3B8LA

Crystal structure of a putative aromatic ring hydroxylase (saro_3538) from novosphingobium aromaticivorans dsm at 1.75 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
FQGMQCPIEDRLAIQDLMIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANMSHHAHYLTNFAVTGYEGDTASMRAYVIGMGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTMDFLMPLSGTLDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_001165924.1) from Novosphingobium aromaticivorans DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Oxidoreductase
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b8lA01
4LMIA 2RCDA 1ASKA 4HM5B 2OWPA 5G2GA 3FSDA 2XSOB 5IENA 1WQLB 3K7CA 3ER7A 1GY6A 4WP5A 4XBTA 5CF2A 4Q53A 3F14A 1NDOB 1STDA 3F8HA 3FKAA 2BMOB 1DMNA 5AIHA 4J8TA 3EHCA 2B24B 1E3VA 2HMLB 3CNXA 3LZAA 2K54A 3LYGA 4HM1B 2Z7AA 3IPTA 4GB5A 1IDPA 1JN5A 3NV0B 4IIAA 1Z1SA 2BMRB 3NUVA 3OWSA 5D81A 3GZRA 1OHOA 2B1XB 2RGQA 2CHCA 4HM0B 3DXOA 1Q40A 3K0ZA 2Z76A 3WMDA 4L8OA 3G8ZA 3UJMA 3GRDA 4OUQA 1O7NB 3HZPA 1O7GB 3KSPA 4STDA 5TGNA 5BVBA 4H3UA 3OWUA 3RGAA 3B4PA 4HZ9B 3B4OA 3OWYA 5FW5A 2BMQB 1NWWA 1A2KA 3KZTA 3Q90A 3CPOA 2PZVA 5CXOA 7STDA 3BB9A 1CQSA 3KE7A 1ULJB 4XM4A 4MJDA 4R9KA 1EA2A 4HM6B 5D82A 5BXQA 4CDLA 4U13A 4XBXA 1AR0A 1OUNA 1VZZA 2F98A 3HX8A 4HM2B 2RFRA 3JUNA 3EF8A 8CHOA 2HMMB 3GZYB 5CLKA 4LGQA 1TP6A 3EX9A 5KP3A 5IEPA 4HKVB 3MYTA 3VGNA 3T8UA 3B7CA 1Q42A 3DM8A 4RZMA 4ORLA 1ULIB 1OF5A 4L7KA 4WYKB 1GY5A 2GEXA 1W01A 5CF1A 2BNGA 3JUMA 3EN1B 3STDA 3FF0A 3NM2A 3NHXA 5STDA 2YFLB 3DMCA 2XSHB 2A15A 2IMJA 3SOAA 2F99A 4LEHA 3G16A 2INXA 5HGRA 3MSOA 5JPPA 2HMOB 1K41A 2UX0A 3GZBA 3CU3A 5JPUA 1OGZA 4K1VA 1O7PB 3MHEA 3FH1A 3OXAA 4KVHA 2HMNB 3GZXB 5AEWB 3VSYA 4PEJA 4HJLB 1ZX2A 4XDWA 3OX9A 1E3RA 3RGRA 4N3VA 5AI1A 4R9LA 4X2HA 2GEYA 4X2OA 3NV0A 1JB4A 4XBYA 3MKIA 3F7SA 1JKGA 3HK4A 1TUHA 1EG9B 3B8LA 3F40A 1E97A 3GWRA 2XR8B 3EC9A 1JN5B 2YFIB 3A76A 1DMQA 3SOYA 5AIIA 1OHSA 4HVNA 3EJVA 3EN8A 4WWUC 1OH0A 3FZWA 1Q40B 1S5AA 3I0YA 1O7WB 4FCMA 3F7XA 3JUOA 4HM4B 4OVMA 1OGXA 1ISKA 3H3HA 3MG1A 5IF6A 1QMAA 3FLJA 4J9AA 3FF2A 3CNMA 1O7HB 3NBRA 4HM3B 2CKFB 5CK6A 2R4IA 1W6YA 3ROBA 1ZO2A 3NXJA 3G0KA 2Z77A 5DRVA 3KKGA 4K1UA 1C7HA 3OV4A 1W00A 2HMJB 1JB2A 1JKGB 3H51A 3F9SA 3DZLA 5IEOA 5IG3A 1UUVB 5KP1A 3D9RA 5DREA 5AEUB 3ECFA 5AIFA 5AIGA 2GBWB 1BUQA 1GYBA 1W02A 1OHPA 5IG5A 3M8CA 4XB5A 2XRXB 1SJWA 3SEDA 3T8NA 4I4KA 2GXFA 1GY7A 3MG2A 5KP4A 3JUPA 3E99A 4HZBB 1U5OA 5IERA 3EBYA 4WYKA 2F86B 3UNLA 5EVHA 2W2CA 1QJGA 3DUKA 2STDA 2YFJB 2QGUA 1OCVA 4L8PA 5D83A 2HMKB 1NU3A 1OF5B 1GS3A 1DMMA 1O7MB 3BLZA 1HKXA 5IG4A 2GBXB 2QIYA 4XDVA 1OPYA 2I9WA 5IG0A 3FGYA 1UUWB 4HM7B 3S5CA 3F8XA 3JUQA 4R1KA 4HM8B 1JB5A 3EBTA 3EQQB 6STDA 4FCJA 3MG3A 2JQ5A
chains in the Genus database with same CATH superfamily
1VQ53 4LMIA 1AVKA 2RCDA 1CEWI 1GOUA 1ASKA 3IMAB 1U8CB 2OWPA 4HM5B 5G2GA 3FSDA 1UI8A 3G4S3 2IYJA 2XSOB 5IENA 1WQLB 2CG0A 2KF4A 2OOVC 2LQVA 3NBBA 3K7CA 1BOXA 1LVNA 2C11A 1YVBI 2WO0A 4N6OB 1VQN3 1RGAA 1QALA 3NQYA 3ER7A 4GHOA 1GY6A 3LXUX 3PS8A 3D4AA 3FG4A 4KFFA 4WP5A 2W0QA 3UL5A 1EKMA 1LOWA 4HYZA 4XBTA 1ZS7A 1UW1A 5CF2A 4Q53A 3F14A 1FUWA 5IW9A 1NDOB 4N6V0 3WODG 1B2SA 5RNTA 1STDA 3F8HA 2F4YA 3FKAA 2BMOB 4J5KA 2L4VA 1FZUA 1A2PA 2P09A 2C4BA 1DMNA 1TFKA 5AIHA 1RNBA 4J8TA 1V74A 1TIJA 4WHAA 3EHCA 2B24B 3CCL3 1E3VA 2IUKA 2HMLB 3CNXA 4NPBA 3LZAA 1YIJ3 3CCV3 2K54A 1I3IA 1I2FA 4O3VA 1IQ8A 3LYGA 1US1A 2Z7AA 4HM1B 3IPTA 1SARA 4N6TA 3AGOA 4GB5A 1IDPA 4EV5A 1RTUA 1JN5A 4LSOA 3NV0B 1B2XA 2KF6A 1FUTA 1GOVA 4IIAA 5FGOA 3ZFZA 2GU1A 1IVWA 5ELJA 1VQM3 3X40A 1JBTA 1Z1SA 3SX1A 2BMRB 3N8BA 2BHMA 3NUVA 2IA7A 3OWSA 5D81A 3WHOA 3CCS3 3GZRA 1BNRA 1I2EA 1RGLA 2CK3H 1YHQ3 1K8A4 1OHOA 1N8QA 3OW22 2B1XB 2LYXA 2RBIA 2RGQA 2CHCA 4EXRA 2XF3A 4HM0B 3DXOA 1Q40A 1FGOA 3LTBA 3K0ZA 3K9MC 1UCJA 4KT3B 2P0MA 2Z76A 1I70A 4MMXB 3WMDA 1V57A 1KQS2 3BIRA 4ZM8A 2D42A 4QWTA 4L8OA 3UB1A 4N6NB 1N5PA 1PFPA 3WR2A 2E2UA 1B3SA 3D3LA 4FCZA 1X1UA 3G8ZA 3UJMA 2CX0A 1M1K4 1VQ63 1A2VA 3GRDA 4OUQA 1HZ1A 2QA43 3CCM3 1KD14 3GAXA 1LOXA 1O7NB 3HZPA 3LOYA 4HBRA 1YGEA 4G1MB 3WOEB 3CME3 1O7GB 2ZDJA 3KSPA 1UI7A 4FMAA 4STDA 2OCTA 1QVG2 2MF7A 5TGNA 4RNTA 3O8YA 4H3UA 1FGTA 5BVBA 1GMRA 1RN1A 5M1AA 3OWUA 1G02A 1BNEA 3JVCA 3KSED 1FUSA 3B4PA 3RGAA 3BNDA 4HZ9B 1D6UA 1UGHI 3B4OA 1B2MA 1B2ZA 1I8VA 1YGWA 