 4J5GA 2AADA 2HMNB 4RNTA 4WP5A 6STDA 8RNTA 3MG2A 3NM2A 4HM1B 3F9SA 4I5QA 1MNLA 1TRQA 3G6E3 1CH0A 1GY7A 1FUTA 1N5HA 2XGLA 5M1AA 4RBNA 4MMXB 1BRHA 3PGBA 4CCVA 1FUSA 3CCR3 1RGHA 2CFDA 1WMOA 3CC23 2SARA 1HYFA 1FGTA 5BU4A 3ECFA 3ZFZA 1YVSA 4HM7B 1A90A 1O7NB 2CIUA 2JQ5A 3EJVA 1W2B2 1RGKA 4HM8B 3FG1A 2PZVA 2CG0A 5D81A 1X1XA 1IVUA 2H0GA 2XH9A 2WOFA 1OUNA 3JUMA 3FGYA 3QK9A 4NREA 3K9MC 3S67A 1MOLA 1BSEA 1A2KA 4STDA 1YHQ3 3SLUA 1BNIA 3EC9A 1I3IA 2F56A 2R41A 1NB5I 4R9LA 2CX0A 5RNTA 1C7HA 3CU3A 2E2UA 2C10A 4BL3A 3V92A 2CFLA 4BIRA 3FLJA 3OX9A 4EBGA 3MG3A 3X42A 3JUPA 2RFRA 1T5YA 1KSIA 1PY3A 3S5CA 4N6LA 3UNLA 3DY5A 3J7Yd 1B2XA 3EHCA 1BNSA 1FGOA 1E97A 3GZBA 1TIJA 2E2VA 2RNTA 3CC43 4HYZA 2OCTA 1KWIA 5IEOA 4BTYA 3KKGA 4H3UA 4RNYA 5EQLA 3HK4A 4LZIA 3CCU3 5IG5A 1UI8A 3Q1CA 1AQZA 2CX1A 1YGEA 2O3OA 1HKXA 1AVKA 2W9PA 4R80A 4CDLA 3DGNA 5AEUB 1FA3A 2ZDJA 1BNGA 3FF0A 1GD3A 1AV4A 3M8CA 2KRTA 2P09A 2ML5A 1BNEA 1FYSA 1LOVA 3ER7A 2RCDA 4FCZA 4LGQA 1QVG2 4XDVA 1WTHA 1RKYA 3TDGA 3S27A 2FNQA 1N9EA 4MMZB 3LXUX 4KFEA 4O02B 1MGRA 1STDA 4L8PA 2P38A 4AEQA 1UCJA 2M7OA 5IF6A 3LT9A 3LYGA 1IQXA 4LEHA 2HOHA 1SJWA 5KP3A 3WOFB 1UGHI 3CMA3 4BTXA 1GMQA 1VQP3 4JF8A 3DMCA 5BVBA 2QIYA 3PXMA 3CPOA 5ELUA 1W00A 2UGIA 2XSHB 3CCL3 1W6GA 2V1LA 1NO3A 1TP6A 1EA2A 2GU3A 3Q90A 2CH9A 3MPHA 1LVNA 4HZ9B 4RZMA 5A0OB 2YFIB 2AAEA 5IERA 1DE3A 1SARA 3LOYA 3BB9A 4KVHA 3FF2A 3DZLA 1VQL3 1BVIA 1IQYA 1Q40A 3GZYB 4FMCA 4MJDA 3KE7A 3EN8A 3PCRA 5KP1A 1EQKA 1BRKA 2CWUA 2CK3H 2YFLB 2C11A 3G713 1O7PB 3KN4A 3I0YA 1U5OA 2CFWA 2P05A 3AMOB 3BNCA 1BNFA 5IEPA 1FGRA 3H51A 3SYUA 1A67A 1Q7HA 1BSAA 4DKIA 4MEIA 3LH4A 4WHAA 2K54A 3CNXA 3KSED 1IV9A 1W6YA 3SXXA 1ASKA 5EEOA 1RN7A 3OXAA 1VQN3 3EB8A 7RNTA 1BU4A 1TJDA 3BNBA 3K0ZA 1IQ8A 1IDPA 2CFKA 1IVWA 5G1LA 1VQ93 1BUQA 1UCIA 1YJN3 3ZG0A 1RNBA 1O7MB 1OF5B 1B3SA 2OTL3 3T0UA 3ALAA 3URPA 3KSPA 3WODG 1EKMA 6RNTA 3K63A 4BL2A 3OW22 1RCKA 2RBIA 1TRPA 1S5AA 4EC6A 4CPKA 2F5WA 1LOWA 5IG0A 5GSPA 1CQSA 1GYBA 3NX0A 1E3RA 2XFSA 3HOHA 2ML6A 5D82A 5G2GA 3WOEB 2BMQB 3LTCA 1DYUA 4GSPA 1RGFA 3LTDA 1N8R4 4FMDA 1B21A 3LTBA 3JVCA 2BMOB 1OGXA 3EBYA 3LTAA 2GXFA 3NXJA 3WDGB 3OWSA 3S28A 5BIRA 1IVVA 2HMKB 3AGNA 1W4NA 3B7CA 1WNHA 3NUVA 4KFDA 2CW9A 2SBLA 2WO0A 3MG1A 4XBXA 1IYYA 1BGSA 2BU4A 2MF7A 1I3FA 3X3YA 1FW7A 3DGYA 2L4VA 2W56B 5M18A 2MC8A 1FGMA 1BRSA 1RN4A 2BMRB 3CCQ3 1GMPA 2LQVA 3V98A 3DGLA 2L1SA 1KC84 1VQK3 3N54B 3SX1A 3BIRA 1RDSA 1RJOA 1OGZA 3I553 2XEPA 3K5TA 1YIJ3 2GBWB 3MWZA 4HM0B 1B2MA 2W6JH 3LMLA 4ORLA 1Q814 1TTOA 4K90B 1UUWB 3A76A 3EBTA 3KIIA 1DMMA 9RNTA 2FGTA 2E2TA 1RLSA 1OF5A 1GSPA 4EXRA 1I8VA 1O7HB 3CNMA 1YGWA 4OK0A 2CHCA 2BNGA 1M1K4 1LQGC 2P0MA 3DGMA 1GY5A 1JB5A 2WGQA 1LNIA 3STDA 4AKYA 1RSNA 2IY2A 1T2HA 5DREA 1SIIA 2OTJ3 1FUWA 3F40A 4HM4B 1UW1A 3HZPA 1OCVA 4N6UA 3RNTA 3UJMA 3NBRA 4BTWA 2GSPA 2PNCA 1K734 1I2GA 4BU4A 4XBYA 3N8BA 2FXTA 2KAAA 3F7SA 3GRDA 3CXC2 2HMOB 1JRQA 2IUKA 1MWTA 1JN5A 1J2BA 2Y74A 1WMNA 1ISKA 4HKVB 3F8XA 1JJ22 1ROVA 4WYKA 5AIFA 3PS8A 1D6UA 2A15A 4H61A 2Z77A 4HAAA 4HM2B 3NV0A 4IPBA 1RGAA 1M9GA 1TU5A 1DETA 4N3VA 3O8YA 1QAKA 2F86B 4AKZA 2IUJA 3FZWA 4N6NB 5IW9A 1YIT3 3U97A 1M1XB 4K1VA 3VGNA 4KZ1A 7GSPA 3AHWA 1K9M4 2Q07A 5DRVA 1EEJA 3D79A 3K7CA 2W03A 3SOAA 4FCJA 1NJI4 4EV2A 4O8SA 1T3BA 5LC6A 3DXOA 4L8OA 1Q42A 2Z76A 1K8A4 1YNVX 3CCJ3 1W5ZA 1NNVA 1RGEA 1UI7A 2IYJA 3DUKA 4GHOA 1IT7A 3FSDA 2KF5A 4KFFA 1F8NA 1MWRA 1RRLA 4RNZA 2R4IA 2OWPA 2IMJA 3BU4A 3RGRA 5ELJA 1JBTA 4R9KA 3EF8A 5EVHA 4EW5A 2F98A 1DMQA 3MHEA 5TGNA 1AR0A 2D1WA 2QEX3 1JZOA 1RGLA 4MMYB 3WMDA 1EUIC 1DVCA 1RN1A 3G4S3 3IJEB 4J9AA 1HU9A 1R4CA 1TFOA 2C4BA 4CJNA 3UB1A 3DH2A 3IMAB 3NBJA 4N6V0 1T2IA 3LZAA 4WYKB 3CME3 1N9JA 1W7CA 1ZX2A 1NDOB 2CC3A 