3B8LA

Crystal structure of a putative aromatic ring hydroxylase (saro_3538) from novosphingobium aromaticivorans dsm at 1.75 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
FQGMQCPIEDRLAIQDLMIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANMSHHAHYLTNFAVTGYEGDTASMRAYVIGMGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTMDFLMPLSGTLDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_001165924.1) from Novosphingobium aromaticivorans DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Oxidoreductase
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b8lA01
3K7CA 1O7GB 5IERA 1NU3A 1OHSA 5DREA 4HM3B 4FCJA 3FGYA 1E97A 3CPOA 3OWUA 3OXAA 3RGAA 3OWSA 2W2CA 1A2KA 3KSPA 4XBXA 1GYBA 4LEHA 1VZZA 1W01A 2HMNB 2GEYA 3ROBA 1E3RA 2JQ5A 6STDA 1W00A 4FCMA 5BXQA 1OHPA 4HJLB 4XB5A 4XM4A 3CU3A 5TGNA 3JUNA 7STDA 3HZPA 5IEOA 1OF5A 4L7KA 1ZX2A 4N3VA 3UNLA 3F8XA 2UX0A 2BMQB 2HMLB 1UUVB 3SOYA 5CLKA 5IG4A 4X2OA 5AIGA 5IENA 4STDA 4XBTA 3IPTA 3OV4A 2BMRB 3KKGA 3MYTA 3EBYA 3KZTA 3MKIA 2HMKB 5D83A 3FF0A 4R1KA 3T8NA 4H3UA 4MJDA 3FH1A 5D81A 1TP6A 3H3HA 3HK4A 3SOAA 3LYGA 4J8TA 4L8OA 2YFIB 3EC9A 2YFLB 5STDA 1NWWA 1JB4A 1GY7A 4HM4B 1JKGA 2STDA 4WYKB 1O7PB 5IG5A 3NHXA 4I4KA 1NDOB 8CHOA 3DZLA 4KVHA 4HM0B 3B7CA 3DUKA 2F98A 1OF5B 2QIYA 3FLJA 3KE7A 3FZWA 1ULIB 1W02A 1GY5A 3MSOA 5BVBA 3EQQB 1Q40B 3DXOA 3FSDA 2IMJA 1OGZA 5IG3A 1O7HB 1STDA 4IIAA 4ORLA 1ISKA 1Q42A 1OGXA 2QGUA 2INXA 3F40A 2PZVA 5FW5A 3NV0A 3F9SA 2XSOB 4XDWA 2B1XB 1W6YA 2HMJB 3H51A 3CNXA 2A15A 4R9LA 4X2HA 4HM7B 2GXFA 3MG3A 5EVHA 1OH0A 1DMNA 3FKAA 1U5OA 4R9KA 4OVMA 2R4IA 3JUQA 5AIFA 5CF2A 3M8CA 1OCVA 3OX9A 2CKFB 2XRXB 1JN5A 3F7SA 1S5AA 3WMDA 4XDVA 1E3VA 1JKGB 3D9RA 5AIIA 3CNMA 3Q90A 5CF1A 5DRVA 3B4PA 3NBRA 1Z1SA 4HM2B 2CHCA 3GWRA 5CK6A 2XR8B 3EHCA 3EN1B 2GBWB 2K54A 2YFJB 3VSYA 3NM2A 3E99A 2RCDA 2GBXB 4K1UA 5IEPA 2RGQA 3DM8A 3NXJA 1QJGA 3GZXB 1DMMA 4L8PA 3B8LA 4LGQA 4OUQA 3VGNA 1DMQA 3OWYA 1JB5A 3GZRA 3SEDA 1GY6A 1UUWB 3GRDA 5AI1A 3UJMA 3STDA 3EX9A 3EN8A 3RGRA 1ZO2A 1K41A 2BNGA 4HKVB 1OPYA 1OHOA 1O7NB 5HGRA 3GZYB 1O7WB 3T8UA 5KP3A 4HZBB 5AIHA 1C7HA 3F7XA 3GZBA 5JPPA 5AEWB 2Z7AA 2GEXA 3ER7A 1ULJB 3G0KA 1JN5B 3A76A 2I9WA 3EF8A 1HKXA 3HX8A 4WP5A 2B24B 4Q53A 3I0YA 4WWUC 3MHEA 3S5CA 2BMOB 1O7MB 1JB2A 3EBTA 1OUNA 2Z77A 3K0ZA 4U13A 3MG2A 4HM5B 3G16A 4HM1B 4WYKA 5G2GA 1CQSA 3F14A 1WQLB 1ASKA 5D82A 5KP4A 1GS3A 4PEJA 4GB5A 1TUHA 3LZAA 3F8HA 2HMOB 1EG9B 3EJVA 3NUVA 1SJWA 5KP1A 1EA2A 3B4OA 1Q40A 4CDLA 5IG0A 1AR0A 2F86B 5IF6A 3MG1A 3BB9A 4HZ9B 4K1VA 4XBYA 2F99A 5CXOA 1BUQA 3JUPA 4J9AA 4LMIA 4RZMA 3ECFA 5JPUA 3FF2A 4HVNA 2HMMB 3NV0B 1QMAA 3JUMA 3JUOA 1IDPA 3DMCA 4HM8B 2XSHB 3G8ZA 2OWPA 5AEUB 4HM6B 2Z76A 3BLZA 2RFRA
chains in the Genus database with same CATH superfamily
4FMAA 1PYLA 1R4YA 3K7CA 1BRJA 3K5TA 1O7GB 5IERA 4N6OB 1TRQA 1EEJA 1NU3A 1OHSA 1Q9EA 4J5KA 2ML5A 5DREA 1I2GA 4HM3B 4FCJA 2OCTA 4GHOA 3LT9A 1A67A 1YJW3 1B27A 1E97A 3CPOA 2P0XA 3FGYA 3OWUA 1VQQA 1RCKA 4LSOA 1BOXA 1MGRA 2W56B 3OXAA 3RGAA 1KC84 3OWSA 2MC8A 2W2CA 1A2KA 4IPBA 2W9PA 3DGOA 3KSPA 4XBXA 1VQK3 3I553 2W9QA 3I563 3LH4A 3DH2A 1GYBA 1RGLA 4LEHA 1KD14 1T5YA 1VZZA 2IUKA 1W01A 1RRLA 1MGWA 2HMNB 2KAAA 1I3IA 2GEYA 2BHMA 3X42A 1JJ22 1RHLA 4FMCA 5M18A 1HYFA 1GMPA 5G1KA 1BNFA 8RNTA 1RN1A 3GSPA 3ROBA 1E3RA 1HZ1A 2JQ5A 3AGOA 1W00A 6STDA 1DVDA 3ZFZA 2W04A 2CWUA 1BRKA 3PZWA 1B2SA 1IV9A 3CCQ3 3X3ZA 2V1LA 4FCMA 1AY7A 5BXQA 1OHPA 4HJLB 2KF6A 1ROVA 2RBIA 1VQ73 3IMAB 2P0MA 2AAEA 4XB5A 1LRAA 3CU3A 2FNQA 2HOHA 4XM4A 5TGNA 3SX1A 3CMA3 1FUWA 1YGEA 3DGNA 1K734 2CC3A 4K61A 1M904 3AMOB 1QVF2 2OTJ3 3JUNA 4I5QA 5RNTA 1VQ53 1Y4KA 1BANA 1PFPA 7STDA 3CCR3 1G96A 4MEIA 4BTXA 4GL6A 3WOFB 1WMOA 3HZPA 3AHWA 2CG1A 3UB1A 2ZHXB 5IEOA 2SBLA 3G4S3 1OF5A 2Q07A 1NB5I 1D6UA 1YIJ3 3O8YA 4L7KA 1K28A 4KFEA 1I3FA 1RGEA 1ZX2A 4WFOA 1B21A 4N3VA 3D3LA 3UNLA 3CCV3 4EV5A 2L4VA 1SIHA 3RDEA 3F8XA 4DKIA 3SYUA 5EEOA 1RDSA 1BNJA 2UX0A 2BMQB 2HMLB 2L1SA 1IVXA 1RCLA 1UUVB 1W4NA 2BU4A 3HOHA 5M19A 2IYJA 3SOYA 1LNIA 4N6LA 5IW9A 3KCHA 5CLKA 5IG4A 2W6JH 4X2OA 1LNHA 4FMDA 1LVNA 3HIIA 4HYZA 5AIGA 4GSPA 1RNTA 3CCU3 3WA2X 5IENA 1VQ83 1KSIA 1UGIA 1PU4A 1BIRA 4STDA 4XBTA 1A2VA 1GOUA 1RLSA 3IPTA 3OV4A 2BMRB 1JV2B 2C10A 3LXUX 3KKGA 1FGOA 3MYTA 3EBYA 3KZTA 3CCE3 3D5GA 1GMQA 4FR9A 1W6GA 3MKIA 