1G0TA 2KF3A 2ML5A 3OWYA 5FW5A 2BMQB 4RNZA 1BVIA 1NWWA 2Y73A 1N8R4 1W5ZA 3SXXA 4KZ1A 1PYLA 1A2KA 3KZTA 2AAEA 1N9JA 3RNTA 3URPA 1BRHA 2ZHXB 2F5MA 2H0GA 3MPHA 3Q90A 3LTDA 4KFDA 1NJI4 3CPOA 3X3XA 2PZVA 5I97A 5CXOA 4AKZA 7STDA 3KFQC 1JBSA 2RNTA 3BB9A 4NHFA 2V1LA 1CQSA 4BU4A 2IY2A 1PY3A 3KE7A 1ULJB 2L1SA 3IJEB 1G96A 1I3FA 4XM4A 1S723 5HOHA 4MJDA 2CFDA 4R9KA 1EA2A 1AQZA 3AMOA 4BTXA 4LZIA 1MWUA 1FW7A 3PXMA 4BTWA 4HAAA 1MOLA 2CFGA 4HM6B 5D82A 3PGBA 5BXQA 4CDLA 3FCSB 1RN7A 2E2VA 1AY7A 3AHSA 4U13A 1CH0A 2UGIA 4MMYB 1NO3A 3T0UA 4XBXA 3WOFB 1TRQA 1AR0A 1OUNA 1JV2B 1VZZA 1BNGA 3LT9A 1BRSA 2F98A 2F56A 3HX8A 1OACA 1V58A 1I0XA 3Q2PA 7GSPA 2W9QA 4HM2B 4BIRA 2OTL3 2KXGA 2P38A 2RFRA 3KCHA 1D6ZA 2O9UX 3JUNA 3V99A 3EF8A 2ML6A 4EBGA 1KWIA 2YX9A 1N9EA 8CHOA 4EW5A 2HMMB 1RSNA 3GZYB 5CLKA 1A90A 4LGQA 1JJ22 1ROVA 3X42A 1Y4KA 2GU3A 3EB8A 1TP6A 3J7Yd 3EX9A 4BL2A 5KP3A 3DY5A 5IEPA 4HKVB 3U97A 3MYTA 3VF1A 4EYCA 3VGNA 1BRIA 4N6LA 3T8UA 3CD63 3B7CA 1Q42A 1CYVA 3DM8A 1BRJA 4FR9A 1SIIA 2KAAA 1NB5I 4RZMA 1W2ZA 1W6GA 1Q7Y4 4ORLA 1ULIB 1YI23 4AEQA 5LC6A 1EEJA 1RNTA 1OF5A 2HOHA 2BT3A 4L7KA 4WYKB 1GY5A 2E2TA 4FMBA 2GEXA 1W01A 1RGEA 1WNHA 1FGRA 1MWSA 2SARA 5CF1A 2BNGA 3LT8A 4MMZB 4K90B 3CCU3 3JUMA 9RNTA 1RRLA 3N9HA 1IQYA 1W6CA 3AHWA 1K9M4 1BIRA 3LMLA 5AYRB 3EN1B 1TU5A 3STDA 3FF0A 1FA3A 3NM2A 3G713 3CCJ3 3NM7A 3NHXA 1BNFA 2C10A 1LRAA 5STDA 2YFLB 3DMCA 1K734 2XSHB 2A15A 2XGLA 5BIRA 1TRPA 2IMJA 2XFTA 3SOAA 1BNIA 1JRQA 5M18A 2F99A 3Q3FA 4LEHA 3G16A 2INXA 1RMSA 4GL6A 1UCLA 2CX1A 1TFOA 2K0MA 3PCSA 3DH2A 1MNLA 4JF8A 3MSOA 5HGRA 5JPPA 4WFOA 4CPKA 2HMOB 3LTCA 1K41A 2UX0A 1SIHA 3KIIA 2WOHA 3MWZA 4HOHA 3BNCA 3GZBA 1RGKA 1JZOA 4OK0A 1VQP3 1X1YA 1UDII 2CW9A 3CU3A 3S27A 1F8NA 3WA3A 1BRGA 5JPUA 1OGZA 4K1VA 1VQL3 2PNCA 1DE3A 2W56B 3CC73 1O7PB 2XFSA 4ILFA 3X3ZA 1YVSA 3MHEA 4R80A 3S28A 3D79A 5EEOA 1BUJA 3FH1A 3OXAA 5G1LA 4KVHA 2HMNB 3GZXB 3BNEA 2F5WA 2W6JH 5AEWB 4JRFA 3ZG5A 1BANA 2GSPA 1Q864 3VSYA 1RGHA 2BO9B 3HIGA 4PEJA 3NX0A 4HJLB 4RBNA 1VQO3 2JDIH 1ZX2A 4I5QA 4XDWA 1TJDA 1IVUA 1B21A 1L5GB 2H0HA 1MWTA 3FG3A 3OX9A 5GSPA 1RRHA 1E3RA 3ZG0A 3RGRA 4N3VA 5AI1A 3AGNA 1IT7A 4DKIA 4R9LA 3UL6A 2OQEA 4X2HA 1LOVA 2GEYA 1Q814 4X2OA 1FGMA 1T2HA 1JB4A 3NV0A 4O8SA 1BAOA 4O2HA 4XBYA 1LOYA 3Q1CA 3DGNA 3MKIA 1R4YA 2SBLA 3F7SA 1JKGA 1EUIC 4J5GA 1VQ43 2P0XA 5A0OB 3HK4A 1TUHA 1EG9B 1A67A 3B8LA 3F40A 1I2GA 3U1WA 4FMDA 1E97A 3GWRA 1T2IA 2CIUA 2XR8B 3EC9A 3LTAA 1JN5B 2KF5A 2YFIB 3EE1A 1IV9A 3A76A 3S67A 1DMQA 1LQMB 1C54A 3SOYA 4MEIA 1WMNA 5AIIA 1JNQA 1GD3A 1BRKA 1RCLA 3HOHA 1OHSA 4NREA 1KC84 3KN4A 4HVNA 1YJW3 3EJVA 1BRNL 5M19A 2CC3A 3PZWA 3CPW2 2OTJ3 1IT8A 1IK3A 3EN8A 4WWUC 3X3YA 1GSPA 1OH0A 2BU4A 1RN4A 3N54B 1FYSA 1WTHA 3FZWA 1Q40B 3I553 2CWUA 1NNVA 1S5AA 3I0YA 1RDSA 1O7WB 4FCMA 1VQQA 3SLUA 5JBSA 1VQ73 1BSBA 3F7XA 3HI7A 5AYSC 3JUOA 4HM4B 2CG1A 1IV7A 1CYUA 1RJOA 4OVMA 4AKYA 1OGXA 1DVCA 1JBRA 1R4CA 1ISKA 4LYLB 6GSPA 2AADA 3BNBA 2ZL8A 1FGQA 2W9PA 1DETA 3H3HA 3MG1A 5IF6A 1QMAA 1IVVA 2CH9A 1VQ83 3V98A 1AV4A 3G6E3 2K3DA 3CXC2 1GOYA 2FNQA 1ZGXA 1HU9A 3L0RA 2CWVA 1TTOA 3CCE3 2FGTA 1QAFA 1B20A 1W7CA 1LNIA 3CCQ3 1RHLA 3CC23 3FLJA 4R4KA 2CFKA 4J9AA 2WGOA 3FF2A 2Q07A 3CNMA 3LH4A 1O7HB 3D5GA 1PU4A 3QK9A 3CMA3 3NBRA 1K28A 2KRTA 1AVLA 4HM3B 2CKFB 1B2UA 1JZDA 1MWRA 3NQZA 2R4IA 5CK6A 4BL3A 3QRDA 1BSDA 2QEX3 1J2BA 1W6YA 2WGQA 1UCKA 1IQXA 2UUGC 1LNHA 5ELUA 8RNTA 3ROBA 1ZO2A 4IT7A 1BGSA 2M7OA 2OOVA 3NXJA 3X41A 3G0KA 4BTYA 1MGWA 2XGNA 1RLSA 1HYFA 3SYUA 3A5EA 3GSPA 2CFWA 1ROAA 3NBJA 2Z77A 5DRVA 1SQWA 3KKGA 2R41A 4K1UA 1C7HA 1T5YA 3OV4A 1UGIA 1W00A 2HMJB 1JB2A 3AMOB 3PCRA 1Q7HA 1WMOA 1JKGB 4TX4A 3H51A 3F9SA 3WA2X 3DZLA 4N6UA 1B27A 1BNSA 5IEOA 5IG3A 1UUVB 1W4NA 1YJ93 5KP1A 2OQEC 1BSEA 1KSIA 3D9RA 1LQGC 1VQK3 1NB3I 3D5IA 5DREA 5AEUB 3ALAA 3ECFA 1M904 2D1WA 5AIFA 5AIGA 1X1WA 1LXEA 4EC6A 6RNTA 2Z6BA 1IYYA 2GBWB 1BUQA 2CFLA 3DGLA 3K63A 2O3OA 4K61A 1GYBA 1RCKA 1W02A 1OHPA 5IG5A 1VQ93 3M8CA 3PYJA 3K5TA 4XB5A 2XRXB 1Q9EA 1DVDA 4O02B 1SJWA 3SEDA 3T8NA 5G1KA 2W04A 4I4KA 4FMCA 1YJN3 5LC7A 2GXFA 1GY7A 3DGYA 4CCVA 3MG2A 5KP4A 3JUPA 3E99A 5BU4A 7RNTA 4HZBB 4H61A 1X1XA 2FXTA 1U5OA 2CWTA 5IERA 1M9GA 1EQKA 3EBYA 4WYKA 2F86B 3UNLA 2KCDA 1N5HA 5EVHA 3WDGB 2H0IA 2W2CA 1BNJA 1M1XB 1QJGA 3V92A 3DUKA 2J8XB 4RNYA 1IU7A 2STDA 3TDGA 2YFJB 2QGUA 2ZA4A 1OCVA 4L8PA 5D83A 1Q824 3I563 2HMKB 1UUGB 1NU3A 1OF5B 1RGCA 1GS3A 1MGRA 2WOFA 1I0VA 3CCR3 1BU4A 1QVF2 1DYUA 1DMMA 1O7MB 1YIT3 2RSXA 1RKYA 1YNVX 2Y74A 2P05A 3BU4A 3BLZA 1HKXA 4IPBA 5IG4A 2GBXB 2MC8A 2XEPA 1WMPA 1D6YA 2QIYA 4XDVA 1OPYA 1SPUA 5EQLA 4CJNA 2I9WA 3FG1A 4KFEA 1GMPA 3DGOA 5IG0A 3FGYA 1UUWB 2IUJA 1RGFA 1BSAA 4HM7B 3S5CA 1BSCA 3F8XA 1T3BA 3CC43 3JUQA 1GD4A 1STFI 2BIRA 4GSPA 4HM8B 4R1KA 1JB5A 3EBTA 3S29A 3DGMA 3EQQB 6STDA 1IVXA 1UCIA 4N6MA 1QAKA 2XH9A 1GMQA 4FCJA 3HIIA 3MG3A 1RGGA 2W03A 2W56A 2JQ5A 3SVAA 1W2B2 3RDEA 4EV2A
