1LOWA

X-ray structure of the h40a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPAKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 22
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lowA00
1BVIA 1G02A 1B2ZA 1GOYA 1GOVA 1X1YA 1RTUA 4J5KA 1IYYA 3D4AA 4GHOA 1RN4A 1BNSA 2RBIA 1FUTA 1BRGA 1FZUA 1B2MA 1BUJA 1BNFA 1BSBA 1RNTA 1BSDA 1BNIA 3Q3FA 3BU4A 3URPA 1T2HA 1I0VA 1B2XA 5HOHA 2KF6A 1B20A 1Q9EA 1B27A 2F5MA 3WR2A 3AGOA 1GMPA 1PY3A 3D5GA 1BSCA 2KF4A 1FW7A 1FYSA 2F56A 4GSPA 1T2IA 3BIRA 1X1XA 2AAEA 1I3FA 4HOHA 1I2EA 3A5EA 3D5IA 1BNEA 1BANA 1YVSA 1RGCA 2C4BA 1I3IA 1CH0A 1I8VA 2KF3A 1RGGA 1BGSA 1GOUA 1I0XA 1BNJA 3KCHA 1RSNA 2AADA 2F4YA 1AY7A 1BU4A 1I2FA 4RNTA 1I2GA 1LRAA 1HYFA 1UCIA 1AQZA 1LOYA 1FUSA 1B2SA 4J5GA 1TTOA 3RNTA 1B21A 1BRJA 1RGAA 1UCLA 6GSPA 1TRQA 2BU4A 4BIRA 1B2UA 2GSPA 9RNTA 1YGWA 3DH2A 2KAAA 1RNBA 5BIRA 1BRNL 1B3SA 7RNTA 1DETA 1BRKA 1RDSA 1UCKA 1DE3A 3AGNA 1BOXA 3SYUA 1BRSA 1BRIA 2KF5A 1GMRA 1YNVX 2SARA 5BU4A 3HOHA 1PYLA 1RLSA 1BNGA 3DGYA 3WHOA 1RHLA 2F5WA 5RNTA 3AHWA 1RCKA 1I70A 1JBRA 1HZ1A 1MGRA 1GSPA 2BIRA 1JBSA 1ZGXA 1UCJA 1BAOA 1RCLA 1RN1A 7GSPA 1JBTA 1RMSA 3AHSA 1RGKA 1X1WA 1BIRA 2HOHA 1BNRA 1BSAA 1A2PA 1BRHA 1LOVA 5GSPA 1RGEA 1C54A 1GMQA 1TRPA 1MGWA 1R4YA 6RNTA 1LNIA 1RGHA 4BU4A 4HAAA 1RGLA 1RGFA 8RNTA 1BSEA 3GSPA 1LOWA 1SARA 1X1UA 2RNTA 2ZA4A
chains in the Genus database with same CATH superfamily
4KFFA 4AKYA 1G02A 2CK3H 1JKGB 3I553 4WFOA 1WNHA 5AIFA 3LTAA 1RTUA 1VQ73 1VQP3 1IYYA 1CEWI 3F7XA 1YJN3 1S5AA 1M904 1M1XB 2CFWA 1FZUA 4FMCA 1W00A 5TGNA 5HGRA 1CQSA 1AR0A 3OXAA 1VQ43 1BUQA 1W02A 3WOFB 1A2KA 1UW1A 2CC3A 2QGUA 1OPYA 3FKAA 1BUJA 5DREA 5D82A 1LNHA 4N6V0 1BNIA 3S67A 2CFLA 2BNGA 1OGXA 3TDGA 3U1WA 4CPKA 2OOVC 3BU4A 2HMOB 2R41A 4N6NB 1Q7Y4 4H3UA 5G1KA 3JUMA 1EKMA 4ORLA 4KFEA 3X3XA 2O3OA 1B27A 3WR2A 3AGOA 3F40A 2HMKB 1VQN3 1Q40B 1MNLA 4OK0A 2KF4A 1UDII 2XGLA 1FYSA 1FA3A 3DY5A 1IU7A 2AAEA 1OHOA 3BIRA 3PGBA 1YJW3 3BB9A 1NWWA 1BANA 3GWRA 2YX9A 1I3IA 1FGTA 1CH0A 2QIYA 2UGIA 3D9RA 2IUJA 2HMNB 4KT3B 3X40A 3OWYA 1RGGA 3PS8A 1T3BA 3G4S3 1W6GA 3T8NA 2AADA 1QVG2 3CC23 1V74A 3JUNA 2ML5A 2B24B 5STDA 1AY7A 3SEDA 4HVNA 1AQZA 4H61A 5DRVA 3D79A 2CWUA 2OCTA 3QRDA 2CWTA 2XR8B 3RNTA 1TRQA 3CPOA 2OQEC 4HYZA 5ELJA 3FSDA 4AEQA 4BIRA 6STDA 5AIGA 2OTL3 3SXXA 3G0KA 1A90A 5BIRA 4WYKB 3WMDA 1VQK3 2SBLA 4HZBB 7RNTA 3GZRA 1OHPA 1DETA 1RDSA 1UCKA 3HI7A 3Q2PA 1BOXA 3CD63 1A2VA 1ZX2A 1DMMA 3NBBA 1RN7A 3UNLA 5JPUA 1VQ83 3NQYA 4XBYA 3FF0A 1K734 3WHOA 1TJDA 2F5WA 3HX8A 3X3ZA 3JUOA 1GY6A 2GXFA 1ZGXA 1YIJ3 1WTHA 3NX0A 1RN1A 1K9M4 5LC6A 3K9MC 1FGOA 1JBTA 5IF6A 3EQQB 2XFSA 5KP3A 2H0HA 2QEX3 1D6ZA 1O7MB 2W9QA 4PEJA 1JRQA 1W4NA 1K8A4 1MWSA 1O7HB 3EJVA 3KSPA 2OOVA 1BNRA 5CK6A 1PU4A 3CC43 5BVBA 2OTJ3 1KSIA 1E3VA 