1N5PA 3H3HA 5AEWB 5KP4A 4IIAA 2J8XB 3MYTA 1BOXA 2W9QA 3AGOA 3B4PA 1PYLA 5M19A 3WHOA 1U8CB 1US1A 4ILFA 2STDA 1Y4KA 2XRXB 2LYXA 5I97A 2Y73A 2BO9B 2Z6BA 2KF6A 2XR8B 2B24B 1CYUA 3FG3A 1Q824 1MWSA 3GWRA 1TFKA 4NHFA 4OUQA 1NU3A 2BT3A 2D42A 3MKIA 1LNHA 2OQEA 2KCDA 1AY7A 5STDA 3ROBA 4HOHA 2IA7A 1KQS2 4HBRA 4HM6B 1IVXA 2KF3A 2Z7AA 3FKAA 3HIIA 3F14A 4K61A 1YJW3 1ULJB 3Q3FA 3D5GA 1QMAA 1JB4A 2H0HA 1UCKA 1OACA 1I2EA 4FCMA 4KT3B 1O7WB 4L7KA 3D4AA 2W2CA 1YI23 4Q53A 1RRHA 1UDII 1X1WA 3HIGA 3CCE3 1A2PA 3CD63 2RGQA 3OWUA 1IT8A 1B2ZA 8CHOA 1LOXA 1D6YA 4N6TA 3GZXB 2F99A 3L0RA 1JV2B 4FMAA 1FZUA 5D83A 1LXEA 4XDWA 4HM3B
chains in the Genus database with same CATH topology
3I563 3WA2X 2WGOA 5IENA 1JNQA 2CWTA 2CWVA 3EE1A 2UX0A 3JUOA 1W01A 2XF3A 1K41A 2P0XA 3KFQC 1IV7A 4FR9A 4PEJA 1YJ93 3X40A 3JUQA 3B4OA 4O2HA 5CLKA 2K0MA 4GL6A 2HMJB 3FH1A 1GS3A 4O3VA 4IT7A 2OQEC 3PYJA 3SVAA 1Q40B 1DVDA 1E3VA 1D6ZA 3IPTA 1KD14 1STFI 4TX4A 4XBTA 3SOYA 3T8NA 3WA3A 1OHOA 2KXGA 3AMOA 1QALA 4I4KA 2W0QA 1IK3A 1OHPA 4LSOA 5AYSC 1W02A 3HI7A 3G16A 3HX8A 3CCS3 3DGOA 4LMIA 1UUVB 1EG9B 4HZBB 1DMNA 3EN1B 3CCM3 2OOVC 1Z1SA 3U1WA 3VF1A 1NWWA 2RSXA 3E99A 1PFPA 1QAFA 1VZZA 3JUNA 5HGRA 3V99A 1VQ43 4G1MB 4J8TA 3LT8A 2W04A 2GBXB 2QGUA 5AIIA 1WQLB 5IG3A 3CC73 3RDEA 2HMLB 2HMMB 2YX9A 3Q2PA 1VQ63 2YFJB 4EV5A 1K28A 3GAXA 1Q7Y4 4U13A 2XGNA 1O7GB 3SEDA 1TUHA 3X3XA 3MSOA 1GD4A 1M904 1ROAA 5LC7A 4XB5A 1JKGB 4N6MA 3DM8A 1L5GB 2INXA 2XSOB 4JRFA 1NB3I 4N6OB 3NBBA 4X2HA 3OWYA 4HJLB 2WOHA 4FMBA 2W56A 1N8QA 3X3ZA 1WMPA 3EX9A 2BHMA 4OVMA 3UL6A 1ULIB 2GEXA 3NHXA 3PZWA 3KZTA 1W2ZA 1VQ53 3GZRA 1SIHA 3F7XA 2GU1A 1VQO3 7STDA 4X2OA 1OPYA 1S723 3F8HA 3NM7A 1W6CA 5AI1A 1CYVA 3G8ZA 3NQYA 5AYRB 2CFGA 4XM4A 2CG1A 3RGAA 5CXOA 1Q864 1SQWA 5FGOA 4HVNA 1OH0A 1PU4A 5CF1A 4K1UA 3X41A 3BNEA 3D9RA 3S29A 4R1KA 3FG4A 5IG4A 1VQM3 3D3LA 2I9WA 3BLZA 3FCSB 2OOVA 1VQ73 3OV4A 2B1XB 5AIGA 1IU7A 3BNDA 1OHSA 1A2VA 4ZM8A 3PCSA 1QJGA 5JPUA 1SPUA 1ZO2A 2O9UX 1YVBI 1AVLA 3NQZA 5AIHA 5FW5A 4GB5A 5JPPA 4WFOA 3B8LA 1FGQA 1JN5B 1V74A 4EYCA 1JB2A 3CCV3 4HM5B 3T8UA 1JKGA 3N9HA 3UL5A 1VQ83 1GY6A 4WWUC 2XFTA 3QRDA 5JBSA 3NV0B 3G0KA 4QWTA 5CK6A 1QVF2 3EQQB 2QA43 2ZL8A 1G96A 4R4KA 1CEWI 5CF2A 3VSYA 2CKFB 2JDIH 5BXQA 2GEYA 4WP5A 2HMNB 6STDA 3MG2A 3NM2A 4HM1B 3F9SA 1MNLA 3G6E3 1GY7A 1N5HA 2XGLA 4RBNA 4MMXB 4CCVA 3PGBA 3CCR3 2CFDA 1WMOA 3CC23 1FGTA 3ECFA 4HM7B 1A90A 1O7NB 2CIUA 2JQ5A 3EJVA 1W2B2 4HM8B 3FG1A 2PZVA 2CG0A 5D81A 1IVUA 2XH9A 2WOFA 1OUNA 3JUMA 3FGYA 3QK9A 4NREA 3K9MC 3S67A 1MOLA 1A2KA 4STDA 1YHQ3 3SLUA 3EC9A 1NB5I 1C7HA 3CU3A 2E2UA 2C10A 3V92A 2CFLA 3FLJA 3OX9A 4EBGA 3MG3A 3X42A 3JUPA 2RFRA 1T5YA 1KSIA 3UNLA 3S5CA 4N6LA 3J7Yd 3DY5A 3EHCA 1FGOA 1E97A 3GZBA 1TIJA 2E2VA 3CC43 4HYZA 2OCTA 1KWIA 5IEOA 4BTYA 3KKGA 4H3UA 4RNYA 5EQLA 3HK4A 4LZIA 3CCU3 5IG5A 1UI8A 3Q1CA 2O3OA 1YGEA 2W9PA 1HKXA 1AVKA 4R80A 4CDLA 3DGNA 5AEUB 1FA3A 2ZDJA 3FF0A 1GD3A 1AV4A 3M8CA 2KRTA 2P09A 2ML5A 4FCZA 3ER7A 2RCDA 4LGQA 1QVG2 4XDVA 1WTHA 1RKYA 3TDGA 3S27A 2FNQA 1N9EA 4MMZB 3LXUX 4KFEA 4O02B 4L8PA 1STDA 2P38A 4AEQA 2M7OA 5IF6A 3LT9A 3LYGA 1IQXA 4LEHA 1SJWA 5KP3A 3WOFB 3CMA3 4BTXA 1VQP3 4JF8A 3DMCA 5BVBA 2QIYA 3PXMA 3CPOA 5ELUA 1W00A 2XSHB 3CCL3 1W6GA 2V1LA 1NO3A 1TP6A 1EA2A 2GU3A 3Q90A 2CH9A 3MPHA 1LVNA 4HZ9B 4RZMA 5A0OB 2YFIB 5IERA 3LOYA 3BB9A 4KVHA 3FF2A 3DZLA 1VQL3 1IQYA 1Q40A 3GZYB 4FMCA 4MJDA 3KE7A 3EN8A 3PCRA 5KP1A 1EQKA 2CWUA 2YFLB 2CK3H 3G713 2C11A 1O7PB 3KN4A 3I0YA 1U5OA 2CFWA 2P05A 3AMOB 3BNCA 5IEPA 1FGRA 3H51A 1A67A 4MEIA 3LH4A 4WHAA 2K54A 3CNXA 3KSED 1IV9A 1W6YA 3SXXA 1ASKA 5EEOA 1RN7A 3OXAA 1VQN3 3EB8A 3BNBA 3K0ZA 1IQ8A 1IDPA 2CFKA 1IVWA 1VQ93 1BUQA 1YJN3 1O7MB 1OF5B 2OTL3 3T0UA 