3B8LA

Crystal structure of a putative aromatic ring hydroxylase (saro_3538) from novosphingobium aromaticivorans dsm at 1.75 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
FQGMQCPIEDRLAIQDLMIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANMSHHAHYLTNFAVTGYEGDTASMRAYVIGMGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTMDFLMPLSGTLDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_001165924.1) from Novosphingobium aromaticivorans DSM 12444 at 1.75 A resolution
rcsb
source organism Novosphingobium aromaticivorans
total genus 38
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3b8lA01
1W02A 1NDOB 1VZZA 1Z1SA 1OGXA 3UJMA 1A2KA 3SOYA 3CNMA 1O7NB 1GS3A 1E3RA 1ZO2A 4HM1B 3WMDA 5IG0A 1ASKA 1Q42A 2JQ5A 1DMNA 5KP3A 1OUNA 3FKAA 4HZ9B 5KP4A 4L8OA 5JPUA 3S5CA 1K41A 3GZRA 3EJVA 3KZTA 1WQLB 2BMQB 3H3HA 3GZBA 2HMNB 3CNXA 2B1XB 1GY5A 3DM8A 1ULIB 1OPYA 4HKVB 3I0YA 1JKGB 4PEJA 1DMMA 4LEHA 1DMQA 4HJLB 4MJDA 2CHCA 1Q40B 3HK4A 1JN5B 3B8LA 3MHEA 3F14A 1O7PB 2GEXA 3FLJA 4RZMA 5DRVA 3LYGA 3GZYB 1EA2A 3CPOA 3HZPA 3EX9A 2XR8B 3F8HA 4STDA 4WP5A 5AEUB 3RGRA 3EC9A 7STDA 3DXOA 5IEOA 2PZVA 3B4PA 1JB5A 3GZXB 2HMKB 5KP1A 3EN1B 3SOAA 4WWUC 1EG9B 3VSYA 5D81A 3FSDA 5AIGA 5AIHA 1CQSA 4L7KA 3K7CA 5IERA 2HMMB 1BUQA 5BXQA 4X2OA 5IG5A 3NM2A 3BLZA 2XSOB 5IG4A 5AIFA 3B7CA 4OVMA 2UX0A 4R9LA 4XM4A 2BMRB 3JUNA 1W6YA 4XBYA 1E3VA 4HM0B 2YFIB 4HM4B 1OGZA 2HMJB 3UNLA 3G0KA 2B24B 5HGRA 1TP6A 4J9AA 3MG3A 5JPPA 4X2HA 1OHOA 4WYKA 3B4OA 2W2CA 6STDA 2R4IA 4HM8B 3JUMA 5EVHA 3OWUA 2A15A 3STDA 5AEWB 4K1VA 3EBYA 3D9RA 1ZX2A 4R1KA 1UUWB 5IEPA 3OXAA 3GWRA 3NV0B 8CHOA 3BB9A 4LGQA 5AIIA 4H3UA 3F7SA 3FGYA 1UUVB 2F86B 4ORLA 3OWSA 2XSHB 2GBXB 1IDPA 1C7HA 3DUKA 3ER7A 3NHXA 3EHCA 1W00A 4U13A 3EN8A 4I4KA 3ROBA 2F99A 1U5OA 4OUQA 3DMCA 4FCJA 1ULJB 3ECFA 5G2GA 4HM6B 2XRXB 4HZBB 3JUPA 3RGAA 1OHSA 2BMOB 2F98A 3G8ZA 2RCDA 1STDA 3MG1A 1JKGA 4KVHA 3F8XA 1OF5A 1Q40A 2HMLB 3HX8A 4XDWA 1QJGA 3KSPA 5IG3A 1NU3A 3A76A 3DZLA 2Z77A 1NWWA 1HKXA 2QGUA 1OCVA 3FF2A 2RGQA 3VGNA 1O7WB 2HMOB 1S5AA 4K1UA 1JB4A 1GYBA 5DREA 4HVNA 5D83A 2QIYA 2Z76A 4N3VA 4R9KA 2GEYA 3NBRA 3F7XA 3GRDA 2BNGA 4Q53A 5STDA 2GBWB 1O7GB 3MSOA 4XBXA 3FH1A 5FW5A 3EF8A 3G16A 3OX9A 4GB5A 2STDA 3IPTA 3KE7A 1O7HB 2YFLB 3CU3A 1QMAA 1TUHA 5BVBA 3M8CA 1OHPA 1GY7A 3MG2A 4HM2B 5TGNA 3E99A 3EBTA 1W01A 1GY6A 3SEDA 1JB2A 2CKFB 1OH0A 1OF5B 2IMJA 2Z7AA 3MKIA 5CK6A 5IENA 5CF2A 3NUVA 3MYTA 4IIAA 3JUQA 3T8NA 1AR0A 3H51A 1E97A 5CLKA 1O7MB 3K0ZA 4L8PA 2K54A 5CXOA 4LMIA 2RFRA 4XDVA 2I9WA 3F40A 5CF1A 3JUOA 3LZAA 3T8UA 4XB5A 2OWPA 1ISKA 2GXFA 3KKGA 4HM5B 4WYKB 3FF0A 3NXJA 5AI1A 3Q90A 4HM7B 3EQQB 3OWYA 1SJWA 3NV0A 5D82A 2INXA 3FZWA 3F9SA 4CDLA 5IF6A 1JN5A 2YFJB 4FCMA 4HM3B 3OV4A 4XBTA 4J8TA
chains in the Genus database with same CATH superfamily
4IT7A 1W02A 1B2XA 1NDOB 2OQEC 1VZZA 1Z1SA 1Q7Y4 1KC84 2MC8A 1OGXA 1TFKA 3UJMA 3CCU3 1A2KA 3SOYA 1QVG2 1K734 1SQWA 1Q7HA 1AVKA 1TFOA 1GOUA 3BIRA 3CNMA 3J7Yd 1BRNL 2AADA 2SARA 1O7NB 3Q1CA 3LTCA 1Q814 1WMPA 1U8CB 3NM7A 1GS3A 4J5GA 3V98A 3X3ZA 3CC23 3WOEB 1E3RA 1FUSA 4KFEA 1IT8A 3NX0A 3S28A 1AV4A 1ZO2A 1VQK3 4HM1B 3BU4A 1RLSA 3WMDA 6GSPA 1KD14 1BNRA 3ALAA 1TRQA 4BTXA 3A5EA 5IG0A 1ASKA 2OOVA 3UL6A 4O2HA 1BSEA 4EC6A 2K0MA 3D3LA 3PZWA 1Q42A 1FGMA 1RGAA 2CFDA 3HIGA 2OOVC 1YGEA 1LOXA 2JQ5A 1DMNA 3BNDA 4I5QA 2LYXA 2Q07A 1W7CA 4G1MB 2IUKA 1AY7A 2W56A 1R4YA 5KP3A 3MWZA 1OUNA 3FKAA 5G1KA 1B2UA 4HZ9B 1YJN3 2W6JH 1AVLA 4L8OA 5KP4A 5JPUA 3CCV3 1DVDA 1W5ZA 1WMNA 3BNCA 3KIIA 1K41A 3S5CA 3GZRA 8RNTA 3EJVA 1RGCA 3KZTA 1T3BA 1T2HA 1WQLB 5EEOA 1V58A 3SVAA 2BMQB 5GSPA 1JRQA 1BRIA 3S27A 2CWVA 3H3HA 3N8BA 3GZBA 3JVCA 3DGMA 2HMNB 3U97A 1B21A 1VQ63 3CNXA 3DY5A 1D6YA 2B1XB 6RNTA 2QA43 1GY5A 4RBNA 3SYUA 1M1K4 2L1SA 3DM8A 2J8XB 1V57A 1JNQA 1ULIB 3CC43 1OPYA 1K28A 1I8VA 1RSNA 1IT7A 1MWSA 3I0YA 4HKVB 4N6LA 5LC6A 1JKGB 3WDGB 4PEJA 1VQM3 1BNJA 1DMMA 4OK0A 1RTUA 4O3VA 4LEHA 1DMQA 2Y74A 4HJLB 5I97A 3G4S3 1LNHA 4LZIA 1VQ73 2P0MA 4MJDA 2CHCA 2XFSA 1FA3A 1Q40B 1UCJA 1N9EA 1BSDA 3HK4A 1AQZA 2FXTA 2SBLA 1JN5B 2UGIA 3WODG 1VQL3 1EQKA 3B8LA 4N6TA 3D79A 3MHEA 2C11A 3F14A 1O7PB 1RNBA 2GEXA 1IU7A 4BU4A 1BGSA 3FLJA 4RZMA 3QRDA 5M1AA 5DRVA 1A67A 3TDGA 3LYGA 2F4YA 2IUJA 1BSBA 3GZYB 2KF6A 4RNZA 3HIIA 3PXMA 4ILFA 3CMA3 1EA2A 3D4AA 2W04A 1CYUA 4BIRA 