2LQVA 4WYKA 3G713 5GSPA 2P09A 2WGOA 1C54A 3S29A 1TRPA 1MGWA 1R4YA 5M18A 5FW5A 1VQ63 3DGNA 3FGYA 1IQXA 2D1WA 1RGLA 3UJMA 1NB5I 4STDA 2CIUA 3F7SA 2GBXB 3GSPA 4N6UA 3K7CA 3WOEB 1LVNA 4O8SA 3LMLA 3CCR3 1X1UA 1OCVA 1F8NA 1BVIA 3CC73 1WMOA 3B8LA 1GOVA 3VF1A 3D4AA 3DGOA 3GZYB 1BNSA 5AYRB 1JV2B 1VQ53 2HMJB 3D3LA 3V98A 5AEUB 1R4CA 1KC84 1BNFA 1A67A 2GU3A 1FGRA 3CCQ3 4RZMA 1UUGB 4BL2A 1JB5A 1MOLA 2W04A 3JVCA 1QALA 1T2HA 1I0VA 3EC9A 2P0XA 3EE1A 1Q9EA 2OQEA 5A0OB 2F5MA 3MHEA 3D5GA 1PY3A 3H51A 1BSCA 1Y4KA 3PXMA 4U13A 3V92A 7STDA 1NU3A 1X1XA 1I3FA 1FGQA 4G1MB 4HOHA 3G16A 4O3VA 2FGTA 1UGHI 1W5ZA 2KCDA 1SPUA 4HM8B 2CH9A 2OWPA 1YVSA 5EQLA 3UL6A 1ULIB 1OF5B 2C4BA 2Q07A 1GS3A 3LXUX 2GEYA 4KZ1A 4N3VA 3SLUA 4GB5A 1I8VA 2KF3A 4MMYB 3X41A 3ZG5A 1VQ93 2CG1A 4FMDA 1BGSA 3STDA 1BNJA 1TUHA 1Q7HA 1RSNA 2F86B 2Z7AA 2PZVA 3HK4A 5JPPA 2F98A 1GY7A 1W7CA 1U8CB 2IA7A 1BU4A 1I2FA 4HBRA 4RNTA 1QAKA 2D42A 2BT3A 3FH1A 3OX9A 3EF8A 4I4KA 4XBXA 3CCM3 1FUSA 1UI8A 4WWUC 1VZZA 4HM4B 2BHMA 1OACA 3SVAA 1B21A 1RGAA 2I9WA 2JDIH 2PNCA 2BU4A 1WQLB 4EV2A 3CCV3 4FMBA 2GSPA 1ROVA 1G96A 1W01A 2HMLB 3FG1A 2E2TA 3GAXA 1LQGC 1AVKA 4HM1B 1NNVA 1STDA 4EW5A 1N8QA 3CCE3 1RNBA 3GRDA 5G2GA 3OW22 2P38A 1JKGA 4HM5B 1WMPA 3EN1B 1UUVB 3SYUA 3CMA3 4WHAA 1K28A 4MMZB 1W2ZA 2BMQB 2XEPA 1BRSA 4WP5A 1BRIA 1NJI4 1DVCA 5IG0A 2SARA 4FCZA 1PYLA 4IPBA 1RLSA 4XDWA 1GD4A 1N5PA 1NDOB 1LOXA 1JN5B 3PCRA 3S27A 2W56B 2XSHB 2BIRA 3LH4A 3MG3A 1UCJA 1RCLA 1NO3A 2CX0A 2XRXB 3NBJA 5AI1A 3OWSA 1JB4A 2YFIB 3ROBA 1IVVA 2ZHXB 3EN8A 1Q40A 1STFI 3DM8A 1L5GB 2GBWB 1DMQA 1E97A 3AHSA 1ULJB 2RCDA 3BNCA 3OV4A 2KRTA 2R4IA 3S28A 5KP4A 3NBRA 2E2UA 1IV7A 4R9KA 3DXOA 1GD3A 1YVBI 4JRFA 2INXA 4XB5A 1RGEA 4HJLB 1CYVA 1V57A 3B7CA 1D6YA 1IT7A 1IQ8A 2CFGA 3QK9A 1LNIA 4NHFA 2CX1A 6RNTA 3CCJ3 3GZXB 1HKXA 5BXQA 1VQL3 1RGFA 2HMMB 1IQYA 4HM3B 3X3YA 1ZS7A 2K54A 4CDLA 1DMNA 3EBYA 2ZL8A 3OWUA 1Q824 2GU1A 8CHOA 1SARA 4K1UA 3DH2A 4RBNA 2W6JH 1JZOA 3K5TA 4EYCA 2W56A 5IERA 1B2ZA 3F9SA 3B4OA 1GY5A 5AIIA 3MKIA 4XBTA 4GHOA 2RGQA 3V99A 1BRGA 1C7HA 2CFKA 4XDVA 4RNYA 5M1AA 3U97A 4ILFA 3CCU3 1KD14 1U5OA 3EB8A 4LZIA 2A15A 2Y73A 4N6OB 3F14A 3HIGA 3KSED 3AMOB 3NM7A 1WMNA 1QJGA 2W9PA 4HZ9B 5IG3A 1OGZA 3KKGA 1Q814 5G1LA 1TIJA 5HOHA 1B2XA 3CME3 2KF6A 2M7OA 1W2B2 2BO9B 1GMPA 5EEOA 3LOYA 4R80A 2F56A 1T2IA 1JB2A 3FG4A 1ZO2A 2WOFA 5FGOA 1EUIC 1EG9B 1ROAA 2CKFB 2ZDJA 3PCSA 3HIIA 3ECFA 5IEPA 1N8R4 1AVLA 3BNBA 2J8XB 2ML6A 3GZBA 3NM2A 4KVHA 1O7GB 5CXOA 4Q53A 3Q1CA 5CF1A 5IG5A 1GOUA 4X2HA 5IG4A 3KCHA 4HM0B 1UGIA 2YFLB 3O8YA 2XF3A 1AV4A 1E3RA 3MYTA 4NREA 2H0GA 3KZTA 4EC6A 3CXC2 3RGRA 1ISKA 2C11A 1LRAA 3LYGA 1HYFA 3S5CA 3NQZA 1LQMB 1LOYA 3FG3A 4IIAA 4J5GA 4GL6A 2K3DA 1TTOA 1BRJA 4FR9A 4K1VA 1UCLA 3FF2A 4XM4A 3VSYA 3CCS3 2XH9A 4OVMA 1OHSA 