1LOWA

X-ray structure of the h40a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPAKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lowA00
3D5IA 2KF6A 6GSPA 1JBRA 1RNTA 1I0XA 2C4BA 1LNIA 1GMRA 1DE3A 4J5GA 3BIRA 1T2HA 1GOYA 3DH2A 1UCJA 2AADA 1B2XA 1BSDA 1BU4A 1RGCA 2BIRA 3WR2A 1B21A 1BSCA 1BNEA 1PYLA 2KF3A 3WHOA 1RGHA 1BNJA 4RNTA 1YNVX 1RSNA 1RGAA 1GOVA 3AHSA 1PY3A 1BNIA 1BRJA 1GOUA 5BIRA 1X1XA 1AY7A 1RN1A 2RNTA 1C54A 1TRQA 1I2FA 1LRAA 3Q3FA 1RCKA 1ZGXA 1B27A 1IYYA 1SARA 1BRIA 1BNFA 1BAOA 5GSPA 1X1WA 3D4AA 1B3SA 1BRSA 1B2ZA 1LOYA 1BSBA 1G02A 1T2IA 2F5MA 1RGGA 3A5EA 1BSAA 1LOVA 1B2MA 1RHLA 1BRNL 1BANA 1UCIA 1JBTA 1BNGA 1BIRA 1RGEA 1X1YA 1CH0A 3SYUA 2BU4A 1LOWA 5HOHA 1RMSA 1I0VA 1JBSA 1RLSA 1RTUA 1X1UA 3AHWA 2KF5A 3AGOA 1I3FA 1RGKA 2HOHA 2ZA4A 3DGYA 1BNSA 1I2EA 1YGWA 3HOHA 2SARA 4J5KA 7GSPA 3AGNA 1RNBA 1RCLA 1TTOA 1I3IA 1FYSA 8RNTA 1RGFA 2F4YA 1BSEA 6RNTA 1FW7A 4HAAA 1UCKA 4BIRA 4GSPA 1GMPA 1HZ1A 1FUSA 1RN4A 2GSPA 9RNTA 1BGSA 5BU4A 1BOXA 2F56A 1RGLA 7RNTA 1BNRA 1AQZA 1BUJA 1BVIA 1B2SA 2AAEA 1UCLA 4BU4A 1B20A 3BU4A 2KAAA 1B2UA 4HOHA 1MGRA 3URPA 1RDSA 1I70A 1FUTA 1GMQA 1MGWA 2RBIA 1R4YA 1I8VA 1Q9EA 1A2PA 1I2GA 3D5GA 1GSPA 2F5WA 4GHOA 1FZUA 2KF4A 1BRKA 1BRGA 1BRHA 1HYFA 1TRPA 1DETA 3GSPA 5RNTA 1YVSA 3RNTA 3KCHA
chains in the Genus database with same CATH superfamily
3HX8A 1IVUA 3EBTA 3UB1A 3CXC2 1YHQ3 1DMNA 3PCRA 3KSED 4IPBA 5JPPA 3CPW2 4R9LA 1STDA 3I553 1JBRA 3GZYB 4HM3B 3CCQ3 1MNLA 1LNIA 1MWTA 1NJI4 1CYUA 3O8YA 3BIRA 2XH9A 3DH2A 1N5HA 4HVNA 1EG9B 1NNVA 3D3LA 1B2XA 3BB9A 5CF2A 3IJEB 2GBXB 1O7PB 1Q40A 1RGCA 2BIRA 1GD3A 3H3HA 3JVCA 3NX0A 4FMBA 1OF5B 3EF8A 3T8NA 1BSCA 5KP1A 1YJW3 2KF3A 4FMDA 4N6LA 1JZOA 4RNTA 2GU3A 1VQ73 1IT7A 1RGAA 2RCDA 3G8ZA 4N3VA 4EBGA 2C11A 1PU4A 5I97A 1WMNA 2XGNA 1X1XA 4N6V0 2OQEA 3UL6A 1RN1A 4N6NB 3CNXA 4EV5A 3OV4A 1I2FA 2BMRB 1Q824 2L4VA 3HI7A 1J2BA 1QMAA 1SARA 2BT3A 1WMOA 3FGYA 2CFGA 4BL3A 1OCVA 7STDA 1X1WA 2J8XB 3OWUA 3KE7A 1W00A 1OHPA 2CFWA 1VQN3 1ZO2A 3D9RA 1YGEA 2CW9A 2F86B 3N8BA 3DM8A 1DYUA 3JUMA 4KZ1A 4LMIA 1G0TA 1B2MA 1DMMA 1RGGA 1BSAA 3ECFA 3K5TA 1M904 2STDA 2YFJB 3QK9A 1BIRA 1UUVB 3I0YA 1YJN3 2ML5A 1D6UA 2P09A 1LOWA 1QAKA 2W03A 3KKGA 1JN5A 5HOHA 1FA3A 4GB5A 4STDA 2CWVA 4MEIA 2BMOB 3AHWA 5IEPA 1VQ43 1SPUA 2KF5A 4NPBA 3G4S3 1TP6A 1VQK3 1RGKA 2Z76A 1Y4KA 3DGYA 5M1AA 5AEWB 3OXAA 1YGWA 3NBBA 4KFFA 4EV2A 5M18A 4WYKB 4LYLB 7GSPA 3AGNA 1RNBA 1SJWA 1RCLA 1RN7A 4CCVA 1TTOA 3EN8A 1I3IA 4EC6A 8RNTA 2IUKA 1RGFA 1NB5I 2QGUA 2XFSA 3CCE3 3DY5A 1IQYA 2OQEC 1LQGC 3MSOA 1DVCA 2CKFB 1MWRA 5IEOA 1AV4A 1FUSA 2GEXA 3DGMA 3K63A 1RN4A 5BVBA 4BTWA 4L8OA 4G1MB 1WQLB 1VQ53 1CEWI 2V1LA 1Q7Y4 1UI7A 7RNTA 5LC7A 1LQMB 1V58A 1T5YA 1ROVA 2IUJA 3OX9A 1EQKA 1B2SA 2AAEA 1SIIA 4HM2B 1JJ22 