1BIRA

Ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNAVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title A catalytic function for the structurally conserved residue Phe 100 of ribonuclease T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1birA00
1PY3A 1BVIA 1BGSA 1RMSA 1B2UA 2C4BA 1B2XA 6RNTA 3AHWA 3DH2A 4J5KA 1RHLA 1JBTA 1UCJA 1BSCA 1FZUA 1I70A 2KF5A 1I3IA 1GSPA 1BNIA 3AGOA 3DGYA 1BRIA 2KF4A 1BNEA 1I3FA 3SYUA 2RBIA 1JBSA 1I8VA 1MGRA 1LNIA 1G02A 1X1XA 2BU4A 2HOHA 1RGLA 4BIRA 1PYLA 1FW7A 1MGWA 5RNTA 2BIRA 2ZA4A 2AAEA 3WR2A 7RNTA 1BRJA 1RTUA 1RGEA 1BU4A 3AGNA 1A2PA 1RN1A 1RN4A 1RGCA 1RSNA 1BIRA 4GHOA 6GSPA 3KCHA 1R4YA 3HOHA 1BRNL 1FUSA 1CH0A 2SARA 1BSAA 4GSPA 1BSEA 1DE3A 1ZGXA 1TTOA 2RNTA 1AY7A 1IYYA 1FUTA 1BRHA 1GMPA 1BNRA 1LOVA 1RNBA 1Q9EA 1UCLA 1BANA 1I2EA 1HYFA 2KAAA 1BNJA 1GOVA 3URPA 1BRGA 5HOHA 1BOXA 1RGFA 2F5WA 1X1WA 2F56A 1I2GA 1I0XA 3D5GA 1BRSA 1GOYA 1BNSA 1BSBA 1LRAA 1DETA 2F4YA 4BU4A 1BNFA 1UCKA 2KF6A 9RNTA 3A5EA 3BIRA 8RNTA 1X1YA 1TRQA 1RNTA 3RNTA 1BSDA 1RLSA 1B27A 3WHOA 1BAOA 4J5GA 1T2HA 3D5IA 1HZ1A 4HOHA 1LOWA 1UCIA 1RGGA 2KF3A 1TRPA 7GSPA 1RGHA 1RGKA 5BU4A 1RCLA 3AHSA 1C54A 1GMRA 1RCKA 2F5MA 4RNTA 1RDSA 2AADA 1B2MA 1AQZA 1YNVX 1JBRA 1B2ZA 1B20A 4HAAA 3D4AA 3GSPA 1BRKA 3Q3FA 3BU4A 1B2SA 1FYSA 1I0VA 1RGAA 1SARA 1YVSA 1I2FA 5GSPA 1B21A 1BNGA 1BUJA 2GSPA 1LOYA 1YGWA 1T2IA 1GOUA 5BIRA 1X1UA 1B3SA 1GMQA
chains in the Genus database with same CATH superfamily
3D79A 2W56B 2C11A 1RMSA 3K9MC 1OUNA 4LMIA 1OACA 3LOYA 3S5CA 3I563 4OK0A 3NM2A 3DGNA 4N6UA 1U8CB 1OHOA 5ELUA 3DH2A 2W2CA 1RHLA 2GEXA 2V1LA 1VQ73 5AI1A 1I70A 4I5QA 1F8NA 1QAKA 1MWTA 3LTAA 1GSPA 1W6CA 1EEJA 3G8ZA 3MG3A 3AGOA 1VQM3 3I0YA 1KQS2 2KF4A 1QAFA 1BNEA 1Q42A 3FF2A 3MG1A 3NXJA 2O9UX 2RBIA 4J9AA 4KFEA 3CCU3 3MWZA 2Q07A 5A0OB 1G02A 2HOHA 1TP6A 3NBBA 2HMLB 1ROVA 3DZLA 2YFLB 2P05A 5AIGA 5IF6A 1IV7A 2K54A 3BB9A 1CYVA 4HM5B 2GBXB 5CF1A 1RTUA 1BU4A 1KSIA 3AGNA 4GL6A 2Z77A 4HM3B 3G0KA 2YFIB 3GAXA 3HIIA 4KFDA 4OUQA 3IJEB 3GWRA 3KN4A 5IEOA 3MKIA 3OWSA 1W01A 1TIJA 2CKFB 1CH0A 3X3ZA 1K41A 4GSPA 5FGOA 1DE3A 2CC3A 2RFRA 2QGUA 1UI8A 2RNTA 3EE1A 1D6YA 4EC6A 1SIHA 2ZL8A 3SXXA 3DUKA 4CPKA 1BNRA 4K61A 1RRLA 3PCSA 1LOVA 3PYJA 1AVKA 3JUMA 3U97A 1VQK3 3MYTA 1T3BA 2IUJA 2Z7AA 3URPA 3NBJA 1BRGA 3ECFA 4NREA 5IEPA 4R9KA 1X1WA 2F56A 1NU3A 1I2GA 4KT3B 1R4CA 4JF8A 1MWRA 1BRSA 1GOYA 1DVCA 3NM7A 1WMPA 1QALA 1LRAA 2UUGC 3LTCA 4HM7B 3EBTA 5IERA 1A2VA 2OOVA 4LEHA 3KZTA 9RNTA 1W2B2 1LQMB 2Z76A 3CPW2 7STDA 1ISKA 1UW1A 1TRQA 1QMAA 2CFLA 1MWSA 3RNTA 1RLSA 2OCTA 4O02B 4CCVA 4LSOA 3WHOA 4J5GA 1UDII 1WMNA 2KRTA 1VQN3 1HZ1A 1CQSA 3ER7A 1PFPA 4HOHA 4KZ1A 1UCIA 2IY2A 4FCJA 1IVVA 4ILFA 4ORLA 3BNEA 4R9LA 3CU3A 2L1SA 2CFKA 2XGNA 3SOAA 3CCL3 5BU4A 1RCLA 1RCKA 3CME3 