1X1XA 1IQ8A 2HMKB 4KFDA 4O2HA 3NX0A 2CH9A 4KZ1A 5D83A 3FF0A 2OTL3 1IVVA 4OK0A 4R1KA 3T8NA 7GSPA 2D42A 4H3UA 3Q3FA 1ROAA 4MJDA 3CCJ3 3FH1A 4TX4A 5D81A 4RNTA 3J7Yd 1DETA 1TP6A 3H3HA 2AADA 3HK4A 5GSPA 3SOAA 3LYGA 1JNQA 4HAAA 4J8TA 4L8OA 3T0UA 1AV4A 1NB3I 1UCLA 2YFIB 4JRFA 3EC9A 2YFLB 1AQZA 2KRTA 5STDA 2Z6BA 2CFDA 3D4AA 1BSAA 4BL3A 1I2FA 1NWWA 2KF3A 2E2UA 3CC23 2CK3H 1YVSA 1JB4A 1GY7A 3PYJA 1JKGA 4HM4B 2STDA 4WYKB 5ELJA 1O7PB 2GSPA 5IG5A 3WR2A 3N54B 1BRNL 3V92A 1TTOA 3S29A 5LC6A 1V58A 1NJI4 3PGBA 2CFWA 3NHXA 4I4KA 1V57A 5I97A 3WOEB 1NDOB 2CWVA 3SXXA 1JRQA 4IT7A 8CHOA 1RGHA 1QALA 2FGTA 3DZLA 4KVHA 3X3XA 1N8R4 4HM0B 3B7CA 2IY2A 1BU4A 3DUKA 1BRSA 2F98A 1YJ93 3SLUA 1OF5B 2QIYA 3FLJA 3KE7A 3NBBA 5JBSA 2H0HA 3EE1A 2H0IA 4RNZA 3ZG5A 3KFQC 3FZWA 1FA3A 1ULIB 4HBRA 1W02A 1Q864 1GY5A 3U97A 1BNRA 4R4KA 1BUJA 3MSOA 2D1WA 1UCIA 1X1WA 4ILFA 1B2MA 4N6UA 1STFI 2H0GA 5BVBA 3BNBA 1ZGXA 3EQQB 3CME3 1W6CA 1VQO3 4BU4A 1Q40B 3DXOA 1BNGA 5FGOA 3FSDA 2IMJA 3WHOA 1OGZA 4NHFA 5IG3A 2WO0A 3X3YA 3LT8A 4BTWA 4MMYB 1O7HB 1UCKA 1STDA 4IIAA 4ORLA 2XEPA 1M1K4 1Q42A 1ISKA 1OGXA 2QGUA 3CCM3 5ELUA 4N6MA 2INXA 3F40A 1LOVA 5A0OB 2O3OA 2PZVA 3NQYA 5FW5A 4EV2A 2M7OA 3NV0A 3F9SA 2OQEA 2XSOB 2QEX3 4XDWA 3V99A 2XF3A 2B1XB 3LOYA 1W6YA 1VQ93 3QRDA 9RNTA 2HMJB 3H51A 1SARA 3CNXA 2A15A 1FYSA 3K63A 4R9LA 1BSEA 4X2HA 2XGLA 4HM7B 2GXFA 1W7CA 2IUJA 1QAKA 4AEQA 4BIRA 1G0TA 1T2HA 3MG3A 5EVHA 1Q7Y4 1JBTA 1UI8A 2ZDJA 3PCSA 1OH0A 1DMNA 1NO3A 5EQLA 3FKAA 1B3SA 1U5OA 4R9KA 1LQGC 3Q2PA 4OVMA 1RN7A 2R4IA 2LQVA 1YHQ3 3RNTA 3U1WA 2RSXA 3FG4A 3JUQA 3N8BA 5AIFA 1B20A 1RSNA 4N6TA 3FG1A 1CYUA 4J5GA 3S28A 5CF2A 3FCSB 4KT3B 2XH9A 2XGNA 1TJDA 3M8CA 1OCVA 2F5MA 1TRPA 3OX9A 4NREA 1Q7HA 2CKFB 3D79A 2XRXB 4AKZA 2W03A 1JN5A 3F7SA 1BRHA 3BNEA 3WA3A 5LC7A 1S5AA 3WMDA 4XDVA 1E3VA 1JKGB 4EW5A 1DVCA 4MMXB 5BIRA 2W56A 3D9RA 5AIIA 3CC73 4K90B 1BRGA 3CNMA 3Q90A 5CF1A 3G713 1QAFA 3HIGA 5DRVA 1TFKA 2UGIA 3B4PA 3NBRA 1IQYA 1Z1SA 3BNDA 1UCJA 1W2ZA 3N9HA 1X1YA 2KCDA 3NM7A 2CHCA 2P05A 3GWRA 5CK6A 2XR8B 2SARA 3EHCA 3EN1B 3OW22 1RGFA 3NQZA 2GBWB 1U8CB 1IVUA 2K54A 2YFJB 3S27A 3VSYA 4G1MB 2P38A 3NM2A 3E99A 1MWSA 2GBXB 1ZS7A 2RCDA 3NBJA 1UDII 1GMRA 4K1UA 5IEPA 2RGQA 3L0RA 3DM8A 3NXJA 1RTUA 3X41A 1QJGA 2ZA4A 4AKYA 3GZXB 1YGWA 1DMMA 1EUIC 4L8PA 2KF4A 1R4CA 3B8LA 4LGQA 4OUQA 1WTHA 3VGNA 1DMQA 1BNIA 1NNVA 1LOWA 1JB5A 1N8QA 3OWYA 1AVKA 3CCL3 1BNEA 1K8A4 1WNHA 2QA43 4MMZB 1RJOA 2C4BA 1I2EA 2Y73A 3G6E3 3GZRA 3SEDA 1GY6A 1UUWB 4EYCA 1B2UA 1FGRA 3GRDA 5AI1A 2CFKA 1IK3A 2MF7A 3UJMA 2K0MA 1LXEA 1UI7A 1EQKA 1VQN3 1LOYA 1F8NA 2O9UX 3STDA 3EX9A 1DYUA 4O02B 1VQ43 1N9EA 4O8SA 2BT3A 3EN8A 3CCS3 2WOFA 4HOHA 1JZDA 1IU7A 2R41A 3JVCA 3RGRA 4O3VA 4FCZA 2FXTA 1ZO2A 1RGCA 3A5EA 2CWTA 1MNLA 3FG3A 1K41A 3HI7A 2BNGA 2WOHA 3KSED 4HKVB 5M1AA 5BU4A 3LTAA 1OPYA 1MWTA 4N6NB 6GSPA 1C54A 5G1LA 1OHOA 1O7NB 5HGRA 2LYXA 1CYVA 1SQWA 1D6ZA 3GZYB 1SPUA 1VQ63 2WGOA 3SVAA 1IVWA 1FZUA 1O7WB 1FGTA 1FGMA 1RMSA 2JDIH 2W0QA 3DGYA 4HZBB 3DGMA 5AIHA 5KP3A 3WODG 4WHAA 1C7HA 3F7XA 3KIIA 2CFLA 2GU3A 2OOVA 1SIIA 2KF5A 3GZBA 1BAOA 2F5WA 1BNSA 5JPPA 1I0VA 3K9MC 1M1XB 2F4YA 4EXRA 2Z7AA 4RBNA 5AEWB 2GEXA 3ER7A 3IJEB 1ULJB 4RNYA 3G0KA 1JN5B 1N9JA 1RN4A 3A76A 3DGLA 4CPKA 2I9WA 2F56A 2YX9A 4QWTA 3EF8A 1UGHI 2OOVC 2IA7A 3URPA 1FW7A 1HKXA 5AYRB 4EBGA 3LTCA 3HX8A 4WP5A 1YI23 2B24B 3PCRA 4Q53A 1VQL3 1TU5A 2E2VA 3I0YA 1KWIA 4WWUC 1MWRA 2C11A 3MHEA 1W5ZA 3S5CA 2BMOB 2CFGA 7RNTA 1X1UA 1TFOA 4H61A 1M9GA 1I70A 1O7MB 3WDGB 1JB2A 2CIUA 3EBTA 1IQXA 1LOXA 1N5PA 1OUNA 1WMNA 2KXGA 2Z77A 3LTDA 1KQS2 2K3DA 1BSBA 1V74A 3UL5A 1BSCA 1GSPA 3K0ZA 4U13A 2OQEC 4KFFA 3MG2A 1T3BA 3EB8A 2CX1A 1IV7A 2E2TA 3ZG0A 1N5HA 3G16A 4HM5B 1L5GB 4HM1B 4WYKA 1VQM3 1PY3A 5G2GA 1I0XA 1CQSA 1K9M4 3F14A 1Q824 1WQLB 1ASKA 3BU4A 4ZM8A 1GOYA 5D82A 1RNBA 5KP4A 1BGSA 1GS3A 1GOVA 1BRIA 1YVBI 4CCVA 3Q1CA 3S67A 4PEJA 1QVG2 1S723 1J2BA 1WMPA 2CX0A 3X40A 1BVIA 4JF8A 1B2XA 1AVLA 4LYLB 3CXC2 2ZL8A 1FUSA 4GB5A 1TUHA 3MWZA 3LZAA 3F8HA 3PXMA 1EKMA 2HMOB 4HM2B 1W2B2 1EG9B 3EJVA 3NUVA 2P09A 2RNTA 1B2ZA 5HOHA 1BSDA 1DE3A 1SJWA 1OACA 3V98A 5KP1A 2XFTA 1RGGA 3CD63 1EA2A 1YNVX 3B4OA 2J8XB 1CH0A 1Q40A 3ALAA 4CDLA 5IG0A 5AYSC 1MWUA 6RNTA 2ML6A 1AR0A 1JBRA 3QK9A 2F86B 1UUGB 5IF6A 1TIJA 1RKYA 1IT7A 4BL2A 1A90A 3MG1A 1MOLA 3VF1A 3LTBA 4BTYA 3BB9A 1IYYA 1YIT3 4HZ9B 4K1VA 4XBYA 2F99A 1CEWI 5CXOA 1RGKA 3AMOA 1BUQA 1RGAA 3UL6A 3JUPA 4J9AA 1IT8A 4LMIA 4EC6A 1Q814 4RZMA 1G02A 1LQMB 3ECFA 4LZIA 5JPUA 1GD4A 3FF2A 3PS8A 1VQP3 4HVNA 2HMMB 3BIRA 2PNCA 1YJN3 1JZOA 2BIRA 2UUGC 1GD3A 3D5IA 3NV0B 3AHSA 1QMAA 3JUMA 1T2IA 3JUOA 3DY5A 3TDGA 1IDPA 1A2PA 4NPBA 2BO9B 3DMCA 3GAXA 1RRHA 1I8VA 2WGQA 1UW1A 1JBSA 2CG0A 3AGNA 3T8UA 4R80A 4HM8B 1D6YA 1US1A 2Y74A 3KN4A 3CPW2 2CW9A 2XSHB 1HU9A 3BNCA 3G8ZA 3LMLA 4N6V0 4FMBA 2OWPA 5AEUB 1FUTA 3MPHA 4HM6B 1FGQA 2GU1A 2XFSA 4CJNA 2Z76A 3BLZA 2RFRA 3CC43