2B1XB 1SIHA 4IT7A 3X40A 1UUGB 3CCR3 4CJNA 8CHOA 2OWPA 3IMAB 3MWZA 3SOYA 1GMQA 1MGWA 2RBIA 2A15A 4KVHA 2M7OA 5IF6A 5G1LA 2OTL3 2F5WA 2KF4A 4MMXB 4KFEA 1NO3A 1STFI 3F40A 3T0UA 3TDGA 1V74A 3GSPA 5STDA 1UGHI 4L8PA 3FG3A 3HK4A 4RBNA 2W9PA 3RNTA 1N5PA 3K0ZA 4DKIA 2HMKB 3FF2A 4X2OA 1GY7A 4O2HA 1NDOB 1OHSA 4K90B 1EA2A 1RNTA 1IQ8A 2F98A 2CFLA 5A0OB 3GRDA 3CPOA 5IG0A 2P05A 1T2HA 1GOYA 3ALAA 3EBYA 4X2HA 4XDWA 2AADA 1KC84 1BSDA 1ULIB 1FGMA 2Z6BA 2K3DA 3WA2X 2HMJB 5AYSC 3WR2A 2W2CA 1PYLA 4WP5A 3X3ZA 1O7NB 2E2UA 1BNJA 2W56A 1YNVX 2L1SA 1ZX2A 3F7XA 3K7CA 5D83A 3PS8A 3CCM3 3AHSA 5CF1A 3CCS3 1FGOA 1TFKA 1PFPA 3B7CA 5TGNA 3SX1A 1GY6A 1GOUA 1YVBI 1VQQA 1JB2A 1AY7A 1BUQA 5DREA 1DVDA 4H61A 5AEUB 1EEJA 2E2VA 2RNTA 2XEPA 1T3BA 1TRQA 1WNHA 4ORLA 3STDA 3X3YA 1LRAA 3RGRA 1IVVA 3ZFZA 1B27A 1IK3A 1IYYA 2IMJA 1W6YA 1YI23 2CX0A 2R4IA 3GWRA 1BNFA 3WDGB 1BAOA 1OGXA 1VQ93 1W02A 1W5ZA 2P0MA 3D4AA 3X41A 1KQS2 2WGQA 3UL5A 1K734 2GXFA 3NHXA 3J7Yd 3AMOA 1IDPA 4L7KA 1VQ83 1LOYA 2F5MA 1IT8A 1W7CA 3B4PA 3LOYA 1W2B2 1DMQA 5IENA 1UCIA 2WOHA 3BNBA 3S29A 2IY2A 1QJGA 1CQSA 1WMPA 3ER7A 3NV0A 5IW9A 1JB5A 2IA7A 3JUNA 3KZTA 1HKXA 2XSOB 2F99A 2W04A 5AIIA 2MF7A 3ZG5A 2D42A 3LYGA 2P0XA 1AVKA 3X3XA 1W6GA 2CWUA 3IPTA 2HOHA 5CLKA 1BNSA 1EKMA 2I9WA 2Z77A 3HOHA 4K1VA 3CCU3 2Y74A 3MPHA 3BNCA 2YX9A 5KP4A 4TX4A 5G2GA 3KN4A 1A90A 3QRDA 5IG5A 1O7MB 5LC6A 1IV9A 3LH4A 1N8R4 4KFDA 1FGQA 2CC3A 4R9KA 6RNTA 2UGIA 2BHMA 1A67A 1JZDA 4N6MA 4K61A 5EQLA 3GZBA 2CG1A 4BIRA 2OOVC 1K9M4 1QVG2 2KRTA 1BGSA 3PXMA 1KSIA 5BU4A 2QEX3 1JKGB 3WOFB 1RGLA 2WO0A 4OUQA 3OW22 1VQP3 1E3VA 1KWIA 3GAXA 3F14A 3MG2A 2K54A 3Q90A 4RZMA 4EXRA 1OUNA 4BU4A 3LTBA 3OWYA 3Q2PA 1LVNA 4H3UA 1SQWA 3SEDA 2C10A 2OCTA 3URPA 3CC23 1RRHA 3WODG 2INXA 1I8VA 1Q7HA 1JRQA 3M8CA 1GY5A 1O7HB 1TUHA 3NBJA 5ELUA 1HU9A 1E3RA 3CU3A 3CNMA 3KIIA 2WOFA 1BRHA 4BTYA 1DETA 3DGLA 1LOXA 4XDVA 1M9GA 1M1K4 2WGOA 3N9HA 2CIUA 3D5IA 3BNEA 3FKAA 3MHEA 5D82A 2OTJ3 2IYJA 2SBLA 3DGNA 1YIJ3 1Q40B 2CX1A 3E99A 4LZIA 1EUIC 4R80A 3NBRA 6GSPA 3SLUA 2C4BA 1GMRA 1ROAA 3G0KA 3L0RA 4WWUC 1W2ZA 4BL2A 2BO9B 1UCJA 4RNYA 4MMZB 2MC8A 4LGQA 1VQL3 4OVMA 2YFIB 3V99A 1TIJA 1B21A 2CG0A 3RGAA 1BNEA 3U1WA 3WHOA 1F8NA 4HKVB 4XBXA 3FF0A 1GOVA 1PY3A 2CK3H 1UGIA 3MG3A 2Q07A 4EW5A 4GL6A 4FMAA 1OF5A 3S67A 3CCJ3 1O7WB 2W6JH 5EEOA 1W01A 1RKYA 1WTHA 1Z1SA 1C54A 1UW1A 1R4CA 3Q3FA 4JRFA 1RCKA 2B24B 2HMLB 3F9SA 1K41A 1IVXA 4FCZA 3VGNA 1LNHA 2H0GA 5IG3A 4XB5A 5CXOA 4XBYA 4WHAA 3X42A 3MYTA 1N9EA 1ULJB 4LSOA 4FMCA 1BRSA 1JN5B 1QALA 4HM7B 4IIAA 3VSYA 1BSBA 3A5EA 1T2IA 3B4OA 3B8LA 4HM6B 1LOVA 4ILFA 1RHLA 3N54B 1GD4A 2PNCA 5CK6A 5AYRB 3WOEB 2Z7AA 1BNGA 5DRVA 2KXGA 3G6E3 1JBTA 1RGEA 1ISKA 1X1YA 2CHCA 1CH0A 2BU4A 3Q1CA 5IG4A 5AIGA 1JV2B 3LXUX 1RJOA 3PZWA 2CFDA 1RLSA 