1OHPA 1K9M4 3FGYA 3K63A 3LMLA 2OTL3 4FMDA 2W04A 1DYUA 1YNVX 1ASKA 2CWTA 5DREA 1STFI 3K5TA 1FGOA 1EG9B 2C10A 1YVBI 4HM2B 2Z6BA 1BRKA 3B7CA 3BU4A 4N6TA 3OXAA 4RZMA 1DVDA 2HMMB 3VSYA 2P09A 2LYXA 1I2FA 1MOLA 2GSPA 1FGRA 1TFKA 2HMNB 4G1MB 1IQYA 1GOUA 1OGXA 1ZS7A 1T5YA 2O3OA 4R4KA 1VZZA 1B3SA 3CNXA 3LT8A 3HK4A 1BVIA 1O7MB 3LYGA 2OQEA 3CCM3 2C4BA 1VQP3 1YGEA 1O7WB 4H3UA 2YFJB 3NQYA 4J5KA 1Q864 1JBTA 1A90A 3OX9A 1G0TA 1N5HA 3DGLA 3G6E3 2CG0A 1FZUA 2OOVC 2KF5A 5STDA 4ZM8A 3HX8A 4WYKA 3WA2X 3F14A 5JBSA 2P38A 4L7KA 1N9JA 3EX9A 2PZVA 3NUVA 1JBSA 4KVHA 1I8VA 5M1AA 2W9QA 2XSHB 1EUIC 1RRHA 3SOYA 1PYLA 1UI7A 5AYRB 4FCZA 3FLJA 2BIRA 3OWUA 4EYCA 1IT8A 3UJMA 1WQLB 3OV4A 4RNYA 5KP4A 3EC9A 1RN1A 4L8PA 1RN4A 4HYZA 3CPOA 3Q2PA 5I97A 1NB5I 1RSNA 6GSPA 3LT9A 1M1K4 1R4YA 3LTDA 1FUSA 4OVMA 4LZIA 1Z1SA 2BHMA 3PS8A 1BSAA 5M18A 1BSEA 4K90B 4KFFA 1STDA 2BT3A 4MEIA 1TFOA 3WMDA 3T8NA 4N6V0 1FUTA 3EN8A 3RGRA 4WHAA 3WA3A 2HMOB 1UCLA 4K1VA 5AEWB 4STDA 1BNJA 2F86B 1GOVA 4EBGA 1VQ63 2E2UA 1NJI4 2Y73A 1BOXA 1FGMA 1JB4A 4MMYB 4O8SA 1A2KA 3LH4A 4J8TA 3FSDA 4MJDA 3D5GA 3FG4A 1IK3A 1BNSA 2RGQA 1BSBA 2OQEC 2F4YA 4BU4A 1BNFA 3DM8A 3X42A 3X40A 1UCKA 1HU9A 2IA7A 2YX9A 2BMOB 1ULJB 1RNTA 1D6ZA 2XFSA 2JDIH 3AMOA 3F40A 4HM8B 4AKZA 1EQKA 1BAOA 3D5IA 3V92A 2XEPA 3OWYA 1Y4KA 1V74A 3UL5A 3F8XA 3KKGA 5IG4A 1SPUA 5DRVA 5EVHA 1TRPA 2WGQA 2XFTA 1GYBA 1RGKA 3GZBA 3AHSA 1JJ22 1C54A 4QWTA 3CMA3 1NWWA 1N5PA 4RNTA 5M19A 2BNGA 1SQWA 4BTWA 3AMOB 1ZX2A 3PZWA 1AQZA 1VQ93 3CNMA 5AIFA 2E2TA 3S29A 1B2ZA 1W6YA 2HMKB 1FGTA 3X3XA 3H3HA 4TX4A 1TJDA 4EW5A 3D4AA 2BMQB 1RN7A 1M904 3B4OA 2WGOA 1GD4A 1I0VA 1UUWB 3BLZA 3O8YA 1SARA 4HM0B 3WODG 1YVSA 3CCE3 3B4PA 3NHXA 4WWUC 1QVG2 3CC23 1UGIA 2CW9A 5IG3A 1YGWA 3LXUX 1JRQA 1L5GB 3J7Yd 1GY5A 1JKGA 1TUHA 4R1KA 2GU1A 2ML5A 5AIIA 1PY3A 4N6OB 1JV2B 3EQQB 3OW22 4FMBA 3ZG0A 3WOFB 2L4VA 3IMAB 5AYSC 2FXTA 2XRXB 3VF1A 3T0UA 1V57A 1UCJA 2ZHXB 2CWUA 1N8R4 1Q40A 3RGAA 3F7XA 3S27A 4FMCA 1BNIA 1JN5A 1BRIA 2STDA 8CHOA 3DGOA 1I3FA 1OF5A 1FGQA 3LTBA 4U13A 1YIJ3 3D9RA 2K3DA 1J2BA 1LNIA 3NX0A 1JB5A 1RGLA 4EV2A 3EN1B 4HM6B 1DMMA 3GZXB 4R80A 1MGWA 4X2HA 1MNLA 2IMJA 2ZA4A 4WP5A 3UNLA 1YI23 1Q40B 4JRFA 1OPYA 2E2VA 3WR2A 2FGTA 3MG2A 3K7CA 1RGEA 2UX0A 3U1WA 5IG5A 3F9SA 1RGCA 4PEJA 1TU5A 1IDPA 1LVNA 2HMJB 3M8CA 3KCHA 1IV9A 1O7GB 3HOHA 4XBXA 5AEUB 1VQQA 2WOFA 3STDA 2Y74A 2SARA 1CEWI 3QRDA 3MSOA 3KIIA 1TTOA 5D82A 3CC73 3T8UA 1W4NA 3ZFZA 1M1XB 5ELJA 5G2GA 3X41A 1YHQ3 3LZAA 1FA3A 1BRHA 1GMPA 5D83A 1VQ83 4Q53A 2XF3A 1Q9EA 1RNBA 3CCR3 2D42A 2KAAA 3UB1A 1NB3I 3PXMA 5JPPA 1C7HA 4H61A 4N6LA 1IVWA 1W5ZA 1IVXA 2F5WA 3JVCA 1WNHA 3DGMA 4NPBA 1I0XA 4LGQA 1DMQA 1GY6A 3NBRA 3NV0A 3X3YA 1PU4A 4WYKB 3VGNA 3NQZA 4WFOA 2WOHA 1IU7A 1OHSA 3IPTA 4L8OA 1JZDA 1AVLA 2KF6A 1U5OA 3N9HA 2W56A 