3FSDA

Crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
121
structure length
121
Chain Sequence
DDIAFYEERLRAAMLTGDLKGLETLLADDLAFVDHTGCVKTKQTHLEPYRAGLLKLSRLDLSDAVVRAAGEDGRVVVVRAVTAGVYDGEAFTETLRFTRIWRRTQGPAGWKLVAGHCSVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NTF2-like protein of unknown function in nutrient uptake
publication title Crystal structure of NTF2-like protein of unknown function in nutrient uptake (YP_427473.1) from RHODOSPIRILLUM RUBRUM ATCC 11170 at 1.70 A resolution
rcsb
source organism Rhodospirillum rubrum atcc 11170
total genus 35
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fsdA00
5KP1A 2QGUA 3CNXA 1EA2A 3EN8A 1OCVA 5FW5A 1QMAA 1A2KA 2HMLB 4IIAA 1W6YA 3UNLA 1OPYA 5EVHA 3EHCA 5IERA 1ULJB 3EN1B 1JB2A 3GZYB 5IG0A 1STDA 3KKGA 4XM4A 5AIGA 5AIIA 2W2CA 5TGNA 1GY6A 1JKGB 3IPTA 1OHPA 3NUVA 3G16A 5CK6A 3B8LA 5IENA 5D81A 3ER7A 1U5OA 2B24B 3RGAA 4HM3B 3WMDA 5IG4A 5KP3A 4K1UA 4R1KA 2INXA 3FGYA 3H51A 1DMNA 4XBYA 2HMMB 3H3HA 2HMKB 2RCDA 1BUQA 4HJLB 3K0ZA 3CU3A 4FCJA 2CKFB 5JPPA 1WQLB 3M8CA 3GZRA 6STDA 1E97A 1Q40B 4HM8B 4K1VA 4RZMA 4J9AA 4GB5A 3B7CA 3HZPA 3JUQA 3FZWA 5AEWB 4HZBB 5IG5A 5CLKA 3MG3A 2OWPA 5KP4A 3Q90A 3GZBA 3EJVA 3KSPA 4XBXA 2CHCA 1E3VA 3EC9A 2GXFA 3K7CA 2HMJB 4HKVB 3NV0A 3STDA 1TP6A 3EQQB 1JB5A 3S5CA 3FKAA 5CXOA 1GY5A 3T8NA 3NHXA 3NV0B 3ROBA 3F8HA 3UJMA 4OUQA 4ORLA 1JKGA 5D83A 2STDA 4HM5B 3KE7A 3FF0A 5IF6A 2BMRB 3F7SA 5D82A 4R9LA 5CF2A 3JUOA 2K54A 3GWRA 3DXOA 4L8OA 1NU3A 4HM0B 2F98A 2HMNB 4XDWA 3FF2A 1GY7A 2GEXA 3VGNA 3DM8A 3KZTA 1VZZA 3G0KA 1CQSA 3EF8A 1IDPA 1W01A 3T8UA 2F86B 4MJDA 2XSHB 1E3RA 4XB5A 1QJGA 5STDA 1GYBA 3BLZA 2YFJB 1Q40A 4PEJA 3FH1A 2YFIB 1C7HA 3GRDA 4CDLA 3CNMA 3G8ZA 2XR8B 2XSOB 1W02A 1O7NB 1W00A 1OF5B 4HM6B 4HM4B 1Q42A 4X2OA 7STDA 2Z77A 1ZO2A 2Z76A 3B4OA 4LGQA 1OGZA 2PZVA 1O7HB 3I0YA 5IEPA 1Z1SA 4J8TA 3MG1A 3VSYA 1ULIB 4FCMA 3F40A 4OVMA 3NXJA 3EBTA 2A15A 2GEYA 3OX9A 2R4IA 1ASKA 3DUKA 2I9WA 4STDA 1TUHA 1OGXA 2QIYA 3NM2A 3DMCA 1O7MB 3E99A 4N3VA 3GZXB 2JQ5A 3EBYA 3CPOA 1OHSA 1JN5A 5HGRA 5AI1A 4L8PA 1JB4A 3MSOA 3OWUA 4WYKB 3RGRA 3F9SA 1JN5B 4WWUC 3NBRA 4HVNA 1UUVB 1NDOB 2HMOB 3JUNA 3F8XA 2GBWB 3OXAA 1O7WB 2IMJA 4KVHA 3JUPA 3MHEA 2RFRA 4R9KA 4H3UA 5JPUA 4Q53A 1DMMA 3JUMA 1ZX2A 5AIHA 2BNGA 2YFLB 3BB9A 3LYGA 3MYTA 1EG9B 2B1XB 3OWSA 1K41A 4LEHA 3HK4A 3FSDA 4X2HA 2XRXB 5IEOA 3F14A 4HM7B 3D9RA 3EX9A 1OF5A 3ECFA 4L7KA 3SOAA 1O7GB 1NWWA 5G2GA 1AR0A 4WP5A 4U13A 1ISKA 5AIFA 2Z7AA 4I4KA 3LZAA 3OWYA 1S5AA 5CF1A 3F7XA 4HZ9B 3A76A 3SOYA 5BXQA 5DREA 5BVBA 2BMOB 1GS3A 4XDVA 3OV4A 5IG3A 3DZLA 2BMQB 4HM2B 1OHOA 8CHOA 1HKXA 1SJWA 3FLJA 2GBXB 4HM1B 4XBTA 3B4PA 2RGQA 3MKIA 3SEDA 2UX0A 1O7PB 3MG2A 1OH0A 1DMQA 5AEUB 1OUNA 2F99A 1UUWB 4WYKA 4LMIA 3HX8A 5DRVA
chains in the Genus database with same CATH superfamily
1DYUA 1L5GB 3AGNA 5KP1A 1VQM3 2QGUA 1V74A 1ZS7A 1RDSA 2AAEA 1RN4A 3CNXA 1EA2A 6GSPA 3EN8A 1OCVA 1IVUA 3WA2X 5FW5A 3PXMA 1IVWA 3S67A 5M18A 1QMAA 1TU5A 1YJN3 2BHMA 2P38A 3DGYA 1A2KA 2HMLB 4IIAA 2KCDA 1W6YA 2W9PA 3V99A 3D5GA 1KD14 3UNLA 1OPYA 1I2GA 1HZ1A 3PCSA 5EVHA 3EHCA 5IERA 1ULJB 3EN1B 3DGMA 1JB2A 1BANA 3GZYB 5IG0A 1STDA 3KKGA 1KWIA 4K61A 4XM4A 5AIGA 5AIIA 4JRFA 3ZG5A 1KQS2 2W2CA 1BRJA 1JNQA 5TGNA 1JKGB 1GY6A 1K734 1BRGA 3LH4A 3IPTA 4BL3A 2Y74A 3PYJA 1LXEA 2RBIA 1JV2B 1UGIA 1OHPA 1BRNL 3NUVA 3G16A 3CCM3 1JBSA 5CK6A 3NX0A 4NREA 3B8LA 3BNCA 3PZWA 4IT7A 5LC7A 1MWUA 5IENA 2V1LA 5D81A 3SYUA 1A2VA 1EEJA 1U5OA 3ER7A 2B24B 1VQN3 4N6MA 1PU4A 4O8SA 3RGAA 1FUSA 4HM3B 3WMDA 1TRPA 3CXC2 3CCL3 1RGEA 1D6UA 3LTAA 5IG4A 5KP3A 3BU4A 4K1UA 4WHAA 3S29A 2AADA 4N6UA 4R1KA 3FG3A 3HIGA 2Q07A 3A5EA 1ROAA 1RGKA 1MGWA 1LVNA 3N54B 2INXA 4CJNA 1D6ZA 1I3FA 2GU1A 3FGYA 2XGNA 1DMNA 3H51A 4HBRA 3LTCA 4IPBA 1YJW3 4AKYA 4XBYA 7RNTA 1BNFA 1BGSA 4GL6A 2HMMB 2KF4A 3H3HA 2HMKB 3S27A 1BNEA 3LXUX 1IV9A 2MC8A 5M1AA 3RNTA 2RCDA 9RNTA 3CCR3 2CH9A 4WFOA 1GMRA 1BUQA 4HJLB 1IQ8A 1UDII 3K0ZA 1W2B2 3CU3A 2GSPA 3BIRA 2XFTA 4FCJA 2CKFB 1FW7A 3N9HA 1WQLB 5JPPA 3M8CA 3GZRA 3LT8A 6STDA 1E97A 1Q40B 1TJDA 1K28A 4HM8B 4K1VA 4RZMA 2W9QA 4R4KA 2ZDJA 3BNEA 1W4NA 1D6YA 4N6NB 5LC6A 2E2UA 1PFPA 1WNHA 3CCQ3 2CK3H 1I2FA 1FZUA 4J9AA 3HIIA 2F56A 3IJEB 4GB5A 1B2MA 3B7CA 1CYVA 2J8XB 3HZPA 3JUQA 4FCZA 1VQK3 3FZWA 5AEWB 4HZBB 1RHLA 5IG5A 1U8CB 2JDIH 5CLKA 