3B8LA

Crystal structure of a putative aromatic ring hydroxylase (saro_3538) from novosphingobium aromaticivorans dsm at 1.75 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
FQGMQCPIEDRLAIQDLMIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANMSHHAHYLTNFAVTGYEGDTASMRAYVIGMGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTMDFLMPLSGTLDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_001165924.1) from Novosphingobium aromaticivorans DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b8lA01
5CLKA 1STDA 2JQ5A 3B8LA 1QJGA 2YFJB 4K1VA 4U13A 3S5CA 3GRDA 1GYBA 2UX0A 3MHEA 3NHXA 1JN5A 2F98A 2HMOB 2HMKB 2Z76A 3DZLA 4J8TA 3T8NA 2BMOB 3SOAA 1U5OA 1ULIB 3FLJA 3ECFA 1Q40B 3JUMA 3Q90A 4LGQA 1ZX2A 2HMNB 3B7CA 2HMMB 3CNMA 2GEYA 1CQSA 1GY7A 1OHPA 3E99A 5D83A 5G2GA 1ISKA 1Q40A 5IENA 3F40A 2HMJB 4FCMA 4FCJA 4XBXA 3M8CA 2F86B 3DXOA 2QIYA 3HZPA 3G0KA 3LYGA 4J9AA 5D82A 3UNLA 3UJMA 1JB4A 2BNGA 5AI1A 1E3RA 1JN5B 1O7MB 3I0YA 1OHSA 2QGUA 3NXJA 5IEOA 4OVMA 4HM0B 3EHCA 3SOYA 2RGQA 6STDA 1ZO2A 2IMJA 1TUHA 3VGNA 4ORLA 4GB5A 5HGRA 3OWUA 5CF1A 3EN1B 5FW5A 3OV4A 1JB5A 3GZXB 3JUPA 4L7KA 3VSYA 3GZYB 1GY5A 4N3VA 5KP4A 3GZRA 5STDA 3RGAA 3OX9A 5IF6A 1EA2A 3OXAA 2R4IA 2YFLB 3EBTA 1ASKA 3FF0A 3JUOA 4OUQA 3NV0B 1UUWB 3DMCA 4R9KA 5DREA 1OUNA 4X2HA 3NBRA 2RFRA 2I9WA 3F7SA 4XB5A 1QMAA 1OF5B 2GBWB 3SEDA 5IG4A 5KP3A 4I4KA 1W02A 2BMQB 2CHCA 2PZVA 3EN8A 4Q53A 4XDVA 1VZZA 4HM4B 3BB9A 1JKGA 1O7NB 1SJWA 3GZBA 3EJVA 3MKIA 3KKGA 4WP5A 1AR0A 4WYKB 3BLZA 3MG2A 5IG0A 3CNXA 1OH0A 4H3UA 2CKFB 4HZ9B 5AIFA 1O7GB 2BMRB 7STDA 5EVHA 1UUVB 5IEPA 5IERA 3NM2A 5CF2A 5CXOA 1GY6A 5BXQA 1K41A 2B24B 3K7CA 3ROBA 4HVNA 5DRVA 3ER7A 1E97A 3MG1A 2A15A 4HM5B 1EG9B 1WQLB 3JUQA 8CHOA 3NUVA 3OWYA 1NU3A 4MJDA 1JKGB 2B1XB 1W00A 4HM3B 4HZBB 3EX9A 3HK4A 4LEHA 4XBTA 3D9RA 4XDWA 5AEUB 1GS3A 2STDA 2Z77A 2XSHB 1OPYA 1E3VA 3A76A 3FGYA 3FSDA 1ULJB 3H51A 1OCVA 2F99A 3KZTA 3G16A 4L8OA 1O7HB 3CPOA 3DM8A 1HKXA 2YFIB 5AIHA 3F8HA 3B4OA 4HM8B 2XR8B 4WWUC 4XBYA 4HKVB 5AIGA 4HJLB 3EBYA 3IPTA 5D81A 2GXFA 5TGNA 3T8UA 4CDLA 5AEWB 3CU3A 3EQQB 5KP1A 3F7XA 3HX8A 3G8ZA 4STDA 1BUQA 1TP6A 1O7PB 5CK6A 1NWWA 1S5AA 5AIIA 3KSPA 1DMQA 3KE7A 3H3HA 2K54A 4KVHA 3F14A 3GWRA 3MYTA 4WYKA 4HM1B 5JPPA 5JPUA 3FKAA 4RZMA 3OWSA 2RCDA 1JB2A 3B4PA 3FZWA 4R1KA 4HM2B 1OHOA 2XRXB 1OGZA 2XSOB 1Z1SA 3WMDA 3DUKA 5BVBA 1Q42A 3LZAA 1W01A 3MG3A 5IG5A 1A2KA 4PEJA 3FF2A 2INXA 3JUNA 4IIAA 4XM4A 4L8PA 1IDPA 1W6YA 2GBXB 1OF5A 3K0ZA 3MSOA 4K1UA 4R9LA 1OGXA 2W2CA 2HMLB 1DMMA 4LMIA 1DMNA 2Z7AA 3EF8A 3F8XA 3NV0A 3F9SA 3FH1A 3STDA 4X2OA 4HM7B 2OWPA 4HM6B 3RGRA 1O7WB 2GEXA 1NDOB 5IG3A 3EC9A 1C7HA
chains in the Genus database with same CATH superfamily
5CLKA 2JQ5A 4U13A 3S5CA 2KF3A 3X3XA 1IVWA 1BNEA 3NHXA 4BTXA 1R4CA 2HMKB 4KT3B 1JJ22 1W6CA 2ZDJA 1N9JA 3LH4A 1QALA 3SXXA 1BRSA 1UI8A 5G1LA 1I2FA 1I3IA 1YHQ3 1Q40B 3HI7A 3JUMA 1EKMA 2XEPA 3B7CA 1BRJA 1BRKA 1SIIA 1CQSA 1OHPA 2HMMB 3KFQC 3CCE3 1ISKA 3S27A 4FCMA 2HMJB 4EYCA 1NB5I 3M8CA 1X1WA 1RRLA 1FGRA 3LYGA 2QIYA 9RNTA 3G0KA 4G1MB 3UNLA 1VQP3 3CCU3 5IEOA 1W2ZA 2IY2A 3D5IA 4BTYA 6STDA 1B21A 1IQYA 1M1K4 1VQ43 5HGRA 5CF1A 3FCSB 1GMRA 5FW5A 1UDII 3GZXB 4BL2A 4L7KA 3WOFB 3ZG5A 1A67A 1W6GA 4N3VA 3SVAA 1QAKA 3CCL3 1RNBA 1DYUA 1RGFA 1EA2A 5AYSC 1UW1A 3EBTA 4O8SA 3PS8A 4RNZA 5DREA 1ROAA 1OUNA 1SQWA 2C10A 3NBRA 1X1XA 2RFRA 2I9WA 3F7SA 3TDGA 4AKZA 4EC6A 1RJOA 2GBWB 1RCLA 2KRTA 6RNTA 1VQK3 1VQO3 1Q814 1W02A 2CK3H 4XDVA 2OOVA 1VZZA 4HM4B 3BB9A 1JKGA 3GZBA 3CME3 2P05A 1VQ63 1MWSA 4WP5A 1K8A4 3BLZA 3MG2A 4TX4A 1RDSA 2CFDA 3K9MC 4LZIA 2WO0A 1UUVB 3CCM3 1CEWI 1RGCA 1K41A 2KXGA 1YJN3 3S29A 1UUGB 3DGLA 1LRAA 4HAAA 1BVIA 2UGIA 1EG9B 4MMYB 1NU3A 2B1XB 2W56B 3X40A 4HZBB 3EX9A 4XBTA 1HYFA 4XDWA 3D9RA 5FGOA 5A0OB 2STDA 1GD4A 1DETA 2XSHB 3A76A 3FSDA 3T0UA 3FGYA 3T8UA 3PYJA 4L8OA 1RGEA 3LT8A 5G1KA 5D81A 5CF2A 5M19A 3CD63 1RGAA 4CJNA 2CH9A 1WTHA 4N6V0 3IMAB 1RGGA 1B2UA 3G8ZA 1W5ZA 1TJDA 5AIIA 1O7PB 4NPBA 3X3ZA 3ZG0A 1DMQA 1D6UA 3KE7A 1YI23 3QRDA 3HIIA 2FNQA 4WYKA 5JPPA 1N5PA 1I2EA 2GU3A 1YIJ3 1BSBA 1JB2A 2ML6A 3B4PA 2OTJ3 2XRXB 4GL6A 1RN1A 4BIRA 1VQ73 1BRNL 3DUKA 1T5YA 1KQS2 1K734 5BVBA 1B2XA 2RNTA 3PGBA 3X3YA 1N5HA 3Q1CA 5BIRA 4IIAA 3WOEB 1W6YA 1VQQA 1B20A 2CWVA 1I0VA 3DGNA 1Q864 4N6TA 1DMMA 1Q9EA 3F8XA 3FH1A 