1BIRA

Ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNAVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title A catalytic function for the structurally conserved residue Phe 100 of ribonuclease T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1birA00
1B2MA 1DE3A 1GOVA 1UCIA 3BIRA 3HOHA 3RNTA 3AGOA 1DETA 1BRJA 1JBTA 3DH2A 3D5GA 1UCLA 3D4AA 1R4YA 1BRKA 3D5IA 1BSBA 2KF6A 1B2UA 1ZGXA 3GSPA 3URPA 1FW7A 1BNFA 1GMRA 1RN4A 1BNGA 1B2ZA 1TRQA 3A5EA 1BRIA 1I3FA 5HOHA 1IYYA 1B2XA 1B2SA 1RMSA 3BU4A 2F5MA 5BIRA 1CH0A 1RN1A 1BNEA 1RSNA 4HOHA 1X1WA 6GSPA 1I70A 8RNTA 7RNTA 1X1XA 1I0VA 6RNTA 1GOUA 4RNTA 2F5WA 1I0XA 1BVIA 1BAOA 1AQZA 1JBSA 1B21A 1RTUA 1FUSA 1LOVA 1GOYA 1PY3A 1FZUA 3SYUA 1HYFA 1LOWA 1BIRA 1RNBA 1C54A 2GSPA 3AHWA 1T2HA 1GMPA 1FUTA 4GHOA 3Q3FA 1RGFA 1I2GA 1TTOA 1BSEA 1UCKA 1I8VA 1RNTA 2F4YA 1RGCA 1A2PA 1BSDA 1BANA 1MGWA 1RGHA 1BRGA 2BIRA 2KF5A 4J5KA 3WHOA 4BU4A 2BU4A 1RDSA 1UCJA 3WR2A 1BSCA 1X1UA 5GSPA 1B20A 2HOHA 1BRHA 4HAAA 1I2FA 1YVSA 2RBIA 1BNRA 1BRNL 1BNSA 1AY7A 1RGGA 5BU4A 5RNTA 1SARA 4BIRA 1I2EA 1RGEA 3AHSA 1BOXA 1TRPA 2F56A 1X1YA 1LOYA 4GSPA 2KAAA 1BRSA 1BU4A 2AAEA 2ZA4A 1RHLA 1RCLA 1PYLA 2KF4A 1BGSA 1T2IA 1LRAA 1BNIA 1LNIA 1BNJA 1RGLA 1RLSA 1BSAA 9RNTA 7GSPA 2SARA 2KF3A 1B27A 1FYSA 1G02A 1RGKA 3AGNA 3DGYA 1BUJA 1RGAA 1RCKA 1YGWA 2AADA 1B3SA 1JBRA 1I3IA 1Q9EA 1GMQA 1YNVX 1GSPA 1HZ1A 1MGRA 2C4BA 4J5GA 2RNTA 3KCHA
chains in the Genus database with same CATH superfamily
1GY5A 3RNTA 2XFTA 1DETA 2W03A 2XF3A 3QRDA 1JBTA 4JF8A 3GZXB 1JV2B 5KP4A 4RBNA 1O7NB 1RRLA 2UUGC 1BRKA 4QWTA 1LVNA 3D5IA 1KQS2 4X2HA 5LC6A 4HM2B 4XBTA 2KF6A 3DGNA 3G8ZA 2CFGA 4HYZA 1B2UA 1CEWI 1JZOA 4N6TA 1VQ43 4OUQA 2CG1A 1TRQA 1NJI4 1IK3A 2BMOB 1I3FA 2BMRB 4IT7A 5FW5A 1AR0A 1RMSA 1WMPA 2Z6BA 3DXOA 5BIRA 1CH0A 4FMAA 4WWUC 3PS8A 3G4S3 1RN1A 2CKFB 3EN8A 3DY5A 1FGOA 4BL2A 1JNQA 4FCZA 1IV9A 1UW1A 4N3VA 2F99A 3ROBA 4HZ9B 2P0XA 1GS3A 2STDA 3K9MC 3OXAA 2HMKB 3PGBA 5D82A 3WDGB 1I0XA 1UDII 1VQ93 1BVIA 4BL3A 1AQZA 2ZDJA 4N6NB 1B21A 5M18A 1MWUA 3CU3A 2W9PA 1T5YA 1FZUA 3IJEB 4FMDA 1LOWA 1BIRA 2D1WA 1FGQA 2P09A 5BVBA 2GXFA 1K734 3FF2A 1T2HA 1GD4A 1OGZA 1IT7A 2ML5A 2RCDA 3NM2A 3JUQA 1I2GA 3MSOA 3Q1CA 1ULIB 3Q3FA 1JN5B 1TTOA 7STDA 1EQKA 1S723 1Q40B 5IEPA 3CCR3 3F7SA 4J8TA 1W6GA 1A2PA 2XRXB 1RGHA 4J5KA 1VQ63 1GY7A 1OPYA 4BU4A 2BU4A 2Z7AA 4WYKB 1W00A 1BSCA 3MG2A 1N9EA 1B20A 1RN7A 3CCJ3 2RSXA 1U8CB 1OACA 3V99A 4GL6A 2FNQA 3N8BA 1ROVA 1YVSA 2YFLB 1BRNL 1ASKA 5AEWB 2CFKA 3EF8A 1BNSA 1AY7A 2CX0A 2H0IA 3T0UA 2WOFA 4BIRA 1ZO2A 3S28A 1I2EA 3D3LA 1QVG2 3CME3 3AMOA 3FSDA 3O8YA 2KAAA 1BU4A 1DMMA 2ZA4A 2R4IA 4CCVA 2MC8A 1NNVA 1RHLA 2IMJA 3X3ZA 3FKAA 3G6E3 3N54B 1PYLA 1Y4KA 2HMNB 5I97A 1LNIA 4JRFA 4O3VA 4BTWA 3ECFA 1MWTA 1RLSA 3MYTA 3I553 1BSAA 1W2B2 