chains in the Genus database with same CATH topology
4FMAA 3K7CA 3K5TA 1O7GB 5IERA 4N6OB 1NU3A 1OHSA 2ML5A 5DREA 4HM3B 4FCJA 2OCTA 3LT9A 1A67A 1YJW3 3FGYA 1E97A 3CPOA 2P0XA 3OWUA 3CCE3 4LSOA 2W56B 3OXAA 3RGAA 1KC84 3OWSA 2MC8A 2W2CA 1A2KA 4IPBA 2W9PA 3DGOA 3KSPA 4XBXA 1VQK3 3I553 2W9QA 3LH4A 1GYBA 4LEHA 1KD14 1T5YA 1VZZA 2IUKA 1W01A 1RRLA 2HMNB 2GEYA 2BHMA 3X42A 1JJ22 4FMCA 3ROBA 1E3RA 2JQ5A 6STDA 1W00A 1DVDA 2W04A 2CWUA 3PZWA 1IV9A 3CCQ3 3X3ZA 2V1LA 4FCMA 5BXQA 1OHPA 4HJLB 1ROVA 1VQ73 3IMAB 2P0MA 4XB5A 4XM4A 3CU3A 2FNQA 5TGNA 3SX1A 3CMA3 1FUWA 1YGEA 3DGNA 1K734 2CC3A 4K61A 1M904 3AMOB 1QVF2 2OTJ3 3JUNA 1VQ53 1Y4KA 1PFPA 7STDA 3CCR3 1G96A 4MEIA 4BTXA 4GL6A 3WOFB 1WMOA 3HZPA 2CG1A 3UB1A 5IEOA 2SBLA 3G4S3 1OF5A 2Q07A 1NB5I 1D6UA 1YIJ3 3O8YA 4L7KA 1K28A 4KFEA 1ZX2A 4WFOA 4N3VA 3D3LA 3UNLA 3CCV3 4EV5A 2L4VA 1SIHA 3RDEA 3F8XA 5EEOA 2UX0A 2BMQB 2HMLB 1IVXA 1W4NA 1UUVB 3SOYA 5IW9A 4N6LA 5CLKA 5IG4A 2W6JH 4X2OA 1LNHA 4FMDA 1LVNA 3HIIA 4HYZA 5AIGA 3CCU3 3WA2X 5IENA 1VQ83 1KSIA 1PU4A 4STDA 4XBTA 1A2VA 3IPTA 3OV4A 2BMRB 1JV2B 2C10A 3LXUX 3KKGA 1FGOA 3MYTA 3EBYA 3KZTA 4FR9A 1W6GA 3MKIA 4KFDA 1IQ8A 2HMKB 4O2HA 3NX0A 2CH9A 4KZ1A 5D83A 3FF0A 2OTL3 1IVVA 4OK0A 4R1KA 3T8NA 2D42A 4H3UA 1ROAA 4MJDA 3CCJ3 3FH1A 4TX4A 5D81A 3J7Yd 1TP6A 3H3HA 3HK4A 3SOAA 3LYGA 1JNQA 4J8TA 4L8OA 3T0UA 1AV4A 1NB3I 2YFIB 4JRFA 3EC9A 2YFLB 2KRTA 5STDA 2Z6BA 2CFDA 1NWWA 2E2UA 3CC23 2CK3H 1JB4A 1GY7A 3PYJA 1JKGA 4HM4B 2STDA 4WYKB 5ELJA 1O7PB 5IG5A 3N54B 3V92A 3S29A 5LC6A 1NJI4 3PGBA 2CFWA 3NHXA 4I4KA 5I97A 3WOEB 1NDOB 2CWVA 3SXXA 1JRQA 4IT7A 8CHOA 1QALA 2FGTA 3DZLA 4KVHA 3X3XA 1N8R4 4HM0B 3B7CA 3DUKA 1YJ93 2F98A 3SLUA 1OF5B 2QIYA 3FLJA 3KE7A 3NBBA 5JBSA 3EE1A 4RNZA 3KFQC 3FZWA 1FA3A 1ULIB 4HBRA 1W02A 1Q864 1GY5A 3U97A 4R4KA 3MSOA 2D1WA 4N6UA 1STFI 5BVBA 3BNBA 3EQQB 3CME3 1W6CA 1VQO3 1Q40B 3DXOA 5FGOA 3FSDA 2IMJA 1OGZA 4NHFA 5IG3A 2WO0A 3X3YA 3LT8A 4BTWA 4MMYB 1O7HB 1STDA 4IIAA 4ORLA 2XEPA 1M1K4 1Q42A 1ISKA 1OGXA 2QGUA 3CCM3 5ELUA 4N6MA 2INXA 3F40A 5A0OB 2O3OA 2PZVA 3NQYA 5FW5A 4EV2A 2M7OA 3NV0A 3F9SA 2OQEA 2XSOB 2QEX3 4XDWA 3V99A 2XF3A 2B1XB 3LOYA 1W6YA 1VQ93 3QRDA 2HMJB 3H51A 3CNXA 2A15A 3K63A 4R9LA 4X2HA 2XGLA 4HM7B 2GXFA 1W7CA 2IUJA 1QAKA 4AEQA 3MG3A 5EVHA 1Q7Y4 1UI8A 2ZDJA 3PCSA 1OH0A 1DMNA 1NO3A 5EQLA 3FKAA 1U5OA 4R9KA 3Q2PA 4OVMA 1RN7A 2R4IA 2LQVA 1YHQ3 3U1WA 2RSXA 3FG4A 3JUQA 3N8BA 5AIFA 4N6TA 3FG1A 1CYUA 3S28A 5CF2A 3FCSB 2XH9A 2XGNA 3M8CA 1OCVA 4NREA 3OX9A 2CKFB 4AKZA 2XRXB 2W03A 1JN5A 3F7SA 3BNEA 3WA3A 5LC7A 1S5AA 3WMDA 4XDVA 1E3VA 1JKGB 1DVCA 4MMXB 2W56A 3D9RA 5AIIA 3CC73 4K90B 3CNMA 3Q90A 5CF1A 3G713 1QAFA 3HIGA 5DRVA 1TFKA 3B4PA 3NBRA 3I563 1IQYA 1Z1SA 3BNDA 1W2ZA 3N9HA 3NM7A 4HM2B 2KCDA 2CHCA 2P05A 3GWRA 5CK6A 2XR8B 3EHCA 3EN1B 3OW22 3NQZA 2GBWB 1U8CB 1IVUA 2K54A 2YFJB 3S27A 3VSYA 4G1MB 2P38A 3NM2A 3E99A 2RCDA 2GBXB 3NBJA 4K1UA 5IEPA 2RGQA 3L0RA 3DM8A 3NXJA 3X41A 1QJGA 4AKYA 3GZXB 1DMMA 4L8PA 3B8LA 1R4CA 4LGQA 4OUQA 1WTHA 3VGNA 1DMQA 3OWYA 1JB5A 1N8QA 1AVKA 3CCL3 1K8A4 1WNHA 2QA43 4MMZB 1RJOA 2Y73A 3G6E3 3GZRA 3SEDA 1GY6A 1UUWB 4EYCA 1FGRA 3GRDA 5AI1A 2CFKA 1IK3A 2MF7A 3UJMA 2K0MA 1LXEA 1UI7A 1EQKA 1VQN3 1F8NA 2O9UX 3STDA 3EX9A 1DYUA 4O02B 1VQ43 1N9EA 4O8SA 2BT3A 3EN8A 2WOFA 1IU7A 3JVCA 3RGRA 4O3VA 4FCZA 2FXTA 1ZO2A 3FG3A 2CWTA 1MNLA 1K41A 3HI7A 2BNGA 2WOHA 3KSED 4HKVB 3LTAA 1OPYA 4N6NB 1OHOA 1O7NB 5HGRA 2LYXA 1CYVA 1SQWA 1D6ZA 3GZYB 1SPUA 1VQ63 2WGOA 3SVAA 1IVWA 1O7WB 1FGTA 1FGMA 2JDIH 2W0QA 4HZBB 5AIHA 5KP3A 3DGMA 3T8UA 3WODG 3CCS3 4WHAA 1C7HA 3F7XA 3KIIA 2CFLA 2GU3A 2OOVA 1SIIA 3GZBA 5JPPA 3K9MC 1M1XB 4EXRA 2Z7AA 4RBNA 5AEWB 2GEXA 3ER7A 3IJEB 1ULJB 4RNYA 3G0KA 1JN5B 1N9JA 3A76A 3DGLA 2I9WA 2YX9A 4QWTA 3EF8A 2OOVC 