4RBNA 1M1XB 1RRHA 2OWPA 4JF8A 3I553 2ZHXB 1C7HA 1NO3A 1STDA 1QJGA 2YFJB 3NM7A 4FCZA 2UX0A 3MHEA 1ZS7A 1JN5A 3DZLA 3T8NA 1Y4KA 2E2TA 1U5OA 1X1YA 7RNTA 3SYUA 1W4NA 3ECFA 1VQ53 2CFWA 5HOHA 1ZX2A 3E99A 2OOVC 1GY7A 3HIGA 1EUIC 1IK3A 2PNCA 1CYUA 3NQYA 1QVF2 1JBTA 3HZPA 2SBLA 2UUGC 3KIIA 4J9AA 1FGMA 3AGNA 4NHFA 3U1WA 2C4BA 3UJMA 5RNTA 1JN5B 3I0YA 4EXRA 2CG0A 2RSXA 4OVMA 4O2HA 1UGHI 1ZO2A 2Y73A 1TUHA 3VGNA 1RGKA 5BU4A 2CC3A 2O3OA 3V98A 1CYVA 1BSDA 2MC8A 1BRHA 1KWIA 3S28A 2GU1A 5ELUA 1IVXA 4MMXB 5STDA 2Q07A 3OX9A 3RGAA 1YJW3 1Q7HA 2KF5A 1V74A 3BIRA 4ZM8A 1UUWB 3DMCA 3WA2X 1RKYA 4X2HA 1AQZA 1IVUA 2W0QA 1QMAA 1QAFA 5KP3A 3SEDA 2BMQB 4Q53A 4KFFA 5KP1A 1O7NB 1SJWA 4WYKB 1HU9A 3LT9A 1DVCA 3KKGA 1AR0A 3LTDA 1BSAA 3GAXA 2XGLA 1IVVA 1PYLA 1LOWA 2AADA 2BMRB 5IERA 3SX1A 1RCKA 1V58A 3Q3FA 2BHMA 4HVNA 4NREA 4R80A 3ER7A 1F8NA 3MG1A 2CX0A 1AVKA 4O3VA 3X41A 3JUQA 3NUVA 2KF4A 3OWYA 1YGEA 4LEHA 1BGSA 4O02B 4CCVA 2Z77A 1GOVA 1E3VA 3RNTA 4PEJA 1OCVA 2F99A 1ROVA 3G16A 1O7HB 3CPOA 3WDGB 1HKXA 2K0MA 1FW7A 3F8HA 3N54B 1YNVX 4HM8B 5AIGA 1G02A 2CWTA 4HBRA 3EBYA 5AEWB 2GXFA 3S67A 3CCS3 3D3LA 3CU3A 1M904 3HX8A 3KSED 1TP6A 1NWWA 1S5AA 4LYLB 3KSPA 3LTBA 4N6LA 1MOLA 1UCIA 2IUJA 2K54A 2IA7A 1JZOA 1VQ93 1VQN3 4MEIA 3SLUA 3CCR3 1WMNA 3EE1A 3FKAA 2D42A 1GD3A 4RZMA 5AI1A 2F4YA 2RCDA 4FMCA 4R1KA 3CC23 4HM2B 3PCSA 3V92A 3VF1A 2P0XA 4GHOA 1US1A 1Q824 5IG5A 1A2KA 4N6OB 1RLSA 3OW22 1IDPA 2GBXB 1OF5A 3LTAA 3MSOA 1OGXA 4BU4A 8RNTA 2W2CA 4LMIA 4IT7A 3U97A 2WOFA 3CC73 3UB1A 1NJI4 1BNRA 1O7WB 1LOVA 3EC9A 3K63A 4DKIA 3B8LA 1NNVA 1GYBA 2YX9A 1LQGC 2F98A 2HMOB 1RNTA 2XFTA 4J8TA 5M1AA 1EQKA 1ULIB 4R4KA 4K90B 1DE3A 5ELJA 3FLJA 1GSPA 3BNDA 2P09A 3Q90A 3DGYA 1BANA 4OK0A 2CFLA 1SPUA 2HMNB 3AMOA 5IF6A 2GEYA 1DVDA 5D83A 4EV5A 1TIJA 3WODG 1Q40A 5IENA 3F40A 4FMBA 2FGTA 3LTCA 4FCJA 2WGOA 1N8R4 2F86B 1GMPA 3URPA 1MGRA 2V1LA 2BNGA 1MWTA 1FUTA 1O7MB 1SIHA 1S723 1BRIA 2H0IA 4HM0B 1RN4A 5GSPA 7GSPA 1IYYA 1IV7A 1U8CB 5M18A 1LVNA 1BUJA 2O9UX 2IMJA 3D79A 4GB5A 1C54A 3OWUA 3EN1B 3OV4A 1JB5A 1BSCA 2Y74A 1MNLA 4LSOA 3VSYA 2E2VA 2MF7A 1FZUA 2F56A 1G96A 2LYXA 1JNQA 2R4IA 2YFLB 3JUOA 4OUQA 4R9KA 3NV0B 4KZ1A 1JZDA 1AVLA 3BNCA 3V99A 1GOUA 2PZVA 3EN8A 1IQXA 3X42A 1D6YA 1LNIA 3EJVA 3DY5A 4H61A 3LMLA 1BU4A 2CWUA 1A2VA 4HOHA 2CKFB 4HZ9B 4N6UA 7STDA 1YGWA 1LOXA 5EVHA 5IEPA 1I0XA 1GY6A 5CXOA 5EEOA 4BTWA 5I97A 1FGQA 2RBIA 3MPHA 2B24B 3K7CA 3PXMA 1X1UA 5LC7A 1VQM3 2ZL8A 1R4YA 1TTOA 1WMOA 1GOYA 1B27A 2A15A 4HM5B 1FUSA 1YIT3 1BNIA 2C11A 3HK4A 1LQMB 2H0HA 1GS3A 1HZ1A 5KP4A 3KZTA 3Q2PA 1ULJB 1FYSA 2CFKA 5AIHA 2YFIB 4RNTA 3B4OA 3LXUX 2XR8B 4XBYA 3N8BA 4HJLB 3WR2A 3ALAA 3NBBA 3EQQB 3PCRA 2W04A 3KN4A 1BOXA 3CXC2 1BUQA 4ILFA 5CK6A 4AKYA 4CPKA 3N9HA 4N6NB 1W2B2 1J2BA 3H3HA 5IW9A 3F14A 2W9PA 3AHSA 4GSPA 3MYTA 1STFI 4HM1B 1ZGXA 1RMSA 2H0GA 5JPUA 1KC84 1FGOA 1A2PA 2CW9A 4J5GA 1BNGA 1OGZA 4K61A 1RN7A 1Z1SA 1MGWA 3WMDA 1QVG2 3D4AA 1BAOA 3MG3A 1W01A 1JV2B 1BNSA 2HOHA 5AYRB 5LC6A 3JUNA 1TFKA 2W9QA 4L8PA 3G6E3 4BL3A 1TRPA 2SARA 2K3DA 2R41A 1RSNA 1KD14 4KFEA 1DMNA 1LXEA 2AAEA 3NV0A 3F9SA 1FUWA 4X2OA 4HM7B 3CPW2 2ZA4A 2GEXA 5IG3A 4KVHA 4WFOA 2JDIH 3DH2A 2L1SA 1JBRA 4K1VA 2CFGA 3CC43 3GRDA 2LQVA 2WOHA 1BRGA 2Z76A 3AHWA 2E2UA 1IQ8A 1BIRA 4JRFA 2BMOB 1N9EA 3HOHA 3SOAA 1UCJA 1T2HA 3KCHA 2L4VA 1Q7Y4 2CIUA 4LGQA 3CNMA 1FA3A 3CCV3 1OACA 6GSPA 5G2GA 3IJEB 1IU7A 1VQ83 2J8XB 1IT7A 4XBXA 1L5GB 3BNEA 2XF3A 3DXOA 3FG4A 1A90A 5D82A 1JBSA 1RTUA 1T2IA 2D1WA 1B3SA 1BNFA 1JB4A 1JRQA 2KCDA 1RGLA 2WGQA 1E3RA 3NBJA 3FG3A 4IPBA 1OHSA 1WNHA 2GSPA 2QGUA 3AMOB 2XFSA 3NXJA 3EHCA 4FMDA 1RGHA 2RGQA 1NB3I 3SOYA 3CMA3 4ORLA 3DGOA 4HYZA 1B2MA 1V57A 3JUPA 1TFOA 3GZYB 2W6JH 2BT3A 2KAAA 1GY5A 3CCJ3 1T3BA 3GZRA 2Z6BA 1I70A 3OXAA 5AIFA 3FF0A 1ASKA 4EW5A 3ROBA 2CX1A 2OTL3 1RHLA 3ZFZA 4XB5A 1OF5B 1IT8A 5IG4A 2BO9B 1TU5A 4I4KA 1VQL3 2CHCA 2FXTA 3CCQ3 1MWUA 2W56A 3RDEA 3MKIA 3J7Yd 3BNBA 1N8QA 5IG0A 4WHAA 3CNXA 2F5MA 1OH0A 4H3UA 2F5WA 1O7GB 1AV4A 1LNHA 3NM2A 1WMPA 2P38A 5BXQA 4J5KA 3NX0A 3O8YA 5DRVA 1E97A 3K5TA 3L0RA 2IYJA 3BU4A 1EEJA 1PU4A 1WQLB 2OQEC 8CHOA 3UL6A 2M7OA 1JKGB 4HM3B 1W00A 3D5GA 4I5QA 3LOYA 4MJDA 2CG1A 5AEUB 3G4S3 1M9GA 1OPYA 3H51A 4FMAA 4EV2A 1SARA 3DM8A 4WWUC 2BIRA 4HKVB 3DGMA 4CDLA 3IPTA 5TGNA 4KFDA 3UL5A 1TRQA 4QWTA 1AY7A 1UGIA 2KF6A 3F7XA 3GSPA 4STDA 1G0TA 3JVCA 1IV9A 2OQEA 4EBGA 3G713 4N6MA 1GMQA 1I3FA 1BNJA 3FG1A 2QA43 1FGTA 2BU4A 3GWRA 2XH9A 5EQLA 1I2GA 3OWSA 3NQZA 3FZWA 1BSEA 1OHOA 2P0MA 3MWZA 1W7CA 4FR9A 1YVSA 1K9M4 3WHOA 2XSOB 1LOYA 4AEQA 3AGOA 3QK9A 1Q42A 1K28A 3LZAA 2ML5A 3FF2A 2QEX3 1D6ZA 1KSIA 1MWRA 2INXA 4MMZB 3I563 4XM4A 3PZWA 2OCTA 3K0ZA 1UCKA 4K1UA 4R9LA 4RNYA 1I8VA 3A5EA 1PY3A 1B2ZA 2HMLB 1UCLA 2Z7AA 3EB8A 3EF8A 3STDA 1UI7A 2IUKA 5JBSA 2XGNA 1CH0A 1YVBI 4HM6B 1YJ93 1B2SA 3RGRA 2W03A 1NDOB 3WA3A 1PFPA