3CXC2 1FGTA 1T2IA 5BU4A 3G6E3 3CPOA 3HZPA 3EX9A 2XR8B 3F8HA 2WO0A 1M9GA 4STDA 3G713 1MGRA 1UCKA 4WP5A 5AEUB 3RGRA 1J2BA 3EC9A 2E2UA 3RDEA 7STDA 1FUWA 3DXOA 5IEOA 1MOLA 2PZVA 2CWTA 3B4PA 1JB5A 4GHOA 3GZXB 1Q9EA 2HMKB 3Q3FA 3X3XA 5KP1A 3EN1B 3SOAA 2W56B 4WWUC 1EG9B 2BO9B 3VSYA 2GSPA 4LSOA 5HOHA 1NJI4 1LRAA 3N9HA 5D81A 2C10A 4MMXB 1GD4A 3FSDA 3FG1A 1A2PA 1HZ1A 1QVF2 5AIGA 3D5GA 3OW22 5AIHA 1HU9A 3NQYA 1CQSA 2RSXA 4L7KA 3K7CA 1ZS7A 1I2FA 5IERA 1QALA 2CH9A 2CX0A 4KFDA 2HMMB 1BUQA 1BNIA 5BXQA 4X2OA 5IG5A 3NM2A 2O3OA 1EKMA 1I3FA 3BLZA 4N6UA 1BIRA 2W0QA 2XSOB 1ROVA 3FG3A 2CG0A 1B2ZA 4RNTA 2KCDA 5IG4A 1X1UA 3LH4A 5AIFA 2Y73A 3B7CA 1LOWA 4CCVA 1JBRA 1X1XA 1BSAA 2CG1A 2Z6BA 1BOXA 2UX0A 1LQGC 4FMCA 2H0GA 4OVMA 4R9LA 4XM4A 2CK3H 1YJ93 2BMRB 4HBRA 2H0HA 3DH2A 3JUNA 3GSPA 5IW9A 1CEWI 1W6YA 4XBYA 1E3VA 3IMAB 3MPHA 3Q2PA 4HM0B 1B27A 2YFIB 2BHMA 2WGQA 4FMBA 1BNEA 1OGZA 2KRTA 4HM4B 3SLUA 2IA7A 3AHSA 3T0UA 2HMJB 4KFFA 3UNLA 2XFTA 3G0KA 1CYVA 2E2TA 2B24B 3VF1A 1RDSA 3I563 5HGRA 2BT3A 2RNTA 3X42A 3AGOA 4HYZA 1TP6A 2P09A 1LOVA 4J9AA 1LVNA 3MG3A 2ZDJA 4LYLB 3PYJA 4DKIA 5JPPA 1BAOA 4X2HA 2QEX3 1NB5I 1I0XA 1L5GB 1OHOA 4GL6A 1VQ43 3PCRA 3N54B 3CCR3 1STFI 4WYKA 3B4OA 2F5MA 2W2CA 6STDA 1YJW3 1RGKA 2R4IA 1I2GA 2WOHA 1M1XB 1TRPA 1FGQA 3FCSB 3JUMA 4HM8B 4EV2A 3BNBA 1IVXA 1G96A 5EVHA 1N8R4 1VQ93 3OWUA 2A15A 3RNTA 2O9UX 2KAAA 4O02B 3NBJA 3STDA 3WA3A 3LT9A 2OCTA 5G1LA 1NO3A 1ZGXA 2CX1A 2W03A 5AEWB 1EUIC 3EBYA 4K1VA 1GOYA 3D9RA 1ZX2A 1YNVX 3LOYA 4R1KA 1UUWB 1IV7A 2BIRA 1US1A 3OXAA 5IEPA 5M19A 4NHFA 3GWRA 3S67A 1TU5A 2P0XA 2HOHA 3NV0B 8CHOA 1RKYA 3BB9A 1VQQA 4LGQA 3LMLA 3AGNA 5AIIA 1G0TA 4H3UA 1BRHA 1IQ8A 3F7SA 1W6CA 1DE3A 2UUGC 4MMYB 3WHOA 3CCJ3 3FGYA 1PY3A 2GU3A 1UUVB 4JRFA 2F86B 1F8NA 1BUJA 2KF5A 4ORLA 3LTAA 3CCM3 3OWSA 1JBTA 2XSHB 4ZM8A 1JBSA 1PU4A 3WR2A 5LC7A 2F56A 2GBXB 1PYLA 4J5KA 1UGHI 1IDPA 1MWRA 2GU1A 1DYUA 3CCS3 1V74A 1MNLA 1FGRA 1C7HA 2MF7A 2CC3A 1B20A 3DUKA 1RGEA 1W2ZA 3CD63 1MWUA 3U1WA 3ER7A 3NHXA 1RN1A 1T5YA 3S29A 3EHCA 1W00A 4U13A 3EN8A 1TTOA 4I4KA 1FYSA 3ROBA 2F99A 3FG4A 4NREA 4AKYA 2R41A 1CH0A 3X41A 1U5OA 4FMDA 3K9MC 4OUQA 3SXXA 3DMCA 3LTDA 2LQVA 4FCJA 2D42A 3CCQ3 1BRJA 1RRHA 1TIJA 1ULJB 1FZUA 1BVIA 4RNYA 4GSPA 1GMPA 2KF4A 1BU4A 2ZA4A 3ECFA 5G2GA 1BRSA 5AYRB 1N8QA 2BU4A 3GAXA 4HM6B 2XRXB 1D6UA 2D1WA 4EBGA 1I0VA 3JUPA 4HZBB 3RGAA 1OHSA 1SPUA 2BMOB 3HOHA 1VQP3 2F98A 1K8A4 4KT3B 1BNGA 1YVBI 2YX9A 2CFLA 2CIUA 3UL5A 1IYYA 2XF3A 3G8ZA 2RCDA 3PGBA 2W9PA 5ELJA 1YIT3 1B3SA 2P05A 1IQYA 1UW1A 2FNQA 1STDA 2RBIA 3MG1A 1JKGA 4KVHA 3F8XA 4WHAA 1OF5A 2XH9A 2XGNA 2IYJA 3AMOA 3KSED 4FMAA 2W9QA 3DGOA 1RN4A 4CJNA 1W6GA 1RMSA 4KZ1A 1GOVA 1Q40A 2HMLB 3HX8A 4XDWA 4N6V0 3CME3 1PFPA 1IK3A 4JF8A 1QJGA 3KSPA 1MWTA 1Y4KA 1DVCA 2M7OA 5BIRA 5IG3A 1SIIA 1YIJ3 1NU3A 1Q824 4N6OB 3CCL3 1KQS2 1QAFA 3A76A 3DZLA 2K3DA 1QAKA 1X1YA 2Z77A 1NWWA 4MMZB 1BNSA 3CCE3 1C54A 4K61A 1HKXA 2CFWA 1OCVA 2QGUA 4FR9A 3WA2X 1N5PA 4AKZA 3FF2A 2RGQA 3VGNA 3I553 4BL2A 1O7WB 1RGGA 1I2EA 4HAAA 4QWTA 2ZHXB 3K5TA 2HMOB 1A2VA 4EXRA 4IPBA 1S5AA 1D6ZA 3CC73 1NB3I 3SX1A 2JDIH 3ZG0A 2F5WA 1JB4A 1GYBA 4K1UA 1RCLA 5DREA 1EEJA 1IQXA 4K90B 1UDII 1GD3A 2KF3A 4N6NB 3URPA 1GMQA 1RHLA 1IVVA 1VQ53 7RNTA 4EYCA 3O8YA 1OACA 2XEPA 4HVNA 5D83A 1B2MA 2QIYA 2Z76A 3PCSA 4N3VA 1VQN3 4R9KA 2IY2A 1UCIA 2GEYA 3NBRA 3F7XA 3GRDA 5RNTA 2BNGA 1JV2B 3AHWA 2GBWB 1O7GB 3MSOA 4N6MA 4Q53A 4XBXA 5STDA 1N9JA 3FH1A 3KCHA 5FW5A 3EF8A 3DGYA 1RCKA 3G16A 3OX9A 5EQLA 1YI23 3ZG5A 4NPBA 1RGFA 4GB5A 5JBSA 2STDA 3DGNA 3IPTA 4WFOA 3D5IA 3KE7A 1O7HB 1SARA 2YFLB 3CU3A 2E2VA 1QMAA 5FGOA 1TUHA 2ML6A 3ZFZA 5BVBA 1S723 1JZDA 1M904 3QK9A 2L4VA 3M8CA 3KFQC 1OHPA 1VQO3 1I70A 1GY7A 3MG2A 4HM2B 1RNTA 5TGNA 3E99A 4EW5A 3EBTA 1W01A 4HOHA 1GY6A 2XGLA 3SEDA 1YHQ3 1BANA 1JB2A 1G02A 2P38A 1UI8A 2WGOA 1I3IA 2CKFB 2ZL8A 1OH0A 1OF5B 2IMJA 3AMOB 1TJDA 3EB8A 2Z7AA 3MKIA 5CK6A 3V92A 1WTHA 3X40A 9RNTA 1W2B2 5IENA 1YVSA 5M18A 1FUTA 5CF2A 3NUVA 3MYTA 1BSCA 4IIAA 3JUQA 3T8NA 1AR0A 2H0IA 3V99A 1IV9A 3H51A 2CFKA 2OTJ3 1FW7A 4O8SA 2CW9A 2WOFA 1JJ22 1E97A 5CLKA 1O7MB 3WOFB 1IVWA 3K0ZA 1N5HA 4L8PA 2K54A 5CXOA 1R4CA 4LMIA 2RFRA 4BL3A 1LXEA 3KN4A 4TX4A 4XDVA 3K63A 2C4BA 5A0OB 2I9WA 3F40A 3IJEB 1DETA 1W4NA 3L0RA 1BRGA 5CF1A 2FGTA 1LOYA 3JUOA 1LQMB 3LZAA 3T8UA 2KXGA 4XB5A 3CPW2 1NNVA 2OWPA 1UI7A 2PNCA 1ISKA 4CPKA 3BNEA 2GXFA 3DGLA 1K9M4 1Q864 1X1WA 2AAEA 1UUGB 1GSPA 3KKGA 1RJOA 3LTBA 4HM5B 4MEIA 4WYKB 1RRLA 1B2SA 1WNHA 3FF0A 3NXJA 1RGHA 5AI1A 4EV5A 3Q90A 4FCZA 4HM7B 1IVUA 1ROAA 4R80A 2OTL3 3EQQB 3HI7A 1KWIA 3OWYA 1SJWA 1BRKA 3NV0A 1YGWA 3UB1A 4BTYA 4BTWA 5D82A 7GSPA 1BNFA 2INXA 1FGOA 2ML5A 3FZWA 1RN7A 3F9SA 1RGLA 3PS8A 1VQ83 2CFGA 3NBBA 1GMRA 3NQZA 3LT8A 1A90A 1WMOA 4CDLA 1KSIA 5IF6A 1JN5A 4R4KA 2YFJB 1HYFA 1LNIA 4FCMA 3EE1A 3LXUX 3OV4A 4HM3B 5AYSC 4AEQA 3X3YA 1JZOA 1MGWA 4H61A 4XBTA 2CWUA 2OQEA 5ELUA 2V1LA 1UGIA 1UCLA 1SIHA 4J8TA