1EKMA 1NO3A 3KSED 3I0YA 5M19A 1EEJA 1G02A 1K8A4 3OV4A 3RGAA 2AADA 2HMOB 1B3SA 4HM1B 4N6V0 1YJN3 2ZL8A 2LYXA 1K41A 1YI23 4G1MB 4CJNA 1GSPA 2K0MA 2A15A 2RGQA 4J5GA 2RNTA 3KCHA 5IENA 1B2MA 3K0ZA 1UCIA 3BIRA 1JB2A 4HM0B 3AGOA 3MG3A 4BTXA 1WTHA 2B24B 1BRJA 2CG0A 2W2CA 1IVVA 3EJVA 1VQQA 3D5GA 3F8HA 1UCLA 3NHXA 3I563 2MF7A 2PNCA 1R4YA 2CH9A 1FGMA 1E3RA 1G96A 1ROAA 1YGEA 2UX0A 3B7CA 1GYBA 3N9HA 4MJDA 5DRVA 5FGOA 3UNLA 3NBRA 1BSBA 3KKGA 3NV0B 4CDLA 3EC9A 3PYJA 2JDIH 1JKGA 1ZGXA 1STDA 1E97A 4N6UA 5IG5A 3PXMA 1QJGA 3OWYA 2HMLB 5D83A 1A67A 1BNGA 4L8PA 5STDA 2WGQA 2RFRA 2Y74A 3A5EA 3RDEA 1O7MB 1IYYA 1B2XA 1B2SA 1GD3A 3EX9A 5IG4A 3K7CA 4HM3B 1BNEA 3LTDA 5G1LA 3OWSA 5EEOA 4ZM8A 2WO0A 4HBRA 1X1WA 3SX1A 1O7HB 6GSPA 6RNTA 1JKGB 1SQWA 3ZG5A 1VQ73 2F5WA 3DGMA 1QAFA 3SLUA 5JPPA 1BAOA 3V98A 2F86B 3EBTA 2L4VA 1M1XB 1E3VA 3U97A 1IT8A 4AEQA 3LZAA 1C54A 2W04A 1GMPA 1VQM3 1N8QA 3OX9A 4LZIA 2HMJB 1JB5A 1RGFA 1VQL3 2Q07A 3G713 3ZFZA 1RGCA 4AKZA 2BIRA 1BANA 1BSDA 1OHOA 1STFI 2KF5A 3GZBA 3JUOA 1W6YA 1WNHA 1N5HA 2O3OA 2P05A 3KE7A 1TUHA 2CC3A 1LOXA 2HMMB 4EV2A 1YIJ3 1JN5A 3B4PA 2BO9B 3Q2PA 1OHSA 4K1UA 5GSPA 1Q40A 3WMDA 1BRHA 3X41A 1DMQA 1CYVA 2WGOA 1R4CA 2XSOB 2Z76A 2IUJA 3KN4A 1NB5I 5IEOA 2W9QA 3ALAA 1Z1SA 5G2GA 3X42A 3OW22 2RBIA 1PFPA 1FUWA 5JBSA 4WYKA 1RGGA 3NM7A 5BU4A 5RNTA 3MG1A 1SARA 1UUVB 1YHQ3 3SXXA 1RGEA 1IQYA 1JRQA 1UUGB 1BOXA 3NXJA 2LQVA 4I4KA 1X1YA 1LOYA 2YX9A 1N9JA 3MWZA 2GEYA 2KRTA 4XDVA 4O8SA 3EBYA 4PEJA 4Q53A 1Q42A 2F98A 1NU3A 1A2VA 1UGHI 1LQGC 3GWRA 3LT8A 2KF4A 3NX0A 1BGSA 4HM5B 3CCE3 3LOYA 1BNIA 1MWSA 3EHCA 1W4NA 2K3DA 2OQEC 1W2ZA 1M1K4 4HM7B 7GSPA 5CF1A 1VQP3 1VQ53 2PZVA 4KZ1A 1IQXA 1FYSA 3DGYA 3X3YA 1KWIA 3LH4A 4H61A 3J7Yd 1YIT3 3BNEA 1WQLB 5AIHA 4U13A 4NREA 2GU3A 1Q9EA 3U1WA 1MWRA 1W5ZA 5CXOA 1YNVX 4EBGA 3CMA3 3GAXA 4STDA 3NUVA 2GU1A 1HZ1A 1MGRA 1MNLA 2OOVC 4LMIA 1LXEA 2C4BA 3LT9A 4KFDA 2OQEA 3RGRA 3WODG 2OTL3 1CQSA 1DE3A 1GOVA 1V57A 2CWTA 4L7KA 4NHFA 4EV5A 1IU7A 1QVF2 3S5CA 3HOHA 3WOEB 1FGRA 3H3HA 1Q7HA 2V1LA 2QIYA 3BNCA 3OWUA 5ELUA 3CC43 3DZLA 3JVCA 2H0HA 4HM8B 1UI8A 2W56B 2ZHXB 1J2BA 4KVHA 3D4AA 1V58A 2BMQB 4KT3B 5AIGA 5IW9A 1K9M4 3LMLA 4FR9A 5HGRA 1DYUA 3MPHA 3TDGA 4X2OA 2OTJ3 1SPUA 3EQQB 4K90B 1OUNA 3GSPA 3URPA 1FW7A 1BNFA 3ZG0A 3CNXA 4HM4B 3CPOA 3D9RA 5EQLA 4ILFA 5HOHA 3BLZA 3BU4A 3NV0A 3LXUX 2XFSA 3CXC2 3F40A 4XBXA 1JJ22 4RZMA 2E2VA 2GEXA 1RSNA 4HOHA 1BUQA 2XEPA 1NB3I 3KZTA 4MMZB 3JUMA 3GZRA 1F8NA 3FG4A 1OCVA 1AVLA 1A2KA 8RNTA 3F8XA 4IPBA 1PU4A 3QK9A 3K5TA 1SIIA 2IUKA 3DGOA 1JBSA 3FGYA 1FUSA 3HX8A 1LOVA 4LEHA 5AYSC 3SOAA 3CC23 4FMCA 3IPTA 3CCQ3 1PY3A 3F9SA 1DVDA 1TU5A 4GHOA 1TIJA 1NDOB 3DMCA 3STDA 1KD14 2E2UA 3AHWA 3BB9A 2CFDA 1FUTA 3WOFB 3FH1A 2XGLA 1WMOA 3T8NA 1UI7A 5ELJA 2QGUA 1UUWB 2WOHA 4FMBA 4KFEA 1SJWA 