5IW9A 3ZG0A 4N6LA 1OH0A 2IY2A 1SIHA 4J9AA 4K90B 1MWUA 1B3SA 3CNXA 4CJNA 1BRKA 2XFTA 1G0TA 3A76A 3AGNA 5D83A 2UX0A 1O7WB 3IPTA 3EBTA 1RJOA 3B4PA 1YNVX 2MF7A 4O2HA 5LC7A 3HOHA 1TFKA 4I5QA 3NUVA 1BNGA 4L8OA 3T8UA 3CNMA 3WA3A 1RHLA 1RCKA 1VQQA 1HZ1A 3LTCA 1GSPA 4X2OA 1VQM3 1K41A 2CWVA 2KXGA 3NHXA 1BAOA 2Z76A 1Q42A 3SOAA 3G8ZA 4JF8A 3BLZA 4HKVB 4HM6B 2UUGC 3SOYA 5AEWB 2V1LA 3G6E3 1S723 3DZLA 1O7NB 4LEHA 1X1WA 2HOHA 4LGQA 3WA2X 2CG0A 1BSAA 2WOHA 1A2PA 1BRHA 1LOVA 1DVDA 3J7Yd 1M9GA 1YGEA 3CU3A 1OF5A 5I97A 3RDEA 4EV5A 1RKYA 3N9HA 1RGHA 3MG2A 3LZAA 3NXJA 4LYLB 4BU4A 4HAAA 2XGNA 1IT8A 3IJEB 3X42A 1SQWA 1IDPA 1QVF2 4BL3A 1YHQ3 1SIIA 1O7PB 1IVXA 2RFRA 1LOWA 4L7KA 3M8CA 4MEIA 2B1XB 1ASKA 2WGQA 2ZA4A 3FZWA 5IEOA 3L0RA 4HM2B 1UI7A 1GOYA 3DGLA 2L4VA 2YFJB 3PZWA 3LT8A 4AKZA 1X1YA 1RRHA 3JUQA 4J5KA 1RN4A 4ZM8A 1EQKA 2RBIA 1FUTA 4DKIA 3EHCA 1B2MA 2F99A 1QMAA 2E2VA 1N9EA 1MWTA 3I0YA 1BSBA 1RNTA 5D81A 5JBSA 1BSDA 2CFDA 3Q3FA 3CCL3 1YI23 2IUKA 3EX9A 3F8XA 3KE7A 3URPA 3MSOA 1B20A 2CHCA 3ER7A 4L8PA 5KP1A 1JNQA 4KFDA 4R1KA 2K0MA 4R4KA 1FW7A 4GSPA 1IVWA 2W03A 2L1SA 1FUWA 3HZPA 1JN5A 1QAFA 1I2EA 3KFQC 1JZDA 3A5EA 3WDGB 3MG1A 3N8BA 2BMOB 1BNEA 3D5IA 3KIIA 4EXRA 1W6YA 4FCJA 2FXTA 2QA43 1JJ22 1RGCA 4EBGA 1VQO3 4FMAA 2FNQA 1N5HA 3LTBA 2CW9A 1I0XA 2W0QA 4MJDA 1T5YA 4CCVA 3RGAA 1SJWA 2F4YA 4NPBA 2O9UX 4OUQA 2W2CA 3MPHA 1I2GA 1UCIA 4O02B 3K63A 2P05A 3E99A 1EEJA 4QWTA 1RRLA 3VGNA 1B2SA 1KWIA 2Y74A 2P0MA 3FLJA 3JUPA 3DMCA 3LT9A 6GSPA 2GEXA 2Z77A 3FCSB 3N54B 5AIHA 1HU9A 1B2UA 1YIT3 3UL5A 3NV0B 4TX4A 1YGWA 9RNTA 1N9JA 1Q864 2KAAA 3DGMA 1DYUA 3UB1A 4IT7A 3PYJA 1BRNL 1CYUA 3H3HA 3T0UA 1W6CA 1UUWB 1YJ93 1M1K4 1DE3A 3SX1A 4RNZA 2JQ5A 5AYSC 1KQS2 1LXEA 2KF5A 4BTWA 1GMRA 5EVHA 1IK3A 5BU4A 3F8HA 1GYBA 2IMJA 1TP6A 1TFOA 1IVUA 3AMOA 3DGYA 2Z6BA 5RNTA 3AHWA 1IV9A 1I70A 1JBRA 3BNEA 1MGRA 4LSOA 1JBSA 4J8TA 7GSPA 2H0IA 2WO0A 1US1A 3Q90A 4K61A 3WODG 3ZFZA 4BTYA 1V58A 4LMIA 3MWZA 1RMSA 1Z1SA 3KN4A 1RGKA 3BNDA 3DUKA 1TU5A 1OUNA 1PFPA 1BIRA 3I563 2BMRB 3NV0A 5CF2A 1J2BA 1MWRA 1NB3I 4N6TA 2STDA 4MMXB 5CLKA 5ELUA 5IENA 3CPW2 2C10A 1GMQA 4FCMA 4R9LA 4BTXA 3IMAB 4N6MA 2XSOB 1FGMA 2LYXA 3K0ZA 8RNTA 1D6UA 4HM7B 1BSEA 2IYJA 2RSXA 1EA2A 3LTDA 2MC8A 3ALAA 5M19A 2RNTA
chains in the Genus database with same CATH topology
1BVIA 1G02A 1B2ZA 1GOYA 1GOVA 1X1YA 1RTUA 4J5KA 1IYYA 3D4AA 4GHOA 1RN4A 1BNSA 2RBIA 1FUTA 1BRGA 1FZUA 1B2MA 1BUJA 1BNFA 1BSBA 1RNTA 1BSDA 1BNIA 3Q3FA 3BU4A 3URPA 1T2HA 1I0VA 1B2XA 5HOHA 2KF6A 1B20A 1Q9EA 1B27A 2F5MA 3WR2A 3AGOA 1GMPA 1PY3A 3D5GA 1BSCA 2KF4A 1FW7A 1FYSA 2F56A 4GSPA 1T2IA 3BIRA 1X1XA 2AAEA 1I3FA 4HOHA 1I2EA 3A5EA 3D5IA 1BNEA 1BANA 1YVSA 1RGCA 2C4BA 1I3IA 1CH0A 1I8VA 2KF3A 1RGGA 1BGSA 1GOUA 1I0XA 1BNJA 3KCHA 1RSNA 2AADA 2F4YA 1AY7A 