chains in the Genus database with same CATH topology
1VQ53 4LMIA 1AVKA 2RCDA 1CEWI 3IMAB 1ASKA 4HM5B 1U8CB 2OWPA 3G4S3 5G2GA 3FSDA 1UI8A 2XSOB 5IENA 1WQLB 2CG0A 2OOVC 2LQVA 3NBBA 3K7CA 1LVNA 2C11A 1YVBI 2WO0A 4N6OB 1VQN3 1QALA 3NQYA 3ER7A 1GY6A 3LXUX 3PS8A 3FG4A 4KFFA 4WP5A 2W0QA 3UL5A 1EKMA 4HYZA 4XBTA 1UW1A 5CF2A 4Q53A 3F14A 1FUWA 5IW9A 1NDOB 4N6V0 3WODG 1STDA 3F8HA 3FKAA 2BMOB 2L4VA 2P09A 1DMNA 1TFKA 5AIHA 4J8TA 1V74A 1TIJA 4WHAA 3EHCA 2B24B 3CCL3 1E3VA 2IUKA 2HMLB 3CNXA 3LZAA 1YIJ3 3CCV3 2K54A 4O3VA 1IQ8A 3LYGA 1US1A 2Z7AA 4HM1B 3IPTA 4N6TA 4GB5A 1IDPA 4EV5A 1JN5A 4LSOA 3NV0B 4IIAA 1VQM3 5FGOA 2GU1A 1IVWA 5ELJA 3X40A 1Z1SA 3SX1A 2BMRB 3N8BA 2BHMA 3NUVA 2IA7A 3OWSA 5D81A 3CCS3 3GZRA 2CK3H 1K8A4 1YHQ3 1OHOA 1N8QA 3OW22 2B1XB 2LYXA 2RGQA 2CHCA 4EXRA 2XF3A 4HM0B 3DXOA 1Q40A 1FGOA 3LTBA 3K0ZA 3K9MC 2P0MA 2Z76A 4MMXB 3WMDA 1KQS2 4ZM8A 2D42A 4QWTA 4L8OA 3UB1A 4N6NB 1N5PA 1PFPA 2E2UA 4FCZA 3D3LA 1M1K4 3G8ZA 3UJMA 1VQ63 1A2VA 3GRDA 4OUQA 2QA43 3CCM3 1KD14 3GAXA 1LOXA 1O7NB 3HZPA 3LOYA 4HBRA 1YGEA 4G1MB 3WOEB 3CME3 1O7GB 2ZDJA 3KSPA 1UI7A 4FMAA 4STDA 2OCTA 1QVG2 2MF7A 5TGNA 5BVBA 3O8YA 4H3UA 1FGTA 3OWUA 3JVCA 3KSED 3RGAA 3B4PA 3BNDA 4HZ9B 3B4OA 1D6UA 2ML5A 3OWYA 5FW5A 2BMQB 4RNZA 1NWWA 2Y73A 1N8R4 1W5ZA 3SXXA 4KZ1A 1A2KA 3KZTA 1N9JA 3Q90A 3MPHA 1NJI4 3LTDA 4KFDA 3CPOA 3X3XA 2PZVA 5I97A 5CXOA 4AKZA 7STDA 3KFQC 3BB9A 4NHFA 2V1LA 1CQSA 3KE7A 1ULJB 3IJEB 1G96A 4XM4A 1S723 4MJDA 2CFDA 4R9KA 1EA2A 3AMOA 4BTXA 4LZIA 3PXMA 4BTWA 1MOLA 2CFGA 4HM6B 5D82A 3PGBA 5BXQA 4CDLA 3FCSB 1RN7A 2E2VA 4U13A 4MMYB 1NO3A 3T0UA 4XBXA 3WOFB 1AR0A 1OUNA 1JV2B 1VZZA 3LT9A 2F98A 3HX8A 3Q2PA 1OACA 2W9QA 4HM2B 2OTL3 2KXGA 2P38A 2RFRA 1D6ZA 2O9UX 3JUNA 3V99A 3EF8A 2ML6A 4EBGA 1KWIA 2YX9A 1N9EA 8CHOA 2HMMB 3GZYB 5CLKA 1A90A 4LGQA 1JJ22 1ROVA 3X42A 1Y4KA 2GU3A 3EB8A 1TP6A 3J7Yd 3EX9A 5KP3A 3DY5A 5IEPA 4HKVB 3U97A 3MYTA 3VF1A 4EYCA 3VGNA 3T8UA 4N6LA 3CD63 3B7CA 1Q42A 1CYVA 3DM8A 4FR9A 1SIIA 1NB5I 4RZMA 1W2ZA 1W6GA 1Q7Y4 4ORLA 1ULIB 1YI23 4AEQA 5LC6A 1OF5A 2BT3A 4L7KA 4WYKB 1GY5A 2E2TA 4FMBA 2GEXA 1W01A 1WNHA 1FGRA 5CF1A 2BNGA 3LT8A 4MMZB 4K90B 3CCU3 3JUMA 1RRLA 3N9HA 1IQYA 1W6CA 1K9M4 3LMLA 5AYRB 3EN1B 1TU5A 3STDA 3FF0A 1FA3A 3NM2A 3G713 3CCJ3 3NM7A 3NHXA 2C10A 5STDA 2YFLB 3DMCA 1K734 2XSHB 2A15A 2XGLA 2IMJA 2XFTA 3SOAA 1JRQA 2F99A 4LEHA 3G16A 2INXA 4GL6A 3PCSA 1TFOA 2K0MA 4JF8A 5HGRA 1MNLA 1VQO3 3MSOA 5JPPA 4WFOA 2HMOB 3LTCA 1K41A 2UX0A 1SIHA 3KIIA 2WOHA 3MWZA 3BNCA 3GZBA 4OK0A 1VQP3 3CU3A 2CW9A 3S27A 3WA3A 1F8NA 5JPUA 1OGZA 4K1VA 1VQL3 2PNCA 2W56B 3CC73 1O7PB 2XFSA 3X3ZA 3MHEA 4R80A 3S28A 5EEOA 3FH1A 3OXAA 4KVHA 2HMNB 3GZXB 3BNEA 2W6JH 5AEWB 4JRFA 3VSYA 2BO9B 3HIGA 4PEJA 3NX0A 4HJLB 4RBNA 2JDIH 1ZX2A 4XDWA 1L5GB 1IVUA 3FG3A 3OX9A 1RRHA 1E3RA 3RGRA 4N3VA 5AI1A 1IT7A 4R9LA 3UL6A 2OQEA 4X2HA 2GEYA 1Q814 4X2OA 1FGMA 3NV0A 1JB4A 4O8SA 4XBYA 4O2HA 3Q1CA 3DGNA 3MKIA 2SBLA 3F7SA 1JKGA 1VQ43 2P0XA 5A0OB 3HK4A 1TUHA 1EG9B 1A67A 3B8LA 3F40A 3U1WA 4FMDA 1E97A 3GWRA 2CIUA 2XR8B 3EC9A 3LTAA 1JN5B 2YFIB 3EE1A 1IV9A 3A76A 3S67A 1DMQA 3SOYA 4MEIA 1WMNA 5AIIA 1JNQA 1GD3A 4NREA 1KC84 1OHSA 3KN4A 4HVNA 1YJW3 3EJVA 2CC3A 3PZWA 3CPW2 2OTJ3 1IT8A 1IK3A 3EN8A 4WWUC 3X3YA 1OH0A 3N54B 1WTHA 3FZWA 1Q40B 3I553 2CWUA 1S5AA 3I0YA 3SLUA 1O7WB 4FCMA 5JBSA 1VQ73 3F7XA 3HI7A 5AYSC 3JUOA 4HM4B 2CG1A 1IV7A 1CYUA 1RJOA 4OVMA 4AKYA 1OGXA 1DVCA 1R4CA 1ISKA 3BNBA 2ZL8A 1FGQA 2W9PA 3H3HA 3MG1A 5IF6A 1QMAA 1IVVA 2CH9A 1VQ83 3V98A 1AV4A 3G6E3 3CXC2 2FNQA 1HU9A 3L0RA 2CWVA 3CCE3 2FGTA 1QAFA 1W7CA 3CCQ3 3CC23 3FLJA 4R4KA 2CFKA 4J9AA 2WGOA 3FF2A 2Q07A 3CNMA 3LH4A 1O7HB 1PU4A 3QK9A 3CMA3 3NBRA 2KRTA 1K28A 1AVLA 4HM3B 2CKFB 5CK6A 2QEX3 3NQZA 2R4IA 1J2BA 3QRDA 1W6YA 2WGQA 