1UCKA 5IG3A 3LTAA 4WFOA 2F4YA 1OH0A 1T3BA 2K54A 1MGWA 1BRGA 3DGLA 3WHOA 1L5GB 1RDSA 3WR2A 5AEUB 1AVKA 3CC73 2HOHA 4HVNA 1U5OA 1DVCA 2CWVA 1IVXA 1QMAA 3EN1B 1Q7Y4 1TP6A 3K63A 3M8CA 1IVWA 2FGTA 4N6OB 2CX1A 2XR8B 3F14A 4FCJA 1ZS7A 1UGIA 1HU9A 3VSYA 3PCRA 1TFOA 3FLJA 4AKYA 5BXQA 3F7XA 3CCM3 2GBXB 2M7OA 4N6LA 2CFWA 2Y73A 4L8OA 3CNMA 1RCLA 2BNGA 2ML6A 2W6JH 1T2IA 3LTBA 4EW5A 1LRAA 1RGLA 3HIGA 1TJDA 5IF6A 5CLKA 3EB8A 1IV7A 3T8UA 1KSIA 3BNDA 2INXA 2SARA 2UGIA 2KF3A 3PZWA 4XBYA 3AGNA 3PCSA 4HM6B 4RNYA 1RGAA 1YGWA 1OF5A 3X40A 2XSHB 1JBRA 1O7WB 1I3IA 1VQN3 1D6YA 1QAKA 2IA7A 1GMQA 3B8LA 1GY6A 3D79A 3ER7A 3BNBA 1D6ZA 2OCTA 2KCDA 5TGNA 3CPW2 3MHEA 5AYRB 4NPBA 3NBJA 4I5QA 4MEIA 3UJMA 1IQ8A 1RNBA 4HZBB 3IMAB 2KXGA 3S67A 1YVBI 5AIIA 4EC6A 2E2TA 3KSPA 4FCMA 2L1SA 1WMNA 5D81A 3X3XA 2CWUA 3DH2A 4XB5A 4J9AA 1OF5B 3JUNA 4GB5A 1Q864 3FF0A 1VQ83 3NQZA 2I9WA 1V74A 2H0GA 1ZX2A 3HIIA 4TX4A 1YJ93 6STDA 4LYLB 1ISKA 2Z77A 3UL6A 2QA43 1W01A 2W56A 3S27A 1GMRA 1RN4A 2B1XB 1NWWA 1S5AA 4R4KA 2R41A 1B2ZA 1CYUA 3S29A 1BRIA 4MMYB 2YFIB 5IERA 1TFKA 1A90A 2W0QA 4IIAA 4K61A 2F5MA 3H51A 3FCSB 2IY2A 2JQ5A 2QEX3 2C10A 5AIFA 2OWPA 4N6MA 4R80A 3SVAA 3B4OA 3E99A 4LSOA 3VGNA 1I70A 5KP1A 3NQYA 1MOLA 2XGNA 7RNTA 3GRDA 1X1XA 1I0VA 3NBBA 4R9KA 2IYJA 2O9UX 5EVHA 1OHPA 4R1KA 3CD63 3CCV3 1GOUA 1FA3A 4RNTA 1IVUA 1EA2A 1ULJB 8CHOA 2BT3A 3G16A 3HK4A 3L0RA 4KFFA 4OVMA 4XM4A 2OOVA 2CHCA 3A76A 1LNHA 1RTUA 4EXRA 1GOYA 1VQK3 1W6CA 3SYUA 3V92A 1HYFA 4CPKA 1VQO3 1VZZA 5LC7A 3CCL3 1M9GA 1KC84 4MMXB 3KFQC 5KP3A 2GSPA 4EYCA 1JB4A 4H3UA 2XH9A 1US1A 3MKIA 4R9LA 1EG9B 3FG3A 2P38A 5CK6A 1BSEA 1C7HA 5M1AA 1I8VA 1RNTA 3G0KA 1AV4A 4WHAA 3WA3A 3UB1A 4HKVB 1K28A 1UCJA 1LQMB 3DUKA 1X1UA 4LGQA 3AMOB 1YJW3 1O7PB 4HAAA 4ORLA 1I2FA 4O02B 1IDPA 1RRHA 4O2HA 3CCS3 1OGXA 2CIUA 1QALA 5DREA 3UL5A 2CFLA 1BNRA 4BTYA 1N8R4 1N5PA 2P0MA 4RNZA 2YFJB 5AI1A 3AHSA 2BHMA 1Q814 3DM8A 1JZDA 3FZWA 4WP5A 1TRPA 1W7CA 2CK3H 2D42A 2F56A 1W02A 3LTCA 4GSPA 1BRSA 5G1KA 5JPUA 3SEDA 2AAEA 4HJLB 3WA2X 5IG0A 1O7GB 3HZPA 3HI7A 4XDWA 3KIIA 4OK0A 1BNJA 1RKYA 3VF1A 3LYGA 2FXTA 5CF2A 9RNTA 1M904 1DMNA 2J8XB 3CCU3 1HKXA 1B27A 1RGKA 1RJOA 1BUJA 3GZYB 3JUPA 1RCKA 1G0TA 3FG1A 1EUIC 3Q90A 2SBLA 2GBWB 1FGTA 2C11A 3SOYA 1D6UA 4K1VA 1SIHA 3EE1A 1Q824 2CW9A 4DKIA 5A0OB
chains in the Genus database with same CATH topology
1B2MA 1DE3A 1GOVA 1UCIA 3BIRA 3HOHA 3RNTA 3AGOA 1DETA 1BRJA 1JBTA 3DH2A 3D5GA 1UCLA 3D4AA 1R4YA 1BRKA 3D5IA 1BSBA 2KF6A 1B2UA 1ZGXA 3GSPA 3URPA 1FW7A 1BNFA 1GMRA 1RN4A 1BNGA 1B2ZA 1TRQA 3A5EA 1BRIA 1I3FA 5HOHA 1IYYA 1B2XA 1B2SA 1RMSA 3BU4A 2F5MA 5BIRA 1CH0A 1RN1A 1BNEA 1RSNA 4HOHA 1X1WA 6GSPA 1I70A 8RNTA 7RNTA 1X1XA 1I0VA 6RNTA 1GOUA 4RNTA 2F5WA 1I0XA 1BVIA 1BAOA 1AQZA 1JBSA 1B21A 1RTUA 1FUSA 1LOVA 1GOYA 1PY3A 