1BU4A 1I2FA 4RNTA 1I2GA 1LRAA 1HYFA 1UCIA 1AQZA 1LOYA 1FUSA 1B2SA 4J5GA 1TTOA 3RNTA 1B21A 1BRJA 1RGAA 1UCLA 6GSPA 1TRQA 2BU4A 4BIRA 1B2UA 2GSPA 9RNTA 1YGWA 3DH2A 2KAAA 1RNBA 5BIRA 1BRNL 1B3SA 7RNTA 1DETA 1BRKA 1RDSA 1UCKA 1DE3A 3AGNA 1BOXA 3SYUA 1BRSA 1BRIA 2KF5A 1GMRA 1YNVX 2SARA 5BU4A 3HOHA 1PYLA 1RLSA 1BNGA 3DGYA 3WHOA 1RHLA 2F5WA 5RNTA 3AHWA 1RCKA 1I70A 1JBRA 1HZ1A 1MGRA 1GSPA 2BIRA 1JBSA 1ZGXA 1UCJA 1BAOA 1RCLA 1RN1A 7GSPA 1JBTA 1RMSA 3AHSA 1RGKA 1X1WA 1BIRA 2HOHA 1BNRA 1BSAA 1A2PA 1BRHA 1LOVA 5GSPA 1RGEA 1C54A 1GMQA 1TRPA 1MGWA 1R4YA 6RNTA 1LNIA 1RGHA 4BU4A 4HAAA 1RGLA 1RGFA 8RNTA 1BSEA 3GSPA 1LOWA 1SARA 1X1UA 2RNTA 2ZA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BVI A;  1G02 A;  1B2Z A;  1GOY A;  1GOV A;  1X1Y A;  1RTU A;  4J5K A;  1IYY A;  3D4A A;  4GHO A;  1RN4 A;  1BNS A;  2RBI A;  1FUT A;  1BRG A;  1FZU A;  1B2M A;  1BUJ A;  1BNF A;  1BSB A;  1RNT A;  1BSD A;  1BNI A;  3Q3F A;  3BU4 A;  3URP A;  1T2H A;  1I0V A;  1B2X A;  5HOH A;  2KF6 A;  1B20 A;  1Q9E A;  1B27 A;  2F5M A;  3WR2 A;  3AGO A;  1GMP A;  1PY3 A;  3D5G A;  1BSC A;  2KF4 A;  1FW7 A;  1FYS A;  2F56 A;  4GSP A;  1T2I A;  3BIR A;  1X1X A;  2AAE A;  1I3F A;  4HOH A;  1I2E A;  3A5E A;  3D5I A;  1BNE A;  1BAN A;  1YVS A;  1RGC A;  2C4B A;  1I3I A;  1CH0 A;  1I8V A;  2KF3 A;  1RGG A;  1BGS A;  1GOU A;  1I0X A;  1BNJ A;  3KCH A;  1RSN A;  2AAD A;  2F4Y A;  1AY7 A;  1BU4 A;  1I2F A;  4RNT A;  1I2G A;  1LRA A;  1HYF A;  1UCI A;  1AQZ A;  1LOY A;  1FUS A;  1B2S A;  4J5G A;  1TTO A;  3RNT A;  1B21 A;  1BRJ A;  1RGA A;  1UCL A;  6GSP A;  1TRQ A;  2BU4 A;  4BIR A;  1B2U A;  2GSP A;  9RNT A;  1YGW A;  3DH2 A;  2KAA A;  1RNB A;  5BIR A;  1BRN L;  1B3S A;  7RNT A;  1DET A;  1BRK A;  1RDS A;  1UCK A;  1DE3 A;  3AGN A;  1BOX A;  3SYU A;  1BRS A;  1BRI A;  2KF5 A;  1GMR A;  1YNV X;  2SAR A;  5BU4 A;  3HOH A;  1PYL A;  1RLS A;  1BNG A;  3DGY A;  3WHO A;  1RHL A;  2F5W A;  5RNT A;  3AHW A;  1RCK A;  1I70 A;  1JBR A;  1HZ1 A;  1MGR A;  1GSP A;  2BIR A;  1JBS A;  1ZGX A;  1UCJ A;  1BAO A;  1RCL A;  1RN1 A;  7GSP A;  1JBT A;  1RMS A;  3AHS A;  1RGK A;  1X1W A;  1BIR A;  2HOH A;  1BNR A;  1BSA A;  1A2P A;  1BRH A;  1LOV A;  5GSP A;  1RGE A;  1C54 A;  1GMQ A;  1TRP A;  1MGW A;  1R4Y A;  6RNT A;  1LNI A;  1RGH A;  4BU4 A;  4HAA A;  1RGL A;  1RGF A;  8RNT A;  1BSE A;  3GSP A;  1LOW A;  1SAR A;  1X1U A;  2RNT A;  2ZA4 A; 
#chains in the Genus database with same CATH topology