3FZWA 3G16A 2JQ5A 4HBRA 4XDVA 3A5EA 3BIRA 8RNTA 4FMAA 2WO0A 2A15A 4XBYA 1S5AA 1E3RA 1OCVA 4HM4B 1BSDA 4NHFA 2CH9A 3K0ZA 4XBTA 2R41A 1GD3A 5LC7A 1S723 4I4KA 4XDWA 1NDOB 3EF8A 3F7SA 3SX1A 1YIT3 3HIGA 1RGGA 3FF0A 3Q1CA 4IT7A 4RBNA 1W00A 4BL2A 2CFWA 5IG0A 3GZRA 2KF3A 7GSPA 3WOEB 3D3LA 3KE7A 4HKVB 4HVNA 4CJNA 1O7HB 1RDSA 4XB5A 3DMCA 3G713 5LC6A 1JBRA 3JUPA 3MHEA 5D81A 2CWVA 2RSXA 2XR8B 5KP3A 2XH9A 1KC84 2MF7A 3MPHA 4HAAA 5EQLA 1HKXA 2GBWB 1Q7HA 3GSPA 5CXOA 1UGHI 4BL3A 4AKYA 1RGAA 4AEQA 1EA2A 1AR0A 2IUKA 3EJVA 3JUQA 1US1A 1BNGA 5CLKA 4BTXA 1A67A 1QJGA 1BUJA 3HI7A 1LOYA 2CFGA 1QVF2 3DY5A 1T2IA 3FCSB 1VQO3 1YJ93 2CG1A 2CFDA 5BIRA 2QA43 3SVAA 3PCRA 4K1UA 3A76A 3RDEA 2ML6A 5AIHA 1BGSA 1WMOA 2W6JH 1B2UA 3QK9A 4O2HA 1VQ53 1B2XA 6RNTA 3AHWA 1V58A 1Q814 2GXFA 1BSCA 1I3IA 1RKYA 2XGLA 3L0RA 2R4IA 1OGZA 2H0IA 4IIAA 3DGYA 2XSOB 3FG3A 4FR9A 3SYUA 1YJW3 2CK3H 1NNVA 1MGRA 4GB5A 1X1XA 2BU4A 3EBYA 3N8BA 1UUGB 3EHCA 1IVUA 3SEDA 4BIRA 4FCMA 3E99A 1FW7A 6STDA 5RNTA 1AV4A 2GEYA 2AAEA 3CCS3 3GRDA 5EEOA 1IQ8A 7RNTA 1BRJA 1W7CA 4HZ9B 1A2PA 2IYJA 2ZDJA 3H51A 1BUQA 2UGIA 1BIRA 4GHOA 4MMZB 1RJOA 2CX1A 2GU3A 3KSPA 3DXOA 1ZO2A 3BNBA 1BRNL 3BNDA 3S28A 4DKIA 1K734 3CC43 1JB2A 2F99A 3B8LA 4N6NB 4LYLB 1ZGXA 2M7OA 1N8QA 2BMRB 2SBLA 4HJLB 2OTJ3 3JUOA 1AY7A 1JKGB 1W02A 1W2ZA 2P0XA 1IYYA 1K28A 3CCJ3 4HZBB 2P0MA 4IPBA 1BANA 1I2EA 3TDGA 1HYFA 1KD14 3FH1A 2CIUA 1WTHA 1ROAA 3CCV3 1E97A 2QIYA 5FW5A 1D6UA 3V98A 1UUVB 5HOHA 1RGFA 5CK6A 3I553 1G96A 2W03A 3UL6A 1M9GA 1IT7A 2H0GA 1GY7A 4XM4A 3GZYB 3WDGB 4BTYA 2INXA 3EB8A 3KSED 1MWUA 1JN5B 1DETA 4RNZA 5KP1A 1CYUA 1OF5B 4N3VA 2CHCA 3PGBA 1N9EA 1LXEA 4EXRA 5BVBA 2MC8A 1X1YA 2BO9B 1SIIA 4N6MA 2B24B 1B27A 3HZPA 4O3VA 2I9WA 5IW9A 1T2HA 1ULIB 2F98A 3BNCA 3ZG5A 1VQL3 1LOWA 3F8HA 3Q90A 2CX0A 1NO3A 5BXQA 1GS3A 2QEX3 2LQVA 3N54B 4HM1B 3CCQ3 1YJN3 1RGHA 1LNHA 1GMRA 2FNQA 1O7NB 2F5MA 3SLUA 5TGNA 4EV5A 1KWIA 1EKMA 1VQ43 1SJWA 5CF2A 1JZOA 2AADA 5IENA 1LOXA 1E3VA 2W0QA 5G1KA 2W9PA 3S67A 5JPUA 1B2MA 3JUNA 1O7PB 1K8A4 1W6GA 1B20A 2B1XB 1Q7Y4 3FKAA 2RCDA 4MMXB 3Q3FA 1B2SA 1FYSA 1OH0A 3FG1A 2OWPA 2D1WA 3V99A 5G1LA 3G4S3 2PNCA 5GSPA 1B21A 2K0MA 3NV0B 2KXGA 3CXC2 1Q824 1DMNA 2H0HA 3KFQC 1JNQA 5HGRA 2J8XB 4CDLA 3CD63 1LQGC 2KCDA 3ALAA 4X2OA 3ROBA 1IQXA 1X1UA 1FUWA 1GMQA
chains in the Genus database with same CATH topology
1PY3A 1BVIA 1BGSA 1RMSA 1B2UA 2C4BA 1B2XA 6RNTA 3AHWA 3DH2A 4J5KA 1RHLA 1JBTA 1UCJA 1BSCA 1FZUA 1I70A 2KF5A 1I3IA 1GSPA 1BNIA 3AGOA 3DGYA 1BRIA 2KF4A 1BNEA 1I3FA 3SYUA 2RBIA 1JBSA 1I8VA 1MGRA 1LNIA 1G02A 1X1XA 2BU4A 2HOHA 1RGLA 4BIRA 1PYLA 1FW7A 1MGWA 5RNTA 2BIRA 2ZA4A 2AAEA 3WR2A 7RNTA 1BRJA 1RTUA 1RGEA 1BU4A 3AGNA 1A2PA 1RN1A 1RN4A 1RGCA 1RSNA 1BIRA 4GHOA 6GSPA 3KCHA 1R4YA 3HOHA 1BRNL 1FUSA 1CH0A 2SARA 1BSAA 