1IQXA 1LNHA 5ELUA 3ROBA 1ZO2A 4IT7A 2M7OA 2OOVA 3NXJA 3X41A 3G0KA 4BTYA 2XGNA 2CFWA 1ROAA 3NBJA 2Z77A 5DRVA 1SQWA 3KKGA 4K1UA 1C7HA 1T5YA 3OV4A 1W00A 2HMJB 1JB2A 3AMOB 3PCRA 1WMOA 1JKGB 4TX4A 3H51A 3F9SA 3WA2X 3DZLA 4N6UA 5IEOA 5IG3A 1UUVB 1W4NA 1YJ93 5KP1A 2OQEC 1KSIA 3D9RA 1VQK3 1NB3I 5DREA 5AEUB 3ALAA 3ECFA 1M904 2D1WA 5AIFA 5AIGA 1LXEA 4EC6A 2Z6BA 2GBWB 1BUQA 2CFLA 3DGLA 3K63A 2O3OA 4K61A 1GYBA 1W02A 1OHPA 5IG5A 1VQ93 3M8CA 3PYJA 3K5TA 4XB5A 2XRXB 1DVDA 4O02B 1SJWA 3SEDA 3T8NA 2W04A 4I4KA 4FMCA 1YJN3 5LC7A 2GXFA 1GY7A 4CCVA 3MG2A 5KP4A 3JUPA 3E99A 4HZBB 4H61A 2FXTA 1U5OA 2CWTA 5IERA 1M9GA 1EQKA 3EBYA 4WYKA 2F86B 3UNLA 2KCDA 1N5HA 5EVHA 3WDGB 2W2CA 1M1XB 1QJGA 3V92A 3DUKA 4RNYA 3TDGA 1IU7A 2STDA 2YFJB 2QGUA 1OCVA 4L8PA 5D83A 1Q824 3I563 2HMKB 1NU3A 1OF5B 1GS3A 2WOFA 3CCR3 1QVF2 1DYUA 1DMMA 1O7MB 1YIT3 2RSXA 1RKYA 2Y74A 2P05A 3BLZA 1HKXA 4IPBA 5IG4A 2GBXB 2MC8A 2XEPA 1WMPA 1D6YA 2QIYA 4XDVA 1OPYA 1SPUA 5EQLA 1Q864 2I9WA 3FG1A 4KFEA 3DGOA 5IG0A 3FGYA 1UUWB 2IUJA 4HM7B 3S5CA 3F8XA 3CC43 3JUQA 1GD4A 1STFI 4HM8B 4R1KA 1JB5A 3EBTA 3S29A 3DGMA 3EQQB 6STDA 1IVXA 4N6MA 1QAKA 2XH9A 4FCJA 3HIIA 3MG3A 2W03A 3SVAA 2W56A 2JQ5A 1W2B2 3RDEA 4EV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMI A;  2RCD A;  1ASK A;  4HM5 B;  2OWP A;  5G2G A;  3FSD A;  2XSO B;  5IEN A;  1WQL B;  3K7C A;  3ER7 A;  1GY6 A;  4WP5 A;  4XBT A;  5CF2 A;  4Q53 A;  3F14 A;  1NDO B;  1STD A;  3F8H A;  3FKA A;  2BMO B;  1DMN A;  5AIH A;  4J8T A;  3EHC A;  2B24 B;  1E3V A;  2HML B;  3CNX A;  3LZA A;  2K54 A;  3LYG A;  4HM1 B;  2Z7A A;  3IPT A;  4GB5 A;  1IDP A;  1JN5 A;  3NV0 B;  4IIA A;  1Z1S A;  2BMR B;  3NUV A;  3OWS A;  5D81 A;  3GZR A;  1OHO A;  2B1X B;  2RGQ A;  2CHC A;  4HM0 B;  3DXO A;  1Q40 A;  3K0Z A;  2Z76 A;  3WMD A;  4L8O A;  3G8Z A;  3UJM A;  3GRD A;  4OUQ A;  1O7N B;  3HZP A;  1O7G B;  3KSP A;  4STD A;  5TGN A;  5BVB A;  4H3U A;  3OWU A;  3RGA A;  3B4P A;  4HZ9 B;  3B4O A;  3OWY A;  5FW5 A;  2BMQ B;  1NWW A;  1A2K A;  3KZT A;  3Q90 A;  3CPO A;  2PZV A;  5CXO A;  7STD A;  3BB9 A;  1CQS A;  3KE7 A;  1ULJ B;  4XM4 A;  4MJD A;  4R9K A;  1EA2 A;  4HM6 B;  5D82 A;  5BXQ A;  4CDL A;  4U13 A;  4XBX A;  1AR0 A;  1OUN A;  1VZZ A;  2F98 A;  3HX8 A;  4HM2 B;  2RFR A;  3JUN A;  3EF8 A;  8CHO A;  2HMM B;  3GZY B;  5CLK A;  4LGQ A;  1TP6 A;  3EX9 A;  5KP3 A;  5IEP A;  4HKV B;  3MYT A;  3VGN A;  3T8U A;  3B7C A;  1Q42 A;  3DM8 A;  4RZM A;  4ORL A;  1ULI B;  1OF5 A;  4L7K A;  4WYK B;  1GY5 A;  2GEX A;  1W01 A;  5CF1 A;  2BNG A;  3JUM A;  3EN1 B;  3STD A;  3FF0 A;  3NM2 A;  3NHX A;  5STD A;  2YFL B;  3DMC A;  2XSH B;  2A15 A;  2IMJ A;  3SOA A;  2F99 A;  4LEH A;  3G16 A;  2INX A;  5HGR A;  3MSO A;  5JPP A;  2HMO B;  1K41 A;  2UX0 A;  3GZB A;  3CU3 A;  5JPU A;  1OGZ A;  4K1V A;  1O7P B;  3MHE A;  3FH1 A;  3OXA A;  4KVH A;  2HMN B;  3GZX B;  5AEW B;  3VSY A;  4PEJ A;  4HJL B;  1ZX2 A;  4XDW A;  3OX9 A;  1E3R A;  3RGR A;  4N3V A;  5AI1 A;  4R9L A;  4X2H A;  2GEY A;  4X2O A;  3NV0 A;  1JB4 A;  4XBY A;  3MKI A;  3F7S A;  1JKG A;  3HK4 A;  1TUH A;  1EG9 B;  3B8L A;  3F40 A;  1E97 A;  3GWR A;  2XR8 B;  3EC9 A;  1JN5 B;  2YFI B;  3A76 A;  1DMQ A;  3SOY A;  5AII A;  1OHS A;  4HVN A;  3EJV A;  3EN8 A;  4WWU C;  1OH0 A;  3FZW A;  1Q40 B;  1S5A A;  3I0Y A;  1O7W B;  4FCM A;  3F7X A;  3JUO A;  4HM4 B;  4OVM A;  1OGX A;  1ISK A;  3H3H A;  3MG1 A;  5IF6 A;  1QMA A;  3FLJ A;  4J9A A;  3FF2 A;  3CNM A;  1O7H B;  3NBR A;  4HM3 B;  2CKF B;  5CK6 A;  2R4I A;  1W6Y A;  3ROB A;  1ZO2 A;  3NXJ A;  3G0K A;  2Z77 A;  5DRV A;  3KKG A;  4K1U A;  1C7H A;  3OV4 A;  1W00 A;  2HMJ B;  1JB2 A;  1JKG B;  3H51 A;  3F9S A;  3DZL A;  5IEO A;  5IG3 A;  1UUV B;  5KP1 A;  3D9R A;  5DRE A;  5AEU B;  3ECF A;  5AIF A;  5AIG A;  2GBW B;  1BUQ A;  1GYB A;  1W02 A;  1OHP A;  5IG5 A;  3M8C A;  4XB5 A;  2XRX B;  1SJW A;  3SED A;  3T8N A;  4I4K A;  2GXF A;  1GY7 A;  3MG2 A;  5KP4 A;  3JUP A;  3E99 A;  4HZB B;  1U5O A;  5IER A;  3EBY A;  4WYK A;  2F86 B;  3UNL A;  5EVH A;  2W2C A;  1QJG A;  3DUK A;  2STD A;  2YFJ B;  2QGU A;  1OCV A;  4L8P A;  5D83 A;  2HMK B;  1NU3 A;  1OF5 B;  1GS3 A;  1DMM A;  1O7M B;  3BLZ A;  1HKX A;  5IG4 A;  2GBX B;  2QIY A;  4XDV A;  1OPY A;  2I9W A;  5IG0 A;  3FGY A;  1UUW B;  4HM7 B;  3S5C A;  3F8X A;  3JUQ A;  4R1K A;  4HM8 B;  1JB5 A;  3EBT A;  3EQQ B;  6STD A;  4FCJ A;  3MG3 A;  2JQ5 A; 