chains in the Genus database with same CATH topology
5CLKA 2JQ5A 4U13A 3S5CA 3X3XA 1IVWA 3NHXA 4BTXA 1R4CA 2HMKB 1JJ22 1W6CA 2ZDJA 1N9JA 3LH4A 1QALA 3SXXA 1UI8A 1YHQ3 1Q40B 3HI7A 3JUMA 1EKMA 2XEPA 3B7CA 2HMMB 1SIIA 3KFQC 1CQSA 1OHPA 3CCE3 1ISKA 3S27A 4FCMA 2HMJB 4EYCA 1NB5I 3M8CA 1RRLA 1FGRA 3LYGA 2QIYA 3G0KA 4G1MB 3UNLA 1VQP3 3CCU3 5IEOA 1W2ZA 4BTYA 6STDA 1IQYA 1M1K4 1VQ43 5HGRA 5CF1A 3FCSB 5FW5A 3GZXB 4L7KA 3WOFB 1A67A 1W6GA 4N3VA 3SVAA 1QAKA 3CCL3 1DYUA 1EA2A 5AYSC 1UW1A 3EBTA 4O8SA 3PS8A 4RNZA 5DREA 1ROAA 1OUNA 1SQWA 2C10A 3NBRA 2RFRA 2I9WA 3F7SA 3TDGA 4AKZA 4EC6A 1RJOA 2GBWB 1VQK3 2KRTA 1VQO3 1Q814 1W02A 2CK3H 4XDVA 2OOVA 1VZZA 4HM4B 3BB9A 1JKGA 3GZBA 3CME3 2P05A 1VQ63 1K8A4 4WP5A 3BLZA 3MG2A 4TX4A 2CFDA 3K9MC 4LZIA 2WO0A 1UUVB 3CCM3 1CEWI 1K41A 2KXGA 1YJN3 3S29A 3DGLA 1EG9B 4MMYB 1NU3A 2B1XB 2W56B 3X40A 4HZBB 3EX9A 4XBTA 5FGOA 4XDWA 3D9RA 5A0OB 2STDA 1GD4A 3A76A 2XSHB 3FSDA 3T0UA 3T8UA 3FGYA 3PYJA 4L8OA 3LT8A 5D81A 5CF2A 3CD63 2CH9A 1WTHA 4N6V0 3IMAB 3G8ZA 1W5ZA 5AIIA 1O7PB 3X3ZA 1DMQA 1D6UA 3KE7A 1YI23 3QRDA 3HIIA 2FNQA 4WYKA 5JPPA 1N5PA 2GU3A 1YIJ3 1JB2A 2ML6A 3B4PA 2OTJ3 2XRXB 4GL6A 1VQ73 3DUKA 1T5YA 1KQS2 1K734 5BVBA 3PGBA 3X3YA 1N5HA 3Q1CA 4IIAA 3WOEB 1W6YA 2CWVA 3DGNA 1Q864 4N6TA 1DMMA 3F8XA 3FH1A 4RBNA 1M1XB 1RRHA 2OWPA 4JF8A 3I553 1C7HA 1NO3A 1STDA 1QJGA 2YFJB 3NM7A 4FCZA 2UX0A 3MHEA 3T8NA 1JN5A 3DZLA 1Y4KA 2E2TA 1U5OA 1W4NA 3ECFA 1VQ53 2CFWA 1ZX2A 3E99A 2OOVC 1GY7A 3HIGA 1IK3A 2PNCA 1CYUA 3NQYA 1QVF2 3HZPA 2SBLA 4J9AA 3KIIA 3U1WA 1FGMA 4NHFA 3UJMA 1JN5B 3I0YA 4EXRA 2CG0A 2RSXA 4OVMA 4O2HA 1ZO2A 2Y73A 1TUHA 3VGNA 2CC3A 2O3OA 3V98A 1CYVA 2MC8A 1KWIA 3S28A 2GU1A 5ELUA 1IVXA 4MMXB 5STDA 2Q07A 3OX9A 3RGAA 1YJW3 1V74A 4ZM8A 1UUWB 3DMCA 3WA2X 1RKYA 4X2HA 1IVUA 2W0QA 1QMAA 1QAFA 5KP3A 3SEDA 2BMQB 4Q53A 4KFFA 5KP1A 1O7NB 1SJWA 4WYKB 1HU9A 3LT9A 1DVCA 3KKGA 1AR0A 3LTDA 3GAXA 2XGLA 1IVVA 2BMRB 5IERA 3SX1A 2BHMA 4HVNA 4NREA 4R80A 3ER7A 1F8NA 3MG1A 1AVKA 4O3VA 3X41A 3JUQA 3NUVA 3OWYA 1YGEA 4LEHA 4O02B 4CCVA 2Z77A 1E3VA 4PEJA 1OCVA 2F99A 1ROVA 3G16A 1O7HB 3CPOA 3WDGB 1HKXA 2K0MA 3F8HA 3N54B 4HM8B 5AIGA 2CWTA 4HBRA 3EBYA 5AEWB 2GXFA 3S67A 3CCS3 3D3LA 3CU3A 1M904 3HX8A 3KSED 1TP6A 1NWWA 1S5AA 3KSPA 3LTBA 4N6LA 1MOLA 2IUJA 2K54A 2IA7A 1VQ93 1VQN3 4MEIA 3SLUA 3CCR3 1WMNA 3EE1A 3FKAA 2D42A 1GD3A 4RZMA 5AI1A 2RCDA 4FMCA 4R1KA 3CC23 4HM2B 3PCSA 3V92A 3VF1A 2P0XA 1US1A 1Q824 5IG5A 1A2KA 4N6OB 3OW22 1IDPA 2GBXB 1OF5A 3LTAA 3MSOA 1OGXA 2W2CA 4LMIA 4IT7A 3U97A 2WOFA 3CC73 3UB1A 1NJI4 1O7WB 3EC9A 3K63A 3B8LA 1GYBA 2YX9A 2XFTA 2F98A 2HMOB 4J8TA 1EQKA 1ULIB 4R4KA 4K90B 5ELJA 3FLJA 3BNDA 2P09A 3Q90A 4OK0A 2CFLA 1SPUA 2HMNB 3AMOA 5IF6A 2GEYA 1DVDA 5D83A 4EV5A 1TIJA 3WODG 1Q40A 5IENA 3F40A 4FMBA 2FGTA 3LTCA 4FCJA 2WGOA 1N8R4 2F86B 2V1LA 2BNGA 1O7MB 1SIHA 1S723 4HM0B 1IV7A 1U8CB 1LVNA 2O9UX 2IMJA 4GB5A 3OWUA 3EN1B 3OV4A 1JB5A 2Y74A 1MNLA 4LSOA 3VSYA 2E2VA 2MF7A 1G96A 2LYXA 1JNQA 2R4IA 2YFLB 3JUOA 4OUQA 4R9KA 3NV0B 4KZ1A 1AVLA 3BNCA 3V99A 2PZVA 3EN8A 1IQXA 3X42A 1D6YA 3EJVA 3DY5A 4H61A 3LMLA 2CWUA 1A2VA 2CKFB 4HZ9B 4N6UA 7STDA 1LOXA 5EVHA 5IEPA 5CXOA 1GY6A 5I97A 5EEOA 4BTWA 1FGQA 3MPHA 2B24B 3K7CA 3PXMA 5LC7A 1VQM3 2ZL8A 1WMOA 2A15A 4HM5B 1YIT3 2C11A 3HK4A 1GS3A 5KP4A 3KZTA 3Q2PA 1ULJB 2CFKA 5AIHA 2YFIB 3B4OA 3LXUX 2XR8B 4XBYA 3N8BA 4HJLB 3ALAA 3NBBA 3EQQB 3PCRA 2W04A 3KN4A 3CXC2 1BUQA 5CK6A 4AKYA 3N9HA 4N6NB 1W2B2 1J2BA 3H3HA 5IW9A 3F14A 2W9PA 1KC84 3MYTA 1STFI 4HM1B 5JPUA 1FGOA 2CW9A 1OGZA 4K61A 1RN7A 1Z1SA 3WMDA 1QVG2 3MG3A 1W01A 1JV2B 5AYRB 5LC6A 3JUNA 1TFKA 2W9QA 4L8PA 3G6E3 1KD14 4KFEA 1DMNA 1LXEA 3NV0A 3F9SA 1FUWA 4X2OA 4HM7B 3CPW2 2GEXA 5IG3A 4KVHA 4WFOA 2JDIH 4K1VA 2CFGA 3CC43 3GRDA 2LQVA 2WOHA 2Z76A 2E2UA 1IQ8A 4JRFA 2BMOB 1N9EA 3SOAA 