4GSPA 1BSEA 1DE3A 1ZGXA 1TTOA 2RNTA 1AY7A 1IYYA 1FUTA 1BRHA 1GMPA 1BNRA 1LOVA 1RNBA 1Q9EA 1UCLA 1BANA 1I2EA 1HYFA 2KAAA 1BNJA 1GOVA 3URPA 1BRGA 5HOHA 1BOXA 1RGFA 2F5WA 1X1WA 2F56A 1I2GA 1I0XA 3D5GA 1BRSA 1GOYA 1BNSA 1BSBA 1LRAA 1DETA 2F4YA 4BU4A 1BNFA 1UCKA 2KF6A 9RNTA 3A5EA 3BIRA 8RNTA 1X1YA 1TRQA 1RNTA 3RNTA 1BSDA 1RLSA 1B27A 3WHOA 1BAOA 4J5GA 1T2HA 3D5IA 1HZ1A 4HOHA 1LOWA 1UCIA 1RGGA 2KF3A 1TRPA 7GSPA 1RGHA 1RGKA 5BU4A 1RCLA 3AHSA 1C54A 1GMRA 1RCKA 2F5MA 4RNTA 1RDSA 2AADA 1B2MA 1AQZA 1YNVX 1JBRA 1B2ZA 1B20A 4HAAA 3D4AA 3GSPA 1BRKA 3Q3FA 3BU4A 1B2SA 1FYSA 1I0VA 1RGAA 1SARA 1YVSA 1I2FA 5GSPA 1B21A 1BNGA 1BUJA 2GSPA 1LOYA 1YGWA 1T2IA 1GOUA 5BIRA 1X1UA 1B3SA 1GMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PY3 A;  1BVI A;  1BGS A;  1RMS A;  1B2U A;  2C4B A;  1B2X A;  6RNT A;  3AHW A;  3DH2 A;  4J5K A;  1RHL A;  1JBT A;  1UCJ A;  1BSC A;  1FZU A;  1I70 A;  2KF5 A;  1I3I A;  1GSP A;  1BNI A;  3AGO A;  3DGY A;  1BRI A;  2KF4 A;  1BNE A;  1I3F A;  3SYU A;  2RBI A;  1JBS A;  1I8V A;  1MGR A;  1LNI A;  1G02 A;  1X1X A;  2BU4 A;  2HOH A;  1RGL A;  4BIR A;  1PYL A;  1FW7 A;  1MGW A;  5RNT A;  2BIR A;  2ZA4 A;  2AAE A;  3WR2 A;  7RNT A;  1BRJ A;  1RTU A;  1RGE A;  1BU4 A;  3AGN A;  1A2P A;  1RN1 A;  1RN4 A;  1RGC A;  1RSN A;  1BIR A;  4GHO A;  6GSP A;  3KCH A;  1R4Y A;  3HOH A;  1BRN L;  1FUS A;  1CH0 A;  2SAR A;  1BSA A;  4GSP A;  1BSE A;  1DE3 A;  1ZGX A;  1TTO A;  2RNT A;  1AY7 A;  1IYY A;  1FUT A;  1BRH A;  1GMP A;  1BNR A;  1LOV A;  1RNB A;  1Q9E A;  1UCL A;  1BAN A;  1I2E A;  1HYF A;  2KAA A;  1BNJ A;  1GOV A;  3URP A;  1BRG A;  5HOH A;  1BOX A;  1RGF A;  2F5W A;  1X1W A;  2F56 A;  1I2G A;  1I0X A;  3D5G A;  1BRS A;  1GOY A;  1BNS A;  1BSB A;  1LRA A;  1DET A;  2F4Y A;  4BU4 A;  1BNF A;  1UCK A;  2KF6 A;  9RNT A;  3A5E A;  3BIR A;  8RNT A;  1X1Y A;  1TRQ A;  1RNT A;  3RNT A;  1BSD A;  1RLS A;  1B27 A;  3WHO A;  1BAO A;  4J5G A;  1T2H A;  3D5I A;  1HZ1 A;  4HOH A;  1LOW A;  1UCI A;  1RGG A;  2KF3 A;  1TRP A;  7GSP A;  1RGH A;  1RGK A;  5BU4 A;  1RCL A;  3AHS A;  1C54 A;  1GMR A;  1RCK A;  2F5M A;  4RNT A;  1RDS A;  2AAD A;  1B2M A;  1AQZ A;  1YNV X;  1JBR A;  1B2Z A;  1B20 A;  4HAA A;  3D4A A;  3GSP A;  1BRK A;  3Q3F A;  3BU4 A;  1B2S A;  1FYS A;  1I0V A;  1RGA A;  1SAR A;  1YVS A;  1I2F A;  5GSP A;  1B21 A;  1BNG A;  1BUJ A;  2GSP A;  1LOY A;  1YGW A;  1T2I A;  1GOU A;  5BIR A;  1X1U A;  1B3S A;  1GMQ A; 
#chains in the Genus database with same CATH topology