chains in the Genus database with same CATH topology
4IT7A 1W02A 1NDOB 2OQEC 1VZZA 1Z1SA 1Q7Y4 1KC84 2MC8A 1OGXA 1TFKA 3UJMA 3CCU3 1A2KA 3SOYA 1QVG2 1K734 1SQWA 1AVKA 1TFOA 3CNMA 3J7Yd 3Q1CA 1O7NB 3LTCA 1Q814 1WMPA 1U8CB 3NM7A 1GS3A 3V98A 3X3ZA 3CC23 3WOEB 1E3RA 4KFEA 1IT8A 3NX0A 3S28A 1AV4A 1ZO2A 1VQK3 4HM1B 3WMDA 1KD14 3ALAA 5IG0A 2OOVA 1ASKA 3UL6A 4O2HA 4EC6A 2K0MA 3D3LA 3PZWA 1Q42A 1FGMA 2CFDA 3HIGA 2OOVC 1YGEA 1LOXA 2JQ5A 1DMNA 3BNDA 2LYXA 2Q07A 1W7CA 4G1MB 2IUKA 2W56A 5KP3A 3MWZA 1OUNA 3FKAA 4HZ9B 1YJN3 2W6JH 1AVLA 4L8OA 5KP4A 5JPUA 3CCV3 1DVDA 1W5ZA 1WMNA 3BNCA 3KIIA 1K41A 3S5CA 3GZRA 3EJVA 3KZTA 1WQLB 5EEOA 3SVAA 2BMQB 1JRQA 3S27A 2CWVA 3H3HA 3N8BA 3GZBA 3JVCA 3DGMA 2HMNB 3U97A 1VQ63 3CNXA 3DY5A 1D6YA 2B1XB 2QA43 1GY5A 4RBNA 1M1K4 3DM8A 1JNQA 1ULIB 3CC43 1OPYA 1K28A 4HKVB 5LC6A 1IT7A 3WDGB 3I0YA 4N6LA 4BTXA 1JKGB 1VQM3 4PEJA 1DMMA 4OK0A 4O3VA 4LEHA 1DMQA 2Y74A 4HJLB 5I97A 3G4S3 1LNHA 4LZIA 1VQ73 2P0MA 4MJDA 2CHCA 2XFSA 1FA3A 1Q40B 1N9EA 3HK4A 2FXTA 2SBLA 1JN5B 3WODG 1VQL3 1EQKA 3B8LA 4N6TA 3MHEA 2C11A 3F14A 1O7PB 2GEXA 1IU7A 3FLJA 4RZMA 3QRDA 5DRVA 1A67A 3TDGA 3LYGA 2IUJA 3GZYB 4RNZA 3HIIA 3PXMA 3CMA3 1EA2A 2W04A 1CYUA 3CXC2 1FGTA 3G6E3 3CPOA 3HZPA 3EX9A 2XR8B 3F8HA 2WO0A 1M9GA 4STDA 3G713 4WP5A 5AEUB 3RGRA 1J2BA 3EC9A 2E2UA 3RDEA 7STDA 1FUWA 3DXOA 5IEOA 1MOLA 2PZVA 2CWTA 3B4PA 1JB5A 3GZXB 2HMKB 5KP1A 3X3XA 3EN1B 3SOAA 2W56B 4WWUC 1EG9B 2BO9B 3VSYA 4LSOA 1NJI4 3N9HA 5D81A 2C10A 4MMXB 1GD4A 3FSDA 3FG1A 1QVF2 5AIGA 3OW22 5AIHA 1HU9A 3NQYA 1CQSA 2RSXA 4L7KA 3K7CA 5IERA 1QALA 2CH9A 4KFDA 2HMMB 1BUQA 5BXQA 4X2OA 5IG5A 3NM2A 2O3OA 1EKMA 3BLZA 4N6UA 2W0QA 2XSOB 1ROVA 3FG3A 2CG0A 2KCDA 5IG4A 3LH4A 5AIFA 2Y73A 3B7CA 4CCVA 2CG1A 2Z6BA 4FMCA 2UX0A 4OVMA 4R9LA 4XM4A 2CK3H 1YJ93 2BMRB 4HBRA 3JUNA 5IW9A 1CEWI 1W6YA 4XBYA 1E3VA 3IMAB 3MPHA 3Q2PA 4HM0B 2YFIB 2BHMA 2WGQA 4FMBA 4HM4B 1OGZA 2KRTA 3SLUA 2IA7A 3T0UA 2HMJB 4KFFA 3UNLA 2XFTA 3G0KA 1CYVA 2E2TA 2B24B 3VF1A 3I563 5HGRA 2BT3A 3X42A 4HYZA 1TP6A 2P09A 4J9AA 1LVNA 3MG3A 2ZDJA 3PYJA 5JPPA 4X2HA 2QEX3 1NB5I 1L5GB 1OHOA 4GL6A 1VQ43 3PCRA 3N54B 3CCR3 1STFI 4WYKA 3B4OA 2W2CA 6STDA 1YJW3 2R4IA 2WOHA 1M1XB 4HM8B 1FGQA 3FCSB 3JUMA 4EV2A 3BNBA 1IVXA 1G96A 5EVHA 1N8R4 1VQ93 3OWUA 2A15A 2O9UX 4O02B 3NBJA 3STDA 3WA3A 3LT9A 2OCTA 1NO3A 2W03A 5AEWB 4K1VA 3EBYA 3D9RA 1ZX2A 3LOYA 4R1KA 1UUWB 1IV7A 1US1A 3OXAA 5IEPA 4NHFA 3GWRA 3S67A 1TU5A 2P0XA 3NV0B 8CHOA 1RKYA 3BB9A 4LGQA 3LMLA 5AIIA 4H3UA 1IQ8A 3F7SA 1W6CA 4MMYB 3CCJ3 3FGYA 2GU3A 1UUVB 4JRFA 2F86B 1F8NA 4ORLA 3LTAA 3CCM3 3OWSA 2XSHB 4ZM8A 1PU4A 5LC7A 2GBXB 1IDPA 2GU1A 1DYUA 3CCS3 1V74A 1MNLA 1FGRA 1C7HA 2MF7A 2CC3A 3DUKA 3CD63 1W2ZA 3U1WA 3ER7A 3NHXA 1T5YA 3S29A 3EHCA 1W00A 4U13A 3EN8A 4I4KA 3ROBA 2F99A 3FG4A 4NREA 4AKYA 3X41A 1U5OA 4FMDA 3K9MC 4OUQA 3SXXA 3DMCA 3LTDA 2LQVA 4FCJA 2D42A 3CCQ3 1RRHA 1TIJA 1ULJB 4RNYA 5AYRB 3ECFA 5G2GA 1N8QA 4HM6B 3GAXA 2XRXB 1D6UA 2D1WA 4EBGA 4HZBB 3JUPA 3RGAA 1OHSA 1SPUA 2BMOB 1VQP3 1K8A4 2F98A 1YVBI 2YX9A 2CFLA 2CIUA 3UL5A 2XF3A 3G8ZA 2RCDA 3PGBA 2W9PA 5ELJA 1YIT3 2P05A 1IQYA 1UW1A 2FNQA 1STDA 3MG1A 1JKGA 4KVHA 3F8XA 4WHAA 1OF5A 2XH9A 2XGNA 3AMOA 3KSED 4FMAA 2W9QA 3DGOA 1W6GA 4KZ1A 1Q40A 2HMLB 3HX8A 4XDWA 4N6V0 3CME3 1PFPA 1IK3A 4JF8A 1QJGA 3KSPA 1Y4KA 1DVCA 2M7OA 5IG3A 1YIJ3 1SIIA 1NU3A 1Q824 4N6OB 3CCL3 1KQS2 1QAFA 3A76A 3DZLA 1QAKA 2Z77A 1NWWA 4MMZB 3CCE3 4K61A 1HKXA 2CFWA 1OCVA 2QGUA 4FR9A 3WA2X 1N5PA 4AKZA 3FF2A 2RGQA 3VGNA 3I553 1O7WB 4QWTA 3K5TA 2HMOB 1A2VA 4EXRA 4IPBA 1S5AA 1D6ZA 3CC73 1NB3I 3SX1A 2JDIH 4K1UA 1JB4A 1GYBA 5DREA 1IQXA 4K90B 1GD3A 4N6NB 1IVVA 1VQ53 4EYCA 3O8YA 1OACA 2XEPA 4HVNA 5D83A 2QIYA 2Z76A 3PCSA 4N3VA 1VQN3 4R9KA 2GEYA 3NBRA 