2L4VA 1Q7Y4 2CIUA 4LGQA 3CNMA 1FA3A 3CCV3 1OACA 5G2GA 3IJEB 1IU7A 1VQ83 4XBXA 1IT7A 1L5GB 3BNEA 2XF3A 3DXOA 3FG4A 1A90A 5D82A 2D1WA 2KCDA 1JB4A 1JRQA 3NBJA 2WGQA 1E3RA 3FG3A 4IPBA 1OHSA 1WNHA 2QGUA 3NXJA 3AMOB 2XFSA 3EHCA 4FMDA 3SOYA 2RGQA 1NB3I 3CMA3 4ORLA 3DGOA 4HYZA 3JUPA 1TFOA 3GZYB 2W6JH 2BT3A 1GY5A 3CCJ3 3GZRA 2Z6BA 3OXAA 5AIFA 3FF0A 1ASKA 3ROBA 2OTL3 4XB5A 1OF5B 1IT8A 5IG4A 2BO9B 1TU5A 4I4KA 1VQL3 2CHCA 2FXTA 3CCQ3 2W56A 3RDEA 3MKIA 3J7Yd 3BNBA 1N8QA 5IG0A 4WHAA 3CNXA 1OH0A 4H3UA 1O7GB 1AV4A 1LNHA 3NM2A 1WMPA 2P38A 5BXQA 3NX0A 3O8YA 5DRVA 1E97A 3K5TA 3L0RA 1PU4A 1WQLB 2OQEC 8CHOA 3UL6A 2M7OA 1JKGB 4HM3B 1W00A 4MJDA 3G4S3 3LOYA 2CG1A 5AEUB 1M9GA 1OPYA 3H51A 4FMAA 4EV2A 3DM8A 4WWUC 4HKVB 3DGMA 4CDLA 3IPTA 5TGNA 4KFDA 3UL5A 4QWTA 3F7XA 4STDA 3JVCA 4EBGA 1IV9A 2OQEA 3G713 4N6MA 3FG1A 2QA43 1FGTA 3GWRA 2XH9A 5EQLA 3OWSA 3NQZA 3FZWA 1OHOA 2P0MA 3MWZA 1W7CA 4FR9A 1K9M4 2XSOB 4AEQA 3QK9A 1Q42A 1K28A 3LZAA 2ML5A 3FF2A 2QEX3 1D6ZA 1KSIA 2INXA 4MMZB 3I563 4XM4A 3PZWA 2OCTA 3K0ZA 4K1UA 4R9LA 4RNYA 2HMLB 2Z7AA 3EB8A 3EF8A 3STDA 1UI7A 2IUKA 5JBSA 2XGNA 1YVBI 4HM6B 1YJ93 3RGRA 2W03A 1NDOB 3WA3A 1PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLK A;  1STD A;  2JQ5 A;  3B8L A;  1QJG A;  2YFJ B;  4K1V A;  4U13 A;  3S5C A;  3GRD A;  1GYB A;  2UX0 A;  3MHE A;  3NHX A;  1JN5 A;  2F98 A;  2HMO B;  2HMK B;  2Z76 A;  3DZL A;  4J8T A;  3T8N A;  2BMO B;  3SOA A;  1U5O A;  1ULI B;  3FLJ A;  3ECF A;  1Q40 B;  3JUM A;  3Q90 A;  4LGQ A;  1ZX2 A;  2HMN B;  3B7C A;  2HMM B;  3CNM A;  2GEY A;  1CQS A;  1GY7 A;  1OHP A;  3E99 A;  5D83 A;  5G2G A;  1ISK A;  1Q40 A;  5IEN A;  3F40 A;  2HMJ B;  4FCM A;  4FCJ A;  4XBX A;  3M8C A;  2F86 B;  3DXO A;  2QIY A;  3HZP A;  3G0K A;  3LYG A;  4J9A A;  5D82 A;  3UNL A;  3UJM A;  1JB4 A;  2BNG A;  5AI1 A;  1E3R A;  1JN5 B;  1O7M B;  3I0Y A;  1OHS A;  2QGU A;  3NXJ A;  5IEO A;  4OVM A;  4HM0 B;  3EHC A;  3SOY A;  2RGQ A;  6STD A;  1ZO2 A;  2IMJ A;  1TUH A;  3VGN A;  4ORL A;  4GB5 A;  5HGR A;  3OWU A;  5CF1 A;  3EN1 B;  5FW5 A;  3OV4 A;  1JB5 A;  3GZX B;  3JUP A;  4L7K A;  3VSY A;  3GZY B;  1GY5 A;  4N3V A;  5KP4 A;  3GZR A;  5STD A;  3RGA A;  3OX9 A;  5IF6 A;  1EA2 A;  3OXA A;  2R4I A;  2YFL B;  3EBT A;  1ASK A;  3FF0 A;  3JUO A;  4OUQ A;  3NV0 B;  1UUW B;  3DMC A;  4R9K A;  5DRE A;  1OUN A;  4X2H A;  3NBR A;  2RFR A;  2I9W A;  3F7S A;  4XB5 A;  1QMA A;  1OF5 B;  2GBW B;  3SED A;  5IG4 A;  5KP3 A;  4I4K A;  1W02 A;  2BMQ B;  2CHC A;  2PZV A;  3EN8 A;  4Q53 A;  4XDV A;  1VZZ A;  4HM4 B;  3BB9 A;  1JKG A;  1O7N B;  1SJW A;  3GZB A;  3EJV A;  3MKI A;  3KKG A;  4WP5 A;  1AR0 A;  4WYK B;  3BLZ A;  3MG2 A;  5IG0 A;  3CNX A;  1OH0 A;  4H3U A;  2CKF B;  4HZ9 B;  5AIF A;  1O7G B;  2BMR B;  7STD A;  5EVH A;  1UUV B;  5IEP A;  5IER A;  3NM2 A;  5CF2 A;  5CXO A;  1GY6 A;  5BXQ A;  1K41 A;  2B24 B;  3K7C A;  3ROB A;  4HVN A;  5DRV A;  3ER7 A;  1E97 A;  3MG1 A;  2A15 A;  4HM5 B;  1EG9 B;  1WQL B;  3JUQ A;  8CHO A;  3NUV A;  3OWY A;  1NU3 A;  4MJD A;  1JKG B;  2B1X B;  1W00 A;  4HM3 B;  4HZB B;  3EX9 A;  3HK4 A;  4LEH A;  4XBT A;  3D9R A;  4XDW A;  5AEU B;  1GS3 A;  2STD A;  2Z77 A;  2XSH B;  1OPY A;  1E3V A;  3A76 A;  3FGY A;  3FSD A;  1ULJ B;  3H51 A;  1OCV A;  2F99 A;  3KZT A;  3G16 A;  4L8O A;  1O7H B;  3CPO A;  3DM8 A;  1HKX A;  2YFI B;  5AIH A;  3F8H A;  3B4O A;  4HM8 B;  2XR8 B;  4WWU C;  4XBY A;  4HKV B;  5AIG A;  4HJL B;  3EBY A;  3IPT A;  5D81 A;  2GXF A;  5TGN A;  3T8U A;  4CDL A;  5AEW B;  3CU3 A;  3EQQ B;  5KP1 A;  3F7X A;  3HX8 A;  3G8Z A;  4STD A;  1BUQ A;  1TP6 A;  1O7P B;  5CK6 A;  1NWW A;  1S5A A;  5AII A;  3KSP A;  1DMQ A;  3KE7 A;  3H3H A;  2K54 A;  4KVH A;  3F14 A;  3GWR A;  3MYT A;  4WYK A;  4HM1 B;  5JPP A;  5JPU A;  3FKA A;  4RZM A;  3OWS A;  2RCD A;  1JB2 A;  3B4P A;  3FZW A;  4R1K A;  4HM2 B;  1OHO A;  2XRX B;  1OGZ A;  2XSO B;  1Z1S A;  3WMD A;  3DUK A;  5BVB A;  1Q42 A;  3LZA A;  1W01 A;  3MG3 A;  5IG5 A;  1A2K A;  4PEJ A;  3FF2 A;  2INX A;  3JUN A;  4IIA A;  4XM4 A;  4L8P A;  1IDP A;  1W6Y A;  2GBX B;  1OF5 A;  3K0Z A;  3MSO A;  4K1U A;  4R9L A;  1OGX A;  2W2C A;  2HML B;  1DMM A;  4LMI A;  1DMN A;  2Z7A A;  3EF8 A;  3F8X A;  3NV0 A;  3F9S A;  3FH1 A;  3STD A;  4X2O A;  4HM7 B;  2OWP A;  4HM6 B;  3RGR A;  1O7W B;  2GEX A;  1NDO B;  5IG3 A;  3EC9 A;  1C7H A; 