4HZ9B 1RTUA 1X1UA 4N6OB 2LQVA 1CYVA 3AGOA 1I3FA 4J9AA 2OOVA 3FSDA 3CD63 2ZA4A 3FG4A 3FH1A 3KSPA 2SARA 4J5KA 3HZPA 1U5OA 4ZM8A 1UI8A 3MKIA 1FYSA 2R41A 4CPKA 2RGQA 4O02B 2K0MA 2F4YA 4I4KA 4WYKA 4HJLB 1A2VA 2E2TA 4RNZA 2H0HA 4R1KA 5AIFA 3EHCA 3SVAA 1TJDA 1GMPA 1HZ1A 1IV7A 1UDII 3NM7A 2JQ5A 1MWUA 3LT8A 3LMLA 1BOXA 2GU1A 3SXXA 2HMNB 2GEYA 3T8UA 3S27A 5EVHA 3PCSA 4NHFA 1Q864 1K8A4 3K9MC 1IU7A 1V57A 1BVIA 4HM0B 3D79A 1UCLA 3LTCA 1NU3A 1ZS7A 1B20A 3WMDA 3G16A 1MOLA 2ZDJA 3NXJA 1VQO3 1VZZA 1LXEA 1MGRA 3ROBA 5IERA 3LTAA 1S5AA 4AKYA 5G1KA 3DUKA 3EB8A 1Q9EA 2ZHXB 1A2PA 3D5GA 4J8TA 1TFOA 1C7HA 1GSPA 4GHOA 3CME3 3CC73 1FZUA 4AEQA 1BRKA 1HYFA 1TRPA 1QAFA 1E97A 1YVSA 4QWTA 2LYXA 5JBSA 2H0IA 1BUJA 3H51A 2XGLA 3V92A 1TU5A 2KF6A 4N6TA 5M19A 4HBRA 2UX0A 3F8XA 3JUQA 3NQZA 5KP3A 1I0XA 2CFKA 2QA43 4WFOA 1O7GB 1DE3A 4J5GA 4Q53A 2FXTA 2W56B 3S28A 4FCMA 1N9JA 1N8QA 3FZWA 3PYJA 6STDA 1YJ93 3DGOA 1MWSA 1BU4A 2D1WA 3RDEA 3F8HA 3G713 4PEJA 2XRXB 3BNDA 5AI1A 4BTXA 3NQYA 1NWWA 1RGHA 2W0QA 3LT9A 1AR0A 1RSNA 4NREA 1L5GB 3U97A 3UNLA 3WA3A 3BLZA 1BNIA 1BRJA 2ML6A 2RFRA 4N6UA 3FG1A 4OK0A 3PGBA 4I5QA 5BIRA 2O9UX 4FR9A 4HM4B 3EE1A 2P38A 2RSXA 2XF3A 2FNQA 3EQQB 4MMYB 3ZG0A 3AMOB 1ZGXA 2HMMB 4HZBB 2CH9A 1VQM3 1BRIA 2QIYA 1Q42A 1IVWA 5GSPA 4R4KA 1NB3I 1OACA 3F7SA 3GZXB 1IQXA 1B3SA 3VF1A 4XM4A 1B2ZA 3NV0B 1G02A 1OPYA 1G96A 2YFLB 4O8SA 1BRNL 1BANA 3CCL3 1S723 3I563 3JUOA 3NUVA 3CC43 1JB4A 4KT3B 3V98A 4XBTA 5AIHA 3SYUA 3A76A 1FGRA 1U8CB 1RMSA 1I0VA 3DZLA 4HM5B 4HM8B 2FGTA 2XFTA 2W9QA 1KD14 2ZL8A 1JBSA 3LZAA 5JPUA 4O3VA 3EJVA 1W6CA 3NM2A 3GZRA 1Q814 2Y73A 1I2EA 1OGZA 3EC9A 4LEHA 3JUPA 4FCJA 1M1XB 3OWSA 3SOAA 5FW5A 1GS3A 2BNGA 1OHOA 1UUWB 1FGTA 3DXOA 4HYZA 2XSHB 3EN1B 3FLJA 5D81A 1VQ63 5FGOA 1BSEA 1FW7A 4HAAA 4U13A 5ELJA 1UCKA 5BXQA 3DMCA 4CDLA 2GBWB 3LTDA 4GSPA 2CWTA 4HM1B 3UJMA 1YIT3 1D6ZA 2GSPA 4MJDA 1AVLA 3HIIA 9RNTA 3HIGA 2JDIH 2F56A 4AKZA 4EYCA 3KFQC 1ASKA 1FUWA 1BNRA 1AQZA 1W4NA 1GYBA 3BU4A 1D6YA 1US1A 3FCSB 1A2KA 2KAAA 1B2UA 1JKGA 2KCDA 4HOHA 5HGRA 2O3OA 2UUGC 1RDSA 1I70A 1FUTA 3CCV3 3MG1A 1R4YA 4K1UA 1I2GA 2BMQB 3CMA3 3EX9A 2HMOB 1RRLA 3S5CA 4JF8A 1BRGA 1K28A 2XR8B 2PZVA 5RNTA 1OH0A 1QVF2 1JNQA 3KCHA
chains in the Genus database with same CATH topology
3D5IA 2KF6A 6GSPA 1JBRA 1RNTA 1I0XA 2C4BA 1LNIA 1GMRA 1DE3A 4J5GA 3BIRA 1T2HA 1GOYA 3DH2A 1UCJA 2AADA 1B2XA 1BSDA 1BU4A 1RGCA 2BIRA 3WR2A 1B21A 1BSCA 1BNEA 1PYLA 2KF3A 3WHOA 1RGHA 1BNJA 4RNTA 1YNVX 1RSNA 1RGAA 1GOVA 3AHSA 1PY3A 1BNIA 1BRJA 1GOUA 5BIRA 1X1XA 1AY7A 1RN1A 2RNTA 1C54A 1TRQA 1I2FA 1LRAA 3Q3FA 1RCKA 1ZGXA 1B27A 1IYYA 1SARA 1BRIA 1BNFA 1BAOA 5GSPA 1X1WA 3D4AA 1B3SA 1BRSA 1B2ZA 1LOYA 1BSBA 1G02A 1T2IA 2F5MA 1RGGA 3A5EA 1BSAA 1LOVA 1B2MA 1RHLA 1BRNL 1BANA 1UCIA 1JBTA 1BNGA 