2IA7A 1HKXA 5AYRB 4EBGA 3LTCA 3HX8A 4WP5A 1YI23 2B24B 3PCRA 4Q53A 1VQL3 1TU5A 2E2VA 3I0YA 1KWIA 4WWUC 2C11A 3MHEA 1W5ZA 3S5CA 2BMOB 2CFGA 1TFOA 4H61A 1M9GA 1O7MB 3WDGB 1JB2A 2CIUA 3EBTA 1IQXA 1LOXA 1N5PA 1OUNA 1WMNA 2KXGA 2Z77A 3LTDA 1KQS2 1V74A 3UL5A 3K0ZA 4U13A 2OQEC 4KFFA 3MG2A 3EB8A 1IV7A 2E2TA 1N5HA 3G16A 4HM5B 1L5GB 4HM1B 4WYKA 1VQM3 5G2GA 1CQSA 1K9M4 3F14A 1Q824 1WQLB 1ASKA 4ZM8A 5D82A 5KP4A 1GS3A 4CCVA 1YVBI 3Q1CA 3S67A 4PEJA 1QVG2 1S723 1J2BA 1WMPA 3X40A 4JF8A 1AVLA 3CXC2 2ZL8A 4GB5A 1TUHA 3MWZA 3LZAA 3F8HA 3PXMA 1EKMA 2HMOB 1W2B2 1EG9B 3EJVA 3NUVA 2P09A 1SJWA 1OACA 3V98A 5KP1A 2XFTA 3CD63 1EA2A 3B4OA 1Q40A 3ALAA 4CDLA 5IG0A 5AYSC 2ML6A 1AR0A 3QK9A 2F86B 5IF6A 1RKYA 1TIJA 1IT7A 1A90A 3MG1A 1MOLA 3VF1A 3LTBA 4BTYA 3BB9A 1YIT3 4HZ9B 4K1VA 4XBYA 2F99A 1CEWI 5CXOA 3AMOA 1BUQA 3UL6A 3JUPA 4J9AA 1IT8A 4LMIA 4EC6A 1Q814 4RZMA 3ECFA 4LZIA 5JPUA 1GD4A 3FF2A 3PS8A 1VQP3 4HVNA 2HMMB 2PNCA 1YJN3 1GD3A 3NV0B 1QMAA 3JUMA 3JUOA 3DY5A 3TDGA 1IDPA 2BO9B 3DMCA 3GAXA 1RRHA 2WGQA 1UW1A 2CG0A 4R80A 4HM8B 1D6YA 1US1A 2Y74A 3KN4A 3CPW2 2CW9A 2XSHB 1HU9A 3BNCA 3G8ZA 3LMLA 4N6V0 4FMBA 2OWPA 5AEUB 3MPHA 4HM6B 1FGQA 2GU1A 2XFSA 2Z76A 3BLZA 2RFRA 3CC43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7C A;  1O7G B;  5IER A;  1NU3 A;  1OHS A;  5DRE A;  4HM3 B;  4FCJ A;  3FGY A;  1E97 A;  3CPO A;  3OWU A;  3OXA A;  3RGA A;  3OWS A;  2W2C A;  1A2K A;  3KSP A;  4XBX A;  1GYB A;  4LEH A;  1VZZ A;  1W01 A;  2HMN B;  2GEY A;  3ROB A;  1E3R A;  2JQ5 A;  6STD A;  1W00 A;  4FCM A;  5BXQ A;  1OHP A;  4HJL B;  4XB5 A;  4XM4 A;  3CU3 A;  5TGN A;  3JUN A;  7STD A;  3HZP A;  5IEO A;  1OF5 A;  4L7K A;  1ZX2 A;  4N3V A;  3UNL A;  3F8X A;  2UX0 A;  2BMQ B;  2HML B;  1UUV B;  3SOY A;  5CLK A;  5IG4 A;  4X2O A;  5AIG A;  5IEN A;  4STD A;  4XBT A;  3IPT A;  3OV4 A;  2BMR B;  3KKG A;  3MYT A;  3EBY A;  3KZT A;  3MKI A;  2HMK B;  5D83 A;  3FF0 A;  4R1K A;  3T8N A;  4H3U A;  4MJD A;  3FH1 A;  5D81 A;  1TP6 A;  3H3H A;  3HK4 A;  3SOA A;  3LYG A;  4J8T A;  4L8O A;  2YFI B;  3EC9 A;  2YFL B;  5STD A;  1NWW A;  1JB4 A;  1GY7 A;  4HM4 B;  1JKG A;  2STD A;  4WYK B;  1O7P B;  5IG5 A;  3NHX A;  4I4K A;  1NDO B;  8CHO A;  3DZL A;  4KVH A;  4HM0 B;  3B7C A;  3DUK A;  2F98 A;  1OF5 B;  2QIY A;  3FLJ A;  3KE7 A;  3FZW A;  1ULI B;  1W02 A;  1GY5 A;  3MSO A;  5BVB A;  3EQQ B;  1Q40 B;  3DXO A;  3FSD A;  2IMJ A;  1OGZ A;  5IG3 A;  1O7H B;  1STD A;  4IIA A;  4ORL A;  1ISK A;  1Q42 A;  1OGX A;  2QGU A;  2INX A;  3F40 A;  2PZV A;  5FW5 A;  3NV0 A;  3F9S A;  2XSO B;  4XDW A;  2B1X B;  1W6Y A;  2HMJ B;  3H51 A;  3CNX A;  2A15 A;  4R9L A;  4X2H A;  4HM7 B;  2GXF A;  3MG3 A;  5EVH A;  1OH0 A;  1DMN A;  3FKA A;  1U5O A;  4R9K A;  4OVM A;  2R4I A;  3JUQ A;  5AIF A;  5CF2 A;  3M8C A;  1OCV A;  3OX9 A;  2CKF B;  2XRX B;  1JN5 A;  3F7S A;  1S5A A;  3WMD A;  4XDV A;  1E3V A;  1JKG B;  3D9R A;  5AII A;  3CNM A;  3Q90 A;  5CF1 A;  5DRV A;  3B4P A;  3NBR A;  1Z1S A;  4HM2 B;  2CHC A;  3GWR A;  5CK6 A;  2XR8 B;  3EHC A;  3EN1 B;  2GBW B;  2K54 A;  2YFJ B;  3VSY A;  3NM2 A;  3E99 A;  2RCD A;  2GBX B;  4K1U A;  5IEP A;  2RGQ A;  3DM8 A;  3NXJ A;  1QJG A;  3GZX B;  1DMM A;  4L8P A;  3B8L A;  4LGQ A;  4OUQ A;  3VGN A;  1DMQ A;  3OWY A;  1JB5 A;  3GZR A;  3SED A;  1GY6 A;  1UUW B;  3GRD A;  5AI1 A;  3UJM A;  3STD A;  3EX9 A;  3EN8 A;  3RGR A;  1ZO2 A;  1K41 A;  2BNG A;  4HKV B;  1OPY A;  1OHO A;  1O7N B;  5HGR A;  3GZY B;  1O7W B;  3T8U A;  5KP3 A;  4HZB B;  5AIH A;  1C7H A;  3F7X A;  3GZB A;  5JPP A;  5AEW B;  2Z7A A;  2GEX A;  3ER7 A;  1ULJ B;  3G0K A;  1JN5 B;  3A76 A;  2I9W A;  3EF8 A;  1HKX A;  3HX8 A;  4WP5 A;  2B24 B;  4Q53 A;  3I0Y A;  4WWU C;  3MHE A;  3S5C A;  2BMO B;  1O7M B;  1JB2 A;  3EBT A;  1OUN A;  2Z77 A;  3K0Z A;  4U13 A;  3MG2 A;  4HM5 B;  3G16 A;  4HM1 B;  4WYK A;  5G2G A;  1CQS A;  3F14 A;  1WQL B;  1ASK A;  5D82 A;  5KP4 A;  1GS3 A;  4PEJ A;  4GB5 A;  1TUH A;  3LZA A;  3F8H A;  2HMO B;  1EG9 B;  3EJV A;  3NUV A;  1SJW A;  5KP1 A;  1EA2 A;  3B4O A;  1Q40 A;  4CDL A;  5IG0 A;  1AR0 A;  2F86 B;  5IF6 A;  3MG1 A;  3BB9 A;  4HZ9 B;  4K1V A;  4XBY A;  2F99 A;  5CXO A;  1BUQ A;  3JUP A;  4J9A A;  4LMI A;  4RZM A;  3ECF A;  5JPU A;  3FF2 A;  4HVN A;  2HMM B;  3NV0 B;  1QMA A;  3JUM A;  3JUO A;  1IDP A;  3DMC A;  4HM8 B;  2XSH B;  3G8Z A;  2OWP A;  5AEU B;  4HM6 B;  2Z76 A;  3BLZ A;  2RFR A; 