 4KFF A;  4AKY A;  1G02 A;  2CK3 H;  1JKG B;  3I55 3;  4WFO A;  1WNH A;  5AIF A;  3LTA A;  1RTU A;  1VQ7 3;  1VQP 3;  1IYY A;  1CEW I;  3F7X A;  1YJN 3;  1S5A A;  1M90 4;  1M1X B;  2CFW A;  1FZU A;  4FMC A;  1W00 A;  5TGN A;  5HGR A;  1CQS A;  1AR0 A;  3OXA A;  1VQ4 3;  1BUQ A;  1W02 A;  3WOF B;  1A2K A;  1UW1 A;  2CC3 A;  2QGU A;  1OPY A;  3FKA A;  1BUJ A;  5DRE A;  5D82 A;  1LNH A;  4N6V 0;  1BNI A;  3S67 A;  2CFL A;  2BNG A;  1OGX A;  3TDG A;  3U1W A;  4CPK A;  2OOV C;  3BU4 A;  2HMO B;  2R41 A;  4N6N B;  1Q7Y 4;  4H3U A;  5G1K A;  3JUM A;  1EKM A;  4ORL A;  4KFE A;  3X3X A;  2O3O A;  1B27 A;  3WR2 A;  3AGO A;  3F40 A;  2HMK B;  1VQN 3;  1Q40 B;  1MNL A;  4OK0 A;  2KF4 A;  1UDI I;  2XGL A;  1FYS A;  1FA3 A;  3DY5 A;  1IU7 A;  2AAE A;  1OHO A;  3BIR A;  3PGB A;  1YJW 3;  3BB9 A;  1NWW A;  1BAN A;  3GWR A;  2YX9 A;  1I3I A;  1FGT A;  1CH0 A;  2QIY A;  2UGI A;  3D9R A;  2IUJ A;  2HMN B;  4KT3 B;  3X40 A;  3OWY A;  1RGG A;  3PS8 A;  1T3B A;  3G4S 3;  1W6G A;  3T8N A;  2AAD A;  1QVG 2;  3CC2 3;  1V74 A;  3JUN A;  2ML5 A;  2B24 B;  5STD A;  1AY7 A;  3SED A;  4HVN A;  1AQZ A;  4H61 A;  5DRV A;  3D79 A;  2CWU A;  2OCT A;  3QRD A;  2CWT A;  2XR8 B;  3RNT A;  1TRQ A;  3CPO A;  2OQE C;  4HYZ A;  5ELJ A;  3FSD A;  4AEQ A;  4BIR A;  6STD A;  5AIG A;  2OTL 3;  3SXX A;  3G0K A;  1A90 A;  5BIR A;  4WYK B;  3WMD A;  1VQK 3;  2SBL A;  4HZB B;  7RNT A;  3GZR A;  1OHP A;  1DET A;  1RDS A;  1UCK A;  3HI7 A;  3Q2P A;  1BOX A;  3CD6 3;  1A2V A;  1ZX2 A;  1DMM A;  3NBB A;  1RN7 A;  3UNL A;  5JPU A;  1VQ8 3;  3NQY A;  4XBY A;  3FF0 A;  1K73 4;  3WHO A;  1TJD A;  2F5W A;  3HX8 A;  3X3Z A;  3JUO A;  1GY6 A;  2GXF A;  1ZGX A;  1YIJ 3;  1WTH A;  3NX0 A;  1RN1 A;  1K9M 4;  5LC6 A;  3K9M C;  1FGO A;  1JBT A;  5IF6 A;  3EQQ B;  2XFS A;  5KP3 A;  2H0H A;  2QEX 3;  1D6Z A;  1O7M B;  2W9Q A;  4PEJ A;  1JRQ A;  1W4N A;  1K8A 4;  1MWS A;  1O7H B;  3EJV A;  3KSP A;  2OOV A;  1BNR A;  5CK6 A;  1PU4 A;  3CC4 3;  5BVB A;  2OTJ 3;  1KSI A;  1E3V A;  2LQV A;  4WYK A;  3G71 3;  5GSP A;  2P09 A;  2WGO A;  1C54 A;  3S29 A;  1TRP A;  1MGW A;  1R4Y A;  5M18 A;  5FW5 A;  1VQ6 3;  3DGN A;  3FGY A;  1IQX A;  2D1W A;  1RGL A;  3UJM A;  1NB5 I;  4STD A;  2CIU A;  3F7S A;  2GBX B;  3GSP A;  4N6U A;  3K7C A;  3WOE B;  1LVN A;  4O8S A;  3LML A;  3CCR 3;  1X1U A;  1OCV A;  1F8N A;  1BVI A;  3CC7 3;  1WMO A;  3B8L A;  1GOV A;  3VF1 A;  3D4A A;  3DGO A;  3GZY B;  1BNS A;  5AYR B;  1JV2 B;  1VQ5 3;  2HMJ B;  3D3L A;  3V98 A;  5AEU B;  1R4C A;  1KC8 4;  1BNF A;  1A67 A;  2GU3 A;  1FGR A;  3CCQ 3;  4RZM A;  1UUG B;  4BL2 A;  1JB5 A;  1MOL A;  2W04 A;  3JVC A;  1QAL A;  1T2H A;  1I0V A;  3EC9 A;  2P0X A;  3EE1 A;  1Q9E A;  2OQE A;  5A0O B;  2F5M A;  3MHE A;  3D5G A;  1PY3 A;  3H51 A;  1BSC A;  1Y4K A;  3PXM A;  4U13 A;  3V92 A;  7STD A;  1NU3 A;  1X1X A;  1I3F A;  1FGQ A;  4G1M B;  4HOH A;  3G16 A;  4O3V A;  2FGT A;  1UGH I;  1W5Z A;  2KCD A;  1SPU A;  4HM8 B;  2CH9 A;  2OWP A;  1YVS A;  5EQL A;  3UL6 A;  1ULI B;  1OF5 B;  2C4B