1BIRA

Ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNAVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
publication title A catalytic function for the structurally conserved residue Phe 100 of ribonuclease T1.
pubmed rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1birA00
1FYSA 1TRPA 1GSPA 1RNBA 1SARA 1YVSA 1BOXA 1FZUA 2KF3A 1UCLA 1I3IA 3BU4A 1G02A 1IYYA 3BIRA 1UCKA 1T2IA 1UCJA 1RGAA 5GSPA 4HOHA 1BRJA 1BSAA 1RCKA 1A2PA 1UCIA 2ZA4A 5BIRA 1I3FA 2BIRA 1TRQA 1X1XA 3A5EA 1BRSA 1PY3A 3WR2A 1RGLA 1BRGA 3HOHA 1GOUA 1FUTA 1RLSA 3KCHA 1I0XA 4J5KA 1HYFA 1RHLA 1MGRA 1ZGXA 3WHOA 1LRAA 1BSEA 1RGGA 1RGHA 1TTOA 1BGSA 1HZ1A 1PYLA 1B27A 1LOVA 2AAEA 4RNTA 5BU4A 1DE3A 1B2UA 1I2GA 1LOWA 1BU4A 1BRKA 1MGWA 5HOHA 1Q9EA 1AQZA 1BNJA 1RSNA 3Q3FA 1I8VA 1C54A 1BNFA 2BU4A 1GMPA 2F56A 2KF4A 1BSDA 1I2FA 1B21A 1RGFA 1I0VA 4GHOA 1B2MA 3DH2A 7RNTA 3GSPA 1FUSA 2HOHA 1BNSA 3RNTA 1BRHA 2RBIA 3D5GA 1RMSA 3AGOA 1B2SA 2C4BA 1LOYA 1RNTA 1RTUA 3AHSA 1RN1A 1DETA 1I70A 3SYUA 1BNIA 1BVIA 1BRIA 3D4AA 2F4YA 1JBRA 5RNTA 1YGWA 1BANA 1JBSA 1B2XA 1I2EA 1YNVX 1FW7A 9RNTA 1AY7A 1LNIA 2KAAA 1BNGA 1BNEA 1R4YA 1RGCA 2F5WA 1GOYA 1RGKA 7GSPA 1JBTA 6GSPA 1B2ZA 2GSPA 1GMQA 1BRNL 6RNTA 1RCLA 1B3SA 2RNTA 2SARA 8RNTA 4BU4A 1BIRA 1BSCA 1RDSA 4J5GA 1RN4A 1GOVA 1BSBA 2KF6A 2AADA 3D5IA 3URPA 1RGEA 2KF5A 1X1WA 4HAAA 1X1YA 2F5MA 1X1UA 4BIRA 1B20A 1GMRA 1T2HA 1CH0A 3AHWA 3AGNA 1BUJA 1BAOA 3DGYA 4GSPA 1BNRA
chains in the Genus database with same CATH superfamily
2CHCA 1ISKA 1RNBA 2CFGA 1VQ93 4HYZA 3FLJA 4KFDA 1VQ83 3SX1A 1IYYA 1DMQA 3BIRA 3N9HA 3CC43 3CPOA 3WA3A 3NHXA 1T2IA 4HM8B 1RKYA 3WOFB 3TDGA 1Q40A 2BMQB 4JRFA 1RGAA 1YI23 5KP3A 1VQL3 1YJ93 1A2PA 1T5YA 2STDA 2ZA4A 3LOYA 1W7CA 4RZMA 2BIRA 3BNEA 1EEJA 4RNZA 2W04A 4STDA 1OHSA 1IK3A 2Z6BA 3KKGA 1W2ZA 1X1XA 3BNBA 3A5EA 3LT9A 4KT3B 1BRSA 3OWYA 4XDWA 5CF1A 1FGMA 1RGLA 4PEJA 1GOUA 1LOXA 2RCDA 2UUGC 1O7PB 1WMNA 4KZ1A 5AEWB 2H0HA 3CCE3 1BSEA 1VQP3 4FCZA 3X41A 1TTOA 3DMCA 3G8ZA 3Q1CA 1B2UA 1I2GA 1MWSA 3EBTA 3ZG0A 1NO3A 2HMJB 3HI7A 1MNLA 3JVCA 2MC8A 1VQ53 1STFI 1FA3A 1EUIC 1SQWA 1AQZA 2LYXA 2BO9B 2Z76A 3B8LA 3BNDA 2E2VA 3FKAA 1I8VA 3DZLA 3HIIA 3U97A 1A67A 1BNFA 1YJW3 1Q7HA 4FMCA 1BSDA 1KD14 3HK4A 1IU7A 2ZDJA 1O7NB 1MWRA 3EN8A 4GL6A 1B2MA 3RGAA 3DH2A 2GBXB 4XBYA 3UL6A 1CQSA 2JQ5A 1FUSA 4WYKA 1UUWB 3CC23 3V92A 1GD3A 3RNTA 1BRHA 1IVWA 4WHAA 1UGIA 1K28A 1E97A 2CKFB 2IYJA 2RBIA 2F86B 2P0MA 3AGOA 1B2SA 4IPBA 3HIGA 1BUQA 1W6GA 3FG1A 4RNYA 1D6UA 1RNTA 2BNGA 3MSOA 3CPW2 3K9MC 2QEX3 2M7OA 3EC9A 4K61A 4N6TA 1QALA 5IEOA 1VQ63 2RGQA 3WMDA 1BRIA 1YGEA 2GEYA 3D4AA 3MHEA 4N6LA 3FH1A 4LZIA 5CXOA 3PZWA 1W00A 3VF1A 5AEUB 3CCR3 1M904 4FCJA 9RNTA 5FGOA 5IENA 2WOFA 3BNCA 1BNGA 3GZRA 4BTXA 1OPYA 2WOHA 3N8BA 3LXUX 1ULIB 2GSPA 2O9UX 6RNTA 