#chains in the Genus database with same CATH topology
 1VQ5 3;  4LMI A;  1AVK A;  2RCD A;  1CEW I;  1GOU A;  1ASK A;  3IMA B;  1U8C B;  2OWP A;  4HM5 B;  5G2G A;  3FSD A;  1UI8 A;  3G4S 3;  2IYJ A;  2XSO B;  5IEN A;  1WQL B;  2CG0 A;  2KF4 A;  2OOV C;  2LQV A;  3NBB A;  3K7C A;  1BOX A;  1LVN A;  2C11 A;  1YVB I;  2WO0 A;  4N6O B;  1VQN 3;  1RGA A;  1QAL A;  3NQY A;  3ER7 A;  4GHO A;  1GY6 A;  3LXU X;  3PS8 A;  3D4A A;  3FG4 A;  4KFF A;  4WP5 A;  2W0Q A;  3UL5 A;  1EKM A;  1LOW A;  4HYZ A;  4XBT A;  1ZS7 A;  1UW1 A;  5CF2 A;  4Q53 A;  3F14 A;  1FUW A;  5IW9 A;  1NDO B;  4N6V 0;  3WOD G;  1B2S A;  5RNT A;  1STD A;  3F8H A;  2F4Y A;  3FKA A;  2BMO B;  4J5K A;  2L4V A;  1FZU A;  1A2P A;  2P09 A;  2C4B A;  1DMN A;  1TFK A;  5AIH A;  1RNB A;  4J8T A;  1V74 A;  1TIJ A;  4WHA A;  3EHC A;  2B24 B;  3CCL 3;  1E3V A;  2IUK A;  2HML B;  3CNX A;  4NPB A;  3LZA A;  1YIJ 3;  3CCV 3;  2K54 A;  1I3I A;  1I2F A;  4O3V A;  1IQ8 A;  3LYG A;  1US1 A;  2Z7A A;  4HM1 B;  3IPT A;  1SAR A;  4N6T A;  3AGO A;  4GB5 A;  1IDP A;  4EV5 A;  1RTU A;  1JN5 A;  4LSO A;  3NV0 B;  1B2X A;  2KF6 A;  1FUT A;  1GOV A;  4IIA A;  5FGO A;  3ZFZ A;  2GU1 A;  1IVW A;  5ELJ A;  1VQM 3;  3X40 A;  1JBT A;  1Z1S A;  3SX1 A;  2BMR B;  3N8B A;  2BHM A;  3NUV A;  2IA7 A;  3OWS A;  5D81 A;  3WHO A;  3CCS 3;  3GZR A;  1BNR A;  1I2E A;  1RGL A;  2CK3 H;  1YHQ 3;  1K8A 4;  1OHO A;  1N8Q A;  3OW2 2;  2B1X B;  2LYX A;  2RBI A;  2RGQ A;  2CHC A;  4EXR A;  2XF3 A;  4HM0 B;  3DXO A;  1Q40 A;  1FGO A;  3LTB A;  3K0Z A;  3K9M C;  1UCJ A;  4KT3 B;  2P0M A;  2Z76 A;  1I70 A;  4MMX B;  3WMD A;  1V57 A;  1KQS 2;  3BIR A;  4ZM8 A;  2D42 A;  4QWT A;  4L8O A;  3UB1 A;  4N6N B;  1N5P A;  1PFP A;  3WR2 A;  2E2U A;  1B3S A;  3D3L A;  4FCZ A;  1X1U A;  3G8Z A;  3UJM A;  2CX0 A;  1M1K 4;  1VQ6 3;  1A2V A;  3GRD A;  4OUQ A;  1HZ1 A;  2QA4 3;  3CCM 3;  1KD1 4;  3GAX A;  1LOX A;  1O7N B;  3HZP A;  3LOY A;  4HBR A;  1YGE A;  4G1M B;  3WOE B;  3CME 3;  1O7G B;  2ZDJ A;  3KSP A;  1UI7 A;  4FMA A;  4STD A;  2OCT A;  1QVG 2;  2MF7 A;  5TGN A;  4RNT A;  3O8Y A;  4H3U A;  1FGT A;  5BVB A;  1GMR A;  1RN1 A;  5M1A A;  3OWU A;  1G02 A;  1BNE A;  3JVC A;  3KSE D;  1FUS A;  3B4P A;  3RGA A;  3BND A;  4HZ9 B;  1D6U A;  1UGH I;  3B4O A;  1B2M A;  1B2Z A;  1I8V A;  1YGW A;  1G0T A;  2KF3 A;  2ML5 A;  3OWY A;  5FW5 A;  2BMQ B;  4RNZ A;  1BVI A;  1NWW A;  2Y73 A;  1N8R 4;  1W5Z A;  3SXX A;  4KZ1 A;  1PYL A;  1A2K A;  3KZT A;  2AAE A;  1N9J A;  3RNT A;  3URP A;  1BRH A;  2ZHX B;  2F5M A;  2H0G A;  3MPH A;  3Q90 A;  3LTD A;  4KFD A;  1NJI 4;  3CPO A;  3X3X A;  2PZV A;  5I97 A;  5CXO A;  4AKZ A;  7STD A;  3KFQ C;  1JBS A;  2RNT A;  3BB9 A;  4NHF A;  2V1L A;  1CQS A;  4BU4 A;  2IY2 A;  1PY3 A;  3KE7 A;  1ULJ B;  2L1S A;  3IJE B;  1G96 A;  1I3F A;  4XM4 A;  1S72 3;  5HOH A;  4MJD A;  2CFD A;  4R9K A;  1EA2 A;  1AQZ A;  3AMO A;  4BTX A;  4LZI A;  1MWU A;  1FW7 A;  3PXM A;  4BTW A;  4HAA A;  1MOL A;  2CFG A;  4HM6 B;  5D82 A;  3PGB A;  5BXQ A;  4CDL A;  3FCS B;  1RN7 A;  2E2V A;  1AY7 A;  3AHS A;  4U13 A;  1CH0 A;  2UGI A;  4MMY B;  1NO3 A;  3T0U A;  4XBX A;  3WOF B;  1TRQ A;  1AR0 A;  1OUN A;  1JV2 B;  1VZZ A;  1BNG A;  3LT9 A;  1BRS A;  2F98 A;  2F56 A;  3HX8 A;  1OAC A;  1V58 A;  1I0X A;  3Q2P A;  7GSP A;  2W9Q A;  4HM2 B;  4BIR A;  2OTL 3;  2KXG A;  2P38 A;  2RFR A;  3KCH A;  1D6Z A;  2O9U X;  3JUN A;  3V99 A;  3EF8 A;  2ML6 A;  4EBG A;  1KWI A;  2YX9 A;  1N9E A;  8CHO A;  4EW5 A;  2HMM B;  1RSN A;  3GZY B;  5CLK A;  1A90 A;  4LGQ A;  1JJ2 2;  1ROV A;  3X42 A;  1Y4K A;  2GU3 A;  3EB8 A;  1TP6 A;  3J7Y d;  3EX9 A;  4BL2 A;  5KP3 A;  3DY5 A;  5IEP A;  4HKV B;  3U97 A;  3MYT A;  3VF1 A;  4EYC A;  3VGN A;  1BRI A;  4N6L A;  3T8U A;  3CD6 3;  3B7C A;  1Q42 A;  1CYV A;  3DM8 A;  1BRJ A;  4FR9 A;  1SII A;  2KAA A;  1NB5 I;  4RZM A;  1W2Z A;  1W6G A;  1Q7Y 4;  4ORL A;  1ULI B;  1YI2 3;  4AEQ A;  5LC6 A;  1EEJ A;  1RNT A;  1OF5 A;  2HOH A;  2BT3 A;  4L7K A;  4WYK B;  1GY5 A;  2E2T A;  4FMB A;  2GEX A;  1W01 A;  1RGE A;  1WNH A;  1FGR A;  1MWS A;  2SAR A;  5CF1 A;  2BNG A;  3LT8 A;  4MMZ B;  4K90 B;  3CCU 3;  