1R4CA 2OCTA 3MG3A 3NQZA 2KF6A 2XF3A 5EEOA 1JJ22 3MWZA 1T2HA 4BTWA 2OWPA 3PGBA 5KP4A 3Q90A 3GZBA 1B2UA 3EJVA 1YGEA 3KSPA 4XBXA 1T2IA 4LYLB 4EW5A 2CFLA 2CHCA 1DE3A 1E3VA 1B27A 1YVSA 3CCU3 3EC9A 2GXFA 2UGIA 3PS8A 3KN4A 3WOFB 3K7CA 1BNIA 2OOVA 1BAOA 2HMJB 3Q3FA 2H0HA 4HKVB 1TFOA 1B2SA 3NV0A 3SLUA 1MOLA 1TP6A 3STDA 3LMLA 1Q864 1FUWA 2BIRA 3EQQB 3HOHA 1QVG2 3EE1A 3U1WA 4TX4A 1JB5A 3S5CA 1RRLA 3FKAA 4DKIA 4GHOA 3CC73 1MGRA 5CXOA 2O3OA 1GY5A 2KF3A 3T8NA 4ZM8A 1UCIA 4KZ1A 1UCLA 5AYSC 3NHXA 3NV0B 1WMOA 4BL2A 2H0GA 3OW22 3ROBA 3UB1A 1C54A 3F8HA 3UJMA 1B2XA 1STFI 3D4AA 2C11A 1F8NA 3FG4A 1LRAA 5HOHA 1BSDA 1MWRA 3CPW2 1A90A 3WHOA 1B2ZA 4FR9A 2QA43 4OUQA 1TRQA 4ORLA 1YVBI 1GSPA 1RN1A 1JKGA 2CIUA 4NHFA 2STDA 4R80A 5D83A 1BNJA 2R41A 4HM5B 3X3ZA 3KE7A 3TDGA 1LOYA 1SQWA 1RGHA 2C10A 1W2ZA 2FGTA 4EC6A 1VQ53 2P0XA 3FF0A 1QVF2 5IF6A 1I70A 2KRTA 3NBBA 2BMRB 1AVLA 5G1LA 1YHQ3 1FGOA 2YX9A 3F7SA 2WOFA 4H61A 4J5GA 5D82A 3IMAB 3CMA3 3D5IA 1NB5I 4RBNA 2XH9A 1Q7Y4 4R9LA 1ROVA 3JUOA 5CF2A 1KSIA 2K0MA 2K54A 1G0TA 3GAXA 2P0MA 3GWRA 4I5QA 2CFWA 4CCVA 2CWTA 3DXOA 1I8VA 4KFEA 1BOXA 3KCHA 4L8OA 1FGRA 1NU3A 4HM0B 1IU7A 2F98A 2L4VA 2W6JH 2BT3A 2HMNB 4KT3B 4N6OB 1BRKA 3FF2A 1GY7A 2GEXA 2PNCA 4XDWA 3DM8A 3VGNA 3DGNA 5ELJA 3KZTA 1BNGA 2P09A 1VZZA 3G0KA 2SARA 1CQSA 2ZA4A 8RNTA 1VQL3 1LOXA 3WOEB 3KIIA 3KFQC 1JBRA 1BRIA 2XEPA 1IDPA 3D79A 3EF8A 3O8YA 1W7CA 1W01A 3T8UA 2F86B 4MJDA 2XSHB 1VQQA 1A2PA 1E3RA 5M19A 2IUJA 4XB5A 1FUTA 3X3YA 4KFDA 1QJGA 5STDA 1RKYA 1RMSA 3DGOA 1GYBA 4ILFA 4N6V0 4EV5A 2ML5A 1JZDA 3BLZA 1NJI4 1W6CA 2YFJB 1Q7HA 4MEIA 2WOHA 1Q40A 4EXRA 1IT8A 1OACA 1X1WA 1TIJA 4PEJA 3FH1A 3ZFZA 1RSNA 2YFIB 5RNTA 1C7HA 1IVXA 3GRDA 4CDLA 3CNMA 3G8ZA 2XR8B 1N9JA 1DETA 1WTHA 1W5ZA 2CWUA 3RDEA 2XSOB 2W56A 1W02A 1O7NB 1M1XB 1W00A 1MWSA 3CCS3 1OF5B 4HM6B 3LTDA 3WDGB 1PYLA 4HM4B 1BSCA 1BSBA 2OOVC 1Q42A 4X2OA 3WA3A 1DVCA 4AEQA 7STDA 2P05A 4BU4A 2W56B 2C4BA 1M1K4 1GOUA 2Z77A 1RGCA 1GOYA 5I97A 1AY7A 2OTJ3 1ZO2A 2Z76A 2ZHXB 3SXXA 3X3XA 4G1MB 1MNLA 3AHWA 3K5TA 1M904 2Y73A 1RNBA 2Z6BA 3B4OA 4LGQA 1OGZA 2PZVA 1O7HB 1RJOA 5BIRA 3I0YA 1RRHA 5IEPA 1W6GA 1FGQA 1QAFA 1Z1SA 2L1SA 2O9UX 2HOHA 3MG1A 4J8TA 2W04A 2LYXA 3VSYA 1A67A 1ULIB 5GSPA 4FCMA 1AV4A 2D42A 3F40A 3FCSB 1EUIC 4OVMA 1M9GA 1RGFA 1VQ93 2CG1A 3NXJA 1RLSA 2FNQA 4HOHA 1LNHA 3EBTA 2KAAA 1TFKA 3DY5A 2A15A 1Q814 2GEYA 1B3SA 3OX9A 2R4IA 1ASKA 2WGOA 1CYUA 1K8A4 1JZOA 3DUKA 2I9WA 3MPHA 3ALAA 4STDA 3GSPA 1TUHA 3UL5A 2M7OA 2BO9B 1OGXA 2CFGA 2IA7A 1SIIA 2QIYA 3LOYA 3X42A 3NM2A 1IK3A 3DMCA 1VQ63 1B20A 1UCJA 1O7MB 2WO0A 3FG1A 3E99A 3K63A 4N3VA 1NB3I 1YGWA 3GZXB 6RNTA 2JQ5A 1LOVA 3EBYA 2CWVA 1Q9EA 1V57A 3CPOA 1GD3A 2IY2A 4AKZA 2W03A 1OHSA 4BTXA 4N6TA 1RGAA 4LSOA 1UGHI 1IVVA 3N8BA 4RNTA 2CC3A 3CC23 2E2TA 1WMNA 2F5WA 2W0QA 3CCJ3 1RN7A 3EB8A 1JN5A 5HGRA 5AI1A 3T0UA 3SX1A 1BU4A 1MWTA 1UI8A 4J5KA 4L8PA 1RGGA 1YJ93 2D1WA 1BIRA 1BSEA 4NPBA 3V92A 1N8QA 1JB4A 3MSOA 3OWUA 4WYKB 4GSPA 4MMYB 3RGRA 2CG0A 2K3DA 3F9SA 1JN5B 4WWUC 4MMXB 3NBRA 2OQEA 3URPA 4HVNA 1YNVX 1UUVB 1NDOB 2LQVA 3CME3 2HMOB 3AHSA 3JUNA 3F8XA 3AGOA 2GBWB 3OXAA 1O7WB 1DVDA 3QK9A 1RTUA 1QALA 3S28A 3V98A 1UI7A 1VQ83 2IMJA 4EYCA 1BVIA 3QRDA 4N6LA 7GSPA 2F4YA 4KVHA 1US1A 3JUPA 1HU9A 1YIT3 1BRHA 1BRSA 1RCLA 3MHEA 1GOVA 3NM7A 3J7Yd 2XGLA 1S723 1ZGXA 4FMDA 2KXGA 2RFRA 1K9M4 1BNRA 4O02B 4H3UA 1GMPA 4R9KA 1SIHA 2H0IA 4HYZA 2QEX3 5JPUA 4Q53A 1DMMA 1I0VA 3CD63 1X1XA 2E2VA 2RSXA 3NQYA 3JUMA 1ZX2A 5AIHA 3ZG0A 3CCE3 4MMZB 5A0OB 1NNVA 4O2HA 1IV7A 2BNGA 1JRQA 2CFDA 1RGLA 3Q1CA 2YFLB 3BB9A 3LYGA 4FMAA 4RNYA 2IUKA 3MYTA 3K9MC 1VQP3 1EG9B 2B1XB 1SARA 3OWSA 1K41A 4BTYA 1RNTA 4LEHA 3HK4A 3FSDA 4X2HA 2CW9A 2XRXB 3JVCA 5IEOA 3F14A 4HM7B 1G96A 2GU3A 1IT7A 2CX0A 4O3VA 1AQZA 3D9RA 3I553 2UUGC 3DH2A 3EX9A 1OF5A 3VF1A 5G1KA 3ECFA 4L7KA 2RNTA 1BUJA 3AMOA 3SOAA 3BNDA 1LQGC 1VQ73 1O7GB 1NWWA 3NBJA 5G2GA 1AR0A 1WMPA 4WP5A 1LOWA 3WODG 4U13A 3G4S3 1ISKA 1BSAA 1YIJ3 1EQKA 5AIFA 5AYRB 2Z7AA 3AMOB 1I3IA 3DGLA 4I4KA 1RCKA 3LZAA 4QWTA 5BU4A 2XFSA 1X1UA 3OWYA 1N8R4 1S5AA 1G02A 2CFKA 1QAKA 4K90B 2OTL3 4EBGA 3I563 5CF1A 1IQYA 3F7XA 3G6E3 1Q824 4HAAA 4HZ9B 5JBSA 1IQXA 1AVKA 3A76A 3SOYA 3LTBA 5DREA 5BVBA 2BMOB 3X41A 1GS3A 4XDVA 5ELUA 5BXQA 1CH0A 3KSED 2F5MA 2IYJA 1T3BA 2WGQA 1UW1A 4RNZA 3OV4A 1B21A 5IG3A 1CEWI 3U97A 3DZLA 2BMQB 1VQO3 1VQ43 4HM2B 1HYFA 5IW9A 1OHOA 8CHOA 2ZL8A 1PY3A 2FXTA 3G713 5FGOA 3BNBA 1GMQA 1J2BA 1KC84 1NO3A 1TTOA 1UUGB 3LT9A 1GD4A 1T5YA 2CX1A 1YI23 1HKXA 1R4YA 1SJWA 4OK0A 3UL6A 3FLJA 2BU4A 2GBXB 4HM1B 3B4PA 4XBTA 2RGQA 3MKIA 1V58A 1UCKA 3L0RA 4EV2A 1N5PA 2OQEC 1FA3A 3SEDA 1BNSA 2UX0A 1LQMB 1O7PB 3MG2A 4CPKA 1JBTA 4BIRA 1N9EA 4FMCA 1EKMA 1FGMA 1OH0A 1DMQA 4LZIA 3PCRA 1SPUA 3CCV3 1N5HA 1FGTA 1I0XA 1Y4KA 3CC43 5AEUB 4KFFA 3WR2A 1OUNA 3SVAA 2MF7A 2F99A 1UUWB 2ML6A 1I2EA 1FYSA 2SBLA 4WYKA 1LNIA 4LMIA 2KF5A 3HI7A 1IYYA 3HX8A 4FMBA 3D3LA 1X1YA 4JF8A 3Q2PA 3X40A 5EQLA 5DRVA