1EQKA 3G0KA 4MJDA 1NNVA 2QGUA 2XH9A 2RNTA 4TX4A 3OWSA 1O7HB 4KFFA 3OX9A 1BSCA 3F40A 5LC6A 3J7Yd 3NV0B 3D3LA 3CCL3 4ILFA 1MWUA 3AMOA 1RN4A 4J5GA 1W5ZA 2XEPA 3UJMA 1QMAA 1QAFA 4RBNA 2QA43 3D5IA 2OTJ3 1LNHA 3MG2A 4L7KA 4HAAA 5AYSC 2E2TA 4U13A 1TFOA 2HMLB 4N6OB 1Q864 3F14A 3OWUA 1RRHA 3AHWA 4MEIA 4BL3A 4O8SA 2F99A 3IMAB 1D6YA 3DGYA 3LH4A 1BNRA 3LT8A 1FYSA 3FG3A 3X3YA 1SARA 1YVSA 2J8XB 1BOXA 3M8CA 1JB5A 1KSIA 3B4PA 1OGXA 1N5PA 1GS3A 1I3IA 3BU4A 3CCU3 2GU3A 1G02A 3L0RA 5A0OB 1VQ73 2RSXA 5AIIA 2C10A 1JN5A 1GY5A 1RN7A 1UCJA 1CYVA 1RCKA 1UCIA 5D81A 1DYUA 3LTAA 4EW5A 4BL2A 3QRDA 5EQLA 5HGRA 3Q2PA 1W4NA 2P0XA 1J2BA 8CHOA 1MWTA 1PY3A 2BMOB 3WR2A 4AKYA 2XR8B 1BRGA 1JZDA 2QIYA 3FG4A 1FUTA 3PXMA 2XSOB 2SBLA 4J5KA 2HMKB 2W03A 1RHLA 1MGRA 1RJOA 1Z1SA 4XB5A 2Z7AA 3B7CA 2AAEA 4RNTA 2W56A 2BMRB 1W6CA 2CX1A 3CCQ3 1M1XB 3HZPA 1BRKA 1LQMB 1MGWA 5IERA 1FGOA 1UUVB 2Q07A 3FCSB 1BNJA 2CFLA 1AV4A 2D42A 4LEHA 3EQQB 1GY6A 1GMPA 2F56A 2KF4A 2KRTA 4JF8A 2INXA 4I5QA 5AYRB 4HKVB 1N5HA 1RGFA 1N8R4 1N9EA 3X40A 1NDOB 1NJI4 4GHOA 1W01A 5M1AA 4QWTA 1YIJ3 2XF3A 1KC84 2GXFA 3DGMA 1BNSA 5DREA 4FMBA 3CCJ3 1TP6A 3GWRA 1JRQA 2C4BA 3T0UA 3UL5A 1IV9A 2FXTA 4XM4A 3T8UA 3G713 3AHSA 1OHOA 6STDA 2D1WA 3K63A 1T3BA 1ULJB 3EB8A 1GD4A 3SYUA 1BNIA 4L8OA 2KXGA 1SIHA 2F4YA 5M19A 5RNTA 1JBRA 4HM7B 1YGWA 1DMNA 1BANA 3JUMA 1UUGB 3ROBA 1YNVX 1FW7A 3UB1A 2CX0A 1AY7A 4R80A 2I9WA 1LNIA 1E3VA 2KAAA 2CH9A 2K3DA 1DMMA 2O3OA 4R4KA 1GOYA 1STDA 4GB5A 6GSPA 3X42A 1CYUA 1OF5A 3NBRA 1PU4A 2OCTA 3ZG5A 3DGOA 3CME3 1ZX2A 1CEWI 1O7MB 1TJDA 1EG9B 3SLUA 1ZS7A 1UDII 1VQM3 4N6NB 3EX9A 4HVNA 1S723 3LMLA 4WP5A 3U1WA 4O2HA 4K1VA 3GRDA 3LTCA 1NB5I 3MKIA 1RGEA 2HMMB 3PYJA 4L8PA 4IIAA 4N6UA 4OUQA 1K734 2BT3A 1JV2B 5IEPA 2IY2A 4LMIA 2H0IA 4KFEA 1B20A 4ORLA 1PFPA 3AGNA 4HM3B 3BB9A 3IJEB 1K8A4 1BUJA 2LQVA 2CK3H 3D9RA 4GSPA 5CF2A 3BLZA 2KCDA 2IMJA 1GSPA 2CFDA 3CU3A 3OV4A 4HM0B 3CD63 3JUQA 1OUNA 2KF3A 1HKXA 3WODG 1FGTA 3ZFZA 3DM8A 3DGLA 3EF8A 4MMXB 2CFKA 1GY7A 5IG5A 3I563 2CG0A 3MWZA 1GYBA 4K1UA 3G6E3 4NREA 3DUKA 5BIRA 3K5TA 1I3FA 1WMPA 2A15A 2R4IA 1JB2A 2K54A 1AR0A 3LYGA 3I553 1QJGA 3FZWA 5AI1A 3DXOA 1JKGA 1RLSA 5D82A 1O7GB 1I0XA 2R41A 3KCHA 5AIHA 2OOVA 1Q824 1LRAA 1RGGA 3ER7A 1RGHA 1YIT3 1SJWA 1Y4KA 1BGSA 1HZ1A 1PYLA 1LOVA 5BU4A 4XDVA 1QVG2 3F9SA 5G1KA 4FR9A 1LOWA 1BU4A 3GZXB 3K0ZA 3EJVA 1ZO2A 1U8CB 4HJLB 5HOHA 1ASKA 5M18A 1RSNA 2Y73A 3HX8A 3JUNA 4DKIA 1C54A 3G4S3 1IQ8A 2BU4A 4EV2A 5KP4A 2YFJB 3H51A 3FGYA 5EVHA 1B21A 1DVDA 1QAKA 3S28A 2FNQA 3S5CA 2ML6A 1AVKA 2PNCA 3FF0A 3KZTA 2H0GA 3B4OA 2WGQA 1K41A 3LZAA 4WWUC 3ALAA 3GSPA 4WFOA 1JN5B 1FGRA 4AEQA 1WNHA 2XRXB 5IG0A 1C7HA 4ZM8A 3RDEA 1M1K4 5G1LA 1FGQA 1E3RA 4NPBA 4EV5A 3D5GA 1RMSA 3EN1B 2W6JH 3WOEB 1VQQA 2E2UA 4G1MB 3PCRA 5IW9A 2CIUA 1RN1A 3MG1A 2F98A 