3JUM A;  9RNT A;  1RRL A;  3N9H A;  1IQY A;  1W6C A;  3AHW A;  1K9M 4;  1BIR A;  3LML A;  5AYR B;  3EN1 B;  1TU5 A;  3STD A;  3FF0 A;  1FA3 A;  3NM2 A;  3G71 3;  3CCJ 3;  3NM7 A;  3NHX A;  1BNF A;  2C10 A;  1LRA A;  5STD A;  2YFL B;  3DMC A;  1K73 4;  2XSH B;  2A15 A;  2XGL A;  5BIR A;  1TRP A;  2IMJ A;  2XFT A;  3SOA A;  1BNI A;  1JRQ A;  5M18 A;  2F99 A;  3Q3F A;  4LEH A;  3G16 A;  2INX A;  1RMS A;  4GL6 A;  1UCL A;  2CX1 A;  1TFO A;  2K0M A;  3PCS A;  3DH2 A;  1MNL A;  4JF8 A;  3MSO A;  5HGR A;  5JPP A;  4WFO A;  4CPK A;  2HMO B;  3LTC A;  1K41 A;  2UX0 A;  1SIH A;  3KII A;  2WOH A;  3MWZ A;  4HOH A;  3BNC A;  3GZB A;  1RGK A;  1JZO A;  4OK0 A;  1VQP 3;  1X1Y A;  1UDI I;  2CW9 A;  3CU3 A;  3S27 A;  1F8N A;  3WA3 A;  1BRG A;  5JPU A;  1OGZ A;  4K1V A;  1VQL 3;  2PNC A;  1DE3 A;  2W56 B;  3CC7 3;  1O7P B;  2XFS A;  4ILF A;  3X3Z A;  1YVS A;  3MHE A;  4R80 A;  3S28 A;  3D79 A;  5EEO A;  1BUJ A;  3FH1 A;  3OXA A;  5G1L A;  4KVH A;  2HMN B;  3GZX B;  3BNE A;  2F5W A;  2W6J H;  5AEW B;  4JRF A;  3ZG5 A;  1BAN A;  2GSP A;  1Q86 4;  3VSY A;  1RGH A;  2BO9 B;  3HIG A;  4PEJ A;  3NX0 A;  4HJL B;  4RBN A;  1VQO 3;  2JDI H;  1ZX2 A;  4I5Q A;  4XDW A;  1TJD A;  1IVU A;  1B21 A;  1L5G B;  2H0H A;  1MWT A;  3FG3 A;  3OX9 A;  5GSP A;  1RRH A;  1E3R A;  3ZG0 A;  3RGR A;  4N3V A;  5AI1 A;  3AGN A;  1IT7 A;  4DKI A;  4R9L A;  3UL6 A;  2OQE A;  4X2H A;  1LOV A;  2GEY A;  1Q81 4;  4X2O A;  1FGM A;  1T2H A;  1JB4 A;  3NV0 A;  4O8S A;  1BAO A;  4O2H A;  4XBY A;  1LOY A;  3Q1C A;  3DGN A;  3MKI A;  1R4Y A;  2SBL A;  3F7S A;  1JKG A;  1EUI C;  4J5G A;  1VQ4 3;  2P0X A;  5A0O B;  3HK4 A;  1TUH A;  1EG9 B;  1A67 A;  3B8L A;  3F40 A;  1I2G A;  3U1W A;  4FMD A;  1E97 A;  3GWR A;  1T2I A;  2CIU A;  2XR8 B;  3EC9 A;  3LTA A;  1JN5 B;  2KF5 A;  2YFI B;  3EE1 A;  1IV9 A;  3A76 A;  3S67 A;  1DMQ A;  1LQM B;  1C54 A;  3SOY A;  4MEI A;  1WMN A;  5AII A;  1JNQ A;  1GD3 A;  1BRK A;  1RCL A;  3HOH A;  1OHS A;  4NRE A;  1KC8 4;  3KN4 A;  4HVN A;  1YJW 3;  3EJV A;  1BRN L;  5M19 A;  2CC3 A;  3PZW A;  3CPW 2;  2OTJ 3;  1IT8 A;  1IK3 A;  3EN8 A;  4WWU C;  3X3Y A;  1GSP A;  1OH0 A;  2BU4 A;  1RN4 A;  3N54 B;  1FYS A;  1WTH A;  3FZW A;  1Q40 B;  3I55 3;  2CWU A;  1NNV A;  1S5A A;  3I0Y A;  1RDS A;  1O7W B;  4FCM A;  1VQQ A;  3SLU A;  5JBS A;  1VQ7 3;  1BSB A;  3F7X A;  3HI7 A;  5AYS C;  3JUO A;  4HM4 B;  2CG1 A;  1IV7 A;  1CYU A;  1RJO A;  4OVM A;  4AKY A;  1OGX A;  1DVC A;  1JBR A;  1R4C A;  1ISK A;  4LYL B;  6GSP A;  2AAD A;  3BNB A;  2ZL8 A;  1FGQ A;  2W9P A;  1DET A;  3H3H A;  3MG1 A;  5IF6 A;  1QMA A;  1IVV A;  2CH9 A;  1VQ8 3;  3V98 A;  1AV4 A;  3G6E 3;  2K3D A;  3CXC 2;  1GOY A;  2FNQ A;  1ZGX A;  1HU9 A;  3L0R A;  2CWV A;  1TTO A;  3CCE 3;  2FGT A;  1QAF A;  1B20 A;  1W7C A;  1LNI A;  3CCQ 3;  1RHL A;  3CC2 3;  3FLJ A;  4R4K A;  2CFK A;  4J9A A;  2WGO A;  3FF2 A;  2Q07 A;  3CNM A;  3LH4 A;  1O7H B;  3D5G A;  1PU4 A;  3QK9 A;  3CMA 3;  3NBR A;  1K28 A;  2KRT A;  1AVL A;  4HM3 B;  2CKF B;  1B2U A;  1JZD A;  1MWR A;  3NQZ A;  2R4I A;  5CK6 A;  4BL3 A;  3QRD A;  1BSD A;  2QEX 3;  1J2B A;  1W6Y A;  2WGQ A;  1UCK A;  1IQX A;  2UUG C;  1LNH A;  5ELU A;  8RNT A;  3ROB A;  1ZO2 A;  4IT7 A;  1BGS A;  2M7O A;  2OOV A;  3NXJ A;  3X41 A;  3G0K A;  4BTY A;  1MGW A;  2XGN A;  1RLS A;  1HYF A;  3SYU A;  3A5E A;  3GSP A;  2CFW A;  1ROA A;  3NBJ A;  2Z77 A;  5DRV A;  1SQW A;  3KKG A;  2R41 A;  4K1U A;  1C7H A;  1T5Y A;  3OV4 A;  1UGI A;  1W00 A;  2HMJ B;  1JB2 A;  3AMO B;  3PCR A;  1Q7H A;  1WMO A;  1JKG B;  4TX4 A;  3H51 A;  3F9S A;  3WA2 X;  3DZL A;  4N6U A;  1B27 A;  1BNS A;  5IEO A;  5IG3 A;  1UUV B;  1W4N A;  1YJ9 3;  5KP1 A;  2OQE C;  1BSE A;  1KSI A;  3D9R A;  1LQG C;  1VQK 3;  1NB3 I;  3D5I A;  5DRE A;  5AEU B;  3ALA A;  3ECF A;  1M90 4;  2D1W A;  5AIF A;  5AIG A;  1X1W A;  1LXE A;  4EC6 A;  6RNT A;  2Z6B A;  1IYY A;  2GBW B;  1BUQ A;  2CFL A;  3DGL A;  3K63 A;  2O3O A;  4K61 A;  1GYB A;  1RCK A;  1W02 A;  1OHP A;  5IG5 A;  1VQ9 3;  3M8C A;  3PYJ A;  3K5T A;  4XB5 A;  2XRX B;  1Q9E A;  1DVD A;  4O02 B;  1SJW A;  3SED A;  3T8N A;  5G1K A;  2W04 A;  4I4K A;  4FMC A;  1YJN 3;  5LC7 A;  2GXF A;  1GY7 A;  3DGY A;  4CCV A;  3MG2 A;  5KP4 A;  3JUP A;  3E99 A;  5BU4 