3F7XA 3GRDA 2BNGA 1JV2B 4Q53A 2GBWB 1O7GB 3MSOA 4N6MA 4XBXA 5STDA 4BTWA 1N9JA 3FH1A 5FW5A 3EF8A 3G16A 3OX9A 5EQLA 1YI23 4GB5A 5JBSA 2STDA 3DGNA 3IPTA 4WFOA 3KE7A 1O7HB 2YFLB 3CU3A 2E2VA 1QMAA 5FGOA 1TUHA 2ML6A 5BVBA 1S723 1M904 3QK9A 2L4VA 3M8CA 3KFQC 1OHPA 1VQO3 1GY7A 3MG2A 4HM2B 5TGNA 3E99A 3EBTA 1W01A 1GY6A 2XGLA 3SEDA 1YHQ3 1JB2A 2WGOA 2P38A 1UI8A 2CKFB 2ZL8A 1OH0A 1OF5B 2IMJA 3AMOB 3EB8A 2Z7AA 3MKIA 5CK6A 3V92A 1WTHA 3X40A 1W2B2 5IENA 5CF2A 3NUVA 3MYTA 4IIAA 3JUQA 3T8NA 1AR0A 3V99A 1IV9A 3H51A 2CFKA 2OTJ3 4O8SA 2CW9A 2WOFA 1JJ22 1E97A 5CLKA 1O7MB 3WOFB 1IVWA 3K0ZA 1N5HA 4L8PA 2K54A 5CXOA 1R4CA 4LMIA 2RFRA 1LXEA 3KN4A 4TX4A 4XDVA 3K63A 5A0OB 2I9WA 3F40A 3IJEB 3L0RA 1W4NA 5CF1A 2FGTA 3JUOA 3LZAA 3T8UA 2KXGA 4XB5A 3CPW2 2OWPA 1UI7A 2PNCA 1ISKA 3BNEA 2GXFA 3DGLA 1K9M4 1Q864 3KKGA 1RJOA 3LTBA 4HM5B 4MEIA 4WYKB 1RRLA 1WNHA 3FF0A 3NXJA 5AI1A 4EV5A 3Q90A 4FCZA 4HM7B 1IVUA 1ROAA 4R80A 2OTL3 3EQQB 3HI7A 1KWIA 3OWYA 1SJWA 3NV0A 3UB1A 4BTYA 5D82A 2INXA 1FGOA 2ML5A 3FZWA 1RN7A 3F9SA 3PS8A 1VQ83 2CFGA 3NBBA 3NQZA 1A90A 3LT8A 1WMOA 4CDLA 1KSIA 5IF6A 1JN5A 4R4KA 2YFJB 4FCMA 4HM3B 3EE1A 5AYSC 3OV4A 4AEQA 3X3YA 4H61A 4XBTA 2OQEA 2CWUA 5ELUA 2V1LA 3LXUX 1SIHA 4J8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W02 A;  1NDO B;  1VZZ A;  1Z1S A;  1OGX A;  3UJM A;  1A2K A;  3SOY A;  3CNM A;  1O7N B;  1GS3 A;  1E3R A;  1ZO2 A;  4HM1 B;  3WMD A;  5IG0 A;  1ASK A;  1Q42 A;  2JQ5 A;  1DMN A;  5KP3 A;  1OUN A;  3FKA A;  4HZ9 B;  5KP4 A;  4L8O A;  5JPU A;  3S5C A;  1K41 A;  3GZR A;  3EJV A;  3KZT A;  1WQL B;  2BMQ B;  3H3H A;  3GZB A;  2HMN B;  3CNX A;  2B1X B;  1GY5 A;  3DM8 A;  1ULI B;  1OPY A;  4HKV B;  3I0Y A;  1JKG B;  4PEJ A;  1DMM A;  4LEH A;  1DMQ A;  4HJL B;  4MJD A;  2CHC A;  1Q40 B;  3HK4 A;  1JN5 B;  3B8L A;  3MHE A;  3F14 A;  1O7P B;  2GEX A;  3FLJ A;  4RZM A;  5DRV A;  3LYG A;  3GZY B;  1EA2 A;  3CPO A;  3HZP A;  3EX9 A;  2XR8 B;  3F8H A;  4STD A;  4WP5 A;  5AEU B;  3RGR A;  3EC9 A;  7STD A;  3DXO A;  5IEO A;  2PZV A;  3B4P A;  1JB5 A;  3GZX B;  2HMK B;  5KP1 A;  3EN1 B;  3SOA A;  4WWU C;  1EG9 B;  3VSY A;  5D81 A;  3FSD A;  5AIG A;  5AIH A;  1CQS A;  4L7K A;  3K7C A;  5IER A;  2HMM B;  1BUQ A;  5BXQ A;  4X2O A;  5IG5 A;  3NM2 A;  3BLZ A;  2XSO B;  5IG4 A;  5AIF A;  3B7C A;  4OVM A;  2UX0 A;  4R9L A;  4XM4 A;  2BMR B;  3JUN A;  1W6Y A;  4XBY A;  1E3V A;  4HM0 B;  2YFI B;  4HM4 B;  1OGZ A;  2HMJ B;  3UNL A;  3G0K A;  2B24 B;  5HGR A;  1TP6 A;  4J9A A;  3MG3 A;  5JPP A;  4X2H A;  1OHO A;  4WYK A;  3B4O A;  2W2C A;  6STD A;  2R4I A;  4HM8 B;  3JUM A;  5EVH A;  3OWU A;  2A15 A;  3STD A;  5AEW B;  4K1V A;  3EBY A;  3D9R A;  1ZX2 A;  4R1K A;  1UUW B;  5IEP A;  3OXA A;  3GWR A;  3NV0 B;  8CHO A;  3BB9 A;  4LGQ A;  5AII A;  4H3U A;  3F7S A;  3FGY A;  1UUV B;  2F86 B;  4ORL A;  3OWS A;  2XSH B;  2GBX B;  1IDP A;  1C7H A;  3DUK A;  3ER7 A;  3NHX A;  3EHC A;  1W00 A;  4U13 A;  3EN8 A;  4I4K A;  3ROB A;  2F99 A;  1U5O A;  4OUQ A;  3DMC A;  4FCJ A;  1ULJ B;  3ECF A;  5G2G A;  4HM6 B;  2XRX B;  4HZB B;  3JUP A;  3RGA A;  1OHS A;  2BMO B;  2F98 A;  3G8Z A;  2RCD A;  1STD A;  3MG1 A;  1JKG A;  4KVH A;  3F8X A;  1OF5 A;  1Q40 A;  2HML B;  3HX8 A;  4XDW A;  1QJG A;  3KSP A;  5IG3 A;  1NU3 A;  3A76 A;  3DZL A;  2Z77 A;  1NWW A;  1HKX A;  2QGU A;  1OCV A;  3FF2 A;  2RGQ A;  3VGN A;  1O7W B;  2HMO B;  1S5A A;  4K1U A;  1JB4 A;  1GYB A;  5DRE A;  4HVN A;  5D83 A;  2QIY A;  2Z76 A;  4N3V A;  4R9K A;  2GEY A;  3NBR A;  3F7X A;  3GRD A;  2BNG A;  4Q53 A;  5STD A;  2GBW B;  1O7G B;  3MSO A;  4XBX A;  3FH1 A;  5FW5 A;  3EF8 A;  3G16 A;  3OX9 A;  4GB5 A;  2STD A;  3IPT A;  3KE7 A;  1O7H B;  2YFL B;  3CU3 A;  1QMA A;  1TUH A;  5BVB A;  3M8C A;  1OHP A;  1GY7 A;  3MG2 A;  4HM2 B;  5TGN A;  3E99 A;  3EBT A;  1W01 A;  1GY6 A;  3SED A;  1JB2 A;  2CKF B;  1OH0 A;  1OF5 B;  2IMJ A;  2Z7A A;  3MKI A;  5CK6 A;  5IEN A;  5CF2 A;  3NUV A;  3MYT A;  4IIA A;  3JUQ A;  3T8N A;  1AR0 A;  3H51 A;  1E97 A;  5CLK A;  1O7M B;  3K0Z A;  4L8P A;  2K54 A;  5CXO A;  4LMI A;  2RFR A;  4XDV A;  2I9W A;  3F40 A;  5CF1 A;  3JUO A;  3LZA A;  3T8U A;  4XB5 A;  2OWP A;  1ISK A;  2GXF A;  3KKG A;  4HM5 B;  4WYK B;  3FF0 A;  3NXJ A;  5AI1 A;  3Q90 A;  4HM7 B;  3EQQ B;  3OWY A;  1SJW A;  3NV0 A;  5D82 A;  2INX A;  3FZW A;  3F9S A;  4CDL A;  5IF6 A;  1JN5 A;  2YFJ B;  4FCM A;  4HM3 B;  3OV4 A;  4XBT A;  4J8T A; 