3Q90A 3NM2A 4BTWA 7STDA 2B24B 2IUJA 1IQXA 3LTDA 2OQEC 3KFQC 1N8QA 2WO0A 2YFLB 4HZ9B 4CDLA 2XFSA 1V57A 1JBSA 3KN4A 1I2EA 3GAXA 4XBXA 3SXXA 4LYLB 2V1LA 2XGLA 5DRVA 2YFIB 5CLKA 3CXC2 1N9JA 1IT7A 4OVMA 2F5WA 5IG3A 2C11A 3NUVA 2HMOB 1RGKA 3PS8A 1JBTA 1B2ZA 1Q40B 1A2VA 4BTYA 1YVBI 2W0QA 5I97A 1VQN3 3KSPA 1G0TA 4R9KA 2L1SA 1B3SA 1RRLA 1SPUA 2CFWA 3D79A 8RNTA 4BU4A 1SIIA 3CCS3 1UGHI 4K90B 5IG4A 3EHCA 1DVCA 4OK0A 1GOVA 1NU3A 2KF6A 1OCVA 5CK6A 1LXEA 1VQK3 1KQS2 3DGNA 3NQYA 5JPPA 3OXAA 3URPA 1VQO3 1R4CA 2BHMA 3CNMA 2OOVC 2F5MA 2ML5A 4BIRA 1T2HA 1CH0A 3KE7A 1ROAA 3NX0A 5LC7A 1Q42A 3LTBA 2WGOA 1D6ZA 2IUKA 2P09A 4FMDA 5EEOA 4EC6A 1JJ22 2W9QA 2UGIA 3V99A 2CWTA 1YHQ3 1US1A 1TRPA 4HM5B 1L5GB 3FF2A 1OH0A 3A76A 1FZUA 2CWVA 3WDGB 1EKMA 3QK9A 1UCLA 1WTHA 3VGNA 3RGRA 2MF7A 1UCKA 1F8NA 1ROVA 2GEXA 2XFTA 2XGNA 1LQGC 3IPTA 1LVNA 2Z77A 3KSED 5GSPA 4WYKB 5TGNA 2GU1A 1BRJA 1BSAA 2L4VA 4HOHA 4EXRA 3GZBA 3CC73 5JBSA 1IT8A 3DY5A 3CNXA 1M9GA 1OF5B 1K9M4 1TRQA 4NHFA 1Q814 3S29A 3EBYA 2OQEA 1UW1A 1TUHA 1TIJA 3HOHA 4R9LA 2CC3A 3X3ZA 1VZZA 1UI8A 4EBGA 4HBRA 1HYFA 1ZGXA 3WHOA 4EYCA 4HZBB 3VSYA 5BXQA 1B27A 1EA2A 1DE3A 4O3VA 5FW5A 3X3XA 4LSOA 1V74A 3NQZA 2CWUA 3E99A 5G2GA 1Q9EA 5BVBA 5D83A 3N54B 1AVLA 3Q3FA 1IDPA 1U5OA 3O8YA 2RFRA 4HM2B 2HMNB 1OHPA 3F8HA 1I2FA 2P05A 1JZOA 3JUPA 5IF6A 1IV7A 3JUOA 1I0VA 4Q53A 4AKZA 5KP1A 1QVF2 2W2CA 3CCM3 3STDA 3NV0A 2K0MA 4IT7A 4X2OA 1TFKA 3S67A 3H3HA 7RNTA 1G96A 3G16A 4J9AA 4I4KA 2HOHA 3MYTA 3SOAA 2YX9A 1V58A 3F7XA 3EE1A 3AMOB 4HM4B 2FGTA 3CMA3 1OACA 4H61A 1KWIA 1FUWA 4HM1B 2ZL8A 1LOYA 5JPUA 2OWPA 1RTUA 3SVAA 3NBJA 4N3VA 4HM6B 1DETA 5AIGA 4CPKA 1I70A 1A2KA 1MOLA 1WQLB 4KVHA 2JDIH 2PZVA 1HU9A 3MPHA 1JKGB 4XBTA 1BVIA 4MMZB 2W9PA 3SOYA 1O7WB 2UX0A 1W2B2 3WA2X 2Y74A 3FSDA 3UNLA 1NWWA 4J8TA 3F8XA 1B2XA 4FCMA 4CJNA 3KIIA 2ZHXB 3K7CA 1TU5A 4R1KA 3CCV3 2IA7A 1BNEA 2CG1A 3NBBA 1R4YA 1RGCA 2OTL3 1IQYA 7GSPA 1YJN3 4FMAA 1GMQA 1BRNL 1WMOA 1JNQA 1W6YA 3MG3A 5STDA 3S27A 2GBWB 1Q7Y4 1RCLA 2B1XB 3T8NA 2SARA 5ELJA 5AIFA 1BIRA 1OGZA 3GZYB 4MMYB 3NXJA 1RDSA 3PGBA 5ELUA 1IVVA 4X2HA 2CW9A 1BSBA 2AADA 4N6MA 3V98A 3OW22 1IVUA 4O02B 3ECFA 2KF5A 1X1WA 3I0YA 4N6V0 3SEDA 2P38A 1X1YA 2XSHB 3PCSA 1JB4A 3NM7A 1X1UA 1UI7A 1GMRA 2W56B 4CCVA 1NB3I 1A90A 3F7SA 1VQ43 4H3UA 4LGQA 1W02A 1BAOA 1IVXA 1S5AA
chains in the Genus database with same CATH topology