A;  7RNT A;  4HZB B;  4H61 A;  1X1X A;  2FXT A;  1U5O A;  2CWT A;  5IER A;  1M9G A;  1EQK A;  3EBY A;  4WYK A;  2F86 B;  3UNL A;  2KCD A;  1N5H A;  5EVH A;  3WDG B;  2H0I A;  2W2C A;  1BNJ A;  1M1X B;  1QJG A;  3V92 A;  3DUK A;  2J8X B;  4RNY A;  1IU7 A;  2STD A;  3TDG A;  2YFJ B;  2QGU A;  2ZA4 A;  1OCV A;  4L8P A;  5D83 A;  1Q82 4;  3I56 3;  2HMK B;  1UUG B;  1NU3 A;  1OF5 B;  1RGC A;  1GS3 A;  1MGR A;  2WOF A;  1I0V A;  3CCR 3;  1BU4 A;  1QVF 2;  1DYU A;  1DMM A;  1O7M B;  1YIT 3;  2RSX A;  1RKY A;  1YNV X;  2Y74 A;  2P05 A;  3BU4 A;  3BLZ A;  1HKX A;  4IPB A;  5IG4 A;  2GBX B;  2MC8 A;  2XEP A;  1WMP A;  1D6Y A;  2QIY A;  4XDV A;  1OPY A;  1SPU A;  5EQL A;  4CJN A;  2I9W A;  3FG1 A;  4KFE A;  1GMP A;  3DGO A;  5IG0 A;  3FGY A;  1UUW B;  2IUJ A;  1RGF A;  1BSA A;  4HM7 B;  3S5C A;  1BSC A;  3F8X A;  1T3B A;  3CC4 3;  3JUQ A;  1GD4 A;  1STF I;  2BIR A;  4GSP A;  4HM8 B;  4R1K A;  1JB5 A;  3EBT A;  3S29 A;  3DGM A;  3EQQ B;  6STD A;  1IVX A;  1UCI A;  4N6M A;  1QAK A;  2XH9 A;  1GMQ A;  4FCJ A;  3HII A;  3MG3 A;  1RGG A;  2W03 A;  2W56 A;  2JQ5 A;  3SVA A;  1W2B 2;  3RDE A;  4EV2 A; 
#chains in the Genus database with same CATH homology
 1VQ5 3;  4LMI A;  1AVK A;  2RCD A;  1CEW I;  3IMA B;  1ASK A;  4HM5 B;  1U8C B;  2OWP A;  3G4S 3;  5G2G A;  3FSD A;  1UI8 A;  2XSO B;  5IEN A;  1WQL B;  2CG0 A;  2OOV C;  2LQV A;  3NBB A;  3K7C A;  1LVN A;  2C11 A;  1YVB I;  2WO0 A;  4N6O B;  1VQN 3;  1QAL A;  3NQY A;  3ER7 A;  1GY6 A;  3LXU X;  3PS8 A;  3FG4 A;  4KFF A;  4WP5 A;  2W0Q A;  3UL5 A;  1EKM A;  4HYZ A;  4XBT A;  1UW1 A;  5CF2 A;  4Q53 A;  3F14 A;  1FUW A;  5IW9 A;  1NDO B;  4N6V 0;  3WOD G;  1STD A;  3F8H A;  3FKA A;  2BMO B;  2L4V A;  2P09 A;  1DMN A;  1TFK A;  5AIH A;  4J8T A;  1V74 A;  1TIJ A;  4WHA A;  3EHC A;  2B24 B;  3CCL 3;  1E3V A;  2IUK A;  2HML B;  3CNX A;  3LZA A;  1YIJ 3;  3CCV 3;  2K54 A;  4O3V A;  1IQ8 A;  3LYG A;  1US1 A;  2Z7A A;  4HM1 B;  3IPT A;  4N6T A;  4GB5 A;  1IDP A;  4EV5 A;  1JN5 A;  4LSO A;  3NV0 B;  4IIA A;  1VQM 3;  5FGO A;  2GU1 A;  1IVW A;  5ELJ A;  3X40 A;  1Z1S A;  3SX1 A;  2BMR B;  3N8B A;  2BHM A;  3NUV A;  2IA7 A;  3OWS A;  5D81 A;  3CCS 3;  3GZR A;  2CK3 H;  1K8A 4;  1YHQ 3;  1OHO A;  1N8Q A;  3OW2 2;  2B1X B;  2LYX A;  2RGQ A;  2CHC A;  4EXR A;  2XF3 A;  4HM0 B;  3DXO A;  1Q40 A;  1FGO A;  3LTB A;  3K0Z A;  3K9M C;  2P0M A;  2Z76 A;  4MMX B;  3WMD A;  1KQS 2;  4ZM8 A;  2D42 A;  4QWT A;  4L8O A;  3UB1 A;  4N6N B;  1N5P A;  1PFP A;  2E2U A;  4FCZ A;  3D3L A;  1M1K 4;  3G8Z A;  3UJM A;  1VQ6 3;  1A2V A;  3GRD A;  4OUQ A;  2QA4 3;  3CCM 3;  1KD1 4;  3GAX A;  1LOX A;  1O7N B;  3HZP A;  3LOY A;  4HBR A;  1YGE A;  4G1M B;  3WOE B;  3CME 3;  1O7G B;  2ZDJ A;  3KSP A;  1UI7 A;  4FMA A;  4STD A;  2OCT A;  1QVG 2;  2MF7 A;  5TGN A;  5BVB A;  3O8Y A;  4H3U A;  1FGT A;  3OWU A;  3JVC A;  3KSE D;  3RGA A;  3B4P A;  3BND A;  4HZ9 B;  3B4O A;  1D6U A;  2ML5 A;  3OWY A;  5FW5 A;  2BMQ B;  4RNZ A;  1NWW A;  2Y73 A;  1N8R 4;  1W5Z A;  3SXX A;  4KZ1 A;  1A2K A;  3KZT A;  1N9J A;  3Q90 A;  3MPH A;  1NJI 4;  3LTD A;  4KFD A;  3CPO A;  3X3X A;  2PZV A;  5I97 A;  5CXO A;  4AKZ A;  7STD A;  3KFQ C;  3BB9 A;  4NHF A;  2V1L A;  1CQS A;  3KE7 A;  1ULJ B;  3IJE B;  1G96 A;  4XM4 A;  1S72 3;  4MJD A;  2CFD A;  4R9K A;  1EA2 A;  3AMO A;  4BTX A;  4LZI A;  3PXM A;  4BTW A;  1MOL A;  2CFG A;  4HM6 B;  5D82 A;  3PGB A;  5BXQ A;  4CDL A;  3FCS B;  1RN7 A;  2E2V A;  4U13 A;  4MMY B;  1NO3 A;  3T0U A;  4XBX A;  3WOF B;  1AR0 A;  1OUN A;  1JV2 B;  1VZZ A;  3LT9 A;  2F98 A;  3HX8 A;  3Q2P A;  1OAC A;  2W9Q A;  4HM2 B;  2OTL 3;  2KXG A;  2P38 A;  2RFR A;  1D6Z A;  2O9U X;  3JUN A;  3V99 A;  3EF8 A;  2ML6 A;  4EBG A;  1KWI A;  2YX9 A;  1N9E A;  8CHO A;  2HMM B;  3GZY B;  5CLK A;  1A90 A;  4LGQ A;  1JJ2 2;  1ROV A;  3X42 A;  1Y4K A;  2GU3 A;  3EB8 A;  1TP6 A;  3J7Y d;  3EX9 A;  5KP3 A;  3DY5 A;  5IEP A;  4HKV B;  3U97 A;  3MYT A;  3VF1 A;  4EYC A;  3VGN A;  3T8U A;  4N6L A;  3CD6 3;  3B7C A;  1Q42 A;  1CYV A;  3DM8 A;  4FR9 A;  1SII A;  1NB5 I;  4RZM A;  1W2Z A;  1W6G A;  1Q7Y 4;  4ORL A;  1ULI B;  1YI2 3;  4AEQ A;  5LC6 A;  1OF5 A;  2BT3 A;  4L7K A;  4WYK B;  1GY5 A;  2E2T A;  4FMB A;  2GEX A;  1W01 A;  1WNH A;  1FGR A;  