 3D79 A;  2W56 B;  2C11 A;  1RMS A;  3K9M C;  1OUN A;  4LMI A;  1OAC A;  3LOY A;  3S5C A;  3I56 3;  4OK0 A;  3NM2 A;  3DGN A;  4N6U A;  1U8C B;  1OHO A;  5ELU A;  3DH2 A;  2W2C A;  1RHL A;  2GEX A;  2V1L A;  1VQ7 3;  5AI1 A;  1I70 A;  4I5Q A;  1F8N A;  1QAK A;  1MWT A;  3LTA A;  1GSP A;  1W6C A;  1EEJ A;  3G8Z A;  3MG3 A;  3AGO A;  1VQM 3;  3I0Y A;  1KQS 2;  2KF4 A;  1QAF A;  1BNE A;  1Q42 A;  3FF2 A;  3MG1 A;  3NXJ A;  2O9U X;  2RBI A;  4J9A A;  4KFE A;  3CCU 3;  3MWZ A;  2Q07 A;  5A0O B;  1G02 A;  2HOH A;  1TP6 A;  3NBB A;  2HML B;  1ROV A;  3DZL A;  2YFL B;  2P05 A;  5AIG A;  5IF6 A;  1IV7 A;  2K54 A;  3BB9 A;  1CYV A;  4HM5 B;  2GBX B;  5CF1 A;  1RTU A;  1BU4 A;  1KSI A;  3AGN A;  4GL6 A;  2Z77 A;  4HM3 B;  3G0K A;  2YFI B;  3GAX A;  3HII A;  4KFD A;  4OUQ A;  3IJE B;  3GWR A;  3KN4 A;  5IEO A;  3MKI A;  3OWS A;  1W01 A;  1TIJ A;  2CKF B;  1CH0 A;  3X3Z A;  1K41 A;  4GSP A;  5FGO A;  1DE3 A;  2CC3 A;  2RFR A;  2QGU A;  1UI8 A;  2RNT A;  3EE1 A;  1D6Y A;  4EC6 A;  1SIH A;  2ZL8 A;  3SXX A;  3DUK A;  4CPK A;  1BNR A;  4K61 A;  1RRL A;  3PCS A;  1LOV A;  3PYJ A;  1AVK A;  3JUM A;  3U97 A;  1VQK 3;  3MYT A;  1T3B A;  2IUJ A;  2Z7A A;  3URP A;  3NBJ A;  1BRG A;  3ECF A;  4NRE A;  5IEP A;  4R9K A;  1X1W A;  2F56 A;  1NU3 A;  1I2G A;  4KT3 B;  1R4C A;  4JF8 A;  1MWR A;  1BRS A;  1GOY A;  1DVC A;  3NM7 A;  1WMP A;  1QAL A;  1LRA A;  2UUG C;  3LTC A;  4HM7 B;  3EBT A;  5IER A;  1A2V A;  2OOV A;  4LEH A;  3KZT A;  9RNT A;  1W2B 2;  1LQM B;  2Z76 A;  3CPW 2;  7STD A;  1ISK A;  1UW1 A;  1TRQ A;  1QMA A;  2CFL A;  1MWS A;  3RNT A;  1RLS A;  2OCT A;  4O02 B;  4CCV A;  4LSO A;  3WHO A;  4J5G A;  1UDI I;  1WMN A;  2KRT A;  1VQN 3;  1HZ1 A;  1CQS A;  3ER7 A;  1PFP A;  4HOH A;  4KZ1 A;  1UCI A;  2IY2 A;  4FCJ A;  1IVV A;  4ILF A;  4ORL A;  3BNE A;  4R9L A;  3CU3 A;  2L1S A;  2CFK A;  2XGN A;  3SOA A;  3CCL 3;  5BU4 A;  1RCL A;  1RCK A;  3CME 3;  1OHP A;  1K9M 4;  3FGY A;  3K63 A;  3LML A;  2OTL 3;  4FMD A;  2W04 A;  1DYU A;  1YNV X;  1ASK A;  2CWT A;  5DRE A;  1STF I;  3K5T A;  1FGO A;  1EG9 B;  2C10 A;  1YVB I;  4HM2 B;  2Z6B A;  1BRK A;  3B7C A;  3BU4 A;  4N6T A;  3OXA A;  4RZM A;  1DVD A;  2HMM B;  3VSY A;  2P09 A;  2LYX A;  1I2F A;  1MOL A;  2GSP A;  1FGR A;  1TFK A;  2HMN B;  4G1M B;  1IQY A;  1GOU A;  1OGX A;  1ZS7 A;  1T5Y A;  2O3O A;  4R4K A;  1VZZ A;  1B3S A;  3CNX A;  3LT8 A;  3HK4 A;  1BVI A;  1O7M B;  3LYG A;  2OQE A;  3CCM 3;  2C4B A;  1VQP 3;  1YGE A;  1O7W B;  4H3U A;  2YFJ B;  3NQY A;  4J5K A;  1Q86 4;  1JBT A;  1A90 A;  3OX9 A;  1G0T A;  1N5H A;  3DGL A;  3G6E 3;  2CG0 A;  1FZU A;  2OOV C;  2KF5 A;  5STD A;  4ZM8 A;  3HX8 A;  4WYK A;  3WA2 X;  3F14 A;  5JBS A;  2P38 A;  4L7K A;  1N9J A;  3EX9 A;  2PZV A;  3NUV A;  1JBS A;  4KVH A;  1I8V A;  5M1A A;  2W9Q A;  2XSH B;  1EUI C;  1RRH A;  3SOY A;  1PYL A;  1UI7 A;  5AYR B;  4FCZ A;  3FLJ A;  2BIR A;  3OWU A;  4EYC A;  1IT8 A;  3UJM A;  1WQL B;  3OV4 A;  4RNY A;  5KP4 A;  3EC9 A;  1RN1 A;  4L8P A;  