#chains in the Genus database with same CATH topology
 4IT7 A;  1W02 A;  1B2X A;  1NDO B;  2OQE C;  1VZZ A;  1Z1S A;  1Q7Y 4;  1KC8 4;  2MC8 A;  1OGX A;  1TFK A;  3UJM A;  3CCU 3;  1A2K A;  3SOY A;  1QVG 2;  1K73 4;  1SQW A;  1Q7H A;  1AVK A;  1TFO A;  1GOU A;  3BIR A;  3CNM A;  3J7Y d;  1BRN L;  2AAD A;  2SAR A;  1O7N B;  3Q1C A;  3LTC A;  1Q81 4;  1WMP A;  1U8C B;  3NM7 A;  1GS3 A;  4J5G A;  3V98 A;  3X3Z A;  3CC2 3;  3WOE B;  1E3R A;  1FUS A;  4KFE A;  1IT8 A;  3NX0 A;  3S28 A;  1AV4 A;  1ZO2 A;  1VQK 3;  4HM1 B;  3BU4 A;  1RLS A;  3WMD A;  6GSP A;  1KD1 4;  1BNR A;  3ALA A;  1TRQ A;  4BTX A;  3A5E A;  5IG0 A;  1ASK A;  2OOV A;  3UL6 A;  4O2H A;  1BSE A;  4EC6 A;  2K0M A;  3D3L A;  3PZW A;  1Q42 A;  1FGM A;  1RGA A;  2CFD A;  3HIG A;  2OOV C;  1YGE A;  1LOX A;  2JQ5 A;  1DMN A;  3BND A;  4I5Q A;  2LYX A;  2Q07 A;  1W7C A;  4G1M B;  2IUK A;  1AY7 A;  2W56 A;  1R4Y A;  5KP3 A;  3MWZ A;  1OUN A;  3FKA A;  5G1K A;  1B2U A;  4HZ9 B;  1YJN 3;  2W6J H;  1AVL A;  4L8O A;  5KP4 A;  5JPU A;  3CCV 3;  1DVD A;  1W5Z A;  1WMN A;  3BNC A;  3KII A;  1K41 A;  3S5C A;  3GZR A;  8RNT A;  3EJV A;  1RGC A;  3KZT A;  1T3B A;  1T2H A;  1WQL B;  5EEO A;  1V58 A;  3SVA A;  2BMQ B;  5GSP A;  1JRQ A;  1BRI A;  3S27 A;  2CWV A;  3H3H A;  3N8B A;  3GZB A;  3JVC A;  3DGM A;  2HMN B;  3U97 A;  1B21 A;  1VQ6 3;  3CNX A;  3DY5 A;  1D6Y A;  2B1X B;  6RNT A;  2QA4 3;  1GY5 A;  4RBN A;  3SYU A;  1M1K 4;  2L1S A;  3DM8 A;  2J8X B;  1V57 A;  1JNQ A;  1ULI B;  3CC4 3;  1OPY A;  1K28 A;  1I8V A;  1RSN A;  1IT7 A;  1MWS A;  3I0Y A;  4HKV B;  4N6L A;  5LC6 A;  1JKG B;  3WDG B;  4PEJ A;  1VQM 3;  1BNJ A;  1DMM A;  4OK0 A;  1RTU A;  4O3V A;  4LEH A;  1DMQ A;  2Y74 A;  4HJL B;  5I97 A;  3G4S 3;  1LNH A;  4LZI A;  1VQ7 3;  2P0M A;  4MJD A;  2CHC A;  2XFS A;  1FA3 A;  1Q40 B;  1UCJ A;  1N9E A;  1BSD A;  3HK4 A;  1AQZ A;  2FXT A;  2SBL A;  1JN5 B;  2UGI A;  3WOD G;  1VQL 3;  1EQK A;  3B8L A;  4N6T A;  3D79 A;  3MHE A;  2C11 A;  3F14 A;  1O7P B;  1RNB A;  2GEX A;  1IU7 A;  4BU4 A;  1BGS A;  3FLJ A;  4RZM A;  3QRD A;  5M1A A;  5DRV A;  1A67 A;  3TDG A;  3LYG A;  2F4Y A;  2IUJ A;  1BSB A;  3GZY B;  2KF6 A;  4RNZ A;  3HII A;  3PXM A;  4ILF A;  3CMA 3;  1EA2 A;  3D4A A;  2W04 A;  1CYU A;  4BIR A;  3CXC 2;  1FGT A;  1T2I A;  5BU4 A;  3G6E 3;  3CPO A;  3HZP A;  3EX9 A;  2XR8 B;  3F8H A;  2WO0 A;  1M9G A;  4STD A;  3G71 3;  1MGR A;  1UCK A;  4WP5 A;  5AEU B;  3RGR A;  1J2B A;  3EC9 A;  2E2U A;  3RDE A;  7STD A;  1FUW A;  3DXO A;  5IEO A;  1MOL A;  2PZV A;  2CWT A;  3B4P A;  1JB5 A;  4GHO A;  3GZX B;  1Q9E A;  2HMK B;  3Q3F A;  3X3X A;  5KP1 A;  3EN1 B;  3SOA A;  2W56 B;  4WWU C;  1EG9 B;  2BO9 B;  3VSY A;  2GSP A;  4LSO A;  5HOH A;  1NJI 4;  1LRA A;  3N9H A;  5D81 A;  2C10 A;  4MMX B;  1GD4 A;  3FSD A;  3FG1 A;  1A2P A;  1HZ1 A;  1QVF 2;  5AIG A;  3D5G A;  3OW2 2;  5AIH A;  1HU9 A;  3NQY A;  1CQS A;  2RSX A;  4L7K A;  3K7C A;  1ZS7 A;  1I2F A;  5IER A;  1QAL A;  2CH9 A;  2CX0 A;  4KFD A;  2HMM B;  1BUQ A;  1BNI A;  5BXQ A;  4X2O A;  5IG5 A;  3NM2 A;  2O3O A;  1EKM A;  1I3F A;  3BLZ A;  4N6U A;  1BIR A;  2W0Q A;  2XSO B;  1ROV A;  3FG3 A;  2CG0 A;  1B2Z A;  4RNT A;  2KCD A;  5IG4 A;  1X1U A;  3LH4 A;  5AIF A;  2Y73 A;  3B7C A;  1LOW A;  4CCV A;  1JBR A;  1X1X A;  1BSA A;  2CG1 A;  2Z6B A;  1BOX A;  2UX0 A;  1LQG C;  4FMC A;  2H0G A;  4OVM A;  4R9L A;  4XM4 A;  2CK3 H;  1YJ9 3;  2BMR B;  4HBR A;  2H0H A;  3DH2 A;  3JUN A;  3GSP A;  5IW9 A;  1CEW I;  1W6Y A;  4XBY A;  1E3V A;  3IMA B;  3MPH A;  3Q2P A;  4HM0 B;  1B27 A;  2YFI B;  2BHM A;  2WGQ A;  4FMB A;  1BNE A;  1OGZ A;  2KRT A;  4HM4 B;  3SLU A;  2IA7 A;  3AHS A;  3T0U A;  2HMJ B;  4KFF A;  3UNL A;  2XFT A;  3G0K A;  1CYV A;  2E2T A;  2B24 B;  3VF1 A;  1RDS A;  3I56 3;  5HGR A;  2BT3 A;  2RNT A;  3X42 A;  3AGO A;  4HYZ A;  1TP6 A;  2P09 A;  1LOV A;  4J9A A;  1LVN A;  3MG3 A;  2ZDJ A;  4LYL B;  3PYJ A;  4DKI A;  5JPP A;  1BAO A;  4X2H A;  2QEX 3;  1NB5 I;  1I0X A;  1L5G B;  1OHO A;  4GL6 A;  1VQ4 3;  3PCR A;  3N54 B;  3CCR 3;  1STF I;  4WYK A;  3B4O A;  2F5M A;  2W2C A;  6STD A;  1YJW 3;  1RGK