#chains in the Genus database with same CATH topology
 4FMA A;  1PYL A;  1R4Y A;  3K7C A;  1BRJ A;  3K5T A;  1O7G B;  5IER A;  4N6O B;  1TRQ A;  1EEJ A;  1NU3 A;  1OHS A;  1Q9E A;  4J5K A;  2ML5 A;  5DRE A;  1I2G A;  4HM3 B;  4FCJ A;  2OCT A;  4GHO A;  3LT9 A;  1A67 A;  1YJW 3;  1B27 A;  1E97 A;  3CPO A;  2P0X A;  3FGY A;  3OWU A;  1VQQ A;  1RCK A;  4LSO A;  1BOX A;  1MGR A;  2W56 B;  3OXA A;  3RGA A;  1KC8 4;  3OWS A;  2MC8 A;  2W2C A;  1A2K A;  4IPB A;  2W9P A;  3DGO A;  3KSP A;  4XBX A;  1VQK 3;  3I55 3;  2W9Q A;  3I56 3;  3LH4 A;  3DH2 A;  1GYB A;  1RGL A;  4LEH A;  1KD1 4;  1T5Y A;  1VZZ A;  2IUK A;  1W01 A;  1RRL A;  1MGW A;  2HMN B;  2KAA A;  1I3I A;  2GEY A;  2BHM A;  3X42 A;  1JJ2 2;  1RHL A;  4FMC A;  5M18 A;  1HYF A;  1GMP A;  5G1K A;  1BNF A;  8RNT A;  1RN1 A;  3GSP A;  3ROB A;  1E3R A;  1HZ1 A;  2JQ5 A;  3AGO A;  1W00 A;  6STD A;  1DVD A;  3ZFZ A;  2W04 A;  2CWU A;  1BRK A;  3PZW A;  1B2S A;  1IV9 A;  3CCQ 3;  3X3Z A;  2V1L A;  4FCM A;  1AY7 A;  5BXQ A;  1OHP A;  4HJL B;  2KF6 A;  1ROV A;  2RBI A;  1VQ7 3;  3IMA B;  2P0M A;  2AAE A;  4XB5 A;  1LRA A;  3CU3 A;  2FNQ A;  2HOH A;  4XM4 A;  5TGN A;  3SX1 A;  3CMA 3;  1FUW A;  1YGE A;  3DGN A;  1K73 4;  2CC3 A;  4K61 A;  1M90 4;  3AMO B;  1QVF 2;  2OTJ 3;  3JUN A;  4I5Q A;  5RNT A;  1VQ5 3;  1Y4K A;  1BAN A;  1PFP A;  7STD A;  3CCR 3;  1G96 A;  4MEI A;  4BTX A;  4GL6 A;  3WOF B;  1WMO A;  3HZP A;  3AHW A;  2CG1 A;  3UB1 A;  2ZHX B;  5IEO A;  2SBL A;  3G4S 3;  1OF5 A;  2Q07 A;  1NB5 I;  1D6U A;  1YIJ 3;  3O8Y A;  4L7K A;  1K28 A;  4KFE A;  1I3F A;  1RGE A;  1ZX2 A;  4WFO A;  1B21 A;  4N3V A;  3D3L A;  3UNL A;  3CCV 3;  4EV5 A;  2L4V A;  1SIH A;  3RDE A;  3F8X A;  4DKI A;  3SYU A;  5EEO A;  1RDS A;  1BNJ A;  2UX0 A;  2BMQ B;  2HML B;  2L1S A;  1IVX A;  1RCL A;  1UUV B;  1W4N A;  2BU4 A;  3HOH A;  5M19 A;  2IYJ A;  3SOY A;  1LNI A;  4N6L A;  5IW9 A;  3KCH A;  5CLK A;  5IG4 A;  2W6J H;  4X2O A;  1LNH A;  4FMD A;  1LVN A;  3HII A;  4HYZ A;  5AIG A;  4GSP A;  1RNT A;  3CCU 3;  3WA2 X;  5IEN A;  1VQ8 3;  1KSI A;  1UGI A;  1PU4 A;  1BIR A;  4STD A;  4XBT A;  1A2V A;  1GOU A;  1RLS A;  3IPT A;  3OV4 A;  2BMR B;  1JV2 B;  2C10 A;  3LXU X;  3KKG A;  1FGO A;  3MYT A;  3EBY A;  3KZT A;  3CCE 3;  3D5G A;  1GMQ A;  4FR9 A;  1W6G A;  3MKI A;  1X1X A;  1IQ8 A;  2HMK B;  4KFD A;  4O2H A;  3NX0 A;  2CH9 A;  4KZ1 A;  5D83 A;  3FF0 A;  2OTL 3;  1IVV A;  4OK0 A;  4R1K A;  3T8N A;  7GSP A;  2D42 A;  4H3U A;  3Q3F A;  1ROA A;  4MJD A;  3CCJ 3;  3FH1 A;  4TX4 A;  5D81 A;  4RNT A;  3J7Y d;  1DET A;  1TP6 A;  3H3H A;  2AAD A;  3HK4 A;  5GSP A;  3SOA A;  3LYG A;  1JNQ A;  4HAA A;  4J8T A;  4L8O A;  3T0U A;  1AV4 A;  1NB3 I;  1UCL A;  2YFI B;  4JRF A;  3EC9 A;  2YFL B;  1AQZ A;  2KRT A;  5STD A;  2Z6B A;  2CFD A;  3D4A A;  1BSA A;  4BL3 A;  1I2F A;  1NWW A;  2KF3 A;  2E2U A;  3CC2 3;  2CK3 H;  1YVS A;  1JB4 A;  1GY7 A;  3PYJ A;  1JKG A;  4HM4 B;  2STD A;  4WYK B;  5ELJ A;  1O7P B;  2GSP A;  5IG5 A;  3WR2 A;  3N54 B;  1BRN L;  3V92 A;  1TTO A;  3S29 A;  5LC6 A;  1V58 A;  1NJI 4;  3PGB A;  2CFW A;  3NHX A;  4I4K A;  1V57 A;  5I97 A;  3WOE B;  1NDO B;  2CWV A;  3SXX A;  1JRQ A;  4IT7 A;  8CHO A;  1RGH A;  1QAL A;  2FGT A;  3DZL A;  4KVH A;  3X3X A;  1N8R 4;  4HM0 B;  3B7C A;  2IY2 A;  1BU4 A;  3DUK A;  1BRS A;  2F98 A;  1YJ9 3;  3SLU A;  1OF5 B;  2QIY A;  3FLJ A;  3KE7 A;  3NBB A;  5JBS A;  2H0H A;  3EE1 A;  2H0I A;  4RNZ A;  3ZG5 A;  3KFQ C;  3FZW A;  1FA3 A;  1ULI B;  4HBR A;  1W02 A;  1Q86 4;  1GY5 A;  3U97 A;  1BNR A;  4R4K A;  1BUJ A;  3MSO A;  2D1W A;  1UCI A;  1X1W A;  4ILF A;  1B2M A;  4N6U A;  1STF I;  2H0G A;  5BVB A;  3BNB A;  1ZGX A;  3EQQ B;  3CME 3;  1W6C A;  1VQO 3;  4BU4 A;  1Q40 B;  3DXO A;  1BNG A;  5FGO A;  3FSD A;  2IMJ A;  3WHO A;  1OGZ A;  4NHF A;  5IG3 A;  2WO0 A;  3X3Y A;  3LT8 A;  4BTW A;  4MMY B;  1O7H B;  1UCK A;  1STD A;  4IIA A;  4ORL A;  2XEP A;  1M1K 4;  1Q42 A;  1ISK A;  1OGX A;  2QGU A;  3CCM 3;  5ELU A;  4N6M A;  2INX A;  3F40 A;  1LOV A;  5A0O B;  2O3O A;  2PZV A;  3NQY A;  5FW5 A;  4EV2 A;  2M7O A;  3NV0 A;  3F9S A;  2OQE A;  2XSO B;  2QEX 3;  