1BIRA 1RGEA 1X1YA 1CH0A 3SYUA 2BU4A 1LOWA 5HOHA 1RMSA 1I0VA 1JBSA 1RLSA 1RTUA 1X1UA 3AHWA 2KF5A 3AGOA 1I3FA 1RGKA 2HOHA 2ZA4A 3DGYA 1BNSA 1I2EA 1YGWA 3HOHA 2SARA 4J5KA 7GSPA 3AGNA 1RNBA 1RCLA 1TTOA 1I3IA 1FYSA 8RNTA 1RGFA 2F4YA 1BSEA 6RNTA 1FW7A 4HAAA 1UCKA 4BIRA 4GSPA 1GMPA 1HZ1A 1FUSA 1RN4A 2GSPA 9RNTA 1BGSA 5BU4A 1BOXA 2F56A 1RGLA 7RNTA 1BNRA 1AQZA 1BUJA 1BVIA 1B2SA 2AAEA 1UCLA 4BU4A 1B20A 3BU4A 2KAAA 1B2UA 4HOHA 1MGRA 3URPA 1RDSA 1I70A 1FUTA 1GMQA 1MGWA 2RBIA 1R4YA 1I8VA 1Q9EA 1A2PA 1I2GA 3D5GA 1GSPA 2F5WA 4GHOA 1FZUA 2KF4A 1BRKA 1BRGA 1BRHA 1HYFA 1TRPA 1DETA 3GSPA 5RNTA 1YVSA 3RNTA 3KCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5I A;  2KF6 A;  6GSP A;  1JBR A;  1RNT A;  1I0X A;  2C4B A;  1LNI A;  1GMR A;  1DE3 A;  4J5G A;  3BIR A;  1T2H A;  1GOY A;  3DH2 A;  1UCJ A;  2AAD A;  1B2X A;  1BSD A;  1BU4 A;  1RGC A;  2BIR A;  3WR2 A;  1B21 A;  1BSC A;  1BNE A;  1PYL A;  2KF3 A;  3WHO A;  1RGH A;  1BNJ A;  4RNT A;  1YNV X;  1RSN A;  1RGA A;  1GOV A;  3AHS A;  1PY3 A;  1BNI A;  1BRJ A;  1GOU A;  5BIR A;  1X1X A;  1AY7 A;  1RN1 A;  2RNT A;  1C54 A;  1TRQ A;  1I2F A;  1LRA A;  3Q3F A;  1RCK A;  1ZGX A;  1B27 A;  1IYY A;  1SAR A;  1BRI A;  1BNF A;  1BAO A;  5GSP A;  1X1W A;  3D4A A;  1B3S A;  1BRS A;  1B2Z A;  1LOY A;  1BSB A;  1G02 A;  1T2I A;  2F5M A;  1RGG A;  3A5E A;  1BSA A;  1LOV A;  1B2M A;  1RHL A;  1BRN L;  1BAN A;  1UCI A;  1JBT A;  1BNG A;  1BIR A;  1RGE A;  1X1Y A;  1CH0 A;  3SYU A;  2BU4 A;  1LOW A;  5HOH A;  1RMS A;  1I0V A;  1JBS A;  1RLS A;  1RTU A;  1X1U A;  3AHW A;  2KF5 A;  3AGO A;  1I3F A;  1RGK A;  2HOH A;  2ZA4 A;  3DGY A;  1BNS A;  1I2E A;  1YGW A;  3HOH A;  2SAR A;  4J5K A;  7GSP A;  3AGN A;  1RNB A;  1RCL A;  1TTO A;  1I3I A;  1FYS A;  8RNT A;  1RGF A;  2F4Y A;  1BSE A;  6RNT A;  1FW7 A;  4HAA A;  1UCK A;  4BIR A;  4GSP A;  1GMP A;  1HZ1 A;  1FUS A;  1RN4 A;  2GSP A;  9RNT A;  1BGS A;  5BU4 A;  1BOX A;  2F56 A;  1RGL A;  7RNT A;  1BNR A;  1AQZ A;  1BUJ A;  1BVI A;  1B2S A;  2AAE A;  1UCL A;  4BU4 A;  1B20 A;  3BU4 A;  2KAA A;  1B2U A;  4HOH A;  1MGR A;  3URP A;  1RDS A;  1I70 A;  1FUT A;  1GMQ A;  1MGW A;  2RBI A;  1R4Y A;  1I8V A;  1Q9E A;  1A2P A;  1I2G A;  3D5G A;  1GSP A;  2F5W A;  4GHO A;  1FZU A;  2KF4 A;  1BRK A;  1BRG A;  1BRH A;  1HYF A;  1TRP A;  1DET A;  3GSP A;  5RNT A;  1YVS A;  3RNT A;  3KCH A; 
#chains in the Genus database with same CATH topology