chains in the Genus database with same CATH topology
1DYUA 1L5GB 5KP1A 1VQM3 2QGUA 1V74A 3CNXA 1EA2A 3EN8A 1OCVA 1IVUA 3WA2X 5FW5A 3PXMA 1IVWA 3S67A 1QMAA 1TU5A 1YJN3 2BHMA 2P38A 1A2KA 2HMLB 4IIAA 2KCDA 1W6YA 2W9PA 3V99A 1KD14 3UNLA 1OPYA 3PCSA 5EVHA 3EHCA 5IERA 1ULJB 3EN1B 3DGMA 1JB2A 3GZYB 5IG0A 1STDA 3KKGA 1KWIA 4K61A 4XM4A 5AIGA 5AIIA 4JRFA 1KQS2 2W2CA 1JNQA 5TGNA 1GY6A 1JKGB 1K734 3LH4A 3IPTA 2Y74A 3PYJA 1LXEA 1JV2B 1OHPA 3NUVA 3G16A 3CCM3 5CK6A 3NX0A 4NREA 3B8LA 3BNCA 3PZWA 4IT7A 5LC7A 5IENA 2V1LA 5D81A 1A2VA 3ER7A 1U5OA 2B24B 1VQN3 4N6MA 1PU4A 4O8SA 3RGAA 4HM3B 3WMDA 3CXC2 3CCL3 3LTAA 1D6UA 5IG4A 5KP3A 4K1UA 4WHAA 3S29A 4N6UA 4R1KA 3FG3A 3HIGA 2Q07A 1ROAA 1LVNA 3N54B 2INXA 1D6ZA 2GU1A 3FGYA 2XGNA 1DMNA 3H51A 4HBRA 3LTCA 4IPBA 1YJW3 4AKYA 4XBYA 4GL6A 2HMMB 3S27A 3H3HA 2HMKB 3LXUX 1IV9A 2MC8A 2RCDA 3CCR3 2CH9A 4WFOA 1BUQA 4HJLB 1IQ8A 3K0ZA 1W2B2 3CU3A 4FCJA 2XFTA 2CKFB 3N9HA 1WQLB 5JPPA 3M8CA 3GZRA 3LT8A 6STDA 1E97A 1Q40B 1K28A 4HM8B 4K1VA 4RZMA 2W9QA 4R4KA 2ZDJA 3BNEA 1W4NA 1D6YA 4N6NB 5LC6A 2E2UA 1PFPA 1WNHA 3CCQ3 2CK3H 4J9AA 3HIIA 4GB5A 3IJEB 3B7CA 1CYVA 3HZPA 3JUQA 1VQK3 4FCZA 3FZWA 5AEWB 4HZBB 5IG5A 1U8CB 2JDIH 5CLKA 1R4CA 2OCTA 3MG3A 3NQZA 2XF3A 5EEOA 1JJ22 3MWZA 4BTWA 2OWPA 3PGBA 5KP4A 3Q90A 3GZBA 3EJVA 1YGEA 3KSPA 4XBXA 2CFLA 2CHCA 1E3VA 3CCU3 3EC9A 2GXFA 3PS8A 3KN4A 3WOFB 3K7CA 2OOVA 2HMJB 4HKVB 1TFOA 3NV0A 3SLUA 1MOLA 1TP6A 3STDA 3LMLA 1Q864 1FUWA 3EQQB 1QVG2 3EE1A 3U1WA 4TX4A 1JB5A 3S5CA 1RRLA 3FKAA 3CC73 5CXOA 2O3OA 1GY5A 3T8NA 4ZM8A 4KZ1A 5AYSC 3NHXA 3NV0B 1WMOA 3OW22 3ROBA 3UB1A 3F8HA 3UJMA 1STFI 2C11A 1F8NA 3FG4A 3CPW2 1A90A 4FR9A 2QA43 4OUQA 4ORLA 1YVBI 3WODG 2CIUA 1JKGA 4NHFA 5D83A 2STDA 4R80A 4HM5B 3X3ZA 3KE7A 3TDGA 2C10A 1SQWA 2FGTA 1VQ53 1W2ZA 4EC6A 2P0XA 3FF0A 1QVF2 5IF6A 2KRTA 3NBBA 2BMRB 1AVLA 1YHQ3 1FGOA 2YX9A 3F7SA 2WOFA 4H61A 5D82A 3CMA3 3IMAB 1NB5I 4RBNA 2XH9A 1Q7Y4 4R9LA 1ROVA 3JUOA 5CF2A 1KSIA 2K0MA 2K54A 3GAXA 2P0MA 3GWRA 2CFWA 4CCVA 2CWTA 3DXOA 4KFEA 4L8OA 1FGRA 1NU3A 4HM0B 1IU7A 2F98A 2L4VA 2W6JH 2BT3A 2HMNB 4N6OB 4XDWA 3FF2A 1GY7A 2GEXA 2PNCA 3VGNA 3DM8A 3DGNA 5ELJA 3KZTA 2P09A 1VZZA 3G0KA 1CQSA 1VQL3 1LOXA 3WOEB 3KIIA 3KFQC 3EF8A 2XEPA 1IDPA 3O8YA 1W7CA 1W01A 3T8UA 2F86B 4MJDA 2XSHB 1E3RA 2IUJA 4XB5A 3X3YA 4KFDA 1QJGA 5STDA 1RKYA 3DGOA 1GYBA 4N6V0 4EV5A 2ML5A 3BLZA 1NJI4 1W6CA 2YFJB 4MEIA 2WOHA 1Q40A 4EXRA 1IT8A 1OACA 1TIJA 4PEJA 3FH1A 2YFIB 1C7HA 1IVXA 3GRDA 4CDLA 3CNMA 3G8ZA 2XR8B 1N9JA 1WTHA 1W5ZA 2CWUA 3RDEA 2XSOB 2W56A 1W02A 1O7NB 1M1XB 1W00A 3CCS3 1OF5B 4HM6B 3LTDA 3WDGB 4HM4B 2OOVC 1Q42A 4X2OA 3WA3A 1DVCA 4AEQA 7STDA 2P05A 1M1K4 2W56B 2Z77A 5I97A 2OTJ3 1ZO2A 2Z76A 3SXXA 3X3XA 4G1MB 1MNLA 3K5TA 1M904 2Y73A 2Z6BA 3B4OA 4LGQA 1OGZA 2PZVA 1O7HB 1RJOA 3I0YA 1RRHA 5IEPA 1W6GA 1FGQA 1QAFA 1Z1SA 2O9UX 4J8TA 3MG1A 1A67A 2W04A 2LYXA 3VSYA 1ULIB 4FCMA 1AV4A 2D42A 3F40A 3FCSB 4OVMA 1M9GA 1VQ93 2CG1A 3NXJA 2FNQA 1LNHA 3EBTA 1TFKA 3DY5A 2A15A 1Q814 2GEYA 3OX9A 2R4IA 1ASKA 2WGOA 1CYUA 1K8A4 3DUKA 2I9WA 3MPHA 3ALAA 4STDA 3UL5A 1TUHA 2M7OA 2BO9B 1OGXA 2CFGA 2IA7A 1SIIA 2QIYA 3LOYA 3X42A 3NM2A 1IK3A 3DMCA 1VQ63 1O7MB 2WO0A 3FG1A 3E99A 3K63A 4N3VA 1NB3I 3GZXB 2JQ5A 3EBYA 2CWVA 3CPOA 1GD3A 4AKZA 2W03A 1OHSA 4BTXA 4N6TA 4LSOA 3N8BA 1IVVA 2CC3A 3CC23 2E2TA 1WMNA 2W0QA 3CCJ3 1RN7A 3EB8A 1JN5A 5HGRA 5AI1A 3T0UA 3SX1A 1UI8A 4L8PA 1YJ93 2D1WA 3V92A 1N8QA 1JB4A 3MSOA 3OWUA 4WYKB 4MMYB 3RGRA 2CG0A 3F9SA 1JN5B 4WWUC 4MMXB 3NBRA 2OQEA 4HVNA 1UUVB 2LQVA 1NDOB 3CME3 2HMOB 3JUNA 3F8XA 2GBWB 3OXAA 1O7WB 1DVDA 3QK9A 1QALA 3S28A 3V98A 1UI7A 1VQ83 2IMJA 4EYCA 3QRDA 4N6LA 4KVHA 1US1A 3JUPA 1HU9A 1YIT3 3MHEA 3NM7A 3J7Yd 2XGLA 1S723 4FMDA 1K9M4 2KXGA 