1FYSA 1TRPA 1GSPA 1RNBA 1SARA 1YVSA 1BOXA 1FZUA 2KF3A 1UCLA 1I3IA 3BU4A 1G02A 1IYYA 3BIRA 1UCKA 1T2IA 1UCJA 1RGAA 5GSPA 4HOHA 1BRJA 1BSAA 1RCKA 1A2PA 1UCIA 2ZA4A 5BIRA 1I3FA 2BIRA 1TRQA 1X1XA 3A5EA 1BRSA 1PY3A 3WR2A 1RGLA 1BRGA 3HOHA 1GOUA 1FUTA 1RLSA 3KCHA 1I0XA 4J5KA 1HYFA 1RHLA 1MGRA 1ZGXA 3WHOA 1LRAA 1BSEA 1RGGA 1RGHA 1TTOA 1BGSA 1HZ1A 1PYLA 1B27A 1LOVA 2AAEA 4RNTA 5BU4A 1DE3A 1B2UA 1I2GA 1LOWA 1BU4A 1BRKA 1MGWA 5HOHA 1Q9EA 1AQZA 1BNJA 1RSNA 3Q3FA 1I8VA 1C54A 1BNFA 2BU4A 1GMPA 2F56A 2KF4A 1BSDA 1I2FA 1B21A 1RGFA 1I0VA 4GHOA 1B2MA 3DH2A 7RNTA 3GSPA 1FUSA 2HOHA 1BNSA 3RNTA 1BRHA 2RBIA 3D5GA 1RMSA 3AGOA 1B2SA 2C4BA 1LOYA 1RNTA 1RTUA 3AHSA 1RN1A 1DETA 1I70A 3SYUA 1BNIA 1BVIA 1BRIA 3D4AA 2F4YA 1JBRA 5RNTA 1YGWA 1BANA 1JBSA 1B2XA 1I2EA 1YNVX 1FW7A 9RNTA 1AY7A 1LNIA 2KAAA 1BNGA 1BNEA 1R4YA 1RGCA 2F5WA 1GOYA 1RGKA 7GSPA 1JBTA 6GSPA 1B2ZA 2GSPA 1GMQA 1BRNL 6RNTA 1RCLA 1B3SA 2RNTA 2SARA 8RNTA 4BU4A 1BIRA 1BSCA 1RDSA 4J5GA 1RN4A 1GOVA 1BSBA 2KF6A 2AADA 3D5IA 3URPA 1RGEA 2KF5A 1X1WA 4HAAA 1X1YA 2F5MA 1X1UA 4BIRA 1B20A 1GMRA 1T2HA 1CH0A 3AHWA 3AGNA 1BUJA 1BAOA 3DGYA 4GSPA 1BNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYS A;  1TRP A;  1GSP A;  1RNB A;  1SAR A;  1YVS A;  1BOX A;  1FZU A;  2KF3 A;  1UCL A;  1I3I A;  3BU4 A;  1G02 A;  1IYY A;  3BIR A;  1UCK A;  1T2I A;  1UCJ A;  1RGA A;  5GSP A;  4HOH A;  1BRJ A;  1BSA A;  1RCK A;  1A2P A;  1UCI A;  2ZA4 A;  5BIR A;  1I3F A;  2BIR A;  1TRQ A;  1X1X A;  3A5E A;  1BRS A;  1PY3 A;  3WR2 A;  1RGL A;  1BRG A;  3HOH A;  1GOU A;  1FUT A;  1RLS A;  3KCH A;  1I0X A;  4J5K A;  1HYF A;  1RHL A;  1MGR A;  1ZGX A;  3WHO A;  1LRA A;  1BSE A;  1RGG A;  1RGH A;  1TTO A;  1BGS A;  1HZ1 A;  1PYL A;  1B27 A;  1LOV A;  2AAE A;  4RNT A;  5BU4 A;  1DE3 A;  1B2U A;  1I2G A;  1LOW A;  1BU4 A;  1BRK A;  1MGW A;  5HOH A;  1Q9E A;  1AQZ A;  1BNJ A;  1RSN A;  3Q3F A;  1I8V A;  1C54 A;  1BNF A;  2BU4 A;  1GMP A;  2F56 A;  2KF4 A;  1BSD A;  1I2F A;  1B21 A;  1RGF A;  1I0V A;  4GHO A;  1B2M A;  3DH2 A;  7RNT A;  3GSP A;  1FUS A;  2HOH A;  1BNS A;  3RNT A;  1BRH A;  2RBI A;  3D5G A;  1RMS A;  3AGO A;  1B2S A;  2C4B A;  1LOY A;  1RNT A;  1RTU A;  3AHS A;  1RN1 A;  1DET A;  1I70 A;  3SYU A;  1BNI A;  1BVI A;  1BRI A;  3D4A A;  2F4Y A;  1JBR A;  5RNT A;  1YGW A;  1BAN A;  1JBS A;  1B2X A;  1I2E A;  1YNV X;  1FW7 A;  9RNT A;  1AY7 A;  1LNI A;  2KAA A;  1BNG A;  1BNE A;  1R4Y A;  1RGC A;  2F5W A;  1GOY A;  1RGK A;  7GSP A;  1JBT A;  6GSP A;  1B2Z A;  2GSP A;  1GMQ A;  1BRN L;  6RNT A;  1RCL A;  1B3S A;  2RNT A;  2SAR A;  8RNT A;  4BU4 A;  1BIR A;  1BSC A;  1RDS A;  4J5G A;  1RN4 A;  1GOV A;  1BSB A;  2KF6 A;  2AAD A;  3D5I A;  3URP A;  1RGE A;  2KF5 A;  1X1W A;  4HAA A;  1X1Y A;  2F5M A;  1X1U A;  4BIR A;  1B20 A;  1GMR A;  1T2H A;  1CH0 A;  3AHW A;  3AGN A;  1BUJ A;  1BAO A;  3DGY A;  4GSP A;  1BNR A; 
#chains in the Genus database with same CATH topology