#chains in the Genus database with same CATH topology
 5CLK A;  2JQ5 A;  4U13 A;  3S5C A;  2KF3 A;  3X3X A;  1IVW A;  1BNE A;  3NHX A;  4BTX A;  1R4C A;  2HMK B;  4KT3 B;  1JJ2 2;  1W6C A;  2ZDJ A;  1N9J A;  3LH4 A;  1QAL A;  3SXX A;  1BRS A;  1UI8 A;  5G1L A;  1I2F A;  1I3I A;  1YHQ 3;  1Q40 B;  3HI7 A;  3JUM A;  1EKM A;  2XEP A;  3B7C A;  1BRJ A;  1BRK A;  1SII A;  1CQS A;  1OHP A;  2HMM B;  3KFQ C;  3CCE 3;  1ISK A;  3S27 A;  4FCM A;  2HMJ B;  4EYC A;  1NB5 I;  3M8C A;  1X1W A;  1RRL A;  1FGR A;  3LYG A;  2QIY A;  9RNT A;  3G0K A;  4G1M B;  3UNL A;  1VQP 3;  3CCU 3;  5IEO A;  1W2Z A;  2IY2 A;  3D5I A;  4BTY A;  6STD A;  1B21 A;  1IQY A;  1M1K 4;  1VQ4 3;  5HGR A;  5CF1 A;  3FCS B;  1GMR A;  5FW5 A;  1UDI I;  3GZX B;  4BL2 A;  4L7K A;  3WOF B;  3ZG5 A;  1A67 A;  1W6G A;  4N3V A;  3SVA A;  1QAK A;  3CCL 3;  1RNB A;  1DYU A;  1RGF A;  1EA2 A;  5AYS C;  1UW1 A;  3EBT A;  4O8S A;  3PS8 A;  4RNZ A;  5DRE A;  1ROA A;  1OUN A;  1SQW A;  2C10 A;  3NBR A;  1X1X A;  2RFR A;  2I9W A;  3F7S A;  3TDG A;  4AKZ A;  4EC6 A;  1RJO A;  2GBW B;  1RCL A;  2KRT A;  6RNT A;  1VQK 3;  1VQO 3;  1Q81 4;  1W02 A;  2CK3 H;  4XDV A;  2OOV A;  1VZZ A;  4HM4 B;  3BB9 A;  1JKG A;  3GZB A;  3CME 3;  2P05 A;  1VQ6 3;  1MWS A;  4WP5 A;  1K8A 4;  3BLZ A;  3MG2 A;  4TX4 A;  1RDS A;  2CFD A;  3K9M C;  4LZI A;  2WO0 A;  1UUV B;  3CCM 3;  1CEW I;  1RGC A;  1K41 A;  2KXG A;  1YJN 3;  3S29 A;  1UUG B;  3DGL A;  1LRA A;  4HAA A;  1BVI A;  2UGI A;  1EG9 B;  4MMY B;  1NU3 A;  2B1X B;  2W56 B;  3X40 A;  4HZB B;  3EX9 A;  4XBT A;  1HYF A;  4XDW A;  3D9R A;  5FGO A;  5A0O B;  2STD A;  1GD4 A;  1DET A;  2XSH B;  3A76 A;  3FSD A;  3T0U A;  3FGY A;  3T8U A;  3PYJ A;  4L8O A;  1RGE A;  3LT8 A;  5G1K A;  5D81 A;  5CF2 A;  5M19 A;  3CD6 3;  1RGA A;  4CJN A;  2CH9 A;  1WTH A;  4N6V 0;  3IMA B;  1RGG A;  1B2U A;  3G8Z A;  1W5Z A;  1TJD A;  5AII A;  1O7P B;  4NPB A;  3X3Z A;  3ZG0 A;  1DMQ A;  1D6U A;  3KE7 A;  1YI2 3;  3QRD A;  3HII A;  2FNQ A;  4WYK A;  5JPP A;  1N5P A;  1I2E A;  2GU3 A;  1YIJ 3;  1BSB A;  1JB2 A;  2ML6 A;  3B4P A;  2OTJ 3;  2XRX B;  4GL6 A;  1RN1 A;  4BIR A;  1VQ7 3;  1BRN L;  3DUK A;  1T5Y A;  1KQS 2;  1K73 4;  5BVB A;  1B2X A;  2RNT A;  3PGB A;  3X3Y A;  1N5H A;  3Q1C A;  5BIR A;  4IIA A;  3WOE B;  1W6Y A;  1VQQ A;  1B20 A;  2CWV A;  1I0V A;  3DGN A;  1Q86 4;  4N6T A;  1DMM A;  1Q9E A;  3F8X A;  3FH1 A;  4RBN A;  1M1X B;  1RRH A;  2OWP A;  4JF8 A;  3I55 3;  2ZHX B;  1C7H A;  1NO3 A;  1STD A;  1QJG A;  2YFJ B;  3NM7 A;  4FCZ A;  2UX0 A;  3MHE A;  1ZS7 A;  1JN5 A;  3DZL A;  3T8N A;  1Y4K A;  2E2T A;  1U5O A;  1X1Y A;  7RNT A;  3SYU A;  1W4N A;  3ECF A;  1VQ5 3;  2CFW A;  5HOH A;  1ZX2 A;  3E99 A;  2OOV C;  1GY7 A;  3HIG A;  1EUI C;  1IK3 A;  2PNC A;  1CYU A;  3NQY A;  1QVF 2;  1JBT A;  3HZP A;  2SBL A;  2UUG C;  3KII A;  4J9A A;  1FGM A;  3AGN A;  4NHF A;  3U1W A;  2C4B A;  3UJM A;  5RNT A;  1JN5 B;  3I0Y A;  4EXR A;  2CG0 A;  2RSX A;  4OVM A;  4O2H A;  1UGH I;  1ZO2 A;  2Y73 A;  1TUH A;  3VGN A;  1RGK A;  5BU4 A;  2CC3 A;  2O3O A;  3V98 A;  1CYV A;  1BSD A;  2MC8 A;  1BRH A;  1KWI A;  3S28 A;  2GU1 A;  5ELU A;  1IVX A;  4MMX B;  5STD A;  2Q07 A;  3OX9 A;  3RGA A;  1YJW 3;  1Q7H A;  2KF5 A;  1V74 A;  3BIR A;  4ZM8 A;  1UUW B;  3DMC A;  3WA2 X;  1RKY A;  4X2H A;  1AQZ A;  1IVU A;  2W0Q A;  1QMA A;  1QAF A;  5KP3 A;  3SED A;  2BMQ B;  4Q53 A;  4KFF A;  5KP1 A;  1O7N B;  1SJW A;  4WYK B;  1HU9 A;  3LT9 A;  1DVC A;  3KKG A;  1AR0 A;  3LTD A;  1BSA A;  3GAX A;  2XGL A;  1IVV A;  1PYL A;  1LOW A;  2AAD A;  2BMR B;  5IER A;  3SX1 A;  1RCK A;  1V58 A;  3Q3F A;  2BHM A;  4HVN A;  4NRE A;  4R80 A;  3ER7 A;  1F8N A;  3MG1 A;  2CX0 A;  1AVK A;  4O3V A;  3X41 A;  3JUQ A;  3NUV A;  2KF4 A;  3OWY A;  1YGE A;  4LEH A;  1BGS A;  4O02 B;  4CCV A;  2Z77 A;  1GOV A;  1E3V A;  3RNT A;  4PEJ A;  1OCV A;  2F99 A;  1ROV A;  3G16 A;  1O7H B;  3CPO A;  3WDG B;  1HKX A;  2K0M A;  1FW7 A;  3F8H A;  3N54 B;  1YNV X;  4HM8 B;  5AIG A;  1G02 A;  2CWT A;  4HBR A;  3EBY A;  5AEW B;  2GXF A;  3S67 A;  3CCS 3;  3D3L A;  3CU3 A;  1M90 4;  3HX8 A;  3KSE D;  1TP6 A;  1NWW A;  1S5A A;  4LYL B;  3KSP