A;  2Q07 A;  1GS3 A;  3LXU X;  2GEY A;  4KZ1 A;  4N3V A;  3SLU A;  4GB5 A;  1I8V A;  2KF3 A;  4MMY B;  3X41 A;  3ZG5 A;  1VQ9 3;  2CG1 A;  4FMD A;  1BGS A;  3STD A;  1BNJ A;  1TUH A;  1Q7H A;  1RSN A;  2F86 B;  2Z7A A;  2PZV A;  3HK4 A;  5JPP A;  2F98 A;  1GY7 A;  1W7C A;  1U8C B;  2IA7 A;  1BU4 A;  1I2F A;  4HBR A;  4RNT A;  1QAK A;  2D42 A;  2BT3 A;  3FH1 A;  3OX9 A;  3EF8 A;  4I4K A;  4XBX A;  3CCM 3;  1FUS A;  1UI8 A;  4WWU C;  1VZZ A;  4HM4 B;  2BHM A;  1OAC A;  3SVA A;  1B21 A;  1RGA A;  2I9W A;  2JDI H;  2PNC A;  2BU4 A;  1WQL B;  4EV2 A;  3CCV 3;  4FMB A;  2GSP A;  1ROV A;  1G96 A;  1W01 A;  2HML B;  3FG1 A;  2E2T A;  3GAX A;  1LQG C;  1AVK A;  4HM1 B;  1NNV A;  1STD A;  4EW5 A;  1N8Q A;  3CCE 3;  1RNB A;  3GRD A;  5G2G A;  3OW2 2;  2P38 A;  1JKG A;  4HM5 B;  1WMP A;  3EN1 B;  1UUV B;  3SYU A;  3CMA 3;  4WHA A;  1K28 A;  4MMZ B;  1W2Z A;  2BMQ B;  2XEP A;  1BRS A;  4WP5 A;  1BRI A;  1NJI 4;  1DVC A;  5IG0 A;  2SAR A;  4FCZ A;  1PYL A;  4IPB A;  1RLS A;  4XDW A;  1GD4 A;  1N5P A;  1NDO B;  1LOX A;  1JN5 B;  3PCR A;  3S27 A;  2W56 B;  2XSH B;  2BIR A;  3LH4 A;  3MG3 A;  1UCJ A;  1RCL A;  1NO3 A;  2CX0 A;  2XRX B;  3NBJ A;  5AI1 A;  3OWS A;  1JB4 A;  2YFI B;  3ROB A;  1IVV A;  2ZHX B;  3EN8 A;  1Q40 A;  1STF I;  3DM8 A;  1L5G B;  2GBW B;  1DMQ A;  1E97 A;  3AHS A;  1ULJ B;  2RCD A;  3BNC A;  3OV4 A;  2KRT A;  2R4I A;  3S28 A;  5KP4 A;  3NBR A;  2E2U A;  1IV7 A;  4R9K A;  3DXO A;  1GD3 A;  1YVB I;  4JRF A;  2INX A;  4XB5 A;  1RGE A;  4HJL B;  1CYV A;  1V57 A;  3B7C A;  1D6Y A;  1IT7 A;  1IQ8 A;  2CFG A;  3QK9 A;  1LNI A;  4NHF A;  2CX1 A;  6RNT A;  3CCJ 3;  3GZX B;  1HKX A;  5BXQ A;  1VQL 3;  1RGF A;  2HMM B;  1IQY A;  4HM3 B;  3X3Y A;  1ZS7 A;  2K54 A;  4CDL A;  1DMN A;  3EBY A;  2ZL8 A;  3OWU A;  1Q82 4;  2GU1 A;  8CHO A;  1SAR A;  4K1U A;  3DH2 A;  4RBN A;  2W6J H;  1JZO A;  3K5T A;  4EYC A;  2W56 A;  5IER A;  1B2Z A;  3F9S A;  3B4O A;  1GY5 A;  5AII A;  3MKI A;  4XBT A;  4GHO A;  2RGQ A;  3V99 A;  1BRG A;  1C7H A;  2CFK A;  4XDV A;  4RNY A;  5M1A A;  3U97 A;  4ILF A;  3CCU 3;  1KD1 4;  1U5O A;  3EB8 A;  4LZI A;  2A15 A;  2Y73 A;  4N6O B;  3F14 A;  3HIG A;  3KSE D;  3AMO B;  3NM7 A;  1WMN A;  1QJG A;  2W9P A;  4HZ9 B;  5IG3 A;  1OGZ A;  3KKG A;  1Q81 4;  5G1L A;  1TIJ A;  5HOH A;  1B2X A;  3CME 3;  2KF6 A;  2M7O A;  1W2B 2;  2BO9 B;  1GMP A;  5EEO A;  3LOY A;  4R80 A;  2F56 A;  1T2I A;  1JB2 A;  3FG4 A;  1ZO2 A;  2WOF A;  5FGO A;  1EUI C;  1EG9 B;  1ROA A;  2CKF B;  2ZDJ A;  3PCS A;  3HII A;  3ECF A;  5IEP A;  1N8R 4;  1AVL A;  3BNB A;  2J8X B;  2ML6 A;  3GZB A;  3NM2 A;  4KVH A;  1O7G B;  5CXO A;  4Q53 A;  3Q1C A;  5CF1 A;  5IG5 A;  1GOU A;  4X2H A;  5IG4 A;  3KCH A;  4HM0 B;  1UGI A;  