4XDW A;  3V99 A;  2XF3 A;  2B1X B;  3LOY A;  1W6Y A;  1VQ9 3;  3QRD A;  9RNT A;  2HMJ B;  3H51 A;  1SAR A;  3CNX A;  2A15 A;  1FYS A;  3K63 A;  4R9L A;  1BSE A;  4X2H A;  2XGL A;  4HM7 B;  2GXF A;  1W7C A;  2IUJ A;  1QAK A;  4AEQ A;  4BIR A;  1G0T A;  1T2H A;  3MG3 A;  5EVH A;  1Q7Y 4;  1JBT A;  1UI8 A;  2ZDJ A;  3PCS A;  1OH0 A;  1DMN A;  1NO3 A;  5EQL A;  3FKA A;  1B3S A;  1U5O A;  4R9K A;  1LQG C;  3Q2P A;  4OVM A;  1RN7 A;  2R4I A;  2LQV A;  1YHQ 3;  3RNT A;  3U1W A;  2RSX A;  3FG4 A;  3JUQ A;  3N8B A;  5AIF A;  1B20 A;  1RSN A;  4N6T A;  3FG1 A;  1CYU A;  4J5G A;  3S28 A;  5CF2 A;  3FCS B;  4KT3 B;  2XH9 A;  2XGN A;  1TJD A;  3M8C A;  1OCV A;  2F5M A;  1TRP A;  3OX9 A;  4NRE A;  1Q7H A;  2CKF B;  3D79 A;  2XRX B;  4AKZ A;  2W03 A;  1JN5 A;  3F7S A;  1BRH A;  3BNE A;  3WA3 A;  5LC7 A;  1S5A A;  3WMD A;  4XDV A;  1E3V A;  1JKG B;  4EW5 A;  1DVC A;  4MMX B;  5BIR A;  2W56 A;  3D9R A;  5AII A;  3CC7 3;  4K90 B;  1BRG A;  3CNM A;  3Q90 A;  5CF1 A;  3G71 3;  1QAF A;  3HIG A;  5DRV A;  1TFK A;  2UGI A;  3B4P A;  3NBR A;  1IQY A;  1Z1S A;  3BND A;  1UCJ A;  1W2Z A;  3N9H A;  1X1Y A;  2KCD A;  3NM7 A;  2CHC A;  2P05 A;  3GWR A;  5CK6 A;  2XR8 B;  2SAR A;  3EHC A;  3EN1 B;  3OW2 2;  1RGF A;  3NQZ A;  2GBW B;  1U8C B;  1IVU A;  2K54 A;  2YFJ B;  3S27 A;  3VSY A;  4G1M B;  2P38 A;  3NM2 A;  3E99 A;  1MWS A;  2GBX B;  1ZS7 A;  2RCD A;  3NBJ A;  1UDI I;  1GMR A;  4K1U A;  5IEP A;  2RGQ A;  3L0R A;  3DM8 A;  3NXJ A;  1RTU A;  3X41 A;  1QJG A;  2ZA4 A;  4AKY A;  3GZX B;  1YGW A;  1DMM A;  1EUI C;  4L8P A;  2KF4 A;  1R4C A;  3B8L A;  4LGQ A;  4OUQ A;  1WTH A;  3VGN A;  1DMQ A;  1BNI A;  1NNV A;  1LOW A;  1JB5 A;  1N8Q A;  3OWY A;  1AVK A;  3CCL 3;  1BNE A;  1K8A 4;  1WNH A;  2QA4 3;  4MMZ B;  1RJO A;  2C4B A;  1I2E A;  2Y73 A;  3G6E 3;  3GZR A;  3SED A;  1GY6 A;  1UUW B;  4EYC A;  1B2U A;  1FGR A;  3GRD A;  5AI1 A;  2CFK A;  1IK3 A;  2MF7 A;  3UJM A;  2K0M A;  1LXE A;  1UI7 A;  1EQK A;  1VQN 3;  1LOY A;  1F8N A;  2O9U X;  3STD A;  3EX9 A;  1DYU A;  4O02 B;  1VQ4 3;  1N9E A;  4O8S A;  2BT3 A;  3EN8 A;  3CCS 3;  2WOF A;  4HOH A;  1JZD A;  1IU7 A;  2R41 A;  3JVC A;  3RGR A;  4O3V A;  4FCZ A;  2FXT A;  1ZO2 A;  1RGC A;  3A5E A;  2CWT A;  1MNL A;  3FG3 A;  1K41 A;  3HI7 A;  2BNG A;  2WOH A;  3KSE D;  4HKV B;  5M1A A;  5BU4 A;  3LTA A;  1OPY A;  1MWT A;  4N6N B;  6GSP A;  1C54 A;  5G1L A;  1OHO A;  1O7N B;  5HGR A;  2LYX A;  1CYV A;  1SQW A;  1D6Z A;  3GZY B;  1SPU A;  1VQ6 3;  2WGO A;  3SVA A;  1IVW A;  1FZU A;  1O7W B;  1FGT A;  1FGM A;  1RMS A;  2JDI H;  2W0Q A;  3DGY A;  4HZB B;  3DGM A;  5AIH A;  5KP3 A;  3WOD G;  4WHA A;  1C7H A;  3F7X A;  3KII A;  2CFL A;  2GU3 A;  2OOV A;  1SII A;  2KF5 A;  3GZB A;  1BAO A;  2F5W A;  1BNS A;  5JPP A;  1I0V A;  3K9M C;  1M1X B;  2F4Y A;  4EXR A;  2Z7A A;  4RBN A;  5AEW B;  2GEX A;  3ER7 A;  3IJE B;  1ULJ B;  4RNY A;  3G0K A;  1JN5 B;  1N9J A;  1RN4 A;  3A76 A;  3DGL A;  4CPK A;  2I9W A;  2F56 A;  2YX9 A;  4QWT A;  3EF8 A;  1UGH I;  2OOV C;  2IA7 A;  3URP A;  1FW7 A;  1HKX A;  5AYR B;  4EBG A;  3LTC A;  3HX8 A;  4WP5 A;  1YI2 3;  2B24 B;  3PCR A;  4Q53 A;  1VQL 3;  1TU5 A;  2E2V A;  3I0Y A;  1KWI A;  4WWU C;  1MWR A;  2C11 A;  3MHE A;  1W5Z A;  3S5C A;  2BMO B;  2CFG A;  7RNT A;  1X1U A;  1TFO A;  4H61 A;  1M9G A;  1I70 A;  1O7M B;  3WDG B;  1JB2 A;  2CIU A;  3EBT A;  1IQX A;  1LOX A;  1N5P A;  1OUN A;  1WMN A;  2KXG A;  2Z77 A;  3LTD A;  1KQS 2;  2K3D A;  1BSB A;  1V74 A;  3UL5 A;  1BSC A;  1GSP A;  3K0Z A;  4U13 A;  2OQE C;  4KFF A;  3MG2 A;  1T3B A;  3EB8 A;  2CX1 A;  1IV7 A;  2E2T A;  3ZG0 A;  1N5H A;  3G16 A;  4HM5 B;  1L5G B;  4HM1 B;  4WYK A;  1VQM 3;  1PY3 A;  5G2G A;  1I0X A;  1CQS A;  1K9M 4;  3F14 A;  1Q82 4;  1WQL B;  1ASK A;  3BU4 A;  4ZM8 A;  1GOY A;  5D82 A;  1RNB A;  5KP4 A;  1BGS A;  1GS3 A;  1GOV A;  1BRI A;  1YVB I;  4CCV A;  3Q1C A;  3S67 A;  4PEJ A;  1QVG 2;  1S72 3;  1J2B A;  1WMP A;  2CX0 A;  3X40 A;  1BVI A;  4JF8 A;  1B2X A;  1AVL A;  4LYL B;  3CXC 2;  2ZL8 A;  1FUS A;  4GB5 A;  1TUH A;  3MWZ A;  3LZA A;  3F8H A;  3PXM A;  1EKM A;  2HMO B;  4HM2 B;  1W2B 2;  1EG9 B;  3EJV A;  3NUV A;  2P09 A;  2RNT A;  1B2Z A;  5HOH A;  1BSD A;  1DE3 A;  1SJW A;  1OAC A;  3V98 A;  5KP1 