A;  3LTB A;  4N6L A;  1MOL A;  1UCI A;  2IUJ A;  2K54 A;  2IA7 A;  1JZO A;  1VQ9 3;  1VQN 3;  4MEI A;  3SLU A;  3CCR 3;  1WMN A;  3EE1 A;  3FKA A;  2D42 A;  1GD3 A;  4RZM A;  5AI1 A;  2F4Y A;  2RCD A;  4FMC A;  4R1K A;  3CC2 3;  4HM2 B;  3PCS A;  3V92 A;  3VF1 A;  2P0X A;  4GHO A;  1US1 A;  1Q82 4;  5IG5 A;  1A2K A;  4N6O B;  1RLS A;  3OW2 2;  1IDP A;  2GBX B;  1OF5 A;  3LTA A;  3MSO A;  1OGX A;  4BU4 A;  8RNT A;  2W2C A;  4LMI A;  4IT7 A;  3U97 A;  2WOF A;  3CC7 3;  3UB1 A;  1NJI 4;  1BNR A;  1O7W B;  1LOV A;  3EC9 A;  3K63 A;  4DKI A;  3B8L A;  1NNV A;  1GYB A;  2YX9 A;  1LQG C;  2F98 A;  2HMO B;  1RNT A;  2XFT A;  4J8T A;  5M1A A;  1EQK A;  1ULI B;  4R4K A;  4K90 B;  1DE3 A;  5ELJ A;  3FLJ A;  1GSP A;  3BND A;  2P09 A;  3Q90 A;  3DGY A;  1BAN A;  4OK0 A;  2CFL A;  1SPU A;  2HMN B;  3AMO A;  5IF6 A;  2GEY A;  1DVD A;  5D83 A;  4EV5 A;  1TIJ A;  3WOD G;  1Q40 A;  5IEN A;  3F40 A;  4FMB A;  2FGT A;  3LTC A;  4FCJ A;  2WGO A;  1N8R 4;  2F86 B;  1GMP A;  3URP A;  1MGR A;  2V1L A;  2BNG A;  1MWT A;  1FUT A;  1O7M B;  1SIH A;  1S72 3;  1BRI A;  2H0I A;  4HM0 B;  1RN4 A;  5GSP A;  7GSP A;  1IYY A;  1IV7 A;  1U8C B;  5M18 A;  1LVN A;  1BUJ A;  2O9U X;  2IMJ A;  3D79 A;  4GB5 A;  1C54 A;  3OWU A;  3EN1 B;  3OV4 A;  1JB5 A;  1BSC A;  2Y74 A;  1MNL A;  4LSO A;  3VSY A;  2E2V A;  2MF7 A;  1FZU A;  2F56 A;  1G96 A;  2LYX A;  1JNQ A;  2R4I A;  2YFL B;  3JUO A;  4OUQ A;  4R9K A;  3NV0 B;  4KZ1 A;  1JZD A;  1AVL A;  3BNC A;  3V99 A;  1GOU A;  2PZV A;  3EN8 A;  1IQX A;  3X42 A;  1D6Y A;  1LNI A;  3EJV A;  3DY5 A;  4H61 A;  3LML A;  1BU4 A;  2CWU A;  1A2V A;  4HOH A;  2CKF B;  4HZ9 B;  4N6U A;  7STD A;  1YGW A;  1LOX A;  5EVH A;  5IEP A;  1I0X A;  1GY6 A;  5CXO A;  5EEO A;  4BTW A;  5I97 A;  1FGQ A;  2RBI A;  3MPH A;  2B24 B;  3K7C A;  3PXM A;  1X1U A;  5LC7 A;  1VQM 3;  2ZL8 A;  1R4Y A;  1TTO A;  1WMO A;  1GOY A;  1B27 A;  2A15 A;  4HM5 B;  1FUS A;  1YIT 3;  1BNI A;  2C11 A;  3HK4 A;  1LQM B;  2H0H A;  1GS3 A;  1HZ1 A;  5KP4 A;  3KZT A;  3Q2P A;  1ULJ B;  1FYS A;  2CFK A;  5AIH A;  2YFI B;  4RNT A;  3B4O A;  3LXU X;  2XR8 B;  4XBY A;  3N8B A;  4HJL B;  3WR2 A;  3ALA A;  3NBB A;  3EQQ B;  3PCR A;  2W04 A;  3KN4 A;  1BOX A;  3CXC 2;  1BUQ A;  4ILF A;  5CK6 A;  4AKY A;  4CPK A;  3N9H A;  4N6N B;  1W2B 2;  1J2B A;  3H3H A;  5IW9 A;  3F14 A;  2W9P A;  3AHS A;  4GSP A;  3MYT A;  1STF I;  4HM1 B;  1ZGX A;  1RMS A;  2H0G A;  5JPU A;  1KC8 4;  1FGO A;  1A2P A;  2CW9 A;  4J5G A;  1BNG A;  1OGZ A;  4K61 A;  1RN7 A;  1Z1S A;  1MGW A;  3WMD A;  1QVG 2;  3D4A A;  1BAO A;  3MG3 A;  1W01 A;  1JV2 B;  1BNS A;  2HOH A;  5AYR B;  5LC6 A;  3JUN A;  1TFK A;  2W9Q A;  4L8P A;  3G6E 3;  4BL3 A;  1TRP A;  2SAR A;  2K3D A;  2R41 A;  1RSN A;  1KD1 4;  4KFE A;  1DMN A;  1LXE A;  2AAE A;  3NV0 A;  3F9S A;  1FUW A;  4X2O A;  4HM7 B;  3CPW 2;  2ZA4 A;  2GEX A;  5IG3 A;  4KVH A;  4WFO A;  2JDI H;  3DH2 A;  2L1S A;  1JBR A;  4K1V A;  2CFG A;  3CC4 3;  3GRD A;  2LQV A;  2WOH A;  1BRG A;  2Z76 A;  3AHW A;  2E2U A;  1IQ8 A;  1BIR A;  4JRF A;  2BMO B;  1N9E A;  3HOH A;  3SOA A;  1UCJ A;  1T2H A;  3KCH A;  2L4V A;  1Q7Y 4;  2CIU A;  4LGQ A;  3CNM A;  1FA3 A;  3CCV 3;  1OAC A;  6GSP A;  5G2G A;  3IJE B;  1IU7 A;  1VQ8 3;  2J8X B;  1IT7 A;  4XBX A;  1L5G B;  3BNE A;  2XF3 A;  3DXO A;  3FG4 A;  1A90 A;  5D82 A;  1JBS A;  1RTU A;  1T2I A;  2D1W A;  1B3S A;  1BNF A;  1JB4 A;  1JRQ A;  2KCD A;  1RGL A;  2WGQ A;  1E3R A;  3NBJ A;  3FG3 A;  4IPB A;  1OHS A;  1WNH A;  2GSP A;  2QGU A;  3AMO B;  2XFS A;  3NXJ A;  3EHC A;  4FMD A;  1RGH A;  2RGQ A;  1NB3 I;  3SOY A;  3CMA 3;  4ORL A;  3DGO A;  4HYZ A;  1B2M A;  1V57 A;  3JUP A;  1TFO A;  3GZY B;  2W6J H;  2BT3 A;  2KAA A;  1GY5 A;  3CCJ 3;  1T3B A;  3GZR A;  2Z6B A;  1I70 A;  3OXA A;  5AIF A;  3FF0 A;  1ASK A;  4EW5 A;  3ROB A;  2CX1 A;  2OTL 3;  1RHL A;  3ZFZ A;  4XB5 A;  1OF5 B;  1IT8 A;  5IG4 A;  2BO9 B;  1TU5 A;  4I4K A;  1VQL 3;  2CHC A;  2FXT A;  3CCQ 3;  1MWU A;  2W56 A;  3RDE A;  3MKI A;  3J7Y d;  3BNB A;  1N8Q A;  5IG0 A;  4WHA A;  3CNX A;  2F5M A;  1OH0 A;  4H3U A;  2F5W A;  1O7G B;  1AV4 A;  1LNH A;  3NM2 A;  1WMP A;  2P38 A;  5BXQ A;  4J5K A;  3NX0 A;  3O8Y A;  5DRV A;  1E97 A;  3K5T A;  3L0R A;  2IYJ A;  3BU4 