1BIRA

Ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNAVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A catalytic function for the structurally conserved residue Phe 100 of ribonuclease T1.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1birA00
1GOYA 5GSPA 1R4YA 3BIRA 1BRGA 3Q3FA 6GSPA 1BNJA 3HOHA 2GSPA 4BU4A 1GSPA 3WR2A 3A5EA 3D4AA 7RNTA 2F5WA 1BRJA 1CH0A 3DH2A 1BANA 1YNVX 1I70A 1LOVA 1T2HA 1UCJA 1X1WA 1BRSA 1LNIA 1RCLA 1TTOA 1RNTA 1BSAA 2C4BA 1HYFA 1FUTA 3WHOA 1UCKA 2F5MA 2F56A 1BSCA 1YGWA 1BRIA 1RLSA 1RN1A 1X1UA 4GHOA 2KF5A 2AAEA 1LOWA 4BIRA 1RGGA 1FZUA 1BU4A 1BNSA 1HZ1A 1PY3A 1C54A 1I2FA 1RHLA 1G02A 1UCLA 1MGWA 1UCIA 1B2XA 1Q9EA 1GMRA 5BU4A 3AGOA 1RGAA 4J5GA 2RNTA 1RTUA 4GSPA 4J5KA 1BRHA 1IYYA 3BU4A 1DE3A 1BOXA 1GMQA 4HAAA 5HOHA 1BIRA 2KF4A 1I3IA 3URPA 1BUJA 1GOUA 1YVSA 1B2SA 1GOVA 1RN4A 1RGEA 1LRAA 1RGHA 1RDSA 2ZA4A 1B27A 1DETA 1RGLA 3DGYA 1B2MA 2BU4A 8RNTA 1JBRA 3KCHA 4RNTA 1AQZA 1B2ZA 1T2IA 2AADA 2KAAA 1BSDA 1RCKA 1RSNA 1X1YA 1I0XA 5RNTA 1BRKA 1I2EA 6RNTA 1BSBA 1SARA 3D5GA 2RBIA 1TRQA 1RNBA 3AGNA 1B20A 1B21A 1BNRA 3SYUA 5BIRA 1RGCA 1BNFA 2BIRA 2SARA 1BAOA 1BNIA 1BNGA 1I2GA 7GSPA 1BGSA 2KF6A 3GSPA 1FYSA 3D5IA 1BVIA 1B2UA 1I3FA 1GMPA 1FUSA 2HOHA 3RNTA 1LOYA 1RMSA 1B3SA 9RNTA 1BRNL 1AY7A 1PYLA 1I0VA 1ZGXA 3AHWA 1X1XA 4HOHA 1FW7A 1MGRA 1RGKA 1A2PA 2F4YA 1JBTA 1RGFA 1BNEA 2KF3A 1TRPA 1JBSA 1I8VA 3AHSA 1BSEA
chains in the Genus database with same CATH superfamily
2HMNB 1NB3I 1GOYA 3HIIA 5AIIA 3BIRA 3ZG5A 2R41A 3KZTA 3Q3FA 1M1XB 4RNZA 1BNJA 5D82A 4AKZA 1OGZA 3SVAA 1GSPA 2FGTA 3GWRA 4N6MA 3A5EA 1IQYA 1IVXA 2XRXB 4WHAA 1YI23 2CG1A 3KE7A 4TX4A 3V99A 2F5WA 1BRJA 2GU1A 1K28A 2V1LA 1I70A 1QALA 2BMQB 1STFI 1VQ73 2W56B 1E97A 2IYJA 2OTJ3 1TIJA 1RCLA 3BNDA 4XDVA 1O7NB 2BO9B 4O3VA 2KCDA 1FUTA 5AIHA 1VQ93 2F5MA 3EB8A 4I5QA 5EVHA 2BMRB 1Q40A 5FW5A 3EE1A 1ZS7A 1DMMA 2P05A 1FGOA 1RLSA 2W0QA 3WODG 4H3UA 3NBJA 2WOHA 4N6LA 4FCMA 2W56A 1HZ1A 1BU4A 1BNSA 1MWRA 1N5HA 1PY3A 1Y4KA 3NV0A 4WFOA 4AKYA 5IEPA 1OACA 3A76A 3DGMA 1G02A 4O2HA 4AEQA 3SX1A 2Z6BA 1IVVA 3LMLA 1MGWA 4BTYA 1JB5A 7STDA 3PCRA 3VF1A 3LH4A 1UCIA 3S29A 3JUNA 3S5CA 3NUVA 2ZDJA 4NREA 3HX8A 1RGAA 5AEUB 4J5GA 1VQK3 2RNTA 1V58A 2F98A 2LQVA 2XFTA 1IQ8A 4J5KA 2FNQA 3BU4A 2HMLB 5AEWB 3SLUA 1A2VA 1C7HA 3GZBA 3EX9A 3FG1A 4GL6A 1KD14 3GZXB 3IMAB 3JUPA 3LT8A 4K61A 2L1SA 1GOUA 1HKXA 1W01A 2RFRA 2KXGA 1YVSA 2GBWB 3AMOB 2CFLA 1LRAA 