5CF1 A;  2BNG A;  3LT8 A;  4MMZ B;  4K90 B;  3CCU 3;  3JUM A;  1RRL A;  3N9H A;  1IQY A;  1W6C A;  1K9M 4;  3LML A;  5AYR B;  3EN1 B;  1TU5 A;  3STD A;  3FF0 A;  1FA3 A;  3NM2 A;  3G71 3;  3CCJ 3;  3NM7 A;  3NHX A;  2C10 A;  5STD A;  2YFL B;  3DMC A;  1K73 4;  2XSH B;  2A15 A;  2XGL A;  2IMJ A;  2XFT A;  3SOA A;  1JRQ A;  2F99 A;  4LEH A;  3G16 A;  2INX A;  4GL6 A;  3PCS A;  1TFO A;  2K0M A;  4JF8 A;  5HGR A;  1MNL A;  1VQO 3;  3MSO A;  5JPP A;  4WFO A;  2HMO B;  3LTC A;  1K41 A;  2UX0 A;  1SIH A;  3KII A;  2WOH A;  3MWZ A;  3BNC A;  3GZB A;  4OK0 A;  1VQP 3;  3CU3 A;  2CW9 A;  3S27 A;  3WA3 A;  1F8N A;  5JPU A;  1OGZ A;  4K1V A;  1VQL 3;  2PNC A;  2W56 B;  3CC7 3;  1O7P B;  2XFS A;  3X3Z A;  3MHE A;  4R80 A;  3S28 A;  5EEO A;  3FH1 A;  3OXA A;  4KVH A;  2HMN B;  3GZX B;  3BNE A;  2W6J H;  5AEW B;  4JRF A;  3VSY A;  2BO9 B;  3HIG A;  4PEJ A;  3NX0 A;  4HJL B;  4RBN A;  2JDI H;  1ZX2 A;  4XDW A;  1L5G B;  1IVU A;  3FG3 A;  3OX9 A;  1RRH A;  1E3R A;  3RGR A;  4N3V A;  5AI1 A;  1IT7 A;  4R9L A;  3UL6 A;  2OQE A;  4X2H A;  2GEY A;  1Q81 4;  4X2O A;  1FGM A;  3NV0 A;  1JB4 A;  4O8S A;  4XBY A;  4O2H A;  3Q1C A;  3DGN A;  3MKI A;  2SBL A;  3F7S A;  1JKG A;  1VQ4 3;  2P0X A;  5A0O B;  3HK4 A;  1TUH A;  1EG9 B;  1A67 A;  3B8L A;  3F40 A;  3U1W A;  4FMD A;  1E97 A;  3GWR A;  2CIU A;  2XR8 B;  3EC9 A;  3LTA A;  1JN5 B;  2YFI B;  3EE1 A;  1IV9 A;  3A76 A;  3S67 A;  1DMQ A;  3SOY A;  4MEI A;  1WMN A;  5AII A;  1JNQ A;  1GD3 A;  4NRE A;  1KC8 4;  1OHS A;  3KN4 A;  4HVN A;  1YJW 3;  3EJV A;  2CC3 A;  3PZW A;  3CPW 2;  2OTJ 3;  1IT8 A;  1IK3 A;  3EN8 A;  4WWU C;  3X3Y A;  1OH0 A;  3N54 B;  1WTH A;  3FZW A;  1Q40 B;  3I55 3;  2CWU A;  1S5A A;  3I0Y A;  3SLU A;  1O7W B;  4FCM A;  5JBS A;  1VQ7 3;  3F7X A;  3HI7 A;  5AYS C;  3JUO A;  4HM4 B;  2CG1 A;  1IV7 A;  1CYU A;  1RJO A;  4OVM A;  4AKY A;  1OGX A;  1DVC A;  1R4C A;  1ISK A;  3BNB A;  2ZL8 A;  1FGQ A;  2W9P A;  3H3H A;  3MG1 A;  5IF6 A;  1QMA A;  1IVV A;  2CH9 A;  1VQ8 3;  3V98 A;  1AV4 A;  3G6E 3;  3CXC 2;  2FNQ A;  1HU9 A;  3L0R A;  2CWV A;  3CCE 3;  2FGT A;  1QAF A;  1W7C A;  3CCQ 3;  3CC2 3;  3FLJ A;  4R4K A;  2CFK A;  4J9A A;  2WGO A;  3FF2 A;  2Q07 A;  3CNM A;  3LH4 A;  1O7H B;  1PU4 A;  3QK9 A;  3CMA 3;  3NBR A;  2KRT A;  1K28 A;  1AVL A;  4HM3 B;  2CKF B;  5CK6 A;  2QEX 3;  3NQZ A;  2R4I A;  1J2B A;  3QRD A;  1W6Y A;  2WGQ A;  1IQX A;  1LNH A;  5ELU A;  3ROB A;  1ZO2 A;  4IT7 A;  2M7O A;  2OOV A;  3NXJ A;  3X41 A;  3G0K A;  4BTY A;  2XGN A;  2CFW A;  1ROA A;  3NBJ A;  2Z77 A;  5DRV A;  1SQW A;  3KKG A;  4K1U A;  1C7H A;  1T5Y A;  3OV4 A;  1W00 A;  2HMJ B;  1JB2 A;  3AMO B;  3PCR A;  1WMO A;  1JKG B;  4TX4 A;  3H51 A;  3F9S A;  3WA2 X;  3DZL A;  4N6U A;  5IEO A;  5IG3 A;  1UUV B;  1W4N A;  1YJ9 3;  5KP1 A;  2OQE C;  1KSI A;  3D9R A;  1VQK 3;  1NB3 I;  5DRE A;  5AEU B;  3ALA A;  3ECF A;  1M90 4;  2D1W A;  5AIF A;  5AIG A;  1LXE A;  4EC6 A;  2Z6B A;  2GBW B;  1BUQ A;  2CFL A;  3DGL A;  3K63 A;  2O3O A;  4K61 A;  1GYB A;  1W02 A;  1OHP A;  5IG5 A;  1VQ9 3;  3M8C A;  3PYJ A;  3K5T A;  4XB5 A;  2XRX B;  1DVD A;  4O02 B;  1SJW A;  3SED A;  3T8N A;  2W04 A;  4I4K A;  4FMC A;  1YJN 3;  5LC7 A;  2GXF A;  1GY7 A;  4CCV A;  3MG2 A;  5KP4 A;  3JUP A;  3E99 A;  4HZB B;  4H61 A;  2FXT A;  1U5O A;  2CWT A;  5IER A;  1M9G A;  1EQK A;  3EBY A;  4WYK A;  2F86 B;  3UNL A;  2KCD A;  1N5H A;  5EVH A;  3WDG B;  2W2C A;  1M1X B;  1QJG A;  3V92 A;  3DUK A;  4RNY A;  3TDG A;  1IU7 A;  2STD A;  2YFJ B;  2QGU A;  1OCV A;  4L8P A;  5D83 A;  1Q82 4;  3I56 3;  2HMK B;  1NU3 A;  1OF5 B;  1GS3 A;  2WOF A;  3CCR 3;  1QVF 2;  1DYU A;  1DMM A;  1O7M B;  1YIT 3;  2RSX A;  1RKY A;  2Y74 A;  2P05 A;  3BLZ A;  1HKX A;  4IPB A;  5IG4 A;  2GBX B;  2MC8 A;  2XEP A;  1WMP A;  1D6Y A;  2QIY A;  4XDV A;  1OPY A;  1SPU A;  5EQL A;  1Q86 4;  2I9W A;  3FG1 A;  4KFE A;  3DGO A;  5IG0 A;  3FGY A;  1UUW B;  2IUJ A;  4HM7 B;  3S5C A;  3F8X A;  3CC4 3;  3JUQ A;  1GD4 A;  1STF I;  4HM8 B;  4R1K A;  1JB5 A;  3EBT A;  3S29 A;  3DGM A;  3EQQ B;  6STD A;  1IVX A;  4N6M A;  1QAK A;  2XH9 A;  4FCJ A;  3HII A;  3MG3 A;  2W03 A;  3SVA A;  2W56 A;  2JQ5 A;  1W2B 2;  3RDE A;  4EV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...