1FZUA 3SYUA 1HYFA 1LOWA 1BIRA 1RNBA 1C54A 2GSPA 3AHWA 1T2HA 1GMPA 1FUTA 4GHOA 3Q3FA 1RGFA 1I2GA 1TTOA 1BSEA 1UCKA 1I8VA 1RNTA 2F4YA 1RGCA 1A2PA 1BSDA 1BANA 1MGWA 1RGHA 1BRGA 2BIRA 2KF5A 4J5KA 3WHOA 4BU4A 2BU4A 1RDSA 1UCJA 3WR2A 1BSCA 1X1UA 5GSPA 1B20A 2HOHA 1BRHA 4HAAA 1I2FA 1YVSA 2RBIA 1BNRA 1BRNL 1BNSA 1AY7A 1RGGA 5BU4A 5RNTA 1SARA 4BIRA 1I2EA 1RGEA 3AHSA 1BOXA 1TRPA 2F56A 1X1YA 1LOYA 4GSPA 2KAAA 1BRSA 1BU4A 2AAEA 2ZA4A 1RHLA 1RCLA 1PYLA 2KF4A 1BGSA 1T2IA 1LRAA 1BNIA 1LNIA 1BNJA 1RGLA 1RLSA 1BSAA 9RNTA 7GSPA 2SARA 2KF3A 1B27A 1FYSA 1G02A 1RGKA 3AGNA 3DGYA 1BUJA 1RGAA 1RCKA 1YGWA 2AADA 1B3SA 1JBRA 1I3IA 1Q9EA 1GMQA 1YNVX 1GSPA 1HZ1A 1MGRA 2C4BA 4J5GA 2RNTA 3KCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2M A;  1DE3 A;  1GOV A;  1UCI A;  3BIR A;  3HOH A;  3RNT A;  3AGO A;  1DET A;  1BRJ A;  1JBT A;  3DH2 A;  3D5G A;  1UCL A;  3D4A A;  1R4Y A;  1BRK A;  3D5I A;  1BSB A;  2KF6 A;  1B2U A;  1ZGX A;  3GSP A;  3URP A;  1FW7 A;  1BNF A;  1GMR A;  1RN4 A;  1BNG A;  1B2Z A;  1TRQ A;  3A5E A;  1BRI A;  1I3F A;  5HOH A;  1IYY A;  1B2X A;  1B2S A;  1RMS A;  3BU4 A;  2F5M A;  5BIR A;  1CH0 A;  1RN1 A;  1BNE A;  1RSN A;  4HOH A;  1X1W A;  6GSP A;  1I70 A;  8RNT A;  7RNT A;  1X1X A;  1I0V A;  6RNT A;  1GOU A;  4RNT A;  2F5W A;  1I0X A;  1BVI A;  1BAO A;  1AQZ A;  1JBS A;  1B21 A;  1RTU A;  1FUS A;  1LOV A;  1GOY A;  1PY3 A;  1FZU A;  3SYU A;  1HYF A;  1LOW A;  1BIR A;  1RNB A;  1C54 A;  2GSP A;  3AHW A;  1T2H A;  1GMP A;  1FUT A;  4GHO A;  3Q3F A;  1RGF A;  1I2G A;  1TTO A;  1BSE A;  1UCK A;  1I8V A;  1RNT A;  2F4Y A;  1RGC A;  1A2P A;  1BSD A;  1BAN A;  1MGW A;  1RGH A;  1BRG A;  2BIR A;  2KF5 A;  4J5K A;  3WHO A;  4BU4 A;  2BU4 A;  1RDS A;  1UCJ A;  3WR2 A;  1BSC A;  1X1U A;  5GSP A;  1B20 A;  2HOH A;  1BRH A;  4HAA A;  1I2F A;  1YVS A;  2RBI A;  1BNR A;  1BRN L;  1BNS A;  1AY7 A;  1RGG A;  5BU4 A;  5RNT A;  1SAR A;  4BIR A;  1I2E A;  1RGE A;  3AHS A;  1BOX A;  1TRP A;  2F56 A;  1X1Y A;  1LOY A;  4GSP A;  2KAA A;  1BRS A;  1BU4 A;  2AAE A;  2ZA4 A;  1RHL A;  1RCL A;  1PYL A;  2KF4 A;  1BGS A;  1T2I A;  1LRA A;  1BNI A;  1LNI A;  1BNJ A;  1RGL A;  1RLS A;  1BSA A;  9RNT A;  7GSP A;  2SAR A;  2KF3 A;  1B27 A;  1FYS A;  1G02 A;  1RGK A;  3AGN A;  3DGY A;  1BUJ A;  1RGA A;  1RCK A;  1YGW A;  2AAD A;  1B3S A;  1JBR A;  1I3I A;  1Q9E A;  1GMQ A;  1YNV X;  1GSP A;  1HZ1 A;  1MGR A;  2C4B A;  4J5G A;  2RNT A;  3KCH A; 
#chains in the Genus database with same CATH topology