2YFL B;  3O8Y A;  2XF3 A;  1AV4 A;  1E3R A;  3MYT A;  4NRE A;  2H0G A;  3KZT A;  4EC6 A;  3CXC 2;  3RGR A;  1ISK A;  2C11 A;  1LRA A;  3LYG A;  1HYF A;  3S5C A;  3NQZ A;  1LQM B;  1LOY A;  3FG3 A;  4IIA A;  4J5G A;  4GL6 A;  2K3D A;  1TTO A;  1BRJ A;  4FR9 A;  4K1V A;  1UCL A;  3FF2 A;  4XM4 A;  3VSY A;  3CCS 3;  2XH9 A;  4OVM A;  1OHS A;  5IW9 A;  3ZG0 A;  4N6L A;  1OH0 A;  2IY2 A;  1SIH A;  4J9A A;  4K90 B;  1MWU A;  1B3S A;  3CNX A;  4CJN A;  1BRK A;  2XFT A;  1G0T A;  3A76 A;  3AGN A;  5D83 A;  2UX0 A;  1O7W B;  3IPT A;  3EBT A;  1RJO A;  3B4P A;  1YNV X;  2MF7 A;  4O2H A;  5LC7 A;  3HOH A;  1TFK A;  4I5Q A;  3NUV A;  1BNG A;  4L8O A;  3T8U A;  3CNM A;  3WA3 A;  1RHL A;  1RCK A;  1VQQ A;  1HZ1 A;  3LTC A;  1GSP A;  4X2O A;  1VQM 3;  1K41 A;  2CWV A;  2KXG A;  3NHX A;  1BAO A;  2Z76 A;  1Q42 A;  3SOA A;  3G8Z A;  4JF8 A;  3BLZ A;  4HKV B;  4HM6 B;  2UUG C;  3SOY A;  5AEW B;  2V1L A;  3G6E 3;  1S72 3;  3DZL A;  1O7N B;  4LEH A;  1X1W A;  2HOH A;  4LGQ A;  3WA2 X;  2CG0 A;  1BSA A;  2WOH A;  1A2P A;  1BRH A;  1LOV A;  1DVD A;  3J7Y d;  1M9G A;  1YGE A;  3CU3 A;  1OF5 A;  5I97 A;  3RDE A;  4EV5 A;  1RKY A;  3N9H A;  1RGH A;  3MG2 A;  3LZA A;  3NXJ A;  4LYL B;  4BU4 A;  4HAA A;  2XGN A;  1IT8 A;  3IJE B;  3X42 A;  1SQW A;  1IDP A;  1QVF 2;  4BL3 A;  1YHQ 3;  1SII A;  1O7P B;  1IVX A;  2RFR A;  1LOW A;  4L7K A;  3M8C A;  4MEI A;  2B1X B;  1ASK A;  2WGQ A;  2ZA4 A;  3FZW A;  5IEO A;  3L0R A;  4HM2 B;  1UI7 A;  1GOY A;  3DGL A;  2L4V A;  2YFJ B;  3PZW A;  3LT8 A;  4AKZ A;  1X1Y A;  1RRH A;  3JUQ A;  4J5K A;  1RN4 A;  4ZM8 A;  1EQK A;  2RBI A;  1FUT A;  4DKI A;  3EHC A;  1B2M A;  2F99 A;  1QMA A;  2E2V A;  1N9E A;  1MWT A;  3I0Y A;  1BSB A;  1RNT A;  5D81 A;  5JBS A;  1BSD A;  2CFD A;  3Q3F A;  3CCL 3;  1YI2 3;  2IUK A;  3EX9 A;  3F8X A;  3KE7 A;  3URP A;  3MSO A;  1B20 A;  2CHC A;  3ER7 A;  4L8P A;  5KP1 A;  1JNQ A;  4KFD A;  4R1K A;  2K0M A;  4R4K A;  1FW7 A;  4GSP A;  1IVW A;  2W03 A;  2L1S A;  1FUW A;  3HZP A;  1JN5 A;  1QAF A;  1I2E A;  3KFQ C;  1JZD A;  3A5E A;  3WDG B;  3MG1 A;  3N8B A;  2BMO B;  1BNE A;  3D5I A;  3KII A;  4EXR A;  1W6Y A;  4FCJ A;  2FXT A;  2QA4 3;  1JJ2 2;  1RGC A;  4EBG A;  1VQO 3;  4FMA A;  2FNQ A;  1N5H A;  3LTB A;  2CW9 A;  1I0X A;  2W0Q A;  4MJD A;  1T5Y A;  4CCV A;  3RGA A;  1SJW A;  2F4Y A;  4NPB A;  2O9U X;  4OUQ A;  2W2C A;  3MPH A;  1I2G A;  1UCI A;  4O02 B;  3K63 A;  2P05 A;  3E99 A;  1EEJ A;  4QWT A;  1RRL A;  3VGN A;  1B2S A;  1KWI A;  2Y74 A;  2P0M A;  3FLJ A;  3JUP A;  3DMC A;  3LT9 A;  6GSP A;  2GEX A;  2Z77 A;  3FCS B;  3N54 B;  5AIH A;  1HU9 A;  1B2U A;  1YIT 3;  3UL5 A;  3NV0 B;  4TX4 A;  1YGW A;  9RNT A;  1N9J A;  1Q86 4;  2KAA A;  3DGM A;  1DYU A;  3UB1 A;  