1RN4 A;  4HYZ A;  3CPO A;  3Q2P A;  5I97 A;  1NB5 I;  1RSN A;  6GSP A;  3LT9 A;  1M1K 4;  1R4Y A;  3LTD A;  1FUS A;  4OVM A;  4LZI A;  1Z1S A;  2BHM A;  3PS8 A;  1BSA A;  5M18 A;  1BSE A;  4K90 B;  4KFF A;  1STD A;  2BT3 A;  4MEI A;  1TFO A;  3WMD A;  3T8N A;  4N6V 0;  1FUT A;  3EN8 A;  3RGR A;  4WHA A;  3WA3 A;  2HMO B;  1UCL A;  4K1V A;  5AEW B;  4STD A;  1BNJ A;  2F86 B;  1GOV A;  4EBG A;  1VQ6 3;  2E2U A;  1NJI 4;  2Y73 A;  1BOX A;  1FGM A;  1JB4 A;  4MMY B;  4O8S A;  1A2K A;  3LH4 A;  4J8T A;  3FSD A;  4MJD A;  3D5G A;  3FG4 A;  1IK3 A;  1BNS A;  2RGQ A;  1BSB A;  2OQE C;  2F4Y A;  4BU4 A;  1BNF A;  3DM8 A;  3X42 A;  3X40 A;  1UCK A;  1HU9 A;  2IA7 A;  2YX9 A;  2BMO B;  1ULJ B;  1RNT A;  1D6Z A;  2XFS A;  2JDI H;  3AMO A;  3F40 A;  4HM8 B;  4AKZ A;  1EQK A;  1BAO A;  3D5I A;  3V92 A;  2XEP A;  3OWY A;  1Y4K A;  1V74 A;  3UL5 A;  3F8X A;  3KKG A;  5IG4 A;  1SPU A;  5DRV A;  5EVH A;  1TRP A;  2WGQ A;  2XFT A;  1GYB A;  1RGK A;  3GZB A;  3AHS A;  1JJ2 2;  1C54 A;  4QWT A;  3CMA 3;  1NWW A;  1N5P A;  4RNT A;  5M19 A;  2BNG A;  1SQW A;  4BTW A;  3AMO B;  1ZX2 A;  3PZW A;  1AQZ A;  1VQ9 3;  3CNM A;  5AIF A;  2E2T A;  3S29 A;  1B2Z A;  1W6Y A;  2HMK B;  1FGT A;  3X3X A;  3H3H A;  4TX4 A;  1TJD A;  4EW5 A;  3D4A A;  2BMQ B;  1RN7 A;  1M90 4;  3B4O A;  2WGO A;  1GD4 A;  1I0V A;  1UUW B;  3BLZ A;  3O8Y A;  1SAR A;  4HM0 B;  3WOD G;  1YVS A;  3CCE 3;  3B4P A;  3NHX A;  4WWU C;  1QVG 2;  3CC2 3;  1UGI A;  2CW9 A;  5IG3 A;  1YGW A;  3LXU X;  1JRQ A;  1L5G B;  3J7Y d;  1GY5 A;  1JKG A;  1TUH A;  4R1K A;  2GU1 A;  2ML5 A;  5AII A;  1PY3 A;  4N6O B;  1JV2 B;  3EQQ B;  3OW2 2;  4FMB A;  3ZG0 A;  3WOF B;  2L4V A;  3IMA B;  5AYS C;  2FXT A;  2XRX B;  3VF1 A;  3T0U A;  1V57 A;  1UCJ A;  2ZHX B;  2CWU A;  1N8R 4;  1Q40 A;  3RGA A;  3F7X A;  3S27 A;  4FMC A;  1BNI A;  1JN5 A;  1BRI A;  2STD A;  8CHO A;  3DGO A;  1I3F A;  1OF5 A;  1FGQ A;  3LTB A;  4U13 A;  1YIJ 3;  3D9R A;  2K3D A;  1J2B A;  1LNI A;  3NX0 A;  1JB5 A;  1RGL A;  4EV2 A;  3EN1 B;  4HM6 B;  1DMM A;  3GZX B;  4R80 A;  1MGW A;  4X2H A;  1MNL A;  2IMJ A;  2ZA4 A;  4WP5 A;  3UNL A;  1YI2 3;  1Q40 B;  4JRF A;  1OPY A;  2E2V A;  3WR2 A;  2FGT A;  3MG2 A;  3K7C A;  1RGE A;  2UX0 A;  3U1W A;  5IG5 A;  3F9S A;  1RGC A;  4PEJ A;  1TU5 A;  1IDP A;  1LVN A;  2HMJ B;  3M8C A;  3KCH A;  1IV9 A;  1O7G B;  3HOH A;  4XBX A;  5AEU B;  1VQQ A;  2WOF A;  3STD A;  2Y74 A;  2SAR A;  1CEW I;  3QRD A;  3MSO A;  3KII A;  1TTO A;  5D82 A;  3CC7 3;  3T8U A;  1W4N A;  3ZFZ A;  1M1X B;  5ELJ A;  5G2G A;  3X41 A;  1YHQ 3;  3LZA A;  1FA3 A;  1BRH A;  1GMP A;  5D83 A;  1VQ8 3;  4Q53 A;  2XF3 A;  1Q9E A;  1RNB A;  3CCR 3;  2D42 A;  2KAA A;  3UB1 A;  1NB3 I;  3PXM A;  5JPP A;  1C7H A;  4H61 