 1GY5 A;  3RNT A;  2XFT A;  1DET A;  2W03 A;  2XF3 A;  3QRD A;  1JBT A;  4JF8 A;  3GZX B;  1JV2 B;  5KP4 A;  4RBN A;  1O7N B;  1RRL A;  2UUG C;  1BRK A;  4QWT A;  1LVN A;  3D5I A;  1KQS 2;  4X2H A;  5LC6 A;  4HM2 B;  4XBT A;  2KF6 A;  3DGN A;  3G8Z A;  2CFG A;  4HYZ A;  1B2U A;  1CEW I;  1JZO A;  4N6T A;  1VQ4 3;  4OUQ A;  2CG1 A;  1TRQ A;  1NJI 4;  1IK3 A;  2BMO B;  1I3F A;  2BMR B;  4IT7 A;  5FW5 A;  1AR0 A;  1RMS A;  1WMP A;  2Z6B A;  3DXO A;  5BIR A;  1CH0 A;  4FMA A;  4WWU C;  3PS8 A;  3G4S 3;  1RN1 A;  2CKF B;  3EN8 A;  3DY5 A;  1FGO A;  4BL2 A;  1JNQ A;  4FCZ A;  1IV9 A;  1UW1 A;  4N3V A;  2F99 A;  3ROB A;  4HZ9 B;  2P0X A;  1GS3 A;  2STD A;  3K9M C;  3OXA A;  2HMK B;  3PGB A;  5D82 A;  3WDG B;  1I0X A;  1UDI I;  1VQ9 3;  1BVI A;  4BL3 A;  1AQZ A;  2ZDJ A;  4N6N B;  1B21 A;  5M18 A;  1MWU A;  3CU3 A;  2W9P A;  1T5Y A;  1FZU A;  3IJE B;  4FMD A;  1LOW A;  1BIR A;  2D1W A;  1FGQ A;  2P09 A;  5BVB A;  2GXF A;  1K73 4;  3FF2 A;  1T2H A;  1GD4 A;  1OGZ A;  1IT7 A;  2ML5 A;  2RCD A;  3NM2 A;  3JUQ A;  1I2G A;  3MSO A;  3Q1C A;  1ULI B;  3Q3F A;  1JN5 B;  1TTO A;  7STD A;  1EQK A;  1S72 3;  1Q40 B;  5IEP A;  3CCR 3;  3F7S A;  4J8T A;  1W6G A;  1A2P A;  2XRX B;  1RGH A;  4J5K A;  1VQ6 3;  1GY7 A;  1OPY A;  4BU4 A;  2BU4 A;  2Z7A A;  4WYK B;  1W00 A;  1BSC A;  3MG2 A;  1N9E A;  1B20 A;  1RN7 A;  3CCJ 3;  2RSX A;  1U8C B;  1OAC A;  3V99 A;  4GL6 A;  2FNQ A;  3N8B A;  1ROV A;  1YVS A;  2YFL B;  1BRN L;  1ASK A;  5AEW B;  2CFK A;  3EF8 A;  1BNS A;  1AY7 A;  2CX0 A;  2H0I A;  3T0U A;  2WOF A;  4BIR A;  1ZO2 A;  3S28 A;  1I2E A;  3D3L A;  1QVG 2;  3CME 3;  3AMO A;  3FSD A;  3O8Y A;  2KAA A;  1BU4 A;  1DMM A;  2ZA4 A;  2R4I A;  4CCV A;  2MC8 A;  1NNV A;  1RHL A;  2IMJ A;  3X3Z A;  3FKA A;  3G6E 3;  3N54 B;  1PYL A;  1Y4K A;  2HMN B;  5I97 A;  1LNI A;  4JRF A;  4O3V A;  4BTW A;  3ECF A;  1MWT A;  1RLS A;  3MYT A;  3I55 3;  1BSA A;  1W2B 2;  1EKM A;  1NO3 A;  3KSE D;  3I0Y A;  5M19 A;  1EEJ A;  1G02 A;  1K8A 4;  3OV4 A;  3RGA A;  2AAD A;  2HMO B;  1B3S A;  4HM1 B;  4N6V 0;  1YJN 3;  2ZL8 A;  2LYX A;  1K41 A;  1YI2 3;  4G1M B;  4CJN A;  1GSP A;  2K0M A;  2A15 A;  2RGQ A;  4J5G A;  2RNT A;  3KCH A;  5IEN A;  1B2M A;  3K0Z A;  1UCI A;  3BIR A;  1JB2 A;  4HM0 B;  3AGO A;  3MG3 A;  4BTX A;  1WTH A;  2B24 B;  1BRJ A;  2CG0 A;  2W2C A;  1IVV A;  3EJV A;  1VQQ A;  3D5G A;  3F8H A;  1UCL A;  3NHX A;  3I56 3;  2MF7 A;  2PNC A;  1R4Y A;  2CH9 A;  1FGM A;  1E3R A;  1G96 A;  1ROA A;  1YGE A;  2UX0 A;  3B7C A;  1GYB A;  3N9H A;  4MJD A;  5DRV A;  5FGO A;  3UNL A;  3NBR A;  1BSB A;  3KKG A;  3NV0 B;  4CDL A;  3EC9 A;  3PYJ A;  2JDI H;  1JKG A;  1ZGX A;  1STD A;  1E97 A;  4N6U A;  5IG5 A;  3PXM A;  1QJG A;  3OWY A;  2HML B;  5D83 A;  1A67 A;  1BNG A;  4L8P A;  5STD A;  2WGQ A;  2RFR A;  2Y74 A;  3A5E A;  3RDE A;  1O7M B;  1IYY A;  1B2X A;  1B2S A;  1GD3 A;  3EX9 A;  5IG4 A;  3K7C A;  4HM3 B;  1BNE A;  3LTD A;  5G1L A;  3OWS A;  5EEO A;  4ZM8 A;  2WO0 A;  4HBR A;  1X1W A;  