4IT7 A;  3PYJ A;  1BRN L;  1CYU A;  3H3H A;  3T0U A;  1W6C A;  1UUW B;  1YJ9 3;  1M1K 4;  1DE3 A;  3SX1 A;  4RNZ A;  2JQ5 A;  5AYS C;  1KQS 2;  1LXE A;  2KF5 A;  4BTW A;  1GMR A;  5EVH A;  1IK3 A;  5BU4 A;  3F8H A;  1GYB A;  2IMJ A;  1TP6 A;  1TFO A;  1IVU A;  3AMO A;  3DGY A;  2Z6B A;  5RNT A;  3AHW A;  1IV9 A;  1I70 A;  1JBR A;  3BNE A;  1MGR A;  4LSO A;  1JBS A;  4J8T A;  7GSP A;  2H0I A;  2WO0 A;  1US1 A;  3Q90 A;  4K61 A;  3WOD G;  3ZFZ A;  4BTY A;  1V58 A;  4LMI A;  3MWZ A;  1RMS A;  1Z1S A;  3KN4 A;  1RGK A;  3BND A;  3DUK A;  1TU5 A;  1OUN A;  1PFP A;  1BIR A;  3I56 3;  2BMR B;  3NV0 A;  5CF2 A;  1J2B A;  1MWR A;  1NB3 I;  4N6T A;  2STD A;  4MMX B;  5CLK A;  5ELU A;  5IEN A;  3CPW 2;  2C10 A;  1GMQ A;  4FCM A;  4R9L A;  4BTX A;  3IMA B;  4N6M A;  2XSO B;  1FGM A;  2LYX A;  3K0Z A;  8RNT A;  1D6U A;  4HM7 B;  1BSE A;  2IYJ A;  2RSX A;  1EA2 A;  3LTD A;  2MC8 A;  3ALA A;  5M19 A;  2RNT A; 
#chains in the Genus database with same CATH homology
 1BVI A;  1G02 A;  1B2Z A;  1GOY A;  1GOV A;  1X1Y A;  1RTU A;  4J5K A;  1IYY A;  3D4A A;  4GHO A;  1RN4 A;  1BNS A;  2RBI A;  1FUT A;  1BRG A;  1FZU A;  1B2M A;  1BUJ A;  1BNF A;  1BSB A;  1RNT A;  1BSD A;  1BNI A;  3Q3F A;  3BU4 A;  3URP A;  1T2H A;  1I0V A;  1B2X A;  5HOH A;  2KF6 A;  1B20 A;  1Q9E A;  1B27 A;  2F5M A;  3WR2 A;  3AGO A;  1GMP A;  1PY3 A;  3D5G A;  1BSC A;  2KF4 A;  1FW7 A;  1FYS A;  2F56 A;  4GSP A;  1T2I A;  3BIR A;  1X1X A;  2AAE A;  1I3F A;  4HOH A;  1I2E A;  3A5E A;  3D5I A;  1BNE A;  1BAN A;  1YVS A;  1RGC A;  2C4B A;  1I3I A;  1CH0 A;  1I8V A;  2KF3 A;  1RGG A;  1BGS A;  1GOU A;  1I0X A;  1BNJ A;  3KCH A;  1RSN A;  2AAD A;  2F4Y A;  1AY7 A;  1BU4 A;  1I2F A;  4RNT A;  1I2G A;  1LRA A;  1HYF A;  1UCI A;  1AQZ A;  1LOY A;  1FUS A;  1B2S A;  4J5G A;  1TTO A;  3RNT A;  1B21 A;  1BRJ A;  1RGA A;  1UCL A;  6GSP A;  1TRQ A;  2BU4 A;  4BIR A;  1B2U A;  2GSP A;  9RNT A;  1YGW A;  3DH2 A;  2KAA A;  1RNB A;  5BIR A;  1BRN L;  1B3S A;  7RNT A;  1DET A;  1BRK A;  1RDS A;  1UCK A;  1DE3 A;  3AGN A;  1BOX A;  3SYU A;  1BRS A;  1BRI A;  2KF5 A;  1GMR A;  1YNV X;  2SAR A;  5BU4 A;  3HOH A;  1PYL A;  1RLS A;  1BNG A;  3DGY A;  3WHO A;  1RHL A;  2F5W A;  5RNT A;  3AHW A;  1RCK A;  1I70 A;  1JBR A;  1HZ1 A;  1MGR A;  1GSP A;  2BIR A;  1JBS A;  1ZGX A;  1UCJ A;  1BAO A;  1RCL A;  1RN1 A;  7GSP A;  1JBT A;  1RMS A;  3AHS A;  1RGK A;  1X1W A;  1BIR A;  2HOH A;  1BNR A;  1BSA A;  1A2P A;  1BRH A;  1LOV A;  5GSP A;  1RGE A;  1C54 A;  1GMQ A;  1TRP A;  1MGW A;  1R4Y A;  6RNT A;  1LNI A;  1RGH A;  4BU4 A;  4HAA A;  1RGL A;  1RGF A;  8RNT A;  1BSE A;  3GSP A;  1LOW A;  1SAR A;  1X1U A;  2RNT A;  2ZA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...