A;  4N6L A;  1IVW A;  1W5Z A;  1IVX A;  2F5W A;  3JVC A;  1WNH A;  3DGM A;  4NPB A;  1I0X A;  4LGQ A;  1DMQ A;  1GY6 A;  3NBR A;  3NV0 A;  3X3Y A;  1PU4 A;  4WYK B;  3VGN A;  3NQZ A;  4WFO A;  2WOH A;  1IU7 A;  1OHS A;  3IPT A;  4L8O A;  1JZD A;  1AVL A;  2KF6 A;  1U5O A;  3N9H A;  2W56 A;  3FZW A;  3G16 A;  2JQ5 A;  4HBR A;  4XDV A;  3A5E A;  3BIR A;  8RNT A;  4FMA A;  2WO0 A;  2A15 A;  4XBY A;  1S5A A;  1E3R A;  1OCV A;  4HM4 B;  1BSD A;  4NHF A;  2CH9 A;  3K0Z A;  4XBT A;  2R41 A;  1GD3 A;  5LC7 A;  1S72 3;  4I4K A;  4XDW A;  1NDO B;  3EF8 A;  3F7S A;  3SX1 A;  1YIT 3;  3HIG A;  1RGG A;  3FF0 A;  3Q1C A;  4IT7 A;  4RBN A;  1W00 A;  4BL2 A;  2CFW A;  5IG0 A;  3GZR A;  2KF3 A;  7GSP A;  3WOE B;  3D3L A;  3KE7 A;  4HKV B;  4HVN A;  4CJN A;  1O7H B;  1RDS A;  4XB5 A;  3DMC A;  3G71 3;  5LC6 A;  1JBR A;  3JUP A;  3MHE A;  5D81 A;  2CWV A;  2RSX A;  2XR8 B;  5KP3 A;  2XH9 A;  1KC8 4;  2MF7 A;  3MPH A;  4HAA A;  5EQL A;  1HKX A;  2GBW B;  1Q7H A;  3GSP A;  5CXO A;  1UGH I;  4BL3 A;  4AKY A;  1RGA A;  4AEQ A;  1EA2 A;  1AR0 A;  2IUK A;  3EJV A;  3JUQ A;  1US1 A;  1BNG A;  5CLK A;  4BTX A;  1A67 A;  1QJG A;  1BUJ A;  3HI7 A;  1LOY A;  2CFG A;  1QVF 2;  3DY5 A;  1T2I A;  3FCS B;  1VQO 3;  1YJ9 3;  2CG1 A;  2CFD A;  5BIR A;  2QA4 3;  3SVA A;  3PCR A;  4K1U A;  3A76 A;  3RDE A;  2ML6 A;  5AIH A;  1BGS A;  1WMO A;  2W6J H;  1B2U A;  3QK9 A;  4O2H A;  1VQ5 3;  1B2X A;  6RNT A;  3AHW A;  1V58 A;  1Q81 4;  2GXF A;  1BSC A;  1I3I A;  1RKY A;  2XGL A;  3L0R A;  2R4I A;  1OGZ A;  2H0I A;  4IIA A;  3DGY A;  2XSO B;  3FG3 A;  4FR9 A;  3SYU A;  1YJW 3;  2CK3 H;  1NNV A;  1MGR A;  4GB5 A;  1X1X A;  2BU4 A;  3EBY A;  3N8B A;  1UUG B;  3EHC A;  1IVU A;  3SED A;  4BIR A;  4FCM A;  3E99 A;  1FW7 A;  6STD A;  5RNT A;  1AV4 A;  2GEY A;  2AAE A;  3CCS 3;  3GRD A;  5EEO A;  1IQ8 A;  7RNT A;  1BRJ A;  1W7C A;  4HZ9 B;  1A2P A;  2IYJ A;  2ZDJ A;  3H51 A;  1BUQ A;  2UGI A;  1BIR A;  4GHO A;  4MMZ B;  1RJO A;  2CX1 A;  2GU3 A;  3KSP A;  3DXO A;  1ZO2 A;  3BNB A;  1BRN L;  3BND A;  3S28 A;  4DKI A;  1K73 4;  3CC4 3;  1JB2 A;  2F99 A;  3B8L A;  4N6N B;  4LYL B;  1ZGX A;  2M7O A;  1N8Q A;  2BMR B;  2SBL A;  4HJL B;  2OTJ 3;  3JUO A;  1AY7 A;  1JKG B;  1W02 A;  1W2Z A;  2P0X A;  1IYY A;  1K28 A;  3CCJ 3;  4HZB B;  2P0M A;  4IPB A;  1BAN A;  1I2E A;  3TDG A;  1HYF A;  1KD1 4;  3FH1 A;  2CIU A;  1WTH A;  1ROA A;  3CCV 3;  1E97 A;  2QIY A;  5FW5 A;  1D6U A;  3V98 A;  1UUV B;  5HOH A;  1RGF A;  5CK6 A;  3I55 3;  1G96 A;  2W03 A;  3UL6 A;  1M9G A;  1IT7 A;  2H0G A;  1GY7 A;  4XM4 A;  3GZY B;  3WDG B;  4BTY A;  2INX A;  3EB8 A;  3KSE D;  1MWU A;  1JN5 B;  1DET A;  4RNZ A;  5KP1 A;  1CYU A;  1OF5 B;  4N3V A;  2CHC A;  3PGB A;  1N9E A;  1LXE A;  