3SX1 A;  1O7H B;  6GSP A;  6RNT A;  1JKG B;  1SQW A;  3ZG5 A;  1VQ7 3;  2F5W A;  3DGM A;  1QAF A;  3SLU A;  5JPP A;  1BAO A;  3V98 A;  2F86 B;  3EBT A;  2L4V A;  1M1X B;  1E3V A;  3U97 A;  1IT8 A;  4AEQ A;  3LZA A;  1C54 A;  2W04 A;  1GMP A;  1VQM 3;  1N8Q A;  3OX9 A;  4LZI A;  2HMJ B;  1JB5 A;  1RGF A;  1VQL 3;  2Q07 A;  3G71 3;  3ZFZ A;  1RGC A;  4AKZ A;  2BIR A;  1BAN A;  1BSD A;  1OHO A;  1STF I;  2KF5 A;  3GZB A;  3JUO A;  1W6Y A;  1WNH A;  1N5H A;  2O3O A;  2P05 A;  3KE7 A;  1TUH A;  2CC3 A;  1LOX A;  2HMM B;  4EV2 A;  1YIJ 3;  1JN5 A;  3B4P A;  2BO9 B;  3Q2P A;  1OHS A;  4K1U A;  5GSP A;  1Q40 A;  3WMD A;  1BRH A;  3X41 A;  1DMQ A;  1CYV A;  2WGO A;  1R4C A;  2XSO B;  2Z76 A;  2IUJ A;  3KN4 A;  1NB5 I;  5IEO A;  2W9Q A;  3ALA A;  1Z1S A;  5G2G A;  3X42 A;  3OW2 2;  2RBI A;  1PFP A;  1FUW A;  5JBS A;  4WYK A;  1RGG A;  3NM7 A;  5BU4 A;  5RNT A;  3MG1 A;  1SAR A;  1UUV B;  1YHQ 3;  3SXX A;  1RGE A;  1IQY A;  1JRQ A;  1UUG B;  1BOX A;  3NXJ A;  2LQV A;  4I4K A;  1X1Y A;  1LOY A;  2YX9 A;  1N9J A;  3MWZ A;  2GEY A;  2KRT A;  4XDV A;  4O8S A;  3EBY A;  4PEJ A;  4Q53 A;  1Q42 A;  2F98 A;  1NU3 A;  1A2V A;  1UGH I;  1LQG C;  3GWR A;  3LT8 A;  2KF4 A;  3NX0 A;  1BGS A;  4HM5 B;  3CCE 3;  3LOY A;  1BNI A;  1MWS A;  3EHC A;  1W4N A;  2K3D A;  2OQE C;  1W2Z A;  1M1K 4;  4HM7 B;  7GSP A;  5CF1 A;  1VQP 3;  1VQ5 3;  2PZV A;  4KZ1 A;  1IQX A;  1FYS A;  3DGY A;  3X3Y A;  1KWI A;  3LH4 A;  4H61 A;  3J7Y d;  1YIT 3;  3BNE A;  1WQL B;  5AIH A;  4U13 A;  4NRE A;  2GU3 A;  1Q9E A;  3U1W A;  1MWR A;  1W5Z A;  5CXO A;  1YNV X;  4EBG A;  3CMA 3;  3GAX A;  4STD A;  3NUV A;  2GU1 A;  1HZ1 A;  1MGR A;  1MNL A;  2OOV C;  4LMI A;  1LXE A;  2C4B A;  3LT9 A;  4KFD A;  2OQE A;  3RGR A;  3WOD G;  2OTL 3;  1CQS A;  1DE3 A;  1GOV A;  1V57 A;  2CWT A;  4L7K A;  4NHF A;  4EV5 A;  1IU7 A;  1QVF 2;  3S5C A;  3HOH A;  3WOE B;  1FGR A;  3H3H A;  1Q7H A;  2V1L A;  2QIY A;  3BNC A;  3OWU A;  5ELU A;  3CC4 3;  3DZL A;  3JVC A;  2H0H A;  4HM8 B;  1UI8 A;  2W56 B;  2ZHX B;  1J2B A;  4KVH A;  3D4A A;  1V58 A;  2BMQ B;  4KT3 B;  5AIG A;  5IW9 A;  1K9M 4;  3LML A;  4FR9 A;  5HGR A;  1DYU A;  3MPH A;  3TDG A;  4X2O A;  2OTJ 3;  1SPU A;  3EQQ B;  4K90 B;  1OUN A;  3GSP A;  3URP A;  1FW7 A;  1BNF A;  3ZG0 A;  3CNX A;  4HM4 B;  3CPO A;  3D9R A;  5EQL A;  4ILF A;  5HOH A;  3BLZ A;  3BU4 A;  3NV0 A;  3LXU X;  2XFS A;  3CXC 2;  3F40 A;  4XBX A;  1JJ2 2;  4RZM A;  2E2V A;  2GEX A;  1RSN A;  4HOH A;  1BUQ A;  2XEP A;  1NB3 I;  3KZT A;  4MMZ B;  3JUM A;  3GZR A;  1F8N A;  3FG4 A;  1OCV A;  1AVL A;  1A2K A;  8RNT A;  3F8X A;  4IPB A;  1PU4 A;  3QK9 A;  3K5T A;  1SII A;  2IUK A;  3DGO A;  1JBS A;  3FGY A;  1FUS A;  3HX8 A;  1LOV A;  4LEH A;  5AYS C;  3SOA