 2CHC A;  1ISK A;  1RNB A;  2CFG A;  1VQ9 3;  4HYZ A;  3FLJ A;  4KFD A;  1VQ8 3;  3SX1 A;  1IYY A;  1DMQ A;  3BIR A;  3N9H A;  3CC4 3;  3CPO A;  3WA3 A;  3NHX A;  1T2I A;  4HM8 B;  1RKY A;  3WOF B;  3TDG A;  1Q40 A;  2BMQ B;  4JRF A;  1RGA A;  1YI2 3;  5KP3 A;  1VQL 3;  1YJ9 3;  1A2P A;  1T5Y A;  2STD A;  2ZA4 A;  3LOY A;  1W7C A;  4RZM A;  2BIR A;  3BNE A;  1EEJ A;  4RNZ A;  2W04 A;  4STD A;  1OHS A;  1IK3 A;  2Z6B A;  3KKG A;  1W2Z A;  1X1X A;  3BNB A;  3A5E A;  3LT9 A;  4KT3 B;  1BRS A;  3OWY A;  4XDW A;  5CF1 A;  1FGM A;  1RGL A;  4PEJ A;  1GOU A;  1LOX A;  2RCD A;  2UUG C;  1O7P B;  1WMN A;  4KZ1 A;  5AEW B;  2H0H A;  3CCE 3;  1BSE A;  1VQP 3;  4FCZ A;  3X41 A;  1TTO A;  3DMC A;  3G8Z A;  3Q1C A;  1B2U A;  1I2G A;  1MWS A;  3EBT A;  3ZG0 A;  1NO3 A;  2HMJ B;  3HI7 A;  1MNL A;  3JVC A;  2MC8 A;  1VQ5 3;  1STF I;  1FA3 A;  1EUI C;  1SQW A;  1AQZ A;  2LYX A;  2BO9 B;  2Z76 A;  3B8L A;  3BND A;  2E2V A;  3FKA A;  1I8V A;  3DZL A;  3HII A;  3U97 A;  1A67 A;  1BNF A;  1YJW 3;  1Q7H A;  4FMC A;  1BSD A;  1KD1 4;  3HK4 A;  1IU7 A;  2ZDJ A;  1O7N B;  1MWR A;  3EN8 A;  4GL6 A;  1B2M A;  3RGA A;  3DH2 A;  2GBX B;  4XBY A;  3UL6 A;  1CQS A;  2JQ5 A;  1FUS A;  4WYK A;  1UUW B;  3CC2 3;  3V92 A;  1GD3 A;  3RNT A;  1BRH A;  1IVW A;  4WHA A;  1UGI A;  1K28 A;  1E97 A;  2CKF B;  2IYJ A;  2RBI A;  2F86 B;  2P0M A;  3AGO A;  1B2S A;  4IPB A;  3HIG A;  1BUQ A;  1W6G A;  3FG1 A;  4RNY A;  1D6U A;  1RNT A;  2BNG A;  3MSO A;  3CPW 2;  3K9M C;  2QEX 3;  2M7O A;  3EC9 A;  4K61 A;  4N6T A;  1QAL A;  5IEO A;  1VQ6 3;  2RGQ A;  3WMD A;  1BRI A;  1YGE A;  2GEY A;  3D4A A;  3MHE A;  4N6L A;  3FH1 A;  4LZI A;  5CXO A;  3PZW A;  1W00 A;  3VF1 A;  5AEU B;  3CCR 3;  1M90 4;  4FCJ A;  9RNT A;  5FGO A;  5IEN A;  2WOF A;  3BNC A;  1BNG A;  3GZR A;  4BTX A;  1OPY A;  2WOH A;  3N8B A;  3LXU X;  1ULI B;  2GSP A;  2O9U X;  6RNT A;  1EQK A;  3G0K A;  4MJD A;  1NNV A;  2QGU A;  2XH9 A;  2RNT A;  4TX4 A;  3OWS A;  1O7H B;  4KFF A;  3OX9 A;  1BSC A;  3F40 A;  5LC6 A;  3J7Y d;  3NV0 B;  3D3L A;  3CCL 3;  4ILF A;  1MWU A;  3AMO A;  1RN4 A;  4J5G A;  1W5Z A;  2XEP A;  3UJM A;  1QMA A;  1QAF A;  4RBN A;  2QA4 3;  3D5I A;  2OTJ 3;  1LNH A;  3MG2 A;  4L7K A;  4HAA A;  5AYS C;  2E2T A;  4U13 A;  1TFO A;  2HML B;  4N6O B;  1Q86 4;  3F14 A;  3OWU A;  1RRH A;  3AHW A;  4MEI A;  4BL3 A;  4O8S A;  2F99 A;  3IMA B;  1D6Y A;  3DGY A;  3LH4 A;  1BNR A;  3LT8 A;  1FYS A;  3FG3 A;  3X3Y A;  1SAR A;  1YVS A;  2J8X B;  1BOX A;  3M8C A;  1JB5 A;  1KSI A;  3B4P A;  1OGX A;  1N5P A;  1GS3 A;  1I3I A;  3BU4 A;  3CCU 3;  2GU3 A;  1G02 A;  3L0R A;  5A0O B;  1VQ7 3;  2RSX A;  5AII A;  2C10 A;  1JN5 A;  1GY5 A;  1RN7 A;  1UCJ A;  1CYV A;  1RCK A;  1UCI A;  5D81 A;  1DYU A;  3LTA A;  4EW5 A;  4BL2 A;  3QRD A;  5EQL A;  5HGR A;  3Q2P A;  1W4N A;  2P0X A;  1J2B A;  8CHO A;  1MWT A;  1PY3 A;  2BMO B;  3WR2 A;  4AKY A;  2XR8 B;  1BRG A;  1JZD A;  2QIY A;  3FG4 A;  1FUT A;  3PXM A;  2XSO B;  2SBL A;  4J5K A;  