2RFRA 4O02B 4H3UA 4R9KA 1SIHA 4HYZA 2QEX3 5JPUA 4Q53A 1DMMA 3CD63 2E2VA 2RSXA 3NQYA 3JUMA 1ZX2A 5AIHA 3CCE3 4MMZB 5A0OB 4O2HA 1IV7A 2BNGA 1JRQA 2CFDA 3Q1CA 2YFLB 3BB9A 3LYGA 4FMAA 4RNYA 2IUKA 3MYTA 3K9MC 1VQP3 1EG9B 2B1XB 3OWSA 1K41A 4BTYA 4LEHA 3HK4A 3FSDA 4X2HA 2CW9A 2XRXB 3JVCA 5IEOA 3F14A 4HM7B 1G96A 2GU3A 1IT7A 4O3VA 3D9RA 3I553 3EX9A 1OF5A 3VF1A 3ECFA 4L7KA 3AMOA 3SOAA 3BNDA 1VQ73 1O7GB 1NWWA 3NBJA 5G2GA 1AR0A 1WMPA 4WP5A 4U13A 3G4S3 1ISKA 1YIJ3 1EQKA 5AIFA 5AYRB 2Z7AA 3AMOB 3DGLA 4I4KA 3LZAA 1N8R4 4QWTA 2XFSA 3OWYA 2OTL3 1S5AA 2CFKA 1QAKA 4K90B 4EBGA 3I563 5CF1A 1IQYA 3F7XA 3G6E3 1Q824 4HZ9B 5JBSA 1IQXA 1AVKA 3A76A 3SOYA 3LTBA 5DREA 5BVBA 2BMOB 3X41A 1GS3A 4XDVA 5ELUA 5BXQA 3KSED 2WGQA 1UW1A 4RNZA 3OV4A 5IG3A 1CEWI 3U97A 3DZLA 2BMQB 1VQO3 1VQ43 4HM2B 5IW9A 1OHOA 8CHOA 2ZL8A 3G713 2FXTA 5FGOA 3BNBA 1J2BA 1KC84 1NO3A 3LT9A 1GD4A 1T5YA 1YI23 1HKXA 1SJWA 4OK0A 3UL6A 3FLJA 2GBXB 4HM1B 4XBTA 3B4PA 2RGQA 3MKIA 3L0RA 4EV2A 1N5PA 2OQEC 1FA3A 3SEDA 2UX0A 1O7PB 3MG2A 1N9EA 4FMCA 1EKMA 1FGMA 1OH0A 1DMQA 4LZIA 3PCRA 1SPUA 3CCV3 1N5HA 1FGTA 1Y4KA 3CC43 5AEUB 4KFFA 1OUNA 3SVAA 2MF7A 2F99A 1UUWB 2ML6A 2SBLA 4WYKA 4LMIA 3HI7A 3HX8A 4FMBA 3D3LA 4JF8A 3Q2PA 3X40A 5EQLA 5DRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP1 A;  2QGU A;  3CNX A;  1EA2 A;  3EN8 A;  1OCV A;  5FW5 A;  1QMA A;  1A2K A;  2HML B;  4IIA A;  1W6Y A;  3UNL A;  1OPY A;  5EVH A;  3EHC A;  5IER A;  1ULJ B;  3EN1 B;  1JB2 A;  3GZY B;  5IG0 A;  1STD A;  3KKG A;  4XM4 A;  5AIG A;  5AII A;  2W2C A;  5TGN A;  1GY6 A;  1JKG B;  3IPT A;  1OHP A;  3NUV A;  3G16 A;  5CK6 A;  3B8L A;  5IEN A;  5D81 A;  3ER7 A;  1U5O A;  2B24 B;  3RGA A;  4HM3 B;  3WMD A;  5IG4 A;  5KP3 A;  4K1U A;  4R1K A;  2INX A;  3FGY A;  3H51 A;  1DMN A;  4XBY A;  2HMM B;  3H3H A;  2HMK B;  2RCD A;  1BUQ A;  4HJL B;  3K0Z A;  3CU3 A;  4FCJ A;  2CKF B;  5JPP A;  1WQL B;  3M8C A;  3GZR A;  6STD A;  1E97 A;  1Q40 B;  4HM8 B;  4K1V A;  4RZM A;  4J9A A;  4GB5 A;  3B7C A;  3HZP A;  3JUQ A;  3FZW A;  5AEW B;  4HZB B;  5IG5 A;  5CLK A;  3MG3 A;  2OWP A;  5KP4 A;  3Q90 A;  3GZB A;  3EJV A;  3KSP A;  4XBX A;  2CHC A;  1E3V A;  3EC9 A;  2GXF A;  3K7C A;  2HMJ B;  4HKV B;  3NV0 A;  3STD A;  1TP6 A;  3EQQ B;  1JB5 A;  3S5C A;  3FKA A;  5CXO A;  1GY5 A;  3T8N A;  3NHX A;  3NV0 B;  3ROB A;  3F8H A;  3UJM A;  4OUQ A;  4ORL A;  1JKG A;  5D83 A;  2STD A;  4HM5 B;  3KE7 A;  3FF0 A;  5IF6 A;  2BMR B;  3F7S A;  5D82 A;  4R9L A;  5CF2 A;  3JUO A;  2K54 A;  3GWR A;  3DXO A;  4L8O A;  1NU3 A;  4HM0 B;  2F98 A;  2HMN B;  4XDW A;  3FF2 A;  1GY7 A;  2GEX A;  3VGN A;  3DM8 A;  3KZT A;  1VZZ A;  3G0K A;  1CQS A;  3EF8 A;  1IDP A;  1W01 A;  3T8U A;  2F86 B;  4MJD A;  2XSH B;  1E3R A;  4XB5 A;  1QJG A;  5STD A;  1GYB A;  3BLZ A;  2YFJ B;  1Q40 A;  4PEJ A;  3FH1 A;  2YFI B;  1C7H A;  3GRD A;  4CDL A;  3CNM A;  3G8Z A;  2XR8 B;  2XSO B;  1W02 A;  1O7N B;  1W00 A;  1OF5 B;  4HM6 B;  4HM4 B;  1Q42 A;  4X2O A;  7STD A;  2Z77 A;  1ZO2 A;  2Z76 A;  3B4O A;  4LGQ A;  1OGZ A;  2PZV A;  1O7H B;  3I0Y A;  5IEP A;  1Z1S A;  4J8T A;  3MG1 A;  3VSY A;  1ULI B;  4FCM A;  3F40 A;  4OVM A;  3NXJ A;  3EBT A;  2A15 A;  2GEY A;  3OX9 A;  2R4I A;  1ASK A;  3DUK A;  2I9W A;  4STD A;  1TUH A;  1OGX A;  2QIY A;  3NM2 A;  3DMC A;  1O7M B;  3E99 A;  4N3V A;  3GZX B;  2JQ5 A;  3EBY A;  3CPO A;  1OHS A;  1JN5 A;  5HGR A;  5AI1 A;  4L8P A;  1JB4 A;  3MSO A;  3OWU A;  4WYK B;  3RGR A;  3F9S A;  1JN5 B;  4WWU C;  3NBR A;  4HVN A;  1UUV B;  1NDO B;  2HMO B;  3JUN A;  3F8X A;  2GBW B;  3OXA A;  1O7W B;  2IMJ A;  4KVH A;  3JUP A;  3MHE A;  2RFR A;  4R9K A;  4H3U A;  5JPU A;  4Q53 A;  1DMM A;  3JUM A;  1ZX2 A;  5AIH A;  2BNG A;  2YFL B;  3BB9 A;  3LYG A;  3MYT A;  1EG9 B;  2B1X B;  3OWS A;  1K41 A;  4LEH A;  3HK4 A;  3FSD A;  4X2H A;  2XRX B;  5IEO A;  3F14 A;  4HM7 B;  3D9R A;  3EX9 A;  1OF5 A;  3ECF A;  4L7K A;  3SOA A;  1O7G B;  1NWW A;  5G2G A;  1AR0 A;  4WP5 A;  4U13 A;  1ISK A;  5AIF A;  2Z7A A;  4I4K A;  3LZA A;  3OWY A;  1S5A A;  5CF1 A;  3F7X A;  4HZ9 B;  3A76 A;  3SOY A;  5BXQ A;  5DRE A;  5BVB A;  2BMO B;  1GS3 A;  4XDV A;  3OV4 A;  5IG3 A;  3DZL A;  2BMQ B;  4HM2 B;  1OHO A;  8CHO A;  1HKX A;  1SJW A;  3FLJ A;  2GBX B;  4HM1 B;  4XBT A;  3B4P A;  2RGQ A;  3MKI A;  3SED A;  2UX0 A;  1O7P B;  3MG2 A;  1OH0 A;  1DMQ A;  5AEU B;  1OUN A;  2F99 A;  1UUW B;  4WYK A;  4LMI A;  3HX8 A;  5DRV A; 