A;  3CC2 3;  4FMC A;  3IPT A;  3CCQ 3;  1PY3 A;  3F9S A;  1DVD A;  1TU5 A;  4GHO A;  1TIJ A;  1NDO B;  3DMC A;  3STD A;  1KD1 4;  2E2U A;  3AHW A;  3BB9 A;  2CFD A;  1FUT A;  3WOF B;  3FH1 A;  2XGL A;  1WMO A;  3T8N A;  1UI7 A;  5ELJ A;  2QGU A;  1UUW B;  2WOH A;  4FMB A;  4KFE A;  1SJW A;  1UCK A;  5IG3 A;  3LTA A;  4WFO A;  2F4Y A;  1OH0 A;  1T3B A;  2K54 A;  1MGW A;  1BRG A;  3DGL A;  3WHO A;  1L5G B;  1RDS A;  3WR2 A;  5AEU B;  1AVK A;  3CC7 3;  2HOH A;  4HVN A;  1U5O A;  1DVC A;  2CWV A;  1IVX A;  1QMA A;  3EN1 B;  1Q7Y 4;  1TP6 A;  3K63 A;  3M8C A;  1IVW A;  2FGT A;  4N6O B;  2CX1 A;  2XR8 B;  3F14 A;  4FCJ A;  1ZS7 A;  1UGI A;  1HU9 A;  3VSY A;  3PCR A;  1TFO A;  3FLJ A;  4AKY A;  5BXQ A;  3F7X A;  3CCM 3;  2GBX B;  2M7O A;  4N6L A;  2CFW A;  2Y73 A;  4L8O A;  3CNM A;  1RCL A;  2BNG A;  2ML6 A;  2W6J H;  1T2I A;  3LTB A;  4EW5 A;  1LRA A;  1RGL A;  3HIG A;  1TJD A;  5IF6 A;  5CLK A;  3EB8 A;  1IV7 A;  3T8U A;  1KSI A;  3BND A;  2INX A;  2SAR A;  2UGI A;  2KF3 A;  3PZW A;  4XBY A;  3AGN A;  3PCS A;  4HM6 B;  4RNY A;  1RGA A;  1YGW A;  1OF5 A;  3X40 A;  2XSH B;  1JBR A;  1O7W B;  1I3I A;  1VQN 3;  1D6Y A;  1QAK A;  2IA7 A;  1GMQ A;  3B8L A;  1GY6 A;  3D79 A;  3ER7 A;  3BNB A;  1D6Z A;  2OCT A;  2KCD A;  5TGN A;  3CPW 2;  3MHE A;  5AYR B;  4NPB A;  3NBJ A;  4I5Q A;  4MEI A;  3UJM A;  1IQ8 A;  1RNB A;  4HZB B;  3IMA B;  2KXG A;  3S67 A;  1YVB I;  5AII A;  4EC6 A;  2E2T A;  3KSP A;  4FCM A;  2L1S A;  1WMN A;  5D81 A;  3X3X A;  2CWU A;  3DH2 A;  4XB5 A;  4J9A A;  1OF5 B;  3JUN A;  4GB5 A;  1Q86 4;  3FF0 A;  1VQ8 3;  3NQZ A;  2I9W A;  1V74 A;  2H0G A;  1ZX2 A;  3HII A;  4TX4 A;  1YJ9 3;  6STD A;  4LYL B;  1ISK A;  2Z77 A;  3UL6 A;  2QA4 3;  1W01 A;  2W56 A;  3S27 A;  1GMR A;  1RN4 A;  2B1X B;  1NWW A;  1S5A A;  4R4K A;  2R41 A;  1B2Z A;  1CYU A;  3S29 A;  1BRI A;  4MMY B;  2YFI B;  5IER A;  1TFK A;  1A90 A;  2W0Q A;  4IIA A;  4K61 A;  2F5M A;  3H51 A;  3FCS B;  2IY2 A;  2JQ5 A;  2QEX 3;  2C10 A;  5AIF A;  2OWP A;  4N6M A;  4R80 A;  3SVA A;  3B4O A;  3E99 A;  4LSO A;  3VGN A;  1I70 A;  5KP1 A;  3NQY A;  1MOL A;  2XGN A;  7RNT A;  3GRD A;  1X1X A;  1I0V A;  3NBB A;  4R9K A;  2IYJ A;  2O9U X;  5EVH A;  1OHP A;  4R1K A;  3CD6 3;  3CCV 3;  1GOU A;  1FA3 A;  4RNT A;  1IVU A;  1EA2 A;  1ULJ B;  8CHO A;  2BT3 A;  3G16 A;  3HK4 A;  3L0R A;  4KFF A;  4OVM A;  4XM4 A;  2OOV A;  2CHC A;  3A76 A;  1LNH A;  1RTU A;  4EXR A;  1GOY A;  1VQK 3;  1W6C A;  3SYU A;  3V92 A;  1HYF A;  4CPK A;  1VQO 3;  1VZZ A;  5LC7 A;  3CCL 3;  1M9G A;  1KC8 4;  4MMX B;  3KFQ C;  5KP3 A;  2GSP A;  4EYC A;  1JB4 A;  4H3U A;  2XH9 A;  1US1 A;  3MKI A;  4R9L A;  1EG9 B;  3FG3 A;  2P38 A;  5CK6 A;  1BSE A;  1C7H A;  5M1A A;  1I8V A;  1RNT A;  