2HMK B;  2W03 A;  1RHL A;  1MGR A;  1RJO A;  1Z1S A;  4XB5 A;  2Z7A A;  3B7C A;  2AAE A;  4RNT A;  2W56 A;  2BMR B;  1W6C A;  2CX1 A;  3CCQ 3;  1M1X B;  3HZP A;  1BRK A;  1LQM B;  1MGW A;  5IER A;  1FGO A;  1UUV B;  2Q07 A;  3FCS B;  1BNJ A;  2CFL A;  1AV4 A;  2D42 A;  4LEH A;  3EQQ B;  1GY6 A;  1GMP A;  2F56 A;  2KF4 A;  2KRT A;  4JF8 A;  2INX A;  4I5Q A;  5AYR B;  4HKV B;  1N5H A;  1RGF A;  1N8R 4;  1N9E A;  3X40 A;  1NDO B;  1NJI 4;  4GHO A;  1W01 A;  5M1A A;  4QWT A;  1YIJ 3;  2XF3 A;  1KC8 4;  2GXF A;  3DGM A;  1BNS A;  5DRE A;  4FMB A;  3CCJ 3;  1TP6 A;  3GWR A;  1JRQ A;  2C4B A;  3T0U A;  3UL5 A;  1IV9 A;  2FXT A;  4XM4 A;  3T8U A;  3G71 3;  3AHS A;  1OHO A;  6STD A;  2D1W A;  3K63 A;  1T3B A;  1ULJ B;  3EB8 A;  1GD4 A;  3SYU A;  1BNI A;  4L8O A;  2KXG A;  1SIH A;  2F4Y A;  5M19 A;  5RNT A;  1JBR A;  4HM7 B;  1YGW A;  1DMN A;  1BAN A;  3JUM A;  1UUG B;  3ROB A;  1YNV X;  1FW7 A;  3UB1 A;  2CX0 A;  1AY7 A;  4R80 A;  2I9W A;  1LNI A;  1E3V A;  2KAA A;  2CH9 A;  2K3D A;  1DMM A;  2O3O A;  4R4K A;  1GOY A;  1STD A;  4GB5 A;  6GSP A;  3X42 A;  1CYU A;  1OF5 A;  3NBR A;  1PU4 A;  2OCT A;  3ZG5 A;  3DGO A;  3CME 3;  1ZX2 A;  1CEW I;  1O7M B;  1TJD A;  1EG9 B;  3SLU A;  1ZS7 A;  1UDI I;  1VQM 3;  4N6N B;  3EX9 A;  4HVN A;  1S72 3;  3LML A;  4WP5 A;  3U1W A;  4O2H A;  4K1V A;  3GRD A;  3LTC A;  1NB5 I;  3MKI A;  1RGE A;  2HMM B;  3PYJ A;  4L8P A;  4IIA A;  4N6U A;  4OUQ A;  1K73 4;  2BT3 A;  1JV2 B;  5IEP A;  2IY2 A;  4LMI A;  2H0I A;  4KFE A;  1B20 A;  4ORL A;  1PFP A;  3AGN A;  4HM3 B;  3BB9 A;  3IJE B;  1K8A 4;  1BUJ A;  2LQV A;  2CK3 H;  3D9R A;  4GSP A;  5CF2 A;  3BLZ A;  2KCD A;  2IMJ A;  1GSP A;  2CFD A;  3CU3 A;  3OV4 A;  4HM0 B;  3CD6 3;  3JUQ A;  1OUN A;  2KF3 A;  1HKX A;  3WOD G;  1FGT A;  3ZFZ A;  3DM8 A;  3DGL A;  3EF8 A;  4MMX B;  2CFK A;  1GY7 A;  5IG5 A;  3I56 3;  2CG0 A;  3MWZ A;  1GYB A;  4K1U A;  3G6E 3;  4NRE A;  3DUK A;  5BIR A;  3K5T A;  1I3F A;  1WMP A;  2A15 A;  2R4I A;  1JB2 A;  2K54 A;  1AR0 A;  3LYG A;  3I55 3;  1QJG A;  3FZW A;  5AI1 A;  3DXO A;  1JKG A;  1RLS A;  5D82 A;  1O7G B;  1I0X A;  2R41 A;  3KCH A;  5AIH A;  2OOV A;  1Q82 4;  1LRA A;  1RGG A;  3ER7 A;  1RGH A;  1YIT 3;  1SJW A;  1Y4K A;  1BGS A;  1HZ1 A;  1PYL A;  1LOV A;  5BU4 A;  4XDV A;  1QVG 2;  3F9S A;  5G1K A;  4FR9 A;  1LOW A;  1BU4 A;  3GZX B;  3K0Z A;  3EJV A;  1ZO2 A;  1U8C B;  4HJL B;  5HOH A;  1ASK A;  5M18 A;  1RSN A;  2Y73 A;  3HX8 A;  3JUN A;  4DKI A;  1C54 A;  3G4S 3;  1IQ8 A;  2BU4 A;  4EV2 A;  5KP4 A;  2YFJ B;  3H51 A;  3FGY A;  5EVH A;  1B21 A;  1DVD A;  1QAK A;  3S28 A;  2FNQ A;  3S5C A;  2ML6 A;  1AVK A;  2PNC A;  3FF0 A;  3KZT A;  2H0G A;  3B4O A;  2WGQ A;  1K41 A;  3LZA A;  4WWU C;  3ALA A;  3GSP A;  