#chains in the Genus database with same CATH topology
 1DYU A;  1L5G B;  3AGN A;  5KP1 A;  1VQM 3;  2QGU A;  1V74 A;  1ZS7 A;  1RDS A;  2AAE A;  1RN4 A;  3CNX A;  1EA2 A;  6GSP A;  3EN8 A;  1OCV A;  1IVU A;  3WA2 X;  5FW5 A;  3PXM A;  1IVW A;  3S67 A;  5M18 A;  1QMA A;  1TU5 A;  1YJN 3;  2BHM A;  2P38 A;  3DGY A;  1A2K A;  2HML B;  4IIA A;  2KCD A;  1W6Y A;  2W9P A;  3V99 A;  3D5G A;  1KD1 4;  3UNL A;  1OPY A;  1I2G A;  1HZ1 A;  3PCS A;  5EVH A;  3EHC A;  5IER A;  1ULJ B;  3EN1 B;  3DGM A;  1JB2 A;  1BAN A;  3GZY B;  5IG0 A;  1STD A;  3KKG A;  1KWI A;  4K61 A;  4XM4 A;  5AIG A;  5AII A;  4JRF A;  3ZG5 A;  1KQS 2;  2W2C A;  1BRJ A;  1JNQ A;  5TGN A;  1JKG B;  1GY6 A;  1K73 4;  1BRG A;  3LH4 A;  3IPT A;  4BL3 A;  2Y74 A;  3PYJ A;  1LXE A;  2RBI A;  1JV2 B;  1UGI A;  1OHP A;  1BRN L;  3NUV A;  3G16 A;  3CCM 3;  1JBS A;  5CK6 A;  3NX0 A;  4NRE A;  3B8L A;  3BNC A;  3PZW A;  4IT7 A;  5LC7 A;  1MWU A;  5IEN A;  2V1L A;  5D81 A;  3SYU A;  1A2V A;  1EEJ A;  1U5O A;  3ER7 A;  2B24 B;  1VQN 3;  4N6M A;  1PU4 A;  4O8S A;  3RGA A;  1FUS A;  4HM3 B;  3WMD A;  1TRP A;  3CXC 2;  3CCL 3;  1RGE A;  1D6U A;  3LTA A;  5IG4 A;  5KP3 A;  3BU4 A;  4K1U A;  4WHA A;  3S29 A;  2AAD A;  4N6U A;  4R1K A;  3FG3 A;  3HIG A;  2Q07 A;  3A5E A;  1ROA A;  1RGK A;  1MGW A;  1LVN A;  3N54 B;  2INX A;  4CJN A;  1D6Z A;  1I3F A;  2GU1 A;  3FGY A;  2XGN A;  1DMN A;  3H51 A;  4HBR A;  3LTC A;  4IPB A;  1YJW 3;  4AKY A;  4XBY A;  7RNT A;  1BNF A;  1BGS A;  4GL6 A;  2HMM B;  2KF4 A;  3H3H A;  2HMK B;  3S27 A;  1BNE A;  3LXU X;  1IV9 A;  2MC8 A;  5M1A A;  3RNT A;  2RCD A;  9RNT A;  3CCR 3;  2CH9 A;  4WFO A;  1GMR A;  1BUQ A;  4HJL B;  1IQ8 A;  1UDI I;  3K0Z A;  1W2B 2;  3CU3 A;  2GSP A;  3BIR A;  2XFT A;  4FCJ A;  2CKF B;  1FW7 A;  3N9H A;  1WQL B;  5JPP A;  3M8C A;  3GZR A;  3LT8 A;  6STD A;  1E97 A;  1Q40 B;  1TJD A;  1K28 A;  4HM8 B;  4K1V A;  4RZM A;  2W9Q A;  4R4K A;  2ZDJ A;  3BNE A;  1W4N A;  1D6Y A;  4N6N B;  5LC6 A;  2E2U A;  1PFP A;  1WNH A;  3CCQ 3;  2CK3 H;  1I2F A;  1FZU A;  4J9A A;  3HII A;  2F56 A;  3IJE B;  4GB5 A;  1B2M A;  3B7C A;  1CYV A;  2J8X B;  3HZP A;  3JUQ A;  4FCZ A;  1VQK 3;  3FZW A;  5AEW B;  4HZB B;  1RHL A;  5IG5 A;  1U8C B;  2JDI H;  5CLK A;  1R4C A;  2OCT A;  3MG3 A;  3NQZ A;  2KF6 A;  2XF3 A;  5EEO A;  1JJ2 2;  3MWZ A;  1T2H A;  4BTW A;  2OWP A;  3PGB A;  5KP4 A;  3Q90 A;  3GZB A;  1B2U A;  3EJV A;  1YGE A;  3KSP A;  4XBX A;  1T2I A;  4LYL B;  4EW5 A;  2CFL A;  2CHC A;  1DE3 A;  1E3V A;  1B27 A;  1YVS A;  3CCU 3;  3EC9 A;  2GXF A;  2UGI A;  3PS8 A;  3KN4 A;  3WOF B;  3K7C A;  1BNI A;  2OOV A;  1BAO A;  2HMJ B;  3Q3F A;  2H0H A;  4HKV B;  1TFO A;  1B2S A;  3NV0 A;  3SLU A;  1MOL A;  1TP6 A;  3STD A;  3LML A;  1Q86 4;  1FUW A;  2BIR A;  3EQQ B;  3HOH A;  1QVG 2;  3EE1 A;  3U1W A;  4TX4 A;  1JB5 A;  3S5C A;  1RRL A;  3FKA A;  4DKI A;  4GHO A;  3CC7 3;  1MGR A;  5CXO A;  2O3O A;  1GY5 A;  2KF3 A;  3T8N A;  4ZM8 A;  1UCI A;  4KZ1 A;  1UCL A;  5AYS C;  3NHX A;  3NV0 B;  1WMO A;  4BL2 A;  2H0G A;  3OW2 2;  3ROB A;  3UB1 A;  1C54 A;  3F8H A;  3UJM A;  1B2X A;  1STF I;  3D4A A;  2C11 A;  1F8N A;  3FG4 A;  1LRA A;  5HOH A;  1BSD A;  1MWR A;  3CPW 2;  1A90 A;  3WHO A;  1B2Z A;  4FR9 A;  2QA4 3;  4OUQ A;  1TRQ A;  4ORL A;  1YVB I;  1GSP A;  1RN1 A;  1JKG A;  2CIU A;  4NHF A;  2STD A;  4R80 A;  5D83 A;  1BNJ A;  2R41 A;  4HM5 B;  3X3Z A;  3KE7 A;  3TDG A;  1LOY A;  1SQW A;  1RGH A;  2C10 A;  1W2Z A;  2FGT A;  4EC6 A;  1VQ5 3;  2P0X A;  3FF0 A;  1QVF 2;  5IF6 A;  1I70 A;  2KRT A;  3NBB A;  2BMR B;  1AVL A;  5G1L A;  1YHQ 3;  1FGO A;  2YX9 A;  3F7S A;  2WOF A;  4H61 A;  4J5G A;  5D82 A;  3IMA B;  3CMA 3;  3D5I A;  1NB5 I;  4RBN A;  2XH9 A;  1Q7Y 4;  4R9L A;  1ROV A;  3JUO A;  5CF2 A;  1KSI A;  2K0M A;  2K54 A;  1G0T A;  3GAX A;  2P0M A;  3GWR A;  4I5Q A;  2CFW A;  4CCV A;  2CWT A;  3DXO A;  1I8V A;  4KFE A;  1BOX A;  3KCH A;  4L8O A;  1FGR A;  1NU3 A;  4HM0 B;  1IU7 A;  2F98 A;  2L4V A;  2W6J H;  2BT3 A;  2HMN B;  4KT3 B;  4N6O B;  1BRK A;  3FF2 A;  1GY7 A;  2GEX A;  2PNC A;  4XDW A;  3DM8 A;  3VGN A;  3DGN A;  