 3HX8 A;  1IVU A;  3EBT A;  3UB1 A;  3CXC 2;  1YHQ 3;  1DMN A;  3PCR A;  3KSE D;  4IPB A;  5JPP A;  3CPW 2;  4R9L A;  1STD A;  3I55 3;  1JBR A;  3GZY B;  4HM3 B;  3CCQ 3;  1MNL A;  1LNI A;  1MWT A;  1NJI 4;  1CYU A;  3O8Y A;  3BIR A;  2XH9 A;  3DH2 A;  1N5H A;  4HVN A;  1EG9 B;  1NNV A;  3D3L A;  1B2X A;  3BB9 A;  5CF2 A;  3IJE B;  2GBX B;  1O7P B;  1Q40 A;  1RGC A;  2BIR A;  1GD3 A;  3H3H A;  3JVC A;  3NX0 A;  4FMB A;  1OF5 B;  3EF8 A;  3T8N A;  1BSC A;  5KP1 A;  1YJW 3;  2KF3 A;  4FMD A;  4N6L A;  1JZO A;  4RNT A;  2GU3 A;  1VQ7 3;  1IT7 A;  1RGA A;  2RCD A;  3G8Z A;  4N3V A;  4EBG A;  2C11 A;  1PU4 A;  5I97 A;  1WMN A;  2XGN A;  1X1X A;  4N6V 0;  2OQE A;  3UL6 A;  1RN1 A;  4N6N B;  3CNX A;  4EV5 A;  3OV4 A;  1I2F A;  2BMR B;  1Q82 4;  2L4V A;  3HI7 A;  1J2B A;  1QMA A;  1SAR A;  2BT3 A;  1WMO A;  3FGY A;  2CFG A;  4BL3 A;  1OCV A;  7STD A;  1X1W A;  2J8X B;  3OWU A;  3KE7 A;  1W00 A;  1OHP A;  2CFW A;  1VQN 3;  1ZO2 A;  3D9R A;  1YGE A;  2CW9 A;  2F86 B;  3N8B A;  3DM8 A;  1DYU A;  3JUM A;  4KZ1 A;  4LMI A;  1G0T A;  1B2M A;  1DMM A;  1RGG A;  1BSA A;  3ECF A;  3K5T A;  1M90 4;  2STD A;  2YFJ B;  3QK9 A;  1BIR A;  1UUV B;  3I0Y A;  1YJN 3;  2ML5 A;  1D6U A;  2P09 A;  1LOW A;  1QAK A;  2W03 A;  3KKG A;  1JN5 A;  5HOH A;  1FA3 A;  4GB5 A;  4STD A;  2CWV A;  4MEI A;  2BMO B;  3AHW A;  5IEP A;  1VQ4 3;  1SPU A;  2KF5 A;  4NPB A;  3G4S 3;  1TP6 A;  1VQK 3;  1RGK A;  2Z76 A;  1Y4K A;  3DGY A;  5M1A A;  5AEW B;  3OXA A;  1YGW A;  3NBB A;  4KFF A;  4EV2 A;  5M18 A;  4WYK B;  4LYL B;  7GSP A;  3AGN A;  1RNB A;  1SJW A;  1RCL A;  1RN7 A;  4CCV A;  1TTO A;  3EN8 A;  1I3I A;  4EC6 A;  8RNT A;  2IUK A;  1RGF A;  1NB5 I;  2QGU A;  2XFS A;  3CCE 3;  3DY5 A;  1IQY A;  2OQE C;  1LQG C;  3MSO A;  1DVC A;  2CKF B;  1MWR A;  5IEO A;  1AV4 A;  1FUS A;  2GEX A;  3DGM A;  3K63 A;  1RN4 A;  5BVB A;  4BTW A;  4L8O A;  4G1M B;  1WQL B;  1VQ5 3;  1CEW I;  2V1L A;  1Q7Y 4;  1UI7 A;  7RNT A;  5LC7 A;  1LQM B;  1V58 A;  1T5Y A;  1ROV A;  2IUJ A;  3OX9 A;  1EQK A;  1B2S A;  2AAE A;  1SII A;  4HM2 B;  1JJ2 2;  2B1X B;  1SIH A;  4IT7 A;  3X40 A;  1UUG B;  3CCR 3;  4CJN A;  8CHO A;  2OWP A;  3IMA B;  3MWZ A;  3SOY A;  1GMQ A;  1MGW A;  2RBI A;  2A15 A;  4KVH A;  2M7O A;  5IF6 A;  5G1L A;  2OTL 3;  2F5W A;  2KF4 A;  4MMX B;  4KFE A;  1NO3 A;  1STF I;  3F40 A;  3T0U A;  3TDG A;  1V74 A;  3GSP A;  5STD A;  1UGH I;  4L8P A;  3FG3 A;  3HK4 A;  4RBN A;  2W9P A;  3RNT A;  1N5P A;  3K0Z A;  4DKI A;  2HMK B;  3FF2 A;  4X2O A;  1GY7 A;  4O2H A;  1NDO B;  1OHS A;  4K90 B;  1EA2 A;  1RNT A;  1IQ8 A;  2F98 A;  2CFL A;  5A0O B;  3GRD A;  3CPO A;  5IG0 A;  2P05 A;  1T2H A;  1GOY A;  3ALA A;  3EBY A;  4X2H A;  4XDW A;  2AAD A;  1KC8 4;  1BSD A;  1ULI B;  1FGM A;  2Z6B A;  2K3D A;  3WA2 X;  2HMJ B;  5AYS C;  3WR2 A;  2W2C A;  1PYL A;  4WP5 A;  3X3Z A;  1O7N B;  2E2U A;  1BNJ A;  2W56 A;  1YNV X;  2L1S A;  1ZX2 A;  3F7X A;  3K7C A;  5D83 A;  3PS8 A;  3CCM 3;  3AHS A;  5CF1 A;  3CCS 3;  1FGO A;  1TFK A;  1PFP A;  3B7C A;  5TGN A;  3SX1 A;  