A;  2R4I A;  1I2G A;  2WOH A;  1M1X B;  1TRP A;  1FGQ A;  3FCS B;  3JUM A;  4HM8 B;  4EV2 A;  3BNB A;  1IVX A;  1G96 A;  5EVH A;  1N8R 4;  1VQ9 3;  3OWU A;  2A15 A;  3RNT A;  2O9U X;  2KAA A;  4O02 B;  3NBJ A;  3STD A;  3WA3 A;  3LT9 A;  2OCT A;  5G1L A;  1NO3 A;  1ZGX A;  2CX1 A;  2W03 A;  5AEW B;  1EUI C;  3EBY A;  4K1V A;  1GOY A;  3D9R A;  1ZX2 A;  1YNV X;  3LOY A;  4R1K A;  1UUW B;  1IV7 A;  2BIR A;  1US1 A;  3OXA A;  5IEP A;  5M19 A;  4NHF A;  3GWR A;  3S67 A;  1TU5 A;  2P0X A;  2HOH A;  3NV0 B;  8CHO A;  1RKY A;  3BB9 A;  1VQQ A;  4LGQ A;  3LML A;  3AGN A;  5AII A;  1G0T A;  4H3U A;  1BRH A;  1IQ8 A;  3F7S A;  1W6C A;  1DE3 A;  2UUG C;  4MMY B;  3WHO A;  3CCJ 3;  3FGY A;  1PY3 A;  2GU3 A;  1UUV B;  4JRF A;  2F86 B;  1F8N A;  1BUJ A;  2KF5 A;  4ORL A;  3LTA A;  3CCM 3;  3OWS A;  1JBT A;  2XSH B;  4ZM8 A;  1JBS A;  1PU4 A;  3WR2 A;  5LC7 A;  2F56 A;  2GBX B;  1PYL A;  4J5K A;  1UGH I;  1IDP A;  1MWR A;  2GU1 A;  1DYU A;  3CCS 3;  1V74 A;  1MNL A;  1FGR A;  1C7H A;  2MF7 A;  2CC3 A;  1B20 A;  3DUK A;  1RGE A;  1W2Z A;  3CD6 3;  1MWU A;  3U1W A;  3ER7 A;  3NHX A;  1RN1 A;  1T5Y A;  3S29 A;  3EHC A;  1W00 A;  4U13 A;  3EN8 A;  1TTO A;  4I4K A;  1FYS A;  3ROB A;  2F99 A;  3FG4 A;  4NRE A;  4AKY A;  2R41 A;  1CH0 A;  3X41 A;  1U5O A;  4FMD A;  3K9M C;  4OUQ A;  3SXX A;  3DMC A;  3LTD A;  2LQV A;  4FCJ A;  2D42 A;  3CCQ 3;  1BRJ A;  1RRH A;  1TIJ A;  1ULJ B;  1FZU A;  1BVI A;  4RNY A;  4GSP A;  1GMP A;  2KF4 A;  1BU4 A;  2ZA4 A;  3ECF A;  5G2G A;  1BRS A;  5AYR B;  1N8Q A;  2BU4 A;  3GAX A;  4HM6 B;  2XRX B;  1D6U A;  2D1W A;  4EBG A;  1I0V A;  3JUP A;  4HZB B;  3RGA A;  1OHS A;  1SPU A;  2BMO B;  3HOH A;  1VQP 3;  2F98 A;  1K8A 4;  4KT3 B;  1BNG A;  1YVB I;  2YX9 A;  2CFL A;  2CIU A;  3UL5 A;  1IYY A;  2XF3 A;  3G8Z A;  2RCD A;  3PGB A;  2W9P A;  5ELJ A;  1YIT 3;  1B3S A;  2P05 A;  1IQY A;  1UW1 A;  2FNQ A;  1STD A;  2RBI A;  3MG1 A;  1JKG A;  4KVH A;  3F8X A;  4WHA A;  1OF5 A;  2XH9 A;  2XGN A;  2IYJ A;  3AMO A;  3KSE D;  4FMA A;  2W9Q A;  3DGO A;  1RN4 A;  4CJN A;  1W6G A;  1RMS A;  4KZ1 A;  1GOV A;  1Q40 A;  2HML B;  3HX8 A;  4XDW A;  4N6V 0;  3CME 3;  1PFP A;  1IK3 A;  4JF8 A;  1QJG A;  3KSP A;  1MWT A;  1Y4K A;  1DVC A;  2M7O A;  5BIR A;  5IG3 A;  1SII A;  1YIJ 3;  1NU3 A;  1Q82 4;  4N6O B;  3CCL 3;  1KQS 2;  1QAF A;  3A76 A;  3DZL A;  2K3D A;  1QAK A;  1X1Y A;  2Z77 A;  1NWW A;  4MMZ B;  1BNS A;  3CCE 3;  1C54 A;  4K61 A;  1HKX A;  2CFW A;  1OCV A;  2QGU A;  4FR9 A;  3WA2 X;  1N5P A;  4AKZ A;  3FF2 A;  2RGQ A;  3VGN A;  3I55 3;  4BL2 A;  1O7W B;  1RGG A;  1I2E A;  4HAA A;  4QWT A;  2ZHX B;  3K5T A;  2HMO B;  1A2V A;  4EXR A;  4IPB A;  1S5A A;  1D6Z A;  3CC7 3;  1NB3 I;  3SX1 A;  2JDI H;  3ZG0 A;  2F5W A;  1JB4 A;  1GYB A;  4K1U A;  1RCL A;  5DRE A;  1EEJ A;  1IQX A;  4K90 B;  1UDI I;  1GD3 A;  2KF3 A;  4N6N B;  3URP A;  1GMQ A;  1RHL A;  1IVV A;  1VQ5 3;  7RNT A;  4EYC A;  3O8Y A;  1OAC A;  2XEP A;  4HVN A;  5D83 A;  1B2M A;  2QIY A;  2Z76 A;  3PCS A;  4N3V A;  1VQN 3;  4R9K A;  2IY2 A;  1UCI A;  2GEY A;  3NBR A;  3F7X A;  3GRD A;  5RNT A;  2BNG A;  1JV2 B;  3AHW A;  2GBW B;  1O7G B;  3MSO A;  4N6M A;  4Q53 A;  4XBX A;  5STD A;  1N9J A;  3FH1 A;  3KCH A;  5FW5 A;  3EF8 A;  3DGY A;  1RCK A;  3G16 A;  3OX9 A;  5EQL A;  1YI2 3;  3ZG5 A;  4NPB A;  1RGF A;  4GB5 A;  5JBS A;  2STD A;  3DGN A;  3IPT A;  4WFO A;  3D5I A;  3KE7 A;  1O7H B;  1SAR A;  2YFL B;  3CU3 A;  2E2V A;  1QMA A;  5FGO A;  1TUH A;  2ML6 A;  3ZFZ A;  5BVB A;  1S72 3;  1JZD A;  1M90 4;  3QK9 A;  2L4V A;  3M8C A;  3KFQ C;  1OHP A;  1VQO 3;  1I70 A;  1GY7 A;  3MG2 A;  4HM2 B;  1RNT A;  5TGN A;  3E99 A;  4EW5 A;  3EBT A;  1W01 A;  4HOH A;  1GY6 A;  2XGL A;  3SED A;  1YHQ 3;  1BAN A;  1JB2 A;  1G02 A;  2P38 A;  1UI8 A;  2WGO A;  1I3I A;  2CKF B;  2ZL8 A;  1OH0 A;  1OF5 B;  2IMJ A;  3AMO B;  1TJD A;  3EB8 A;  2Z7A A;  3MKI A;  5CK6 A;  3V92 A;  1WTH A;  3X40 A;  9RNT A;  1W2B 2;  5IEN A;  1YVS A;  5M18 A;  1FUT A;  5CF2 A;  3NUV A;  3MYT A;  1BSC A;  4IIA A;  3JUQ A;  3T8N A;  1AR0 A;  2H0I A;  3V99 A;  1IV9 A;  3H51 A;  2CFK A;  2OTJ 3;  1FW7 A;  4O8S A;  2CW9 A;  2WOF A;  1JJ2 2;  1E97 A;  5CLK A;  1O7M B;  3WOF B;  1IVW A;  3K0Z A;  1N5H A;  4L8P A;  2K54 