A;  1EEJ A;  1PU4 A;  1WQL B;  2OQE C;  8CHO A;  3UL6 A;  2M7O A;  1JKG B;  4HM3 B;  1W00 A;  3D5G A;  4I5Q A;  3LOY A;  4MJD A;  2CG1 A;  5AEU B;  3G4S 3;  1M9G A;  1OPY A;  3H51 A;  4FMA A;  4EV2 A;  1SAR A;  3DM8 A;  4WWU C;  2BIR A;  4HKV B;  3DGM A;  4CDL A;  3IPT A;  5TGN A;  4KFD A;  3UL5 A;  1TRQ A;  4QWT A;  1AY7 A;  1UGI A;  2KF6 A;  3F7X A;  3GSP A;  4STD A;  1G0T A;  3JVC A;  1IV9 A;  2OQE A;  4EBG A;  3G71 3;  4N6M A;  1GMQ A;  1I3F A;  1BNJ A;  3FG1 A;  2QA4 3;  1FGT A;  2BU4 A;  3GWR A;  2XH9 A;  5EQL A;  1I2G A;  3OWS A;  3NQZ A;  3FZW A;  1BSE A;  1OHO A;  2P0M A;  3MWZ A;  1W7C A;  4FR9 A;  1YVS A;  1K9M 4;  3WHO A;  2XSO B;  1LOY A;  4AEQ A;  3AGO A;  3QK9 A;  1Q42 A;  1K28 A;  3LZA A;  2ML5 A;  3FF2 A;  2QEX 3;  1D6Z A;  1KSI A;  1MWR A;  2INX A;  4MMZ B;  3I56 3;  4XM4 A;  3PZW A;  2OCT A;  3K0Z A;  1UCK A;  4K1U A;  4R9L A;  4RNY A;  1I8V A;  3A5E A;  1PY3 A;  1B2Z A;  2HML B;  1UCL A;  2Z7A A;  3EB8 A;  3EF8 A;  3STD A;  1UI7 A;  2IUK A;  5JBS A;  2XGN A;  1CH0 A;  1YVB I;  4HM6 B;  1YJ9 3;  1B2S A;  3RGR A;  2W03 A;  1NDO B;  3WA3 A;  1PFP A; 
#chains in the Genus database with same CATH homology
 5CLK A;  2JQ5 A;  4U13 A;  3S5C A;  3X3X A;  1IVW A;  3NHX A;  4BTX A;  1R4C A;  2HMK B;  1JJ2 2;  1W6C A;  2ZDJ A;  1N9J A;  3LH4 A;  1QAL A;  3SXX A;  1UI8 A;  1YHQ 3;  1Q40 B;  3HI7 A;  3JUM A;  1EKM A;  2XEP A;  3B7C A;  2HMM B;  1SII A;  3KFQ C;  1CQS A;  1OHP A;  3CCE 3;  1ISK A;  3S27 A;  4FCM A;  2HMJ B;  4EYC A;  1NB5 I;  3M8C A;  1RRL A;  1FGR A;  3LYG A;  2QIY A;  3G0K A;  4G1M B;  3UNL A;  1VQP 3;  3CCU 3;  5IEO A;  1W2Z A;  4BTY A;  6STD A;  1IQY A;  1M1K 4;  1VQ4 3;  5HGR A;  5CF1 A;  3FCS B;  5FW5 A;  3GZX B;  4L7K A;  3WOF B;  1A67 A;  1W6G A;  4N3V A;  3SVA A;  1QAK A;  3CCL 3;  1DYU A;  1EA2 A;  5AYS C;  1UW1 A;  3EBT A;  4O8S A;  3PS8 A;  4RNZ A;  5DRE A;  1ROA A;  1OUN A;  1SQW A;  2C10 A;  3NBR A;  2RFR A;  2I9W A;  3F7S A;  3TDG A;  4AKZ A;  4EC6 A;  1RJO A;  2GBW B;  1VQK 3;  2KRT A;  1VQO 3;  1Q81 4;  1W02 A;  2CK3 H;  4XDV A;  2OOV A;  1VZZ A;  4HM4 B;  3BB9 A;  1JKG A;  3GZB A;  3CME 3;  2P05 A;  1VQ6 3;  1K8A 4;  4WP5 A;  3BLZ A;  3MG2 A;  4TX4 A;  2CFD A;  3K9M C;  4LZI A;  2WO0 A;  1UUV B;  3CCM 3;  1CEW I;  1K41 A;  2KXG A;  1YJN 3;  3S29 A;  3DGL A;  1EG9 B;  4MMY B;  1NU3 A;  2B1X B;  2W56 B;  3X40 A;  4HZB B;  3EX9 A;  4XBT A;  5FGO A;  4XDW A;  3D9R A;  5A0O B;  2STD A;  1GD4 A;  3A76 A;  2XSH B;  3FSD A;  3T0U A;  3T8U A;  3FGY A;  3PYJ A;  4L8O A;  3LT8 A;  5D81 A;  5CF2 A;  3CD6 3;  2CH9 A;  1WTH A;  4N6V 0;  3IMA B;  3G8Z A;  1W5Z A;  5AII A;  1O7P B;  3X3Z A;  1DMQ A;  1D6U A;  3KE7 A;  1YI2 3;  3QRD A;  3HII A;  2FNQ A;  4WYK A;  5JPP A;  1N5P A;  2GU3 A;  1YIJ 3;  1JB2 A;  2ML6 A;  3B4P A;  2OTJ 3;  2XRX B;  4GL6 A;  1VQ7 3;  3DUK A;  1T5Y A;  1KQS 2;  1K73 4;  5BVB A;  3PGB A;  3X3Y A;  1N5H A;  3Q1C A;  4IIA A;  3WOE B;  1W6Y A;  2CWV A;  3DGN A;  1Q86 4;  4N6T A;  1DMM A;  3F8X A;  3FH1 A;  4RBN A;  1M1X B;  1RRH A;  2OWP A;  4JF8 A;  3I55 3;  1C7H A;  1NO3 A;  1STD A;  1QJG A;  2YFJ B;  3NM7 A;  4FCZ A;  2UX0 A;  3MHE A;  3T8N A;  1JN5 A;  3DZL A;  1Y4K A;  2E2T A;  1U5O A;  1W4N A;  3ECF A;  1VQ5 3;  2CFW A;  1ZX2 A;  3E99 A;  2OOV C;  1GY7 A;  3HIG A;  1IK3 A;  2PNC A;  1CYU A;  3NQY A;  1QVF 2;  3HZP A;  2SBL A;  4J9A A;  3KII A;  3U1W A;  1FGM A;  4NHF A;  3UJM A;  1JN5 B;  3I0Y A;  4EXR A;  2CG0 A;  2RSX A;  4OVM A;  4O2H A;  1ZO2 A;  2Y73 A;  1TUH A;  3VGN A;  2CC3 A;  2O3O A;  3V98 A;  1CYV A;  2MC8 A;  1KWI A;  3S28 A;  2GU1 A;  5ELU A;  1IVX A;  4MMX B;  5STD A;  2Q07 A;  3OX9 A;  3RGA A;  1YJW 3;  1V74 A;  4ZM8 A;  1UUW B;  3DMC A;  3WA2 X;  1RKY A;  4X2H A;  1IVU A;  2W0Q A;  1QMA A;  1QAF A;  5KP3 A;  3SED A;  2BMQ B;  4Q53 A;  4KFF A;  5KP1 A;  1O7N B;  1SJW A;  4WYK B;  1HU9 A;  3LT9 A;  1DVC A;  3KKG A;  1AR0 A;  3LTD A;  3GAX A;  2XGL A;  1IVV A;  2BMR B;  5IER A;  3SX1 A;  2BHM A;  4HVN A;  4NRE A;  4R80 A;  3ER7 A;  1F8N A;  3MG1 A;  1AVK A;  4O3V A;  3X41 A;  3JUQ A;  3NUV A;  3OWY A;  1YGE A;  4LEH A;  4O02 B;  4CCV A;  2Z77 A;  1E3V A;  4PEJ A;  1OCV A;  2F99 A;  1ROV A;  3G16 A;  1O7H B;  3CPO A;  3WDG B;  1HKX A;  2K0M A;  