5ELJ A;  3KZT A;  1BNG A;  2P09 A;  1VZZ A;  3G0K A;  2SAR A;  1CQS A;  2ZA4 A;  8RNT A;  1VQL 3;  1LOX A;  3WOE B;  3KII A;  3KFQ C;  1JBR A;  1BRI A;  2XEP A;  1IDP A;  3D79 A;  3EF8 A;  3O8Y A;  1W7C A;  1W01 A;  3T8U A;  2F86 B;  4MJD A;  2XSH B;  1VQQ A;  1A2P A;  1E3R A;  5M19 A;  2IUJ A;  4XB5 A;  1FUT A;  3X3Y A;  4KFD A;  1QJG A;  5STD A;  1RKY A;  1RMS A;  3DGO A;  1GYB A;  4ILF A;  4N6V 0;  4EV5 A;  2ML5 A;  1JZD A;  3BLZ A;  1NJI 4;  1W6C A;  2YFJ B;  1Q7H A;  4MEI A;  2WOH A;  1Q40 A;  4EXR A;  1IT8 A;  1OAC A;  1X1W A;  1TIJ A;  4PEJ A;  3FH1 A;  3ZFZ A;  1RSN A;  2YFI B;  5RNT A;  1C7H A;  1IVX A;  3GRD A;  4CDL A;  3CNM A;  3G8Z A;  2XR8 B;  1N9J A;  1DET A;  1WTH A;  1W5Z A;  2CWU A;  3RDE A;  2XSO B;  2W56 A;  1W02 A;  1O7N B;  1M1X B;  1W00 A;  1MWS A;  3CCS 3;  1OF5 B;  4HM6 B;  3LTD A;  3WDG B;  1PYL A;  4HM4 B;  1BSC A;  1BSB A;  2OOV C;  1Q42 A;  4X2O A;  3WA3 A;  1DVC A;  4AEQ A;  7STD A;  2P05 A;  4BU4 A;  2W56 B;  2C4B A;  1M1K 4;  1GOU A;  2Z77 A;  1RGC A;  1GOY A;  5I97 A;  1AY7 A;  2OTJ 3;  1ZO2 A;  2Z76 A;  2ZHX B;  3SXX A;  3X3X A;  4G1M B;  1MNL A;  3AHW A;  3K5T A;  1M90 4;  2Y73 A;  1RNB A;  2Z6B A;  3B4O A;  4LGQ A;  1OGZ A;  2PZV A;  1O7H B;  1RJO A;  5BIR A;  3I0Y A;  1RRH A;  5IEP A;  1W6G A;  1FGQ A;  1QAF A;  1Z1S A;  2L1S A;  2O9U X;  2HOH A;  3MG1 A;  4J8T A;  2W04 A;  2LYX A;  3VSY A;  1A67 A;  1ULI B;  5GSP A;  4FCM A;  1AV4 A;  2D42 A;  3F40 A;  3FCS B;  1EUI C;  4OVM A;  1M9G A;  1RGF A;  1VQ9 3;  2CG1 A;  3NXJ A;  1RLS A;  2FNQ A;  4HOH A;  1LNH A;  3EBT A;  2KAA A;  1TFK A;  3DY5 A;  2A15 A;  1Q81 4;  2GEY A;  1B3S A;  3OX9 A;  2R4I A;  1ASK A;  2WGO A;  1CYU A;  1K8A 4;  1JZO A;  3DUK A;  2I9W A;  3MPH A;  3ALA A;  4STD A;  3GSP A;  1TUH A;  3UL5 A;  2M7O A;  2BO9 B;  1OGX A;  2CFG A;  2IA7 A;  1SII A;  2QIY A;  3LOY A;  3X42 A;  3NM2 A;  1IK3 A;  3DMC A;  1VQ6 3;  1B20 A;  1UCJ A;  1O7M B;  2WO0 A;  3FG1 A;  3E99 A;  3K63 A;  4N3V A;  1NB3 I;  1YGW A;  3GZX B;  6RNT A;  2JQ5 A;  1LOV A;  3EBY A;  2CWV A;  1Q9E A;  1V57 A;  3CPO A;  1GD3 A;  2IY2 A;  4AKZ A;  2W03 A;  1OHS A;  4BTX A;  4N6T A;  1RGA A;  4LSO A;  1UGH I;  1IVV A;  3N8B A;  4RNT A;  2CC3 A;  3CC2 3;  2E2T A;  1WMN A;  2F5W A;  2W0Q A;  3CCJ 3;  1RN7 A;  3EB8 A;  1JN5 A;  5HGR A;  5AI1 A;  3T0U A;  3SX1 A;  1BU4 A;  1MWT A;  1UI8 A;  4J5K A;  4L8P A;  1RGG A;  1YJ9 3;  2D1W A;  1BIR A;  1BSE A;  4NPB A;  3V92 A;  1N8Q A;  1JB4 A;  3MSO A;  3OWU A;  4WYK B;  4GSP A;  4MMY B;  3RGR A;  2CG0 A;  2K3D A;  3F9S A;  1JN5 B;  4WWU C;  4MMX B;  3NBR A;  2OQE A;  3URP A;  4HVN A;  1YNV X;  1UUV B;  1NDO B;  2LQV A;  3CME 3;  2HMO B;  3AHS A;  3JUN A;  3F8X A;  3AGO A;  2GBW B;  3OXA A;  1O7W B;  1DVD A;  3QK9 A;  1RTU A;  1QAL A;  3S28 A;  3V98 A;  1UI7 A;  1VQ8 3;  2IMJ A;  4EYC A;  1BVI A;  3QRD A;  4N6L A;  7GSP A;  2F4Y A;  4KVH A;  1US1 A;  3JUP A;  1HU9 A;  1YIT 3;  1BRH A;  1BRS A;  1RCL A;  3MHE A;  1GOV A;  3NM7 A;  3J7Y d;  2XGL A;  1S72 3;  1ZGX A;  4FMD A;  2KXG A;  2RFR A;  1K9M 4;  1BNR A;  4O02 B;  4H3U A;  1GMP A;  4R9K A;  1SIH A;  2H0I A;  4HYZ A;  2QEX 3;  5JPU A;  4Q53 A;  1DMM A;  1I0V A;  3CD6 3;  1X1X A;  2E2V A;  2RSX A;  3NQY A;  3JUM A;  1ZX2 A;  5AIH A;  3ZG0 A;  3CCE 3;  4MMZ B;  5A0O B;  1NNV A;  4O2H A;  1IV7 A;  2BNG A;  1JRQ A;  2CFD A;  1RGL A;  3Q1C A;  2YFL B;  3BB9 A;  3LYG A;  4FMA A;  4RNY A;  2IUK A;  3MYT A;  3K9M C;  1VQP 3;  1EG9 B;  2B1X B;  1SAR A;  3OWS A;  1K41 A;  4BTY A;  1RNT A;  4LEH A;  3HK4 A;  3FSD A;  4X2H A;  2CW9 A;  2XRX B;  3JVC A;  5IEO A;  3F14 A;  4HM7 B;  1G96 A;  2GU3 A;  1IT7 A;  2CX0 A;  4O3V A;  1AQZ A;  3D9R A;  3I55 3;  2UUG C;  3DH2 A;  3EX9 A;  1OF5 A;  3VF1 A;  5G1K A;  3ECF A;  4L7K A;  2RNT A;  1BUJ A;  3AMO A;  3SOA A;  3BND A;  1LQG C;  1VQ7 3;  1O7G B;  1NWW A;  3NBJ A;  5G2G A;  1AR0 A;  1WMP A;  4WP5 A;  1LOW A;  3WOD G;  4U13 A;  3G4S 3;  1ISK A;  1BSA A;  1YIJ 3;  1EQK A;  5AIF A;  5AYR B;  2Z7A A;  3AMO B;  1I3I A;  3DGL A;  4I4K A;  1RCK A;  3LZA A;  4QWT A;  5BU4 A;  2XFS A;  1X1U A;  3OWY A;  1N8R 4;  1S5A A;  1G02 A;  2CFK A;  1QAK A;  4K90 B;  2OTL 3;  4EBG A;  3I56 3;  5CF1 A;  1IQY A;  3F7X A;  3G6E 3;  1Q82 4;  4HAA A;  4HZ9 B;  