3ALAA 3KSPA 3WODG 1EKMA 3K63A 3OW22 1S5AA 4EC6A 5IG0A 1CQSA 1GYBA 3NX0A 1E3RA 2XFSA 5D82A 2ML6A 5G2GA 3WOEB 3CPW2 2BMQB 3LTCA 1DYUA 3LTDA 1N8R4 4FMDA 3LTBA 3JVCA 2BMOB 1OGXA 3EBYA 3LTAA 2GXFA 3NXJA 3WDGB 3OWSA 3S28A 1IVVA 2HMKB 3B7CA 1W4NA 3NUVA 1WNHA 4KFDA 4R9LA 2CW9A 2SBLA 2WO0A 3MG1A 4XBXA 3X3YA 2L4VA 2W56B 2MC8A 1FGMA 2BMRB 3CCQ3 2LQVA 3V98A 3DGLA 1KC84 1VQK3 3N54B 3SX1A 3I553 1RJOA 1OGZA 2XEPA 3K5TA 1YIJ3 2GBWB 3MWZA 4HM0B 2W6JH 3LMLA 4ORLA 1Q814 4K90B 1UUWB 3A76A 3EBTA 3KIIA 1DMMA 2FGTA 2E2TA 1OF5A 4EXRA 3CNMA 1O7HB 4OK0A 2CHCA 2BNGA 1M1K4 2P0MA 3DGMA 1GY5A 1JB5A 2WGQA 4AKYA 3STDA 5DREA 1SIIA 2OTJ3 1FUWA 3F40A 4HM4B 1UW1A 3HZPA 1OCVA 4N6UA 3UJMA 3NBRA 4BTWA 2PNCA 1K734 4XBYA 3N8BA 2FXTA 3F7SA 3GRDA 3CXC2 2HMOB 1JRQA 2IUKA 1JN5A 1J2BA 2Y74A 1WMNA 1ISKA 4HKVB 3F8XA 1JJ22 1ROVA 4WYKA 5AIFA 3PS8A 1D6UA 2A15A 4H61A 2Z77A 4HM2B 3NV0A 4IPBA 1M9GA 1TU5A 4N3VA 3O8YA 1QAKA 2F86B 4AKZA 2IUJA 3FZWA 4N6NB 5IW9A 1YIT3 3U97A 1M1XB 4K1VA 3VGNA 4KZ1A 1K9M4 2Q07A 5DRVA 3K7CA 2W03A 3SOAA 4FCJA 1NJI4 4EV2A 4O8SA 5LC6A 3DXOA 4L8OA 1Q42A 2Z76A 1K8A4 3CCJ3 1W5ZA 1UI7A 3DUKA 1IT7A 3FSDA 4KFFA 1F8NA 1RRLA 4RNZA 2R4IA 2OWPA 2IMJA 3RGRA 5ELJA 4R9KA 3EF8A 5EVHA 2F98A 1DMQA 3MHEA 5TGNA 1AR0A 2D1WA 2QEX3 4MMYB 3WMDA 1DVCA 3G4S3 3IJEB 4J9AA 1HU9A 1R4CA 1TFOA 3UB1A 3IMAB 3NBJA 4N6V0 3LZAA 4WYKB 3CME3 1N9JA 1W7CA 1ZX2A 1NDOB 2CC3A 1N5PA 3H3HA 5AEWB 5KP4A 4IIAA 3MYTA 2W9QA 3B4PA 1U8CB 1US1A 2STDA 1Y4KA 2XRXB 2LYXA 5I97A 2Y73A 2BO9B 2Z6BA 2XR8B 2B24B 1CYUA 3FG3A 1Q824 3GWRA 1TFKA 4NHFA 4OUQA 1NU3A 2BT3A 2D42A 3MKIA 1LNHA 2OQEA 2KCDA 5STDA 3ROBA 2IA7A 1KQS2 4HBRA 4HM6B 1IVXA 2Z7AA 4K61A 3FKAA 3HIIA 3F14A 1YJW3 1ULJB 1QMAA 1JB4A 1OACA 4FCMA 1O7WB 4L7KA 2W2CA 1YI23 4Q53A 1RRHA 3HIGA 3CCE3 3CD63 2RGQA 3OWUA 1IT8A 8CHOA 1LOXA 1D6YA 4N6TA 3GZXB 2F99A 3L0RA 1JV2B 4FMAA 2MF7A 5D83A 1LXEA 4XDWA 4HM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBR A;  5AIH A;  5FW5 A;  4GB5 A;  5JPP A;  3B8L A;  3DMC A;  5IEN A;  4XBY A;  1JN5 B;  5BVB A;  1JB2 A;  2QIY A;  3F7S A;  3GRD A;  3CPO A;  1JKG A;  2HMO B;  4HM5 B;  1W00 A;  1JN5 A;  2UX0 A;  2XSH B;  3JUO A;  3T8U A;  1W01 A;  1ISK A;  1TP6 A;  1EA2 A;  1GY6 A;  3Q90 A;  4HKV B;  3F8X A;  4WWU C;  4HZ9 B;  1K41 A;  3NV0 B;  3G0K A;  4PEJ A;  4RZM A;  2A15 A;  2YFI B;  2Z77 A;  4HM2 B;  3EQQ B;  5CK6 A;  5IER A;  3NV0 A;  3JUQ A;  3B4O A;  3BB9 A;  4KVH A;  5CLK A;  5CF2 A;  2HMJ B;  3FF2 A;  3DZL A;  3FH1 A;  1GS3 A;  3VSY A;  2CKF B;  4N3V A;  1Q40 A;  3GZY B;  4MJD A;  2GEY A;  3KE7 A;  2F86 B;  3EN8 A;  4WP5 A;  2HMN B;  5KP1 A;  6STD A;  1Q40 B;  3FZW A;  1E3V A;  3IPT A;  3MG2 A;  2YFL B;  3NM2 A;  4HM1 B;  3F9S A;  1O7P B;  4K1V A;  4XBT A;  3I0Y A;  1U5O A;  3SOY A;  3T8N A;  3VGN A;  5IEP A;  1GY7 A;  1OHO A;  3H51 A;  4I4K A;  1OHP A;  1W02 A;  3G16 A;  3HX8 A;  5DRV A;  3K7C A;  5AIF A;  2K54 A;  3CNX A;  3SOA A;  1W6Y A;  4FCJ A;  1ASK A;  1UUV B;  1EG9 B;  4LMI A;  4WYK A;  4HZB B;  1DMN A;  3DXO A;  3OXA A;  4L8O A;  3EN1 B;  1Q42 A;  1Z1S A;  2Z76 A;  3ECF A;  3K0Z A;  1BUQ A;  1NWW A;  1IDP A;  3E99 A;  1VZZ A;  3JUN A;  4HM7 B;  5HGR A;  3DUK A;  1O7N B;  2JQ5 A;  3FSD A;  1O7M B;  1OF5 B;  3EJV A;  4J8T A;  2GBX B;  2QGU A;  4HM8 B;  2R4I A;  2OWP A;  2IMJ A;  2PZV A;  3RGR A;  5D81 A;  5AII A;  3KSP A;  1WQL B;  5IG3 A;  4R9K A;  3EF8 A;  5EVH A;  5D83 A;  2HML B;  2F98 A;  2HMM B;  1DMQ A;  3MHE A;  5TGN A;  1AR0 A;  1OUN A;  2YFJ B;  3JUM A;  3FGY A;  3WMD A;  1S5A A;  4U13 A;  1A2K A;  4STD A;  5IG0 A;  1O7G B;  1CQS A;  1GYB A;  3EC9 A;  1E3R A;  4J9A A;  5D82 A;  1TUH A;  5G2G A;  3SED A;  2BMQ B;  1C7H A;  3CU3 A;  