1GY6 A;  1GOU A;  1YVB I;  1VQQ A;  1JB2 A;  1AY7 A;  1BUQ A;  5DRE A;  1DVD A;  4H61 A;  5AEU B;  1EEJ A;  2E2V A;  2RNT A;  2XEP A;  1T3B A;  1TRQ A;  1WNH A;  4ORL A;  3STD A;  3X3Y A;  1LRA A;  3RGR A;  1IVV A;  3ZFZ A;  1B27 A;  1IK3 A;  1IYY A;  2IMJ A;  1W6Y A;  1YI2 3;  2CX0 A;  2R4I A;  3GWR A;  1BNF A;  3WDG B;  1BAO A;  1OGX A;  1VQ9 3;  1W02 A;  1W5Z A;  2P0M A;  3D4A A;  3X41 A;  1KQS 2;  2WGQ A;  3UL5 A;  1K73 4;  2GXF A;  3NHX A;  3J7Y d;  3AMO A;  1IDP A;  4L7K A;  1VQ8 3;  1LOY A;  2F5M A;  1IT8 A;  1W7C A;  3B4P A;  3LOY A;  1W2B 2;  1DMQ A;  5IEN A;  1UCI A;  2WOH A;  3BNB A;  3S29 A;  2IY2 A;  1QJG A;  1CQS A;  1WMP A;  3ER7 A;  3NV0 A;  5IW9 A;  1JB5 A;  2IA7 A;  3JUN A;  3KZT A;  1HKX A;  2XSO B;  2F99 A;  2W04 A;  5AII A;  2MF7 A;  3ZG5 A;  2D42 A;  3LYG A;  2P0X A;  1AVK A;  3X3X A;  1W6G A;  2CWU A;  3IPT A;  2HOH A;  5CLK A;  1BNS A;  1EKM A;  2I9W A;  2Z77 A;  3HOH A;  4K1V A;  3CCU 3;  2Y74 A;  3MPH A;  3BNC A;  2YX9 A;  5KP4 A;  4TX4 A;  5G2G A;  3KN4 A;  1A90 A;  3QRD A;  5IG5 A;  1O7M B;  5LC6 A;  1IV9 A;  3LH4 A;  1N8R 4;  4KFD A;  1FGQ A;  2CC3 A;  4R9K A;  6RNT A;  2UGI A;  2BHM A;  1A67 A;  1JZD A;  4N6M A;  4K61 A;  5EQL A;  3GZB A;  2CG1 A;  4BIR A;  2OOV C;  1K9M 4;  1QVG 2;  2KRT A;  1BGS A;  3PXM A;  1KSI A;  5BU4 A;  2QEX 3;  1JKG B;  3WOF B;  1RGL A;  2WO0 A;  4OUQ A;  3OW2 2;  1VQP 3;  1E3V A;  1KWI A;  3GAX A;  3F14 A;  3MG2 A;  2K54 A;  3Q90 A;  4RZM A;  4EXR A;  1OUN A;  4BU4 A;  3LTB A;  3OWY A;  3Q2P A;  1LVN A;  4H3U A;  1SQW A;  3SED A;  2C10 A;  2OCT A;  3URP A;  3CC2 3;  1RRH A;  3WOD G;  2INX A;  1I8V A;  1Q7H A;  1JRQ A;  3M8C A;  1GY5 A;  1O7H B;  1TUH A;  3NBJ A;  5ELU A;  1HU9 A;  1E3R A;  3CU3 A;  3CNM A;  3KII A;  2WOF A;  1BRH A;  4BTY A;  1DET A;  3DGL A;  1LOX A;  4XDV A;  1M9G A;  1M1K 4;  2WGO A;  3N9H A;  2CIU A;  3D5I A;  3BNE A;  3FKA A;  3MHE A;  5D82 A;  2OTJ 3;  2IYJ A;  2SBL A;  3DGN A;  1YIJ 3;  1Q40 B;  2CX1 A;  3E99 A;  4LZI A;  1EUI C;  4R80 A;  3NBR A;  6GSP A;  3SLU A;  2C4B A;  1GMR A;  1ROA A;  3G0K A;  3L0R A;  4WWU C;  1W2Z A;  4BL2 A;  2BO9 B;  1UCJ A;  4RNY A;  4MMZ B;  2MC8 A;  4LGQ A;  1VQL 3;  4OVM A;  2YFI B;  3V99 A;  1TIJ A;  1B21 A;  2CG0 A;  3RGA A;  1BNE A;  3U1W A;  3WHO A;  1F8N A;  4HKV B;  4XBX A;  3FF0 A;  1GOV A;  1PY3 A;  2CK3 H;  1UGI A;  3MG3 A;  2Q07 A;  4EW5 A;  4GL6 A;  4FMA A;  1OF5 A;  3S67 A;  3CCJ 3;  1O7W B;  2W6J H;  5EEO A;  1W01 A;  1RKY A;  1WTH A;  1Z1S A;  1C54 A;  1UW1 A;  1R4C A;  3Q3F A;  4JRF A;  1RCK A;  2B24 B;  2HML B;  3F9S A;  1K41 A;  1IVX A;  4FCZ A;  3VGN A;  1LNH A;  2H0G A;  5IG3 A;  4XB5 A;  5CXO A;  4XBY A;  4WHA A;  3X42 A;  3MYT A;  1N9E A;  1ULJ B;  4LSO