5JBS A;  1IQX A;  1AVK A;  3A76 A;  3SOY A;  3LTB A;  5DRE A;  5BVB A;  2BMO B;  3X41 A;  1GS3 A;  4XDV A;  5ELU A;  5BXQ A;  1CH0 A;  3KSE D;  2F5M A;  2IYJ A;  1T3B A;  2WGQ A;  1UW1 A;  4RNZ A;  3OV4 A;  1B21 A;  5IG3 A;  1CEW I;  3U97 A;  3DZL A;  2BMQ B;  1VQO 3;  1VQ4 3;  4HM2 B;  1HYF A;  5IW9 A;  1OHO A;  8CHO A;  2ZL8 A;  1PY3 A;  2FXT A;  3G71 3;  5FGO A;  3BNB A;  1GMQ A;  1J2B A;  1KC8 4;  1NO3 A;  1TTO A;  1UUG B;  3LT9 A;  1GD4 A;  1T5Y A;  2CX1 A;  1YI2 3;  1HKX A;  1R4Y A;  1SJW A;  4OK0 A;  3UL6 A;  3FLJ A;  2BU4 A;  2GBX B;  4HM1 B;  3B4P A;  4XBT A;  2RGQ A;  3MKI A;  1V58 A;  1UCK A;  3L0R A;  4EV2 A;  1N5P A;  2OQE C;  1FA3 A;  3SED A;  1BNS A;  2UX0 A;  1LQM B;  1O7P B;  3MG2 A;  4CPK A;  1JBT A;  4BIR A;  1N9E A;  4FMC A;  1EKM A;  1FGM A;  1OH0 A;  1DMQ A;  4LZI A;  3PCR A;  1SPU A;  3CCV 3;  1N5H A;  1FGT A;  1I0X A;  1Y4K A;  3CC4 3;  5AEU B;  4KFF A;  3WR2 A;  1OUN A;  3SVA A;  2MF7 A;  2F99 A;  1UUW B;  2ML6 A;  1I2E A;  1FYS A;  2SBL A;  4WYK A;  1LNI A;  4LMI A;  2KF5 A;  3HI7 A;  1IYY A;  3HX8 A;  4FMB A;  3D3L A;  1X1Y A;  4JF8 A;  3Q2P A;  3X40 A;  5EQL A;  5DRV A; 
#chains in the Genus database with same CATH homology
 1DYU A;  1L5G B;  5KP1 A;  1VQM 3;  2QGU A;  1V74 A;  3CNX A;  1EA2 A;  3EN8 A;  1OCV A;  1IVU A;  3WA2 X;  5FW5 A;  3PXM A;  1IVW A;  3S67 A;  1QMA A;  1TU5 A;  1YJN 3;  2BHM A;  2P38 A;  1A2K A;  2HML B;  4IIA A;  2KCD A;  1W6Y A;  2W9P A;  3V99 A;  1KD1 4;  3UNL A;  1OPY A;  3PCS A;  5EVH A;  3EHC A;  5IER A;  1ULJ B;  3EN1 B;  3DGM A;  1JB2 A;  3GZY B;  5IG0 A;  1STD A;  3KKG A;  1KWI A;  4K61 A;  4XM4 A;  5AIG A;  5AII A;  4JRF A;  1KQS 2;  2W2C A;  1JNQ A;  5TGN A;  1GY6 A;  1JKG B;  1K73 4;  3LH4 A;  3IPT A;  2Y74 A;  3PYJ A;  1LXE A;  1JV2 B;  1OHP A;  3NUV A;  3G16 A;  3CCM 3;  5CK6 A;  3NX0 A;  4NRE A;  3B8L A;  3BNC A;  3PZW A;  4IT7 A;  5LC7 A;  5IEN A;  2V1L A;  5D81 A;  1A2V A;  3ER7 A;  1U5O A;  2B24 B;  1VQN 3;  4N6M A;  1PU4 A;  4O8S A;  3RGA A;  4HM3 B;  3WMD A;  3CXC 2;  3CCL 3;  3LTA A;  1D6U A;  5IG4 A;  5KP3 A;  4K1U A;  4WHA A;  3S29 A;  4N6U A;  4R1K A;  3FG3 A;  3HIG A;  2Q07 A;  1ROA A;  1LVN A;  3N54 B;  2INX A;  1D6Z A;  2GU1 A;  3FGY A;  2XGN A;  1DMN A;  3H51 A;  4HBR A;  3LTC A;  4IPB A;  1YJW 3;  4AKY A;  4XBY A;  4GL6 A;  2HMM B;  3S27 A;  3H3H A;  2HMK B;  3LXU X;  1IV9 A;  2MC8 A;  2RCD A;  3CCR 3;  2CH9 A;  4WFO A;  1BUQ A;  4HJL B;  1IQ8 A;  3K0Z A;  1W2B 2;  3CU3 A;  4FCJ A;  2XFT A;  2CKF B;  3N9H A;  1WQL B;  5JPP A;  3M8C A;  3GZR A;  3LT8 A;  6STD A;  1E97 A;  1Q40 B;  1K28 A;  4HM8 B;  4K1V A;  4RZM A;  2W9Q A;  4R4K A;  2ZDJ A;  3BNE A;  1W4N A;  1D6Y A;  4N6N B;  5LC6 A;  2E2U A;  1PFP A;  1WNH A;  3CCQ 3;  2CK3 H;  4J9A A;  3HII A;  4GB5 A;  3IJE B;  3B7C A;  1CYV A;  3HZP A;  3JUQ A;  1VQK 3;  4FCZ A;  3FZW A;  5AEW B;  4HZB B;  5IG5 A;  1U8C B;  2JDI H;  5CLK A;  1R4C A;  2OCT A;  3MG3 A;  3NQZ A;  2XF3 A;  5EEO A;  1JJ2 2;  3MWZ A;  4BTW A;  2OWP A;  3PGB A;  5KP4 A;  3Q90 A;  3GZB A;  3EJV A;  1YGE A;  3KSP A;  4XBX A;  2CFL A;  2CHC A;  1E3V A;  3CCU 3;  3EC9 A;  2GXF A;  3PS8 A;  3KN4 A;  3WOF B;  3K7C A;  2OOV A;  2HMJ B;  4HKV B;  1TFO A;  3NV0 A;  3SLU A;  1MOL A;  1TP6 A;  3STD A;  3LML A;  1Q86 4;  1FUW A;  3EQQ B;  1QVG 2;  3EE1 A;  3U1W A;  4TX4 A;  1JB5 A;  3S5C A;  1RRL A;  3FKA A;  3CC7 3;  5CXO A;  2O3O A;  1GY5 A;  3T8N A;  4ZM8 A;  4KZ1 A;  5AYS C;  3NHX A;  3NV0 B;  1WMO A;  3OW2 2;  3ROB A;  3UB1 A;  3F8H A;  3UJM A;  1STF I;  2C11 A;  1F8N A;  3FG4 A;  3CPW 2;  1A90 A;  4FR9 A;  2QA4 3;  4OUQ A;  4ORL A;  1YVB I;  3WOD G;  2CIU A;  1JKG A;  4NHF A;  5D83 A;  2STD A;  4R80 A;  4HM5 B;  3X3Z A;  3KE7 A;  3TDG A;  2C10 A;  1SQW A;  2FGT A;  1VQ5 3;  1W2Z A;  4EC6 A;  2P0X A;  3FF0 A;  1QVF 2;  5IF6 A;  2KRT A;  3NBB A;  2BMR B;  1AVL A;  1YHQ 3;  1FGO A;  2YX9 A;  3F7S A;  2WOF A;  4H61 A;  5D82 A;  3CMA 3;  3IMA B;  1NB5 I;  4RBN A;  2XH9 A;  1Q7Y 4;  4R9L A;  1ROV A;  3JUO A;  5CF2 A;  1KSI A;  2K0M A;  2K54 A;  3GAX A;  2P0M A;  3GWR A;  2CFW A;  4CCV A;  2CWT A;  3DXO A;  4KFE A;  4L8O A;  1FGR A;  1NU3 A;  4HM0 B;  1IU7 A;  2F98 A;  2L4V A;  2W6J H;  2BT3 A;  2HMN B;  4N6O B;  4XDW A;  3FF2 A;  1GY7 A;  2GEX