3MSO A;  3LZA A;  4WYK B;  4XB5 A;  1JKG B;  3DM8 A;  1ZX2 A;  2BMO B;  1NDO B;  3FLJ A;  1OGX A;  3EBY A;  3OX9 A;  3MG3 A;  3JUP A;  2GXF A;  3H3H A;  2RFR A;  3NXJ A;  2INX A;  2XSO B;  5AEW B;  5KP4 A;  4IIA A;  3OWS A;  3UNL A;  3S5C A;  2HMK B;  3B7C A;  3MYT A;  3NUV A;  4R9L A;  3EHC A;  4XBX A;  4X2H A;  3MG1 A;  3OWY A;  3B4P A;  4HJL B;  1E97 A;  3EX9 A;  3GZB A;  2STD A;  4OVM A;  2XRX B;  1ULI B;  2GEX A;  3NHX A;  5IEO A;  3KZT A;  2BMR B;  3KKG A;  4H3U A;  2XR8 B;  3HK4 A;  3GZR A;  5IG5 A;  2B24 B;  3F7X A;  7STD A;  4X2O A;  1HKX A;  1OPY A;  3F8H A;  1OGZ A;  3GWR A;  4OUQ A;  1NU3 A;  3MKI A;  4CDL A;  5AEU B;  2GBW B;  4HM0 B;  3FF0 A;  5AI1 A;  3M8C A;  4ORL A;  3G8Z A;  1UUW B;  5STD A;  3A76 A;  3EBT A;  3ROB A;  4XM4 A;  1DMM A;  2Z7A A;  4HM6 B;  3RGA A;  3FKA A;  3F14 A;  5CXO A;  3ER7 A;  1ULJ B;  2RCD A;  1OF5 A;  1QMA A;  1JB4 A;  4LGQ A;  4HVN A;  3CNM A;  1O7H B;  4XDV A;  1OH0 A;  4FCM A;  2CHC A;  2BNG A;  4K1U A;  5BXQ A;  1O7W B;  5CF1 A;  3D9R A;  1GY5 A;  1JB5 A;  2W2C A;  4L7K A;  4R1K A;  4Q53 A;  5IG4 A;  2I9W A;  1STD A;  3BLZ A;  4L8P A;  3STD A;  3OV4 A;  2B1X B;  5AIG A;  5IF6 A;  1OHS A;  2RGQ A;  3OWU A;  5DRE A;  1QJG A;  3LYG A;  3UJM A;  8CHO A;  4LEH A;  5JPU A;  1ZO2 A;  3GZX B;  1SJW A;  2F99 A;  5KP3 A;  3F40 A;  4HM4 B;  3HZP A;  1OCV A;  4XDW A;  4HM3 B; 
#chains in the Genus database with same CATH topology
 3I56 3;  1I0V A;  1GOU A;  3WA2 X;  2WGO A;  5IEN A;  1JNQ A;  1MWU A;  2CWT A;  2CWV A;  3EE1 A;  2UX0 A;  3JUO A;  3ZG5 A;  1W01 A;  2KF4 A;  2XF3 A;  1K41 A;  2P0X A;  3KFQ C;  1IV7 A;  1BAO A;  4FR9 A;  4PEJ A;  1YJ9 3;  1X1Y A;  3JUQ A;  3B4O A;  4O2H A;  5CLK A;  2K0M A;  3GSP A;  4GL6 A;  3X40 A;  2ZA4 A;  1B2S A;  2HMJ B;  1LQM B;  3FH1 A;  1GS3 A;  1RTU A;  4O3V A;  4IT7 A;  1JBR A;  1RMS A;  2OQE C;  3PYJ A;  3SVA A;  1Q40 B;  1DVD A;  1E3V A;  1D6Z A;  3IPT A;  1BSD A;  1STF I;  1KD1 4;  4TX4 A;  4XBT A;  3SOY A;  3T8N A;  4LYL B;  3WA3 A;  1OHO A;  1UUG B;  2KXG A;  3AMO A;  1QAL A;  1R4Y A;  2W0Q A;  4I4K A;  1OHP A;  4LSO A;  5AYS C;  1W02 A;  3HI7 A;  1IK3 A;  3G16 A;  3HX8 A;  3CCS 3;  3DGO A;  4LMI A;  1ZGX A;  1UUV B;  1EG9 B;  1BRN L;  3D5I A;  4HZB B;  1DMN A;  3EN1 B;  3CCM 3;  2OOV C;  1Z1S A;  4J5K A;  3U1W A;  3VF1 A;  1NWW A;  1UGI A;  2RSX A;  3E99 A;  1PFP A;  1QAF A;  1VZZ A;  3JUN A;  5HGR A;  3V99 A;  1VQ4 3;  4G1M B;  4J8T A;  3LT8 A;  1LOY A;  2W04 A;  1BNR A;  2GBX B;  2QGU A;  1C54 A;  1GOY A;  1BNJ A;  5AII A;  1WQL B;  5IG3 A;  1RGG A;  3CC7 3;  3RDE A;  1MGW A;  2HML B;  2HMM B;  2YX9 A;  3Q2P A;  1VQ6 3;  2YFJ B;  1RNT A;  1BAN A;  2H0I A;  4EV5 A;  1UCL A;  1K28 A;  3GAX A;  1Q7Y 4;  4U13 A;  1GOV A;  2XGN A;  1B27 A;  1O7G B;  5G1K A;  3SED A;  1TUH A;  1BRJ A;  3X3X A;  3MSO A;  1GD4 A;  1M90 4;  1ROA A;  5LC7 A;  4XB5 A;  1VQQ A;  1JKG B;  4N6M A;  3DM8 A;  1L5G B;  1G02 A;  2INX A;  2XSO B;  4JRF A;  1BRI A;  1I0X A;  1NB3 I;  4N6O B;  3NBB A;  4X2H A;  1BSB A;  1BSC A;  3OWY A;  2WOH A;  4HJL B;  4FMB A;  2W56 A;  1N8Q A;  1V58 A;  1RHL A;  2F5M A;  1WMP A;  3EX9 A;  1B2U A;  2BHM A;  1Q9E A;  3A5E A;  4OVM A;  3UL6 A;  3X3Z A;  1ULI B;  2GEX A;  3NHX A;  3PZW A;  3KZT A;  1W2Z A;  1VQ5 3;  1BRG A;  1SIH A;  3GZR A;  1GMR A;  3F7X A;  2GU1 A;  1VQO 3;  2F4Y A;  7STD A;  4X2O A;  1OPY A;  1S72 3;  3F8H A;  1I70 A;  3NM7 A;  2ZHX B;  1W6C A;  5AI1 A;  1CYV A;  1LRA A;  1RCL A;  3G8Z A;  3NQY A;  1BIR A;  2CFG A;  4XM4 A;  5AYR B;  2CG1 A;  3RGA A;  5CXO A;  1Q86 4;  1SQW A;  5FGO A;  4NPB A;  4HVN A;  1V57 A;  1OH0 A;  2K3D A;  1PU4 A;  5CF1 A;  4K1U