A;  4FMC A;  1BRS A;  1JN5 B;  1QAL A;  4HM7 B;  4IIA A;  3VSY A;  1BSB A;  3A5E A;  1T2I A;  3B4O A;  3B8L A;  4HM6 B;  1LOV A;  4ILF A;  1RHL A;  3N54 B;  1GD4 A;  2PNC A;  5CK6 A;  5AYR B;  3WOE B;  2Z7A A;  1BNG A;  5DRV A;  2KXG A;  3G6E 3;  1JBT A;  1RGE A;  1ISK A;  1X1Y A;  2CHC A;  1CH0 A;  2BU4 A;  3Q1C A;  5IG4 A;  5AIG A;  1JV2 B;  3LXU X;  1RJO A;  3PZW A;  2CFD A;  1RLS A;  4HZ9 B;  1RTU A;  1X1U A;  4N6O B;  2LQV A;  1CYV A;  3AGO A;  1I3F A;  4J9A A;  2OOV A;  3FSD A;  3CD6 3;  2ZA4 A;  3FG4 A;  3FH1 A;  3KSP A;  2SAR A;  4J5K A;  3HZP A;  1U5O A;  4ZM8 A;  1UI8 A;  3MKI A;  1FYS A;  2R41 A;  4CPK A;  2RGQ A;  4O02 B;  2K0M A;  2F4Y A;  4I4K A;  4WYK A;  4HJL B;  1A2V A;  2E2T A;  4RNZ A;  2H0H A;  4R1K A;  5AIF A;  3EHC A;  3SVA A;  1TJD A;  1GMP A;  1HZ1 A;  1IV7 A;  1UDI I;  3NM7 A;  2JQ5 A;  1MWU A;  3LT8 A;  3LML A;  1BOX A;  2GU1 A;  3SXX A;  2HMN B;  2GEY A;  3T8U A;  3S27 A;  5EVH A;  3PCS A;  4NHF A;  1Q86 4;  1K8A 4;  3K9M C;  1IU7 A;  1V57 A;  1BVI A;  4HM0 B;  3D79 A;  1UCL A;  3LTC A;  1NU3 A;  1ZS7 A;  1B20 A;  3WMD A;  3G16 A;  1MOL A;  2ZDJ A;  3NXJ A;  1VQO 3;  1VZZ A;  1LXE A;  1MGR A;  3ROB A;  5IER A;  3LTA A;  1S5A A;  4AKY A;  5G1K A;  3DUK A;  3EB8 A;  1Q9E A;  2ZHX B;  1A2P A;  3D5G A;  4J8T A;  1TFO A;  1C7H A;  1GSP A;  4GHO A;  3CME 3;  3CC7 3;  1FZU A;  4AEQ A;  1BRK A;  1HYF A;  1TRP A;  1QAF A;  1E97 A;  1YVS A;  4QWT A;  2LYX A;  5JBS A;  2H0I A;  1BUJ A;  3H51 A;  2XGL A;  3V92 A;  1TU5 A;  2KF6 A;  4N6T A;  5M19 A;  4HBR A;  2UX0 A;  3F8X A;  3JUQ A;  3NQZ A;  5KP3 A;  1I0X A;  2CFK A;  2QA4 3;  4WFO A;  1O7G B;  1DE3 A;  4J5G A;  4Q53 A;  2FXT A;  2W56 B;  3S28 A;  4FCM A;  1N9J A;  1N8Q A;  3FZW A;  3PYJ A;  6STD A;  1YJ9 3;  3DGO A;  1MWS A;  1BU4 A;  2D1W A;  3RDE A;  3F8H A;  3G71 3;  4PEJ A;  2XRX B;  3BND A;  5AI1 A;  4BTX A;  3NQY A;  1NWW A;  1RGH A;  2W0Q A;  3LT9 A;  1AR0 A;  1RSN A;  4NRE A;  1L5G B;  3U97 A;  3UNL A;  3WA3 A;  3BLZ A;  1BNI A;  1BRJ A;  2ML6 A;  2RFR A;  4N6U A;  3FG1 A;  4OK0 A;  3PGB A;  4I5Q A;  5BIR A;  2O9U X;  4FR9 A;  4HM4 B;  3EE1 A;  2P38 A;  2RSX A;  2XF3 A;  2FNQ A;  3EQQ B;  4MMY B;  3ZG0 A;  3AMO B;  1ZGX A;  2HMM B;  4HZB B;  2CH9 A;  1VQM 3;  1BRI A;  2QIY A;  1Q42 A;  1IVW A;  5GSP A;  4R4K A;  1NB3 I;  1OAC A;  3F7S A;  3GZX B;  1IQX A;  1B3S A;  3VF1 A;  4XM4 A;  1B2Z A;  3NV0 B;  1G02 A;  1OPY A;  1G96 A;  2YFL B;  4O8S A;  1BRN L;  1BAN A;  3CCL 3;  1S72 3;  3I56 3;  3JUO A;  3NUV A;  3CC4 3;  1JB4 A;  4KT3 B;  3V98 A;  4XBT A;  5AIH A;  3SYU A;  3A76 A;  1FGR A;  1U8C B;  1RMS A;  1I0V A;  3DZL A;  4HM5 B;  4HM8 B;  2FGT A;  2XFT A;  2W9Q A;  1KD1 4;  2ZL8 A;  1JBS A;  3LZA A;  5JPU A;  4O3V