A;  5CXO A;  1R4C A;  4LMI A;  2RFR A;  4BL3 A;  1LXE A;  3KN4 A;  4TX4 A;  4XDV A;  3K63 A;  2C4B A;  5A0O B;  2I9W A;  3F40 A;  3IJE B;  1DET A;  1W4N A;  3L0R A;  1BRG A;  5CF1 A;  2FGT A;  1LOY A;  3JUO A;  1LQM B;  3LZA A;  3T8U A;  2KXG A;  4XB5 A;  3CPW 2;  1NNV A;  2OWP A;  1UI7 A;  2PNC A;  1ISK A;  4CPK A;  3BNE A;  2GXF A;  3DGL A;  1K9M 4;  1Q86 4;  1X1W A;  2AAE A;  1UUG B;  1GSP A;  3KKG A;  1RJO A;  3LTB A;  4HM5 B;  4MEI A;  4WYK B;  1RRL A;  1B2S A;  1WNH A;  3FF0 A;  3NXJ A;  1RGH A;  5AI1 A;  4EV5 A;  3Q90 A;  4FCZ A;  4HM7 B;  1IVU A;  1ROA A;  4R80 A;  2OTL 3;  3EQQ B;  3HI7 A;  1KWI A;  3OWY A;  1SJW A;  1BRK A;  3NV0 A;  1YGW A;  3UB1 A;  4BTY A;  4BTW A;  5D82 A;  7GSP A;  1BNF A;  2INX A;  1FGO A;  2ML5 A;  3FZW A;  1RN7 A;  3F9S A;  1RGL A;  3PS8 A;  1VQ8 3;  2CFG A;  3NBB A;  1GMR A;  3NQZ A;  3LT8 A;  1A90 A;  1WMO A;  4CDL A;  1KSI A;  5IF6 A;  1JN5 A;  4R4K A;  2YFJ B;  1HYF A;  1LNI A;  4FCM A;  3EE1 A;  3LXU X;  3OV4 A;  4HM3 B;  5AYS C;  4AEQ A;  3X3Y A;  1JZO A;  1MGW A;  4H61 A;  4XBT A;  2CWU A;  2OQE A;  5ELU A;  2V1L A;  1UGI A;  1UCL A;  1SIH A;  4J8T A; 
#chains in the Genus database with same CATH homology
 4IT7 A;  1W02 A;  1NDO B;  2OQE C;  1VZZ A;  1Z1S A;  1Q7Y 4;  1KC8 4;  2MC8 A;  1OGX A;  1TFK A;  3UJM A;  3CCU 3;  1A2K A;  3SOY A;  1QVG 2;  1K73 4;  1SQW A;  1AVK A;  1TFO A;  3CNM A;  3J7Y d;  3Q1C A;  1O7N B;  3LTC A;  1Q81 4;  1WMP A;  1U8C B;  3NM7 A;  1GS3 A;  3V98 A;  3X3Z A;  3CC2 3;  3WOE B;  1E3R A;  4KFE A;  1IT8 A;  3NX0 A;  3S28 A;  1AV4 A;  1ZO2 A;  1VQK 3;  4HM1 B;  3WMD A;  1KD1 4;  3ALA A;  5IG0 A;  2OOV A;  1ASK A;  3UL6 A;  4O2H A;  4EC6 A;  2K0M A;  3D3L A;  3PZW A;  1Q42 A;  1FGM A;  2CFD A;  3HIG A;  2OOV C;  1YGE A;  1LOX A;  2JQ5 A;  1DMN A;  3BND A;  2LYX A;  2Q07 A;  1W7C A;  4G1M B;  2IUK A;  2W56 A;  5KP3 A;  3MWZ A;  1OUN A;  3FKA A;  4HZ9 B;  1YJN 3;  2W6J H;  1AVL A;  4L8O A;  5KP4 A;  5JPU A;  3CCV 3;  1DVD A;  1W5Z A;  1WMN A;  3BNC A;  3KII A;  1K41 A;  3S5C A;  3GZR A;  3EJV A;  3KZT A;  1WQL B;  5EEO A;  3SVA A;  2BMQ B;  1JRQ A;  3S27 A;  2CWV A;  3H3H A;  3N8B A;  3GZB A;  3JVC A;  3DGM A;  2HMN B;  3U97 A;  1VQ6 3;  3CNX A;  3DY5 A;  1D6Y A;  2B1X B;  2QA4 3;  1GY5 A;  4RBN A;  1M1K 4;  3DM8 A;  1JNQ A;  1ULI B;  3CC4 3;  1OPY A;  1K28 A;  4HKV B;  5LC6 A;  1IT7 A;  3WDG B;  3I0Y A;  4N6L A;  4BTX A;  1JKG B;  1VQM 3;  4PEJ A;  1DMM A;  4OK0 A;  4O3V A;  4LEH A;  1DMQ A;  2Y74 A;  4HJL B;  5I97 A;  3G4S 3;  1LNH A;  4LZI A;  1VQ7 3;  2P0M A;  4MJD A;  2CHC A;  2XFS A;  1FA3 A;  1Q40 B;  1N9E A;  3HK4 A;  2FXT A;  2SBL A;  1JN5 B;  3WOD G;  1VQL 3;  1EQK A;  3B8L A;  4N6T A;  3MHE A;  2C11 A;  3F14 A;  1O7P B;  2GEX A;  1IU7 A;  3FLJ A;  4RZM A;  3QRD A;  5DRV A;  1A67 A;  3TDG A;  3LYG A;  2IUJ A;  3GZY B;  4RNZ A;  3HII A;  3PXM A;  3CMA 3;  1EA2 A;  2W04 A;  1CYU A;  3CXC 2;  1FGT A;  3G6E 3;  3CPO A;  3HZP A;  3EX9 A;  2XR8 B;  3F8H A;  2WO0 A;  1M9G A;  4STD A;  3G71 3;  4WP5 A;  5AEU B;  3RGR A;  1J2B A;  3EC9 A;  2E2U A;  3RDE A;  7STD A;  1FUW A;  3DXO A;  5IEO A;  1MOL A;  2PZV A;  2CWT A;  3B4P A;  1JB5 A;  3GZX B;  2HMK B;  5KP1 A;  3X3X A;  3EN1 B;  3SOA A;  2W56 B;  4WWU C;  1EG9 B;  2BO9 B;  3VSY A;  4LSO A;  1NJI 4;  3N9H A;  5D81 A;  2C10 A;  4MMX B;  1GD4 A;  3FSD A;  3FG1 A;  1QVF 2;  5AIG A;  3OW2 2;  5AIH A;  1HU9 A;  3NQY A;  1CQS A;  2RSX A;  4L7K A;  3K7C A;  5IER A;  1QAL A;  2CH9 A;  4KFD A;  2HMM B;  1BUQ A;  5BXQ A;  4X2O A;  5IG5 A;  3NM2 A;  2O3O A;  1EKM A;  3BLZ A;  4N6U A;  2W0Q A;  2XSO B;  1ROV A;  3FG3 A;  2CG0 A;  2KCD A;  5IG4 A;  3LH4 A;  5AIF A;  2Y73 A;  3B7C A;  4CCV A;  2CG1 A;  2Z6B A;  4FMC A;  2UX0 A;  4OVM A;  4R9L A;  4XM4 A;  2CK3 H;  1YJ9 3;  2BMR B;  4HBR A;  3JUN A;  5IW9 A;  1CEW I;  1W6Y A;  4XBY A;  1E3V A;  3IMA B;  3MPH A;  3Q2P A;  4HM0 B;  2YFI B;  2BHM A;  2WGQ A;  4FMB A;  4HM4 B;  1OGZ A;  2KRT A;  3SLU A;  2IA7 A;  3T0U A;  2HMJ B;  4KFF A;  3UNL A;  2XFT A;  3G0K A;  1CYV A;  2E2T A;  2B24 B;  3VF1 A;  3I56 3;  5HGR A;  2BT3 A;  3X42 A;  4HYZ A;  1TP6 A;  2P09 A;  4J9A A;  1LVN A;  3MG3 A;  2ZDJ A;  3PYJ A;  5JPP A;  4X2H A;  2QEX 3;  1NB5 I;  1L5G B;  1OHO A;  4GL6 A;  1VQ4 