A;  2XFT A;  1RGG A;  3CD6 3;  1EA2 A;  1YNV X;  3B4O A;  2J8X B;  1CH0 A;  1Q40 A;  3ALA A;  4CDL A;  5IG0 A;  5AYS C;  1MWU A;  6RNT A;  2ML6 A;  1AR0 A;  1JBR A;  3QK9 A;  2F86 B;  1UUG B;  5IF6 A;  1TIJ A;  1RKY A;  1IT7 A;  4BL2 A;  1A90 A;  3MG1 A;  1MOL A;  3VF1 A;  3LTB A;  4BTY A;  3BB9 A;  1IYY A;  1YIT 3;  4HZ9 B;  4K1V A;  4XBY A;  2F99 A;  1CEW I;  5CXO A;  1RGK A;  3AMO A;  1BUQ A;  1RGA A;  3UL6 A;  3JUP A;  4J9A A;  1IT8 A;  4LMI A;  4EC6 A;  1Q81 4;  4RZM A;  1G02 A;  1LQM B;  3ECF A;  4LZI A;  5JPU A;  1GD4 A;  3FF2 A;  3PS8 A;  1VQP 3;  4HVN A;  2HMM B;  3BIR A;  2PNC A;  1YJN 3;  1JZO A;  2BIR A;  2UUG C;  1GD3 A;  3D5I A;  3NV0 B;  3AHS A;  1QMA A;  3JUM A;  1T2I A;  3JUO A;  3DY5 A;  3TDG A;  1IDP A;  1A2P A;  4NPB A;  2BO9 B;  3DMC A;  3GAX A;  1RRH A;  1I8V A;  2WGQ A;  1UW1 A;  1JBS A;  2CG0 A;  3AGN A;  3T8U A;  4R80 A;  4HM8 B;  1D6Y A;  1US1 A;  2Y74 A;  3KN4 A;  3CPW 2;  2CW9 A;  2XSH B;  1HU9 A;  3BNC A;  3G8Z A;  3LML A;  4N6V 0;  4FMB A;  2OWP A;  5AEU B;  1FUT A;  3MPH A;  4HM6 B;  1FGQ A;  2GU1 A;  2XFS A;  4CJN A;  2Z76 A;  3BLZ A;  2RFR A;  3CC4 3; 
#chains in the Genus database with same CATH homology
 4FMA A;  3K7C A;  3K5T A;  1O7G B;  5IER A;  4N6O B;  1NU3 A;  1OHS A;  2ML5 A;  5DRE A;  4HM3 B;  4FCJ A;  2OCT A;  3LT9 A;  1A67 A;  1YJW 3;  3FGY A;  1E97 A;  3CPO A;  2P0X A;  3OWU A;  3CCE 3;  4LSO A;  2W56 B;  3OXA A;  3RGA A;  1KC8 4;  3OWS A;  2MC8 A;  2W2C A;  1A2K A;  4IPB A;  2W9P A;  3DGO A;  3KSP A;  4XBX A;  1VQK 3;  3I55 3;  2W9Q A;  3LH4 A;  1GYB A;  4LEH A;  1KD1 4;  1T5Y A;  1VZZ A;  2IUK A;  1W01 A;  1RRL A;  2HMN B;  2GEY A;  2BHM A;  3X42 A;  1JJ2 2;  4FMC A;  3ROB A;  1E3R A;  2JQ5 A;  6STD A;  1W00 A;  1DVD A;  2W04 A;  2CWU A;  3PZW A;  1IV9 A;  3CCQ 3;  3X3Z A;  2V1L A;  4FCM A;  5BXQ A;  1OHP A;  4HJL B;  1ROV A;  1VQ7 3;  3IMA B;  2P0M A;  4XB5 A;  4XM4 A;  3CU3 A;  2FNQ A;  5TGN A;  3SX1 A;  3CMA 3;  1FUW A;  1YGE A;  3DGN A;  1K73 4;  2CC3 A;  4K61 A;  1M90 4;  3AMO B;  1QVF 2;  2OTJ 3;  3JUN A;  1VQ5 3;  1Y4K A;  1PFP A;  7STD A;  3CCR 3;  1G96 A;  4MEI A;  4BTX A;  4GL6 A;  3WOF B;  1WMO A;  3HZP A;  2CG1 A;  3UB1 A;  5IEO A;  2SBL A;  3G4S 3;  1OF5 A;  2Q07 A;  1NB5 I;  1D6U A;  1YIJ 3;  3O8Y A;  4L7K A;  1K28 A;  4KFE A;  1ZX2 A;  4WFO A;  4N3V A;  3D3L A;  3UNL A;  3CCV 3;  4EV5 A;  2L4V A;  1SIH A;  3RDE A;  3F8X A;  5EEO A;  2UX0 A;  2BMQ B;  2HML B;  1IVX A;  1W4N A;  1UUV B;  3SOY A;  5IW9 A;  4N6L A;  5CLK A;  5IG4 A;  2W6J H;  4X2O A;  1LNH A;  4FMD A;  1LVN A;  3HII A;  4HYZ A;  5AIG A;  3CCU 3;  3WA2 X;  5IEN A;  1VQ8 3;  1KSI A;  1PU4 A;  4STD A;  4XBT A;  1A2V A;  3IPT A;  3OV4 A;  2BMR B;  1JV2 B;  2C10 A;  3LXU X;  3KKG A;  1FGO A;  3MYT A;  3EBY A;  3KZT A;  4FR9 A;  1W6G A;  3MKI A;  4KFD A;  1IQ8 A;  2HMK B;  4O2H A;  3NX0 A;  2CH9 A;  4KZ1 A;  5D83 A;  3FF0 A;  2OTL 3;  1IVV A;  4OK0 A;  4R1K A;  3T8N A;  2D42 A;  4H3U A;  1ROA A;  4MJD A;  3CCJ 3;  3FH1 A;  4TX4 A;  5D81 A;  3J7Y d;  1TP6 A;  3H3H A;  3HK4 A;  3SOA A;  3LYG A;  1JNQ A;  4J8T A;  4L8O A;  3T0U A;  1AV4 A;  1NB3 I;  2YFI B;  4JRF A;  3EC9 A;  2YFL B;  2KRT A;  5STD A;  2Z6B A;  2CFD A;  1NWW A;  2E2U A;  3CC2 3;  2CK3 H;  1JB4 A;  1GY7 A;  3PYJ A;  1JKG A;  4HM4 B;  2STD A;  4WYK B;  5ELJ A;  1O7P B;  5IG5 A;  3N54 B;  3V92 A;  3S29 A;  5LC6 A;  1NJI 4;  3PGB A;  2CFW A;  3NHX A;  4I4K A;  5I97 A;  3WOE B;  1NDO B;  2CWV A;  3SXX A;  1JRQ A;  4IT7 A;  8CHO A;  1QAL A;  2FGT A;  3DZL A;  4KVH A;  3X3X A;  1N8R 4;  4HM0 B;  3B7C A;  3DUK A;  1YJ9 3;  2F98 A;  3SLU A;  1OF5 B;  2QIY A;  3FLJ A;  3KE7 A;  3NBB A;  5JBS A;  3EE1 A;  4RNZ A;  3KFQ C;  3FZW A;  1FA3 A;  1ULI B;  4HBR A;  1W02 A;  1Q86 4;  1GY5 A;  3U97 A;  4R4K A;  3MSO A;  2D1W A;  4N6U A;  1STF I;  5BVB A;  3BNB A;  3EQQ B;  3CME 3;  1W6C A;  1VQO 3;  1Q40 B;  3DXO A;  5FGO A;  3FSD A;  2IMJ A;  1OGZ A;  4NHF A;  5IG3 A;  2WO0 A;  3X3Y A;  3LT8 A;  4BTW A;  4MMY B;  1O7H B;  1STD A;  4IIA A;  4ORL A;  2XEP A;  1M1K 4;  1Q42 A;  1ISK A;  1OGX A;  2QGU A;  3CCM 3;  5ELU A;  4N6M A;  2INX A;  3F40 A;  5A0O B;  2O3O A;  2PZV A;  3NQY A;  5FW5 A;  4EV2 A;  2M7O A;  3NV0 A;  3F9S A;  2OQE A;  2XSO B;  2QEX 3;  