A;  3X41 A;  3BNE A;  6GSP A;  3D9R A;  1JZD A;  4R1K A;  3FG4 A;  3S29 A;  5IG4 A;  1VQM 3;  2BIR A;  3D3L A;  2I9W A;  3BLZ A;  1B20 A;  3FCS B;  2OOV A;  1VQ7 3;  3OV4 A;  2B1X B;  5AIG A;  1IU7 A;  3BND A;  1OHS A;  1A2V A;  4ZM8 A;  3PCS A;  1QJG A;  5JPU A;  1JBS A;  1RGC A;  1ZS7 A;  1SPU A;  1ZO2 A;  2O9U X;  1YVB I;  1AVL A;  3NQZ A;  5AIH A;  2UUG C;  4GB5 A;  5FW5 A;  5JPP A;  4WFO A;  3CPW 2;  3B8L A;  1FGQ A;  1JN5 B;  1V74 A;  4EYC A;  1JB2 A;  3CCV 3;  4HM5 B;  3T8U A;  1JKG A;  3N9H A;  3UL5 A;  3WR2 A;  1VQ8 3;  1BUJ A;  1GY6 A;  4WWU C;  2XFT A;  3QRD A;  1X1U A;  5JBS A;  3NV0 B;  3AHS A;  3G0K A;  4QWT A;  5CK6 A;  1QVF 2;  3EQQ B;  2QA4 3;  2ZL8 A;  1G96 A;  1I2F A;  4R4K A;  1CEW I;  5CF2 A;  3KCH A;  3VSY A;  1G0T A;  2CKF B;  2JDI H;  5BXQ A;  5HOH A;  2GEY A;  1HZ1 A;  4J5G A;  2AAD A;  2HMN B;  4RNT A;  4WP5 A;  6STD A;  8RNT A;  3MG2 A;  3NM2 A;  4HM1 B;  3F9S A;  4I5Q A;  1MNL A;  1TRQ A;  3G6E 3;  1CH0 A;  1GY7 A;  1FUT A;  1N5H A;  2XGL A;  5M1A A;  4RBN A;  4MMX B;  1BRH A;  3PGB A;  4CCV A;  1FUS A;  3CCR 3;  1RGH A;  2CFD A;  1WMO A;  3CC2 3;  2SAR A;  1HYF A;  1FGT A;  5BU4 A;  3ECF A;  3ZFZ A;  1YVS A;  4HM7 B;  1A90 A;  1O7N B;  2CIU A;  2JQ5 A;  3EJV A;  1W2B 2;  1RGK A;  4HM8 B;  3FG1 A;  2PZV A;  2CG0 A;  5D81 A;  1X1X A;  1IVU A;  2H0G A;  2XH9 A;  2WOF A;  1OUN A;  3JUM A;  3FGY A;  3QK9 A;  4NRE A;  3K9M C;  3S67 A;  1MOL A;  1BSE A;  1A2K A;  4STD A;  1YHQ 3;  3SLU A;  1BNI A;  3EC9 A;  1I3I A;  2F56 A;  2R41 A;  1NB5 I;  4R9L A;  2CX0 A;  5RNT A;  1C7H A;  3CU3 A;  2E2U A;  2C10 A;  4BL3 A;  3V92 A;  2CFL A;  4BIR A;  3FLJ A;  3OX9 A;  4EBG A;  3MG3 A;  3X42 A;  3JUP A;  2RFR A;  1T5Y A;  1KSI A;  1PY3 A;  3S5C A;  4N6L A;  3UNL A;  3DY5 A;  3J7Y d;  1B2X A;  3EHC A;  1BNS A;  1FGO A;  1E97 A;  3GZB A;  1TIJ A;  2E2V A;  2RNT A;  3CC4 3;  4HYZ A;  2OCT A;  1KWI A;  5IEO A;  4BTY A;  3KKG A;  4H3U A;  4RNY A;  5EQL A;  3HK4 A;  4LZI A;  3CCU 3;  5IG5 A;  1UI8 A;  3Q1C A;  1AQZ A;  2CX1 A;  1YGE A;  2O3O A;  1HKX A;  1AVK A;  2W9P A;  4R80 A;  4CDL A;  3DGN A;  5AEU B;  1FA3 A;  2ZDJ A;  1BNG A;  3FF0 A;  1GD3 A;  1AV4 A;  3M8C A;  2KRT A;  2P09 A;  2ML5 A;  1BNE A;  1FYS A;  1LOV A;  3ER7 A;  2RCD A;  4FCZ A;  4LGQ A;  1QVG 2;  4XDV A;  1WTH A;  1RKY A;  3TDG A;  3S27 A;  2FNQ A;  1N9E A;  4MMZ B;  3LXU X;  4KFE A;  4O02 B;  1MGR A;  1STD A;  4L8P A;  2P38 A;  4AEQ A;  1UCJ A;  2M7O A;  5IF6 A;  3LT9 A;  3LYG A;  1IQX A;  4LEH A;  2HOH A;  1SJW A;  5KP3 A;  3WOF B;  1UGH I;  3CMA 3;  4BTX A;  1GMQ A;  1VQP 3;  4JF8 A;  3DMC A;  5BVB A;  2QIY A;  3PXM A;  3CPO A;  5ELU A;  1W00 A;  2UGI A;  2XSH B;  3CCL 3;  1W6G A;  2V1L A;  1NO3 A;  1TP6 A;  1EA2 A;  2GU3 A;  3Q90 A;  2CH9 A;  3MPH A;  1LVN A;  4HZ9 B;  4RZM A;  5A0O B;  2YFI B;  2AAE A;  5IER A;  1DE3 A;  1SAR A;  3LOY A;  3BB9 A;  4KVH A;  3FF2 A;  3DZL A;  1VQL 3;  1BVI A;  1IQY A;  1Q40 A;  3GZY B;  4FMC A;  4MJD A;  3KE7 A;  3EN8 A;  3PCR A;  5KP1 A;  1EQK A;  1BRK A;  2CWU A;  2CK3 H;  2YFL B;  2C11 A;  3G71 3;  1O7P B;  3KN4 A;  3I0Y A;  1U5O A;  2CFW A;  2P05 A;  3AMO B;  3BNC A;  1BNF A;  5IEP A;  1FGR A;  3H51 A;  3SYU A;  1A67 A;  1Q7H A;  1BSA A;  4DKI A;  4MEI A;  3LH4 A;  4WHA A;  2K54 A;  3CNX A;  3KSE D;  1IV9 A;  1W6Y A;  3SXX A;  1ASK A;  5EEO A;  1RN7 A;  3OXA A;  1VQN 3;  3EB8 A;  7RNT A;  1BU4 A;  1TJD A;  3BNB A;  3K0Z A;  1IQ8 A;  1IDP A;  2CFK A;  1IVW A;  5G1L A;  1VQ9 3;  1BUQ A;  1UCI A;  1YJN 3;  3ZG0 A;  1RNB A;  1O7M B;  1OF5 B;  1B3S A;  2OTL 3;  3T0U A;  3ALA A;  3URP A;  3KSP A;  3WOD G;  1EKM A;  6RNT A;  3K63 A;  4BL2 A;  3OW2 