A;  3EJV A;  1W6C A;  3NM2 A;  3GZR A;  1Q81 4;  2Y73 A;  1I2E A;  1OGZ A;  3EC9 A;  4LEH A;  3JUP A;  4FCJ A;  1M1X B;  3OWS A;  3SOA A;  5FW5 A;  1GS3 A;  2BNG A;  1OHO A;  1UUW B;  1FGT A;  3DXO A;  4HYZ A;  2XSH B;  3EN1 B;  3FLJ A;  5D81 A;  1VQ6 3;  5FGO A;  1BSE A;  1FW7 A;  4HAA A;  4U13 A;  5ELJ A;  1UCK A;  5BXQ A;  3DMC A;  4CDL A;  2GBW B;  3LTD A;  4GSP A;  2CWT A;  4HM1 B;  3UJM A;  1YIT 3;  1D6Z A;  2GSP A;  4MJD A;  1AVL A;  3HII A;  9RNT A;  3HIG A;  2JDI H;  2F56 A;  4AKZ A;  4EYC A;  3KFQ C;  1ASK A;  1FUW A;  1BNR A;  1AQZ A;  1W4N A;  1GYB A;  3BU4 A;  1D6Y A;  1US1 A;  3FCS B;  1A2K A;  2KAA A;  1B2U A;  1JKG A;  2KCD A;  4HOH A;  5HGR A;  2O3O A;  2UUG C;  1RDS A;  1I70 A;  1FUT A;  3CCV 3;  3MG1 A;  1R4Y A;  4K1U A;  1I2G A;  2BMQ B;  3CMA 3;  3EX9 A;  2HMO B;  1RRL A;  3S5C A;  4JF8 A;  1BRG A;  1K28 A;  2XR8 B;  2PZV A;  5RNT A;  1OH0 A;  1QVF 2;  1JNQ A;  3KCH A; 
#chains in the Genus database with same CATH homology
 3D5I A;  2KF6 A;  6GSP A;  1JBR A;  1RNT A;  1I0X A;  2C4B A;  1LNI A;  1GMR A;  1DE3 A;  4J5G A;  3BIR A;  1T2H A;  1GOY A;  3DH2 A;  1UCJ A;  2AAD A;  1B2X A;  1BSD A;  1BU4 A;  1RGC A;  2BIR A;  3WR2 A;  1B21 A;  1BSC A;  1BNE A;  1PYL A;  2KF3 A;  3WHO A;  1RGH A;  1BNJ A;  4RNT A;  1YNV X;  1RSN A;  1RGA A;  1GOV A;  3AHS A;  1PY3 A;  1BNI A;  1BRJ A;  1GOU A;  5BIR A;  1X1X A;  1AY7 A;  1RN1 A;  2RNT A;  1C54 A;  1TRQ A;  1I2F A;  1LRA A;  3Q3F A;  1RCK A;  1ZGX A;  1B27 A;  1IYY A;  1SAR A;  1BRI A;  1BNF A;  1BAO A;  5GSP A;  1X1W A;  3D4A A;  1B3S A;  1BRS A;  1B2Z A;  1LOY A;  1BSB A;  1G02 A;  1T2I A;  2F5M A;  1RGG A;  3A5E A;  1BSA A;  1LOV A;  1B2M A;  1RHL A;  1BRN L;  1BAN A;  1UCI A;  1JBT A;  1BNG A;  1BIR A;  1RGE A;  1X1Y A;  1CH0 A;  3SYU A;  2BU4 A;  1LOW A;  5HOH A;  1RMS A;  1I0V A;  1JBS A;  1RLS A;  1RTU A;  1X1U A;  3AHW A;  2KF5 A;  3AGO A;  1I3F A;  1RGK A;  2HOH A;  2ZA4 A;  3DGY A;  1BNS A;  1I2E A;  1YGW A;  3HOH A;  2SAR A;  4J5K A;  7GSP A;  3AGN A;  1RNB A;  1RCL A;  1TTO A;  1I3I A;  1FYS A;  8RNT A;  1RGF A;  2F4Y A;  1BSE A;  6RNT A;  1FW7 A;  4HAA A;  1UCK A;  4BIR A;  4GSP A;  1GMP A;  1HZ1 A;  1FUS A;  1RN4 A;  2GSP A;  9RNT A;  1BGS A;  5BU4 A;  1BOX A;  2F56 A;  1RGL A;  7RNT A;  1BNR A;  1AQZ A;  1BUJ A;  1BVI A;  1B2S A;  2AAE A;  1UCL A;  4BU4 A;  1B20 A;  3BU4 A;  2KAA A;  1B2U A;  4HOH A;  1MGR A;  3URP A;  1RDS A;  1I70 A;  1FUT A;  1GMQ A;  1MGW A;  2RBI A;  1R4Y A;  1I8V A;  1Q9E A;  1A2P A;  1I2G A;  3D5G A;  1GSP A;  2F5W A;  4GHO A;  1FZU A;  2KF4 A;  1BRK A;  1BRG A;  1BRH A;  1HYF A;  1TRP A;  1DET A;  3GSP A;  5RNT A;  1YVS A;  3RNT A;  3KCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...