4WFO A;  1JN5 B;  1FGR A;  4AEQ A;  1WNH A;  2XRX B;  5IG0 A;  1C7H A;  4ZM8 A;  3RDE A;  1M1K 4;  5G1L A;  1FGQ A;  1E3R A;  4NPB A;  4EV5 A;  3D5G A;  1RMS A;  3EN1 B;  2W6J H;  3WOE B;  1VQQ A;  2E2U A;  4G1M B;  3PCR A;  5IW9 A;  2CIU A;  1RN1 A;  3MG1 A;  2F98 A;  3Q90 A;  3NM2 A;  4BTW A;  7STD A;  2B24 B;  2IUJ A;  1IQX A;  3LTD A;  2OQE C;  3KFQ C;  1N8Q A;  2WO0 A;  2YFL B;  4HZ9 B;  4CDL A;  2XFS A;  1V57 A;  1JBS A;  3KN4 A;  1I2E A;  3GAX A;  4XBX A;  3SXX A;  4LYL B;  2V1L A;  2XGL A;  5DRV A;  2YFI B;  5CLK A;  3CXC 2;  1N9J A;  1IT7 A;  4OVM A;  2F5W A;  5IG3 A;  2C11 A;  3NUV A;  2HMO B;  1RGK A;  3PS8 A;  1JBT A;  1B2Z A;  1Q40 B;  1A2V A;  4BTY A;  1YVB I;  2W0Q A;  5I97 A;  1VQN 3;  3KSP A;  1G0T A;  4R9K A;  2L1S A;  1B3S A;  1RRL A;  1SPU A;  2CFW A;  3D79 A;  8RNT A;  4BU4 A;  1SII A;  3CCS 3;  1UGH I;  4K90 B;  5IG4 A;  3EHC A;  1DVC A;  4OK0 A;  1GOV A;  1NU3 A;  2KF6 A;  1OCV A;  5CK6 A;  1LXE A;  1VQK 3;  1KQS 2;  3DGN A;  3NQY A;  5JPP A;  3OXA A;  3URP A;  1VQO 3;  1R4C A;  2BHM A;  3CNM A;  2OOV C;  2F5M A;  2ML5 A;  4BIR A;  1T2H A;  1CH0 A;  3KE7 A;  1ROA A;  3NX0 A;  5LC7 A;  1Q42 A;  3LTB A;  2WGO A;  1D6Z A;  2IUK A;  2P09 A;  4FMD A;  5EEO A;  4EC6 A;  1JJ2 2;  2W9Q A;  2UGI A;  3V99 A;  2CWT A;  1YHQ 3;  1US1 A;  1TRP A;  4HM5 B;  1L5G B;  3FF2 A;  1OH0 A;  3A76 A;  1FZU A;  2CWV A;  3WDG B;  1EKM A;  3QK9 A;  1UCL A;  1WTH A;  3VGN A;  3RGR A;  2MF7 A;  1UCK A;  1F8N A;  1ROV A;  2GEX A;  2XFT A;  2XGN A;  1LQG C;  3IPT A;  1LVN A;  2Z77 A;  3KSE D;  5GSP A;  4WYK B;  5TGN A;  2GU1 A;  1BRJ A;  1BSA A;  2L4V A;  4HOH A;  4EXR A;  3GZB A;  3CC7 3;  5JBS A;  1IT8 A;  3DY5 A;  3CNX A;  1M9G A;  1OF5 B;  1K9M 4;  1TRQ A;  4NHF A;  1Q81 4;  3S29 A;  3EBY A;  2OQE A;  1UW1 A;  1TUH A;  1TIJ A;  3HOH A;  4R9L A;  2CC3 A;  3X3Z A;  1VZZ A;  1UI8 A;  4EBG A;  4HBR A;  1HYF A;  1ZGX A;  3WHO A;  4EYC A;  4HZB B;  3VSY A;  5BXQ A;  1B27 A;  1EA2 A;  1DE3 A;  4O3V A;  5FW5 A;  3X3X A;  4LSO A;  1V74 A;  3NQZ A;  2CWU A;  3E99 A;  5G2G A;  1Q9E A;  5BVB A;  5D83 A;  3N54 B;  1AVL A;  3Q3F A;  1IDP A;  1U5O A;  3O8Y A;  2RFR A;  4HM2 B;  2HMN B;  1OHP A;  3F8H A;  1I2F A;  2P05 A;  1JZO A;  3JUP A;  5IF6 A;  1IV7 A;  3JUO A;  1I0V A;  4Q53 A;  4AKZ A;  5KP1 A;  1QVF 2;  2W2C A;  3CCM 3;  3STD A;  3NV0 A;  2K0M A;  4IT7 A;  4X2O A;  1TFK A;  3S67 A;  3H3H A;  7RNT A;  1G96 A;  3G16 A;  4J9A A;  4I4K A;  2HOH A;  3MYT A;  3SOA A;  2YX9 A;  1V58 A;  3F7X A;  3EE1 A;  3AMO B;  4HM4 B;  2FGT A;  3CMA 3;  1OAC A;  4H61 A;  1KWI A;  1FUW A;  4HM1 B;  2ZL8 A;  1LOY A;  5JPU A;  2OWP A;  1RTU A;  3SVA A;  3NBJ A;  4N3V A;  4HM6 B;  1DET A;  5AIG A;  4CPK A;  1I70 A;  1A2K A;  1MOL A;  1WQL