2;  1RCK A;  2RBI A;  1TRP A;  1S5A A;  4EC6 A;  4CPK A;  2F5W A;  1LOW A;  5IG0 A;  5GSP A;  1CQS A;  1GYB A;  3NX0 A;  1E3R A;  2XFS A;  3HOH A;  2ML6 A;  5D82 A;  5G2G A;  3WOE B;  2BMQ B;  3LTC A;  1DYU A;  4GSP A;  1RGF A;  3LTD A;  1N8R 4;  4FMD A;  1B21 A;  3LTB A;  3JVC A;  2BMO B;  1OGX A;  3EBY A;  3LTA A;  2GXF A;  3NXJ A;  3WDG B;  3OWS A;  3S28 A;  5BIR A;  1IVV A;  2HMK B;  3AGN A;  1W4N A;  3B7C A;  1WNH A;  3NUV A;  4KFD A;  2CW9 A;  2SBL A;  2WO0 A;  3MG1 A;  4XBX A;  1IYY A;  1BGS A;  2BU4 A;  2MF7 A;  1I3F A;  3X3Y A;  1FW7 A;  3DGY A;  2L4V A;  2W56 B;  5M18 A;  2MC8 A;  1FGM A;  1BRS A;  1RN4 A;  2BMR B;  3CCQ 3;  1GMP A;  2LQV A;  3V98 A;  3DGL A;  2L1S A;  1KC8 4;  1VQK 3;  3N54 B;  3SX1 A;  3BIR A;  1RDS A;  1RJO A;  1OGZ A;  3I55 3;  2XEP A;  3K5T A;  1YIJ 3;  2GBW B;  3MWZ A;  4HM0 B;  1B2M A;  2W6J H;  3LML A;  4ORL A;  1Q81 4;  1TTO A;  4K90 B;  1UUW B;  3A76 A;  3EBT A;  3KII A;  1DMM A;  9RNT A;  2FGT A;  2E2T A;  1RLS A;  1OF5 A;  1GSP A;  4EXR A;  1I8V A;  1O7H B;  3CNM A;  1YGW A;  4OK0 A;  2CHC A;  2BNG A;  1M1K 4;  1LQG C;  2P0M A;  3DGM A;  1GY5 A;  1JB5 A;  2WGQ A;  1LNI A;  3STD A;  4AKY A;  1RSN A;  2IY2 A;  1T2H A;  5DRE A;  1SII A;  2OTJ 3;  1FUW A;  3F40 A;  4HM4 B;  1UW1 A;  3HZP A;  1OCV A;  4N6U A;  3RNT A;  3UJM A;  3NBR A;  4BTW A;  2GSP A;  2PNC A;  1K73 4;  1I2G A;  4BU4 A;  4XBY A;  3N8B A;  2FXT A;  2KAA A;  3F7S A;  3GRD A;  3CXC 2;  2HMO B;  1JRQ A;  2IUK A;  1MWT A;  1JN5 A;  1J2B A;  2Y74 A;  1WMN A;  1ISK A;  4HKV B;  3F8X A;  1JJ2 2;  1ROV A;  4WYK A;  5AIF A;  3PS8 A;  1D6U A;  2A15 A;  4H61 A;  2Z77 A;  4HAA A;  4HM2 B;  3NV0 A;  4IPB A;  1RGA A;  1M9G A;  1TU5 A;  1DET A;  4N3V A;  3O8Y A;  1QAK A;  2F86 B;  4AKZ A;  2IUJ A;  3FZW A;  4N6N B;  5IW9 A;  1YIT 3;  3U97 A;  1M1X B;  4K1V A;  3VGN A;  4KZ1 A;  7GSP A;  3AHW A;  1K9M 4;  2Q07 A;  5DRV A;  1EEJ A;  3D79 A;  3K7C A;  2W03 A;  3SOA A;  4FCJ A;  1NJI 4;  4EV2 A;  4O8S A;  1T3B A;  5LC6 A;  3DXO A;  4L8O A;  1Q42 A;  2Z76 A;  1K8A 4;  1YNV X;  3CCJ 3;  1W5Z A;  1NNV A;  1RGE A;  1UI7 A;  2IYJ A;  3DUK A;  4GHO A;  1IT7 A;  3FSD A;  2KF5 A;  4KFF A;  1F8N A;  1MWR A;  1RRL A;  4RNZ A;  2R4I A;  2OWP A;  2IMJ A;  3BU4 A;  3RGR A;  5ELJ A;  1JBT A;  4R9K A;  3EF8 A;  5EVH A;  4EW5 A;  2F98 A;  1DMQ A;  3MHE A;  5TGN A;  1AR0 A;  2D1W A;  2QEX 3;  1JZO A;  1RGL A;  4MMY B;  3WMD A;  1EUI C;  1DVC A;  1RN1 A;  3G4S 3;  3IJE B;  4J9A A;  1HU9 A;  1R4C A;  1TFO A;  2C4B A;  4CJN A;  3UB1 A;  3DH2 A;  3IMA B;  3NBJ A;  4N6V 0;  1T2I A;  3LZA A;  4WYK B;  3CME 3;  1N9J A;  1W7C A;  1ZX2 A;  1NDO B;  2CC3 A;  1N5P A;  3H3H A;  5AEW B;  5KP4 A;  4IIA A;  2J8X B;  3MYT A;  1BOX A;  2W9Q A;  3AGO A;  3B4P A;  1PYL A;  5M19 A;  3WHO A;  1U8C B;  1US1 A;  4ILF A;  2STD A;  1Y4K A;  2XRX B;  2LYX A;  5I97 A;  2Y73 A;  2BO9 B;  2Z6B A;  2KF6 A;  2XR8 B;  2B24 B;  1CYU A;  3FG3 A;  1Q82 4;  1MWS A;  3GWR A;  1TFK A;  4NHF A;  4OUQ A;  1NU3 A;  2BT3 A;  2D42 A;  3MKI A;  1LNH A;  2OQE A;  2KCD A;  1AY7 A;  5STD A;  3ROB A;  4HOH A;  2IA7 A;  1KQS 2;  4HBR A;  4HM6 B;  1IVX A;  2KF3 A;  2Z7A A;  3FKA A;  3HII A;  3F14 A;  4K61 A;  1YJW 3;  1ULJ B;  3Q3F A;  3D5G A;  1QMA A;  1JB4 A;  2H0H A;  1UCK A;  1OAC A;  1I2E A;  4FCM A;  4KT3 B;  1O7W B;  4L7K A;  3D4A A;  2W2C A;  1YI2 3;  4Q53 A;  1RRH A;  1UDI I;  1X1W A;  3HIG A;  3CCE 3;  1A2P A;  3CD6 3;  2RGQ A;  3OWU A;  1IT8 A;  1B2Z A;  8CHO A;  1LOX A;  1D6Y A;  4N6T A;  3GZX B;  2F99 A;  3L0R A;  1JV2 B;  4FMA A;  1FZU A;  5D83 A;  1LXE A;  4XDW A;  4HM3 B; 
#chains in the Genus database with same CATH homology