4XDW A;  3V99 A;  2XF3 A;  2B1X B;  3LOY A;  1W6Y A;  1VQ9 3;  3QRD A;  2HMJ B;  3H51 A;  3CNX A;  2A15 A;  3K63 A;  4R9L A;  4X2H A;  2XGL A;  4HM7 B;  2GXF A;  1W7C A;  2IUJ A;  1QAK A;  4AEQ A;  3MG3 A;  5EVH A;  1Q7Y 4;  1UI8 A;  2ZDJ A;  3PCS A;  1OH0 A;  1DMN A;  1NO3 A;  5EQL A;  3FKA A;  1U5O A;  4R9K A;  3Q2P A;  4OVM A;  1RN7 A;  2R4I A;  2LQV A;  1YHQ 3;  3U1W A;  2RSX A;  3FG4 A;  3JUQ A;  3N8B A;  5AIF A;  4N6T A;  3FG1 A;  1CYU A;  3S28 A;  5CF2 A;  3FCS B;  2XH9 A;  2XGN A;  3M8C A;  1OCV A;  4NRE A;  3OX9 A;  2CKF B;  4AKZ A;  2XRX B;  2W03 A;  1JN5 A;  3F7S A;  3BNE A;  3WA3 A;  5LC7 A;  1S5A A;  3WMD A;  4XDV A;  1E3V A;  1JKG B;  1DVC A;  4MMX B;  2W56 A;  3D9R A;  5AII A;  3CC7 3;  4K90 B;  3CNM A;  3Q90 A;  5CF1 A;  3G71 3;  1QAF A;  3HIG A;  5DRV A;  1TFK A;  3B4P A;  3NBR A;  3I56 3;  1IQY A;  1Z1S A;  3BND A;  1W2Z A;  3N9H A;  3NM7 A;  4HM2 B;  2KCD A;  2CHC A;  2P05 A;  3GWR A;  5CK6 A;  2XR8 B;  3EHC A;  3EN1 B;  3OW2 2;  3NQZ A;  2GBW B;  1U8C B;  1IVU A;  2K54 A;  2YFJ B;  3S27 A;  3VSY A;  4G1M B;  2P38 A;  3NM2 A;  3E99 A;  2RCD A;  2GBX B;  3NBJ A;  4K1U A;  5IEP A;  2RGQ A;  3L0R A;  3DM8 A;  3NXJ A;  3X41 A;  1QJG A;  4AKY A;  3GZX B;  1DMM A;  4L8P A;  3B8L A;  1R4C A;  4LGQ A;  4OUQ A;  1WTH A;  3VGN A;  1DMQ A;  3OWY A;  1JB5 A;  1N8Q A;  1AVK A;  3CCL 3;  1K8A 4;  1WNH A;  2QA4 3;  4MMZ B;  1RJO A;  2Y73 A;  3G6E 3;  3GZR A;  3SED A;  1GY6 A;  1UUW B;  4EYC A;  1FGR A;  3GRD A;  5AI1 A;  2CFK A;  1IK3 A;  2MF7 A;  3UJM A;  2K0M A;  1LXE A;  1UI7 A;  1EQK A;  1VQN 3;  1F8N A;  2O9U X;  3STD A;  3EX9 A;  1DYU A;  4O02 B;  1VQ4 3;  1N9E A;  4O8S A;  2BT3 A;  3EN8 A;  2WOF A;  1IU7 A;  3JVC A;  3RGR A;  4O3V A;  4FCZ A;  2FXT A;  1ZO2 A;  3FG3 A;  2CWT A;  1MNL A;  1K41 A;  3HI7 A;  2BNG A;  2WOH A;  3KSE D;  4HKV B;  3LTA A;  1OPY A;  4N6N B;  1OHO A;  1O7N B;  5HGR A;  2LYX A;  1CYV A;  1SQW A;  1D6Z A;  3GZY B;  1SPU A;  1VQ6 3;  2WGO A;  3SVA A;  1IVW A;  1O7W B;  1FGT A;  1FGM A;  2JDI H;  2W0Q A;  4HZB B;  5AIH A;  5KP3 A;  3DGM A;  3T8U A;  3WOD G;  3CCS 3;  4WHA A;  1C7H A;  3F7X A;  3KII A;  2CFL A;  2GU3 A;  2OOV A;  1SII A;  3GZB A;  5JPP A;  3K9M C;  1M1X B;  4EXR A;  2Z7A A;  4RBN A;  5AEW B;  2GEX A;  3ER7 A;  3IJE B;  1ULJ B;  4RNY A;  3G0K A;  1JN5 B;  1N9J A;  3A76 A;  3DGL A;  2I9W A;  2YX9 A;  4QWT A;  3EF8 A;  2OOV C;  2IA7 A;  1HKX A;  5AYR B;  4EBG A;  3LTC A;  3HX8 A;  4WP5 A;  1YI2 3;  2B24 B;  3PCR A;  4Q53 A;  1VQL 3;  1TU5 A;  2E2V A;  3I0Y A;  1KWI A;  4WWU C;  2C11 A;  3MHE A;  1W5Z A;  3S5C A;  2BMO B;  2CFG A;  1TFO A;  4H61 A;  1M9G A;  1O7M B;  3WDG B;  1JB2 A;  2CIU A;  3EBT A;  1IQX A;  1LOX A;  1N5P A;  1OUN A;  1WMN A;  2KXG A;  2Z77 A;  3LTD A;  1KQS 2;  1V74 A;  3UL5 A;  3K0Z A;  4U13 A;  2OQE C;  4KFF A;  3MG2 A;  3EB8 A;  1IV7 A;  2E2T A;  1N5H A;  3G16 A;  4HM5 B;  1L5G B;  4HM1 B;  4WYK A;  1VQM 3;  5G2G A;  1CQS A;  1K9M 4;  3F14 A;  1Q82 4;  1WQL B;  1ASK A;  4ZM8 A;  5D82 A;  5KP4 A;  1GS3 A;  4CCV A;  1YVB I;  3Q1C A;  3S67 A;  4PEJ A;  1QVG 2;  1S72 3;  1J2B A;  1WMP A;  3X40 A;  4JF8 A;  1AVL A;  3CXC 2;  2ZL8 A;  4GB5 A;  1TUH A;  3MWZ A;  3LZA A;  3F8H A;  3PXM A;  1EKM A;  2HMO B;  1W2B 2;  1EG9 B;  3EJV A;  3NUV A;  2P09 A;  1SJW A;  1OAC A;  3V98 A;  5KP1 A;  2XFT A;  3CD6 3;  1EA2 A;  3B4O A;  1Q40 A;  3ALA A;  4CDL A;  5IG0 A;  5AYS C;  2ML6 A;  1AR0 A;  3QK9 A;  2F86 B;  5IF6 A;  1RKY A;  1TIJ A;  1IT7 A;  1A90 A;  3MG1 A;  1MOL A;  3VF1 A;  3LTB A;  4BTY A;  3BB9 A;  1YIT 3;  4HZ9 B;  4K1V A;  4XBY A;  2F99 A;  1CEW I;  5CXO A;  3AMO A;  1BUQ A;  3UL6 A;  3JUP A;  4J9A A;  1IT8 A;  4LMI A;  4EC6 A;  1Q81 4;  4RZM A;  3ECF A;  4LZI A;  5JPU A;  1GD4 A;  3FF2 A;  3PS8 A;  1VQP 3;  4HVN A;  2HMM B;  2PNC A;  1YJN 3;  1GD3 A;  3NV0 B;  1QMA A;  3JUM A;  3JUO A;  3DY5 A;  3TDG A;  1IDP A;  2BO9 B;  3DMC A;  3GAX A;  1RRH A;  2WGQ A;  1UW1 A;  2CG0 A;  4R80 A;  4HM8 B;  1D6Y A;  1US1 A;  2Y74 A;  3KN4 A;  3CPW 2;  2CW9 A;  2XSH B;  1HU9 A;  3BNC A;  3G8Z A;  3LML A;  4N6V 0;  4FMB A;  2OWP A;  5AEU B;  3MPH A;  4HM6 B;  1FGQ A;  2GU1 A;  2XFS A;  2Z76 A;  3BLZ A;  2RFR A;  3CC4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...