3G0K A;  1AV4 A;  4WHA A;  3WA3 A;  3UB1 A;  4HKV B;  1K28 A;  1UCJ A;  1LQM B;  3DUK A;  1X1U A;  4LGQ A;  3AMO B;  1YJW 3;  1O7P B;  4HAA A;  4ORL A;  1I2F A;  4O02 B;  1IDP A;  1RRH A;  4O2H A;  3CCS 3;  1OGX A;  2CIU A;  1QAL A;  5DRE A;  3UL5 A;  2CFL A;  1BNR A;  4BTY A;  1N8R 4;  1N5P A;  2P0M A;  4RNZ A;  2YFJ B;  5AI1 A;  3AHS A;  2BHM A;  1Q81 4;  3DM8 A;  1JZD A;  3FZW A;  4WP5 A;  1TRP A;  1W7C A;  2CK3 H;  2D42 A;  2F56 A;  1W02 A;  3LTC A;  4GSP A;  1BRS A;  5G1K A;  5JPU A;  3SED A;  2AAE A;  4HJL B;  3WA2 X;  5IG0 A;  1O7G B;  3HZP A;  3HI7 A;  4XDW A;  3KII A;  4OK0 A;  1BNJ A;  1RKY A;  3VF1 A;  3LYG A;  2FXT A;  5CF2 A;  9RNT A;  1M90 4;  1DMN A;  2J8X B;  3CCU 3;  1HKX A;  1B27 A;  1RGK A;  1RJO A;  1BUJ A;  3GZY B;  3JUP A;  1RCK A;  1G0T A;  3FG1 A;  1EUI C;  3Q90 A;  2SBL A;  2GBW B;  1FGT A;  2C11 A;  3SOY A;  1D6U A;  4K1V A;  1SIH A;  3EE1 A;  1Q82 4;  2CW9 A;  4DKI A;  5A0O B; 
#chains in the Genus database with same CATH homology
 1B2M A;  1DE3 A;  1GOV A;  1UCI A;  3BIR A;  3HOH A;  3RNT A;  3AGO A;  1DET A;  1BRJ A;  1JBT A;  3DH2 A;  3D5G A;  1UCL A;  3D4A A;  1R4Y A;  1BRK A;  3D5I A;  1BSB A;  2KF6 A;  1B2U A;  1ZGX A;  3GSP A;  3URP A;  1FW7 A;  1BNF A;  1GMR A;  1RN4 A;  1BNG A;  1B2Z A;  1TRQ A;  3A5E A;  1BRI A;  1I3F A;  5HOH A;  1IYY A;  1B2X A;  1B2S A;  1RMS A;  3BU4 A;  2F5M A;  5BIR A;  1CH0 A;  1RN1 A;  1BNE A;  1RSN A;  4HOH A;  1X1W A;  6GSP A;  1I70 A;  8RNT A;  7RNT A;  1X1X A;  1I0V A;  6RNT A;  1GOU A;  4RNT A;  2F5W A;  1I0X A;  1BVI A;  1BAO A;  1AQZ A;  1JBS A;  1B21 A;  1RTU A;  1FUS A;  1LOV A;  1GOY A;  1PY3 A;  1FZU A;  3SYU A;  1HYF A;  1LOW A;  1BIR A;  1RNB A;  1C54 A;  2GSP A;  3AHW A;  1T2H A;  1GMP A;  1FUT A;  4GHO A;  3Q3F A;  1RGF A;  1I2G A;  1TTO A;  1BSE A;  1UCK A;  1I8V A;  1RNT A;  2F4Y A;  1RGC A;  1A2P A;  1BSD A;  1BAN A;  1MGW A;  1RGH A;  1BRG A;  2BIR A;  2KF5 A;  4J5K A;  3WHO A;  4BU4 A;  2BU4 A;  1RDS A;  1UCJ A;  3WR2 A;  1BSC A;  1X1U A;  5GSP A;  1B20 A;  2HOH A;  1BRH A;  4HAA A;  1I2F A;  1YVS A;  2RBI A;  1BNR A;  1BRN L;  1BNS A;  1AY7 A;  1RGG A;  5BU4 A;  5RNT A;  1SAR A;  4BIR A;  1I2E A;  1RGE A;  3AHS A;  1BOX A;  1TRP A;  2F56 A;  1X1Y A;  1LOY A;  4GSP A;  2KAA A;  1BRS A;  1BU4 A;  2AAE A;  2ZA4 A;  1RHL A;  1RCL A;  1PYL A;  2KF4 A;  1BGS A;  1T2I A;  1LRA A;  1BNI A;  1LNI A;  1BNJ A;  1RGL A;  1RLS A;  1BSA A;  9RNT A;  7GSP A;  2SAR A;  2KF3 A;  1B27 A;  1FYS A;  1G02 A;  1RGK A;  3AGN A;  3DGY A;  1BUJ A;  1RGA A;  1RCK A;  1YGW A;  2AAD A;  1B3S A;  1JBR A;  1I3I A;  1Q9E A;  1GMQ A;  1YNV X;  1GSP A;  1HZ1 A;  1MGR A;  2C4B A;  4J5G A;  2RNT A;  3KCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...