 3I56 3;  3WA2 X;  2WGO A;  5IEN A;  1JNQ A;  2CWT A;  2CWV A;  3EE1 A;  2UX0 A;  3JUO A;  1W01 A;  2XF3 A;  1K41 A;  2P0X A;  3KFQ C;  1IV7 A;  4FR9 A;  4PEJ A;  1YJ9 3;  3X40 A;  3JUQ A;  3B4O A;  4O2H A;  5CLK A;  2K0M A;  4GL6 A;  2HMJ B;  3FH1 A;  1GS3 A;  4O3V A;  4IT7 A;  2OQE C;  3PYJ A;  3SVA A;  1Q40 B;  1DVD A;  1E3V A;  1D6Z A;  3IPT A;  1KD1 4;  1STF I;  4TX4 A;  4XBT A;  3SOY A;  3T8N A;  3WA3 A;  1OHO A;  2KXG A;  3AMO A;  1QAL A;  4I4K A;  2W0Q A;  1IK3 A;  1OHP A;  4LSO A;  5AYS C;  1W02 A;  3HI7 A;  3G16 A;  3HX8 A;  3CCS 3;  3DGO A;  4LMI A;  1UUV B;  1EG9 B;  4HZB B;  1DMN A;  3EN1 B;  3CCM 3;  2OOV C;  1Z1S A;  3U1W A;  3VF1 A;  1NWW A;  2RSX A;  3E99 A;  1PFP A;  1QAF A;  1VZZ A;  3JUN A;  5HGR A;  3V99 A;  1VQ4 3;  4G1M B;  4J8T A;  3LT8 A;  2W04 A;  2GBX B;  2QGU A;  5AII A;  1WQL B;  5IG3 A;  3CC7 3;  3RDE A;  2HML B;  2HMM B;  2YX9 A;  3Q2P A;  1VQ6 3;  2YFJ B;  4EV5 A;  1K28 A;  3GAX A;  1Q7Y 4;  4U13 A;  2XGN A;  1O7G B;  3SED A;  1TUH A;  3X3X A;  3MSO A;  1GD4 A;  1M90 4;  1ROA A;  5LC7 A;  4XB5 A;  1JKG B;  4N6M A;  3DM8 A;  1L5G B;  2INX A;  2XSO B;  4JRF A;  1NB3 I;  4N6O B;  3NBB A;  4X2H A;  3OWY A;  4HJL B;  2WOH A;  4FMB A;  2W56 A;  1N8Q A;  3X3Z A;  1WMP A;  3EX9 A;  2BHM A;  4OVM A;  3UL6 A;  1ULI B;  2GEX A;  3NHX A;  3PZW A;  3KZT A;  1W2Z A;  1VQ5 3;  3GZR A;  1SIH A;  3F7X A;  2GU1 A;  1VQO 3;  7STD A;  4X2O A;  1OPY A;  1S72 3;  3F8H A;  3NM7 A;  1W6C A;  5AI1 A;  1CYV A;  3G8Z A;  3NQY A;  5AYR B;  2CFG A;  4XM4 A;  2CG1 A;  3RGA A;  5CXO A;  1Q86 4;  1SQW A;  5FGO A;  4HVN A;  1OH0 A;  1PU4 A;  5CF1 A;  4K1U A;  3X41 A;  3BNE A;  3D9R A;  3S29 A;  4R1K A;  3FG4 A;  5IG4 A;  1VQM 3;  3D3L A;  2I9W A;  3BLZ A;  3FCS B;  2OOV A;  1VQ7 3;  3OV4 A;  2B1X B;  5AIG A;  1IU7 A;  3BND A;  1OHS A;  1A2V A;  4ZM8 A;  3PCS A;  1QJG A;  5JPU A;  1SPU A;  1ZO2 A;  2O9U X;  1YVB I;  1AVL A;  3NQZ A;  5AIH A;  5FW5 A;  4GB5 A;  5JPP A;  4WFO A;  3B8L A;  1FGQ A;  1JN5 B;  1V74 A;  4EYC A;  1JB2 A;  3CCV 3;  4HM5 B;  3T8U A;  1JKG A;  3N9H A;  3UL5 A;  1VQ8 3;  1GY6 A;  4WWU C;  2XFT A;  3QRD A;  5JBS A;  3NV0 B;  3G0K A;  4QWT A;  5CK6 A;  1QVF 2;  3EQQ B;  2QA4 3;  2ZL8 A;  1G96 A;  4R4K A;  1CEW I;  5CF2 A;  3VSY A;  2CKF B;  2JDI H;  5BXQ A;  2GEY A;  4WP5 A;  2HMN B;  6STD A;  3MG2 A;  3NM2 A;  4HM1 B;  3F9S A;  1MNL A;  3G6E 3;  1GY7 A;  1N5H A;  2XGL A;  4RBN A;  4MMX B;  4CCV A;  3PGB A;  3CCR 3;  2CFD A;  1WMO A;  3CC2 3;  1FGT A;  3ECF A;  4HM7 B;  1A90 A;  1O7N B;  2CIU A;  2JQ5 A;  3EJV A;  1W2B 2;  4HM8 B;  3FG1 A;  2PZV A;  2CG0 A;  5D81 A;  1IVU A;  2XH9 A;  2WOF A;  1OUN A;  3JUM A;  3FGY A;  3QK9 A;  4NRE A;  3K9M C;  3S67 A;  1MOL A;  1A2K A;  4STD A;  1YHQ 3;  3SLU A;  3EC9 A;  1NB5 I;  1C7H A;  3CU3 A;  2E2U A;  2C10 A;  3V92 A;  2CFL A;  3FLJ A;  3OX9 A;  4EBG A;  3MG3 A;  3X42 A;  3JUP A;  2RFR A;  1T5Y A;  1KSI A;  3UNL A;  3S5C A;  4N6L A;  3J7Y d;  3DY5 A;  3EHC A;  1FGO A;  1E97 A;  3GZB A;  1TIJ A;  2E2V A;  3CC4 3;  4HYZ A;  2OCT A;  1KWI A;  5IEO A;  4BTY A;  3KKG A;  4H3U A;  4RNY A;  5EQL A;  3HK4 A;  4LZI A;  3CCU 3;  5IG5 A;  1UI8 A;  3Q1C A;  2O3O A;  1YGE A;  2W9P A;  1HKX A;  1AVK A;  4R80 A;  4CDL A;  3DGN A;  5AEU B;  1FA3 A;  2ZDJ A;  3FF0 A;  1GD3 A;  1AV4 A;  3M8C A;  2KRT A;  2P09 A;  2ML5 A;  4FCZ A;  3ER7 A;  2RCD A;  4LGQ A;  1QVG 2;  4XDV A;  1WTH A;  1RKY A;  3TDG A;  3S27 A;  2FNQ A;  1N9E A;  4MMZ B;  3LXU X;  4KFE A;  4O02 B;  4L8P A;  1STD A;  2P38 A;  4AEQ A;  2M7O A;  5IF6 A;  3LT9 A;  3LYG A;  1IQX A;  4LEH A;  1SJW A;  5KP3 A;  3WOF B;  3CMA 3;  4BTX A;  1VQP 3;  