3;  3PCR A;  3N54 B;  3CCR 3;  1STF I;  4WYK A;  3B4O A;  2W2C A;  6STD A;  1YJW 3;  2R4I A;  2WOH A;  1M1X B;  4HM8 B;  1FGQ A;  3FCS B;  3JUM A;  4EV2 A;  3BNB A;  1IVX A;  1G96 A;  5EVH A;  1N8R 4;  1VQ9 3;  3OWU A;  2A15 A;  2O9U X;  4O02 B;  3NBJ A;  3STD A;  3WA3 A;  3LT9 A;  2OCT A;  1NO3 A;  2W03 A;  5AEW B;  4K1V A;  3EBY A;  3D9R A;  1ZX2 A;  3LOY A;  4R1K A;  1UUW B;  1IV7 A;  1US1 A;  3OXA A;  5IEP A;  4NHF A;  3GWR A;  3S67 A;  1TU5 A;  2P0X A;  3NV0 B;  8CHO A;  1RKY A;  3BB9 A;  4LGQ A;  3LML A;  5AII A;  4H3U A;  1IQ8 A;  3F7S A;  1W6C A;  4MMY B;  3CCJ 3;  3FGY A;  2GU3 A;  1UUV B;  4JRF A;  2F86 B;  1F8N A;  4ORL A;  3LTA A;  3CCM 3;  3OWS A;  2XSH B;  4ZM8 A;  1PU4 A;  5LC7 A;  2GBX B;  1IDP A;  2GU1 A;  1DYU A;  3CCS 3;  1V74 A;  1MNL A;  1FGR A;  1C7H A;  2MF7 A;  2CC3 A;  3DUK A;  3CD6 3;  1W2Z A;  3U1W A;  3ER7 A;  3NHX A;  1T5Y A;  3S29 A;  3EHC A;  1W00 A;  4U13 A;  3EN8 A;  4I4K A;  3ROB A;  2F99 A;  3FG4 A;  4NRE A;  4AKY A;  3X41 A;  1U5O A;  4FMD A;  3K9M C;  4OUQ A;  3SXX A;  3DMC A;  3LTD A;  2LQV A;  4FCJ A;  2D42 A;  3CCQ 3;  1RRH A;  1TIJ A;  1ULJ B;  4RNY A;  5AYR B;  3ECF A;  5G2G A;  1N8Q A;  4HM6 B;  3GAX A;  2XRX B;  1D6U A;  2D1W A;  4EBG A;  4HZB B;  3JUP A;  3RGA A;  1OHS A;  1SPU A;  2BMO B;  1VQP 3;  1K8A 4;  2F98 A;  1YVB I;  2YX9 A;  2CFL A;  2CIU A;  3UL5 A;  2XF3 A;  3G8Z A;  2RCD A;  3PGB A;  2W9P A;  5ELJ A;  1YIT 3;  2P05 A;  1IQY A;  1UW1 A;  2FNQ A;  1STD A;  3MG1 A;  1JKG A;  4KVH A;  3F8X A;  4WHA A;  1OF5 A;  2XH9 A;  2XGN A;  3AMO A;  3KSE D;  4FMA A;  2W9Q A;  3DGO A;  1W6G A;  4KZ1 A;  1Q40 A;  2HML B;  3HX8 A;  4XDW A;  4N6V 0;  3CME 3;  1PFP A;  1IK3 A;  4JF8 A;  1QJG A;  3KSP A;  1Y4K A;  1DVC A;  2M7O A;  5IG3 A;  1YIJ 3;  1SII A;  1NU3 A;  1Q82 4;  4N6O B;  3CCL 3;  1KQS 2;  1QAF A;  3A76 A;  3DZL A;  1QAK A;  2Z77 A;  1NWW A;  4MMZ B;  3CCE 3;  4K61 A;  1HKX A;  2CFW A;  1OCV A;  2QGU A;  4FR9 A;  3WA2 X;  1N5P A;  4AKZ A;  3FF2 A;  2RGQ A;  3VGN A;  3I55 3;  1O7W B;  4QWT A;  3K5T A;  2HMO B;  1A2V A;  4EXR A;  4IPB A;  1S5A A;  1D6Z A;  3CC7 3;  1NB3 I;  3SX1 A;  2JDI H;  4K1U A;  1JB4 A;  1GYB A;  5DRE A;  1IQX A;  4K90 B;  1GD3 A;  4N6N B;  1IVV A;  1VQ5 3;  4EYC A;  3O8Y A;  1OAC A;  2XEP A;  4HVN A;  5D83 A;  2QIY A;  2Z76 A;  3PCS A;  4N3V A;  1VQN 3;  4R9K A;  2GEY A;  3NBR A;  3F7X A;  3GRD A;  2BNG A;  1JV2 B;  4Q53 A;  2GBW B;  1O7G B;  3MSO A;  4N6M A;  4XBX A;  5STD A;  4BTW A;  1N9J A;  3FH1 A;  5FW5 A;  3EF8 A;  3G16 A;  3OX9 A;  5EQL A;  1YI2 3;  4GB5 A;  5JBS A;  2STD A;  3DGN A;  3IPT A;  4WFO A;  3KE7 A;  1O7H B;  2YFL B;  3CU3 A;  2E2V A;  1QMA A;  5FGO A;  1TUH A;  2ML6 A;  5BVB A;  1S72 3;  1M90 4;  3QK9 A;  2L4V A;  3M8C A;  3KFQ C;  1OHP A;  1VQO 3;  1GY7 A;  3MG2 A;  4HM2 B;  5TGN A;  3E99 A;  3EBT A;  1W01 A;  1GY6 A;  2XGL A;  3SED A;  1YHQ 3;  1JB2 A;  2WGO A;  2P38 A;  1UI8 A;  2CKF B;  2ZL8 A;  1OH0 A;  1OF5 B;  2IMJ A;  3AMO B;  3EB8 A;  2Z7A A;  3MKI A;  5CK6 A;  3V92 A;  1WTH A;  3X40 A;  1W2B 2;  5IEN A;  5CF2 A;  3NUV A;  3MYT A;  4IIA A;  3JUQ A;  3T8N A;  1AR0 A;  3V99 A;  1IV9 A;  3H51 A;  2CFK A;  2OTJ 3;  4O8S A;  2CW9 A;  2WOF A;  1JJ2 2;  1E97 A;  5CLK A;  1O7M B;  3WOF B;  1IVW A;  3K0Z A;  1N5H A;  4L8P A;  2K54 A;  5CXO A;  1R4C A;  4LMI A;  2RFR A;  1LXE A;  3KN4 A;  4TX4 A;  4XDV A;  3K63 A;  5A0O B;  2I9W A;  3F40 A;  3IJE B;  3L0R A;  1W4N A;  5CF1 A;  2FGT A;  3JUO A;  3LZA A;  3T8U A;  2KXG A;  4XB5 A;  3CPW 2;  2OWP A;  1UI7 A;  2PNC A;  1ISK A;  3BNE A;  2GXF A;  3DGL A;  1K9M 4;  1Q86 4;  3KKG A;  1RJO A;  3LTB A;  4HM5 B;  4MEI A;  4WYK B;  1RRL A;  1WNH A;  3FF0 A;  3NXJ A;  5AI1 A;  4EV5 A;  3Q90 A;  4FCZ A;  4HM7 B;  1IVU A;  1ROA A;  4R80 A;  2OTL 3;  3EQQ B;  3HI7 A;  1KWI A;  3OWY A;  1SJW A;  3NV0 A;  3UB1 A;  4BTY A;  5D82 A;  2INX A;  1FGO A;  2ML5 A;  3FZW A;  1RN7 A;  3F9S A;  3PS8 A;  1VQ8 3;  2CFG A;  3NBB A;  3NQZ A;  1A90 A;  3LT8 A;  1WMO A;  4CDL A;  1KSI A;  5IF6 A;  1JN5 A;  4R4K A;  2YFJ B;  4FCM A;  4HM3 B;  3EE1 A;  5AYS C;  3OV4 A;  4AEQ A;  3X3Y A;  4H61 A;  4XBT A;  2OQE A;  2CWU A;  5ELU A;  2V1L A;  3LXU X;  1SIH A;  4J8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...