3F8H A;  3N54 B;  4HM8 B;  5AIG A;  2CWT A;  4HBR A;  3EBY A;  5AEW B;  2GXF A;  3S67 A;  3CCS 3;  3D3L A;  3CU3 A;  1M90 4;  3HX8 A;  3KSE D;  1TP6 A;  1NWW A;  1S5A A;  3KSP A;  3LTB A;  4N6L A;  1MOL A;  2IUJ A;  2K54 A;  2IA7 A;  1VQ9 3;  1VQN 3;  4MEI A;  3SLU A;  3CCR 3;  1WMN A;  3EE1 A;  3FKA A;  2D42 A;  1GD3 A;  4RZM A;  5AI1 A;  2RCD A;  4FMC A;  4R1K A;  3CC2 3;  4HM2 B;  3PCS A;  3V92 A;  3VF1 A;  2P0X A;  1US1 A;  1Q82 4;  5IG5 A;  1A2K A;  4N6O B;  3OW2 2;  1IDP A;  2GBX B;  1OF5 A;  3LTA A;  3MSO A;  1OGX A;  2W2C A;  4LMI A;  4IT7 A;  3U97 A;  2WOF A;  3CC7 3;  3UB1 A;  1NJI 4;  1O7W B;  3EC9 A;  3K63 A;  3B8L A;  1GYB A;  2YX9 A;  2XFT A;  2F98 A;  2HMO B;  4J8T A;  1EQK A;  1ULI B;  4R4K A;  4K90 B;  5ELJ A;  3FLJ A;  3BND A;  2P09 A;  3Q90 A;  4OK0 A;  2CFL A;  1SPU A;  2HMN B;  3AMO A;  5IF6 A;  2GEY A;  1DVD A;  5D83 A;  4EV5 A;  1TIJ A;  3WOD G;  1Q40 A;  5IEN A;  3F40 A;  4FMB A;  2FGT A;  3LTC A;  4FCJ A;  2WGO A;  1N8R 4;  2F86 B;  2V1L A;  2BNG A;  1O7M B;  1SIH A;  1S72 3;  4HM0 B;  1IV7 A;  1U8C B;  1LVN A;  2O9U X;  2IMJ A;  4GB5 A;  3OWU A;  3EN1 B;  3OV4 A;  1JB5 A;  2Y74 A;  1MNL A;  4LSO A;  3VSY A;  2E2V A;  2MF7 A;  1G96 A;  2LYX A;  1JNQ A;  2R4I A;  2YFL B;  3JUO A;  4OUQ A;  4R9K A;  3NV0 B;  4KZ1 A;  1AVL A;  3BNC A;  3V99 A;  2PZV A;  3EN8 A;  1IQX A;  3X42 A;  1D6Y A;  3EJV A;  3DY5 A;  4H61 A;  3LML A;  2CWU A;  1A2V A;  2CKF B;  4HZ9 B;  4N6U A;  7STD A;  1LOX A;  5EVH A;  5IEP A;  5CXO A;  1GY6 A;  5I97 A;  5EEO A;  4BTW A;  1FGQ A;  3MPH A;  2B24 B;  3K7C A;  3PXM A;  5LC7 A;  1VQM 3;  2ZL8 A;  1WMO A;  2A15 A;  4HM5 B;  1YIT 3;  2C11 A;  3HK4 A;  1GS3 A;  5KP4 A;  3KZT A;  3Q2P A;  1ULJ B;  2CFK A;  5AIH A;  2YFI B;  3B4O A;  3LXU X;  2XR8 B;  4XBY A;  3N8B A;  4HJL B;  3ALA A;  3NBB A;  3EQQ B;  3PCR A;  2W04 A;  3KN4 A;  3CXC 2;  1BUQ A;  5CK6 A;  4AKY A;  3N9H A;  4N6N B;  1W2B 2;  1J2B A;  3H3H A;  5IW9 A;  3F14 A;  2W9P A;  1KC8 4;  3MYT A;  1STF I;  4HM1 B;  5JPU A;  1FGO A;  2CW9 A;  1OGZ A;  4K61 A;  1RN7 A;  1Z1S A;  3WMD A;  1QVG 2;  3MG3 A;  1W01 A;  1JV2 B;  5AYR B;  5LC6 A;  3JUN A;  1TFK A;  2W9Q A;  4L8P A;  3G6E 3;  1KD1 4;  4KFE A;  1DMN A;  1LXE A;  3NV0 A;  3F9S A;  1FUW A;  4X2O A;  4HM7 B;  3CPW 2;  2GEX A;  5IG3 A;  4KVH A;  4WFO A;  2JDI H;  4K1V A;  2CFG A;  3CC4 3;  3GRD A;  2LQV A;  2WOH A;  2Z76 A;  2E2U A;  1IQ8 A;  4JRF A;  2BMO B;  1N9E A;  3SOA A;  2L4V A;  1Q7Y 4;  2CIU A;  4LGQ A;  3CNM A;  1FA3 A;  3CCV 3;  1OAC A;  5G2G A;  3IJE B;  1IU7 A;  1VQ8 3;  4XBX A;  1IT7 A;  1L5G B;  3BNE A;  2XF3 A;  3DXO A;  3FG4 A;  1A90 A;  5D82 A;  2D1W A;  2KCD A;  1JB4 A;  1JRQ A;  3NBJ A;  2WGQ A;  1E3R A;  3FG3 A;  4IPB A;  1OHS A;  1WNH A;  2QGU A;  3NXJ A;  3AMO B;  2XFS A;  3EHC A;  4FMD A;  3SOY A;  2RGQ A;  1NB3 I;  3CMA 3;  4ORL A;  3DGO A;  4HYZ A;  3JUP A;  1TFO A;  3GZY B;  2W6J H;  2BT3 A;  1GY5 A;  3CCJ 3;  3GZR A;  2Z6B A;  3OXA A;  5AIF A;  3FF0 A;  1ASK A;  3ROB A;  2OTL 3;  4XB5 A;  1OF5 B;  1IT8 A;  5IG4 A;  2BO9 B;  1TU5 A;  4I4K A;  1VQL 3;  2CHC A;  2FXT A;  3CCQ 3;  2W56 A;  3RDE A;  3MKI A;  3J7Y d;  3BNB A;  1N8Q A;  5IG0 A;  4WHA A;  3CNX A;  1OH0 A;  4H3U A;  1O7G B;  1AV4 A;  1LNH A;  3NM2 A;  1WMP A;  2P38 A;  5BXQ A;  3NX0 A;  3O8Y A;  5DRV A;  1E97 A;  3K5T A;  3L0R A;  1PU4 A;  1WQL B;  2OQE C;  8CHO A;  3UL6 A;  2M7O A;  1JKG B;  4HM3 B;  1W00 A;  4MJD A;  3G4S 3;  3LOY A;  2CG1 A;  5AEU B;  1M9G A;  1OPY A;  3H51 A;  4FMA A;  4EV2 A;  3DM8 A;  4WWU C;  4HKV B;  3DGM A;  4CDL A;  3IPT A;  5TGN A;  4KFD A;  3UL5 A;  4QWT A;  3F7X A;  4STD A;  3JVC A;  4EBG A;  1IV9 A;  2OQE A;  3G71 3;  4N6M A;  3FG1 A;  2QA4 3;  1FGT A;  3GWR A;  2XH9 A;  5EQL A;  3OWS A;  3NQZ A;  3FZW A;  1OHO A;  2P0M A;  3MWZ A;  1W7C A;  4FR9 A;  1K9M 4;  2XSO B;  4AEQ A;  3QK9 A;  1Q42 A;  1K28 A;  3LZA A;  2ML5 A;  3FF2 A;  2QEX 3;  1D6Z A;  1KSI A;  2INX A;  4MMZ B;  3I56 3;  4XM4 A;  3PZW A;  2OCT A;  3K0Z A;  4K1U A;  4R9L A;  4RNY A;  2HML B;  2Z7A A;  3EB8 A;  3EF8 A;  3STD A;  1UI7 A;  2IUK A;  5JBS A;  2XGN A;  1YVB I;  4HM6 B;  1YJ9 3;  3RGR A;  2W03 A;  1NDO B;  3WA3 A;  1PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...