A;  2PNC A;  3VGN A;  3DM8 A;  3DGN A;  5ELJ A;  3KZT A;  2P09 A;  1VZZ A;  3G0K A;  1CQS A;  1VQL 3;  1LOX A;  3WOE B;  3KII A;  3KFQ C;  3EF8 A;  2XEP A;  1IDP A;  3O8Y A;  1W7C A;  1W01 A;  3T8U A;  2F86 B;  4MJD A;  2XSH B;  1E3R A;  2IUJ A;  4XB5 A;  3X3Y A;  4KFD A;  1QJG A;  5STD A;  1RKY A;  3DGO A;  1GYB A;  4N6V 0;  4EV5 A;  2ML5 A;  3BLZ A;  1NJI 4;  1W6C A;  2YFJ B;  4MEI A;  2WOH A;  1Q40 A;  4EXR A;  1IT8 A;  1OAC A;  1TIJ A;  4PEJ A;  3FH1 A;  2YFI B;  1C7H A;  1IVX A;  3GRD A;  4CDL A;  3CNM A;  3G8Z A;  2XR8 B;  1N9J A;  1WTH A;  1W5Z A;  2CWU A;  3RDE A;  2XSO B;  2W56 A;  1W02 A;  1O7N B;  1M1X B;  1W00 A;  3CCS 3;  1OF5 B;  4HM6 B;  3LTD A;  3WDG B;  4HM4 B;  2OOV C;  1Q42 A;  4X2O A;  3WA3 A;  1DVC A;  4AEQ A;  7STD A;  2P05 A;  1M1K 4;  2W56 B;  2Z77 A;  5I97 A;  2OTJ 3;  1ZO2 A;  2Z76 A;  3SXX A;  3X3X A;  4G1M B;  1MNL A;  3K5T A;  1M90 4;  2Y73 A;  2Z6B A;  3B4O A;  4LGQ A;  1OGZ A;  2PZV A;  1O7H B;  1RJO A;  3I0Y A;  1RRH A;  5IEP A;  1W6G A;  1FGQ A;  1QAF A;  1Z1S A;  2O9U X;  4J8T A;  3MG1 A;  1A67 A;  2W04 A;  2LYX A;  3VSY A;  1ULI B;  4FCM A;  1AV4 A;  2D42 A;  3F40 A;  3FCS B;  4OVM A;  1M9G A;  1VQ9 3;  2CG1 A;  3NXJ A;  2FNQ A;  1LNH A;  3EBT A;  1TFK A;  3DY5 A;  2A15 A;  1Q81 4;  2GEY A;  3OX9 A;  2R4I A;  1ASK A;  2WGO A;  1CYU A;  1K8A 4;  3DUK A;  2I9W A;  3MPH A;  3ALA A;  4STD A;  3UL5 A;  1TUH A;  2M7O A;  2BO9 B;  1OGX A;  2CFG A;  2IA7 A;  1SII A;  2QIY A;  3LOY A;  3X42 A;  3NM2 A;  1IK3 A;  3DMC A;  1VQ6 3;  1O7M B;  2WO0 A;  3FG1 A;  3E99 A;  3K63 A;  4N3V A;  1NB3 I;  3GZX B;  2JQ5 A;  3EBY A;  2CWV A;  3CPO A;  1GD3 A;  4AKZ A;  2W03 A;  1OHS A;  4BTX A;  4N6T A;  4LSO A;  3N8B A;  1IVV A;  2CC3 A;  3CC2 3;  2E2T A;  1WMN A;  2W0Q A;  3CCJ 3;  1RN7 A;  3EB8 A;  1JN5 A;  5HGR A;  5AI1 A;  3T0U A;  3SX1 A;  1UI8 A;  4L8P A;  1YJ9 3;  2D1W A;  3V92 A;  1N8Q A;  1JB4 A;  3MSO A;  3OWU A;  4WYK B;  4MMY B;  3RGR A;  2CG0 A;  3F9S A;  1JN5 B;  4WWU C;  4MMX B;  3NBR A;  2OQE A;  4HVN A;  1UUV B;  2LQV A;  1NDO B;  3CME 3;  2HMO B;  3JUN A;  3F8X A;  2GBW B;  3OXA A;  1O7W B;  1DVD A;  3QK9 A;  1QAL A;  3S28 A;  3V98 A;  1UI7 A;  1VQ8 3;  2IMJ A;  4EYC A;  3QRD A;  4N6L A;  4KVH A;  1US1 A;  3JUP A;  1HU9 A;  1YIT 3;  3MHE A;  3NM7 A;  3J7Y d;  2XGL A;  1S72 3;  4FMD A;  1K9M 4;  2KXG A;  2RFR A;  4O02 B;  4H3U A;  4R9K A;  1SIH A;  4HYZ A;  2QEX 3;  5JPU A;  4Q53 A;  1DMM A;  3CD6 3;  2E2V A;  2RSX A;  3NQY A;  3JUM A;  1ZX2 A;  5AIH A;  3CCE 3;  4MMZ B;  5A0O B;  4O2H A;  1IV7 A;  2BNG A;  1JRQ A;  2CFD A;  3Q1C A;  2YFL B;  3BB9 A;  3LYG A;  4FMA A;  4RNY A;  2IUK A;  3MYT A;  3K9M C;  1VQP 3;  1EG9 B;  2B1X B;  3OWS A;  1K41 A;  4BTY A;  4LEH A;  3HK4 A;  3FSD A;  4X2H A;  2CW9 A;  2XRX B;  3JVC A;  5IEO A;  3F14 A;  4HM7 B;  1G96 A;  2GU3 A;  1IT7 A;  4O3V A;  3D9R A;  3I55 3;  3EX9 A;  1OF5 A;  3VF1 A;  3ECF A;  4L7K A;  3AMO A;  3SOA A;  3BND A;  1VQ7 3;  1O7G B;  1NWW A;  3NBJ A;  5G2G A;  1AR0 A;  1WMP A;  4WP5 A;  4U13 A;  3G4S 3;  1ISK A;  1YIJ 3;  1EQK A;  5AIF A;  5AYR B;  2Z7A A;  3AMO B;  3DGL A;  4I4K A;  3LZA A;  1N8R 4;  4QWT A;  2XFS A;  3OWY A;  2OTL 3;  1S5A A;  2CFK A;  1QAK A;  4K90 B;  4EBG A;  3I56 3;  5CF1 A;  1IQY A;  3F7X A;  3G6E 3;  1Q82 4;  4HZ9 B;  5JBS A;  1IQX A;  1AVK A;  3A76 A;  3SOY A;  3LTB A;  5DRE A;  5BVB A;  2BMO B;  3X41 A;  1GS3 A;  4XDV A;  5ELU A;  5BXQ A;  3KSE D;  2WGQ A;  1UW1 A;  4RNZ A;  3OV4 A;  5IG3 A;  1CEW I;  3U97 A;  3DZL A;  2BMQ B;  1VQO 3;  1VQ4 3;  4HM2 B;  5IW9 A;  1OHO A;  8CHO A;  2ZL8 A;  3G71 3;  2FXT A;  5FGO A;  3BNB A;  1J2B A;  1KC8 4;  1NO3 A;  3LT9 A;  1GD4 A;  1T5Y A;  1YI2 3;  1HKX A;  1SJW A;  4OK0 A;  3UL6 A;  3FLJ A;  2GBX B;  4HM1 B;  4XBT A;  3B4P A;  2RGQ A;  3MKI A;  3L0R A;  4EV2 A;  1N5P A;  2OQE C;  1FA3 A;  3SED A;  2UX0 A;  1O7P B;  3MG2 A;  1N9E A;  4FMC A;  1EKM A;  1FGM A;  1OH0 A;  1DMQ A;  4LZI A;  3PCR A;  1SPU A;  3CCV 3;  1N5H A;  1FGT A;  1Y4K A;  3CC4 3;  5AEU B;  4KFF A;  1OUN A;  3SVA A;  2MF7 A;  2F99 A;  1UUW B;  2ML6 A;  2SBL A;  4WYK A;  4LMI A;  3HI7 A;  3HX8 A;  4FMB A;  3D3L A;  4JF8 A;  3Q2P A;  3X40 A;  5EQL A;  5DRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...