4EXR A;  5BVB A;  2MC8 A;  1X1Y A;  2BO9 B;  1SII A;  4N6M A;  2B24 B;  1B27 A;  3HZP A;  4O3V A;  2I9W A;  5IW9 A;  1T2H A;  1ULI B;  2F98 A;  3BNC A;  3ZG5 A;  1VQL 3;  1LOW A;  3F8H A;  3Q90 A;  2CX0 A;  1NO3 A;  5BXQ A;  1GS3 A;  2QEX 3;  2LQV A;  3N54 B;  4HM1 B;  3CCQ 3;  1YJN 3;  1RGH A;  1LNH A;  1GMR A;  2FNQ A;  1O7N B;  2F5M A;  3SLU A;  5TGN A;  4EV5 A;  1KWI A;  1EKM A;  1VQ4 3;  1SJW A;  5CF2 A;  1JZO A;  2AAD A;  5IEN A;  1LOX A;  1E3V A;  2W0Q A;  5G1K A;  2W9P A;  3S67 A;  5JPU A;  1B2M A;  3JUN A;  1O7P B;  1K8A 4;  1W6G A;  1B20 A;  2B1X B;  1Q7Y 4;  3FKA A;  2RCD A;  4MMX B;  3Q3F A;  1B2S A;  1FYS A;  1OH0 A;  3FG1 A;  2OWP A;  2D1W A;  3V99 A;  5G1L A;  3G4S 3;  2PNC A;  5GSP A;  1B21 A;  2K0M A;  3NV0 B;  2KXG A;  3CXC 2;  1Q82 4;  1DMN A;  2H0H A;  3KFQ C;  1JNQ A;  5HGR A;  2J8X B;  4CDL A;  3CD6 3;  1LQG C;  2KCD A;  3ALA A;  4X2O A;  3ROB A;  1IQX A;  1X1U A;  1FUW A;  1GMQ A; 
#chains in the Genus database with same CATH homology
 1PY3 A;  1BVI A;  1BGS A;  1RMS A;  1B2U A;  2C4B A;  1B2X A;  6RNT A;  3AHW A;  3DH2 A;  4J5K A;  1RHL A;  1JBT A;  1UCJ A;  1BSC A;  1FZU A;  1I70 A;  2KF5 A;  1I3I A;  1GSP A;  1BNI A;  3AGO A;  3DGY A;  1BRI A;  2KF4 A;  1BNE A;  1I3F A;  3SYU A;  2RBI A;  1JBS A;  1I8V A;  1MGR A;  1LNI A;  1G02 A;  1X1X A;  2BU4 A;  2HOH A;  1RGL A;  4BIR A;  1PYL A;  1FW7 A;  1MGW A;  5RNT A;  2BIR A;  2ZA4 A;  2AAE A;  3WR2 A;  7RNT A;  1BRJ A;  1RTU A;  1RGE A;  1BU4 A;  3AGN A;  1A2P A;  1RN1 A;  1RN4 A;  1RGC A;  1RSN A;  1BIR A;  4GHO A;  6GSP A;  3KCH A;  1R4Y A;  3HOH A;  1BRN L;  1FUS A;  1CH0 A;  2SAR A;  1BSA A;  4GSP A;  1BSE A;  1DE3 A;  1ZGX A;  1TTO A;  2RNT A;  1AY7 A;  1IYY A;  1FUT A;  1BRH A;  1GMP A;  1BNR A;  1LOV A;  1RNB A;  1Q9E A;  1UCL A;  1BAN A;  1I2E A;  1HYF A;  2KAA A;  1BNJ A;  1GOV A;  3URP A;  1BRG A;  5HOH A;  1BOX A;  1RGF A;  2F5W A;  1X1W A;  2F56 A;  1I2G A;  1I0X A;  3D5G A;  1BRS A;  1GOY A;  1BNS A;  1BSB A;  1LRA A;  1DET A;  2F4Y A;  4BU4 A;  1BNF A;  1UCK A;  2KF6 A;  9RNT A;  3A5E A;  3BIR A;  8RNT A;  1X1Y A;  1TRQ A;  1RNT A;  3RNT A;  1BSD A;  1RLS A;  1B27 A;  3WHO A;  1BAO A;  4J5G A;  1T2H A;  3D5I A;  1HZ1 A;  4HOH A;  1LOW A;  1UCI A;  1RGG A;  2KF3 A;  1TRP A;  7GSP A;  1RGH A;  1RGK A;  5BU4 A;  1RCL A;  3AHS A;  1C54 A;  1GMR A;  1RCK A;  2F5M A;  4RNT A;  1RDS A;  2AAD A;  1B2M A;  1AQZ A;  1YNV X;  1JBR A;  1B2Z A;  1B20 A;  4HAA A;  3D4A A;  3GSP A;  1BRK A;  3Q3F A;  3BU4 A;  1B2S A;  1FYS A;  1I0V A;  1RGA A;  1SAR A;  1YVS A;  1I2F A;  5GSP A;  1B21 A;  1BNG A;  1BUJ A;  2GSP A;  1LOY A;  1YGW A;  1T2I A;  1GOU A;  5BIR A;  1X1U A;  1B3S A;  1GMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...