4JF8 A;  3DMC A;  5BVB A;  2QIY A;  3PXM A;  3CPO A;  5ELU A;  1W00 A;  2XSH B;  3CCL 3;  1W6G A;  2V1L A;  1NO3 A;  1TP6 A;  1EA2 A;  2GU3 A;  3Q90 A;  2CH9 A;  3MPH A;  1LVN A;  4HZ9 B;  4RZM A;  5A0O B;  2YFI B;  5IER A;  3LOY A;  3BB9 A;  4KVH A;  3FF2 A;  3DZL A;  1VQL 3;  1IQY A;  1Q40 A;  3GZY B;  4FMC A;  4MJD A;  3KE7 A;  3EN8 A;  3PCR A;  5KP1 A;  1EQK A;  2CWU A;  2YFL B;  2CK3 H;  3G71 3;  2C11 A;  1O7P B;  3KN4 A;  3I0Y A;  1U5O A;  2CFW A;  2P05 A;  3AMO B;  3BNC A;  5IEP A;  1FGR A;  3H51 A;  1A67 A;  4MEI A;  3LH4 A;  4WHA A;  2K54 A;  3CNX A;  3KSE D;  1IV9 A;  1W6Y A;  3SXX A;  1ASK A;  5EEO A;  1RN7 A;  3OXA A;  1VQN 3;  3EB8 A;  3BNB A;  3K0Z A;  1IQ8 A;  1IDP A;  2CFK A;  1IVW A;  1VQ9 3;  1BUQ A;  1YJN 3;  1O7M B;  1OF5 B;  2OTL 3;  3T0U A;  3ALA A;  3KSP A;  3WOD G;  1EKM A;  3K63 A;  3OW2 2;  1S5A A;  4EC6 A;  5IG0 A;  1CQS A;  1GYB A;  3NX0 A;  1E3R A;  2XFS A;  5D82 A;  2ML6 A;  5G2G A;  3WOE B;  3CPW 2;  2BMQ B;  3LTC A;  1DYU A;  3LTD A;  1N8R 4;  4FMD A;  3LTB A;  3JVC A;  2BMO B;  1OGX A;  3EBY A;  3LTA A;  2GXF A;  3NXJ A;  3WDG B;  3OWS A;  3S28 A;  1IVV A;  2HMK B;  3B7C A;  1W4N A;  3NUV A;  1WNH A;  4KFD A;  4R9L A;  2CW9 A;  2SBL A;  2WO0 A;  3MG1 A;  4XBX A;  3X3Y A;  2L4V A;  2W56 B;  2MC8 A;  1FGM A;  2BMR B;  3CCQ 3;  2LQV A;  3V98 A;  3DGL A;  1KC8 4;  1VQK 3;  3N54 B;  3SX1 A;  3I55 3;  1RJO A;  1OGZ A;  2XEP A;  3K5T A;  1YIJ 3;  2GBW B;  3MWZ A;  4HM0 B;  2W6J H;  3LML A;  4ORL A;  1Q81 4;  4K90 B;  1UUW B;  3A76 A;  3EBT A;  3KII A;  1DMM A;  2FGT A;  2E2T A;  1OF5 A;  4EXR A;  3CNM A;  1O7H B;  4OK0 A;  2CHC A;  2BNG A;  1M1K 4;  2P0M A;  3DGM A;  1GY5 A;  1JB5 A;  2WGQ A;  4AKY A;  3STD A;  5DRE A;  1SII A;  2OTJ 3;  1FUW A;  3F40 A;  4HM4 B;  1UW1 A;  3HZP A;  1OCV A;  4N6U A;  3UJM A;  3NBR A;  4BTW A;  2PNC A;  1K73 4;  4XBY A;  3N8B A;  2FXT A;  3F7S A;  3GRD A;  3CXC 2;  2HMO B;  1JRQ A;  2IUK A;  1JN5 A;  1J2B A;  2Y74 A;  1WMN A;  1ISK A;  4HKV B;  3F8X A;  1JJ2 2;  1ROV A;  4WYK A;  5AIF A;  3PS8 A;  1D6U A;  2A15 A;  4H61 A;  2Z77 A;  4HM2 B;  3NV0 A;  4IPB A;  1M9G A;  1TU5 A;  4N3V A;  3O8Y A;  1QAK A;  2F86 B;  4AKZ A;  2IUJ A;  3FZW A;  4N6N B;  5IW9 A;  1YIT 3;  3U97 A;  1M1X B;  4K1V A;  3VGN A;  4KZ1 A;  1K9M 4;  2Q07 A;  5DRV A;  3K7C A;  2W03 A;  3SOA A;  4FCJ A;  1NJI 4;  4EV2 A;  4O8S A;  5LC6 A;  3DXO A;  4L8O A;  1Q42 A;  2Z76 A;  1K8A 4;  3CCJ 3;  1W5Z A;  1UI7 A;  3DUK A;  1IT7 A;  3FSD A;  4KFF A;  1F8N A;  1RRL A;  4RNZ A;  2R4I A;  2OWP A;  2IMJ A;  3RGR A;  5ELJ A;  4R9K A;  3EF8 A;  5EVH A;  2F98 A;  1DMQ A;  3MHE A;  5TGN A;  1AR0 A;  2D1W A;  2QEX 3;  4MMY B;  3WMD A;  1DVC A;  3G4S 3;  3IJE B;  4J9A A;  1HU9 A;  1R4C A;  1TFO A;  3UB1 A;  3IMA B;  3NBJ A;  4N6V 0;  3LZA A;  4WYK B;  3CME 3;  1N9J A;  1W7C A;  1ZX2 A;  1NDO B;  2CC3 A;  1N5P A;  3H3H A;  5AEW B;  5KP4 A;  4IIA A;  3MYT A;  2W9Q A;  3B4P A;  1U8C B;  1US1 A;  2STD A;  1Y4K A;  2XRX B;  2LYX A;  5I97 A;  2Y73 A;  2BO9 B;  2Z6B A;  2XR8 B;  2B24 B;  1CYU A;  3FG3 A;  1Q82 4;  3GWR A;  1TFK A;  4NHF A;  4OUQ A;  1NU3 A;  2BT3 A;  2D42 A;  3MKI A;  1LNH A;  2OQE A;  2KCD A;  5STD A;  3ROB A;  2IA7 A;  1KQS 2;  4HBR A;  4HM6 B;  1IVX A;  2Z7A A;  4K61 A;  3FKA A;  3HII A;  3F14 A;  1YJW 3;  1ULJ B;  1QMA A;  1JB4 A;  1OAC A;  4FCM A;  1O7W B;  4L7K A;  2W2C A;  1YI2 3;  4Q53 A;  1RRH A;  3HIG A;  3CCE 3;  3CD6 3;  2RGQ A;  3OWU A;  1IT8 A;  8CHO A;  1LOX A;  1D6Y A;  4N6T A;  3GZX B;  2F99 A;  3L0R A;  1JV2 B;  4FMA A;  2MF7 A;  5D83 A;  1LXE A;  4XDW A;  4HM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...