B;  4KVH A;  2JDI H;  2PZV A;  1HU9 A;  3MPH A;  1JKG B;  4XBT A;  1BVI A;  4MMZ B;  2W9P A;  3SOY A;  1O7W B;  2UX0 A;  1W2B 2;  3WA2 X;  2Y74 A;  3FSD A;  3UNL A;  1NWW A;  4J8T A;  3F8X A;  1B2X A;  4FCM A;  4CJN A;  3KII A;  2ZHX B;  3K7C A;  1TU5 A;  4R1K A;  3CCV 3;  2IA7 A;  1BNE A;  2CG1 A;  3NBB A;  1R4Y A;  1RGC A;  2OTL 3;  1IQY A;  7GSP A;  1YJN 3;  4FMA A;  1GMQ A;  1BRN L;  1WMO A;  1JNQ A;  1W6Y A;  3MG3 A;  5STD A;  3S27 A;  2GBW B;  1Q7Y 4;  1RCL A;  2B1X B;  3T8N A;  2SAR A;  5ELJ A;  5AIF A;  1BIR A;  1OGZ A;  3GZY B;  4MMY B;  3NXJ A;  1RDS A;  3PGB A;  5ELU A;  1IVV A;  4X2H A;  2CW9 A;  1BSB A;  2AAD A;  4N6M A;  3V98 A;  3OW2 2;  1IVU A;  4O02 B;  3ECF A;  2KF5 A;  1X1W A;  3I0Y A;  4N6V 0;  3SED A;  2P38 A;  1X1Y A;  2XSH B;  3PCS A;  1JB4 A;  3NM7 A;  1X1U A;  1UI7 A;  1GMR A;  2W56 B;  4CCV A;  1NB3 I;  1A90 A;  3F7S A;  1VQ4 3;  4H3U A;  4LGQ A;  1W02 A;  1BAO A;  1IVX A;  1S5A A; 
#chains in the Genus database with same CATH homology
 1FYS A;  1TRP A;  1GSP A;  1RNB A;  1SAR A;  1YVS A;  1BOX A;  1FZU A;  2KF3 A;  1UCL A;  1I3I A;  3BU4 A;  1G02 A;  1IYY A;  3BIR A;  1UCK A;  1T2I A;  1UCJ A;  1RGA A;  5GSP A;  4HOH A;  1BRJ A;  1BSA A;  1RCK A;  1A2P A;  1UCI A;  2ZA4 A;  5BIR A;  1I3F A;  2BIR A;  1TRQ A;  1X1X A;  3A5E A;  1BRS A;  1PY3 A;  3WR2 A;  1RGL A;  1BRG A;  3HOH A;  1GOU A;  1FUT A;  1RLS A;  3KCH A;  1I0X A;  4J5K A;  1HYF A;  1RHL A;  1MGR A;  1ZGX A;  3WHO A;  1LRA A;  1BSE A;  1RGG A;  1RGH A;  1TTO A;  1BGS A;  1HZ1 A;  1PYL A;  1B27 A;  1LOV A;  2AAE A;  4RNT A;  5BU4 A;  1DE3 A;  1B2U A;  1I2G A;  1LOW A;  1BU4 A;  1BRK A;  1MGW A;  5HOH A;  1Q9E A;  1AQZ A;  1BNJ A;  1RSN A;  3Q3F A;  1I8V A;  1C54 A;  1BNF A;  2BU4 A;  1GMP A;  2F56 A;  2KF4 A;  1BSD A;  1I2F A;  1B21 A;  1RGF A;  1I0V A;  4GHO A;  1B2M A;  3DH2 A;  7RNT A;  3GSP A;  1FUS A;  2HOH A;  1BNS A;  3RNT A;  1BRH A;  2RBI A;  3D5G A;  1RMS A;  3AGO A;  1B2S A;  2C4B A;  1LOY A;  1RNT A;  1RTU A;  3AHS A;  1RN1 A;  1DET A;  1I70 A;  3SYU A;  1BNI A;  1BVI A;  1BRI A;  3D4A A;  2F4Y A;  1JBR A;  5RNT A;  1YGW A;  1BAN A;  1JBS A;  1B2X A;  1I2E A;  1YNV X;  1FW7 A;  9RNT A;  1AY7 A;  1LNI A;  2KAA A;  1BNG A;  1BNE A;  1R4Y A;  1RGC A;  2F5W A;  1GOY A;  1RGK A;  7GSP A;  1JBT A;  6GSP A;  1B2Z A;  2GSP A;  1GMQ A;  1BRN L;  6RNT A;  1RCL A;  1B3S A;  2RNT A;  2SAR A;  8RNT A;  4BU4 A;  1BIR A;  1BSC A;  1RDS A;  4J5G A;  1RN4 A;  1GOV A;  1BSB A;  2KF6 A;  2AAD A;  3D5I A;  3URP A;  1RGE A;  2KF5 A;  1X1W A;  4HAA A;  1X1Y A;  2F5M A;  1X1U A;  4BIR A;  1B20 A;  1GMR A;  1T2H A;  1CH0 A;  3AHW A;  3AGN A;  1BUJ A;  1BAO A;  3DGY A;  4GSP A;  1BNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...