5KP4A 2ZA4A 2GU3A 1B27A 1DETA 1O7WB 4Q53A 1B2MA 1IV7A 3ROBA 4HM3B 3OWYA 3J7Yd 2CFKA 2XSHB 1CQSA 1TJDA 4FCJA 4IPBA 3T8UA 3FG4A 1QVF2 1Q40B 1UUWB 1T2IA 2KAAA 1FGMA 3L0RA 1IQXA 1RCKA 1DYUA 1N9JA 3F9SA 5RNTA 1Q7HA 2CIUA 3Q90A 2GBXB 1LNHA 1L5GB 2OQEC 2HMOB 3DGNA 4WYKB 3EQQB 1TRQA 3CME3 3CCU3 3CCM3 1B20A 1PFPA 4R80A 4NHFA 3OV4A 1EUIC 3PGBA 4K90B 1DMNA 2E2VA 1BAOA 4MJDA 1PU4A 1JB2A 7GSPA 1SQWA 1GY6A 3WOEB 3MG1A 3GSPA 1FYSA 1GS3A 1O7HB 2WO0A 1B2UA 2HMJB 4O8SA 1KWIA 1TU5A 4KFFA 1I3FA 1JRQA 1FUSA 2UX0A 3EN1B 2HOHA 2WOFA 3NQYA 4JF8A 3RNTA 3CCR3 4N6OB 4N6NB 4QWTA 5CF1A 1FA3A 4R1KA 1DVDA 1NNVA 1NJI4 1DVCA 1AY7A 4RZMA 1ZGXA 3AHWA 3EN8A 3PYJA 1RGKA 2ML6A 1RGFA 2BHMA 2Q07A 1U5OA 1MWSA 1ZX2A 1TUHA 2KF3A 3NBRA 2O9UX 1JBSA 2CWTA 3FKAA 3N8BA 4HZBB 4K1UA 3BNCA 3DY5A 5EEOA 3WA3A 3X3ZA 1GYBA 2SBLA 6GSPA 1JZOA 3E99A 1CYUA 4XBXA 4N3VA 3G6E3 1W6YA 2CC3A 5IEOA 3K5TA 1Z1SA 7RNTA 4EC6A 3LTCA 3DH2A 4XBTA 3GAXA 1BANA 3OW22 1KQS2 1A90A 1CYVA 3LTBA 4N6TA 1LOVA 3X3XA 1X1WA 4MMZB 2P38A 1YVBI 1IT7A 1TTOA 1BSAA 2C4BA 5M18A 3T8NA 3NM2A 1UCKA 2O3OA 2F56A 3DUKA 3F8HA 3UL6A 1BSCA 2CWVA 1YGWA 1YJW3 2W03A 3LTAA 4H61A 5LC7A 3G713 5IENA 1X1UA 2K0MA 3N9HA 1TP6A 1UI7A 4O02B 3PZWA 1JN5A 1Q824 2AAEA 1LOWA 3PXMA 2K3DA 2YX9A 1HU9A 2YFIB 1I2FA 1OH0A 1RHLA 3H3HA 3RGRA 3U1WA 4EBGA 1O7PB 3FZWA 4LMIA 3WOFB 5IW9A 1YIT3 5IG0A 4HM1B 1Q814 4HM5B 3NV0B 3FF2A 3VSYA 3WA2X 3D3LA 3STDA 3WDGB 3AGOA 5BVBA 4RNYA 1UDII 3MWZA 4NPBA 4R4KA 3SOYA 3MKIA 2OCTA 2E2UA 1BRHA 3QK9A 4HZ9B 3Q1CA 4HM0B 5AIFA 3UL5A 3FLJA 4EYCA 1GMQA 1UUGB 2K54A 4J8TA 3EBTA 2BT3A 1VQ83 1A67A 4XM4A 3JUMA 3MG3A 1OHSA 3URPA 5M19A 2H0IA 4FMAA 5KP3A 1JJ22 2PZVA 4WWUC 4PEJA 2CK3H 1RN4A 3I563 2D42A 3F8XA 1FGRA 4XDWA 3O8YA 3DGYA 1SPUA 3BNBA 4FMDA 3CXC2 1SIIA 1TFOA 1S5AA 2XSOB 5IG5A 1ZO2A 8RNTA 3WMDA 5AYSC 3LOYA 5EQLA 3X41A 2P0XA 1AQZA 2AADA 2JDIH 5D81A 1BSDA 4RBNA 1QVG2 4N6UA 5IG3A 1K9M4 1VQL3 2Z77A 5IERA 3I0YA 1GD4A 1W2B2 1SARA 1IVWA 1K41A 1YGEA 4HM7B 5IF6A 3AGNA 1RNBA 3BNEA 2GEYA 3G16A 4LYLB 3CNMA 3G8ZA 3ECFA 1MWTA 1N8QA 1BNIA 4ORLA 1QAKA 1MWUA 1BNGA 4BTXA 1BGSA 2KF6A 3FH1A 4STDA 1IU7A 1E3RA 4JRFA 1ASKA 1GMPA 2MF7A 4FMCA 3I553 4KFEA 1YHQ3 1RMSA 2OOVA 1B3SA 1W2ZA 4OVMA 4CJNA 1DMQA 3PS8A 4U13A 1IDPA 1I0VA 1VQ53 3F7SA 4HOHA 3MG2A 2CWUA 4IIAA 4HBRA 1JBTA 1W02A 4GB5A 6STDA 5KP1A 1UGHI 2GEXA 2E2TA 1ULIB 3NXJA 1BNEA 1LQMB 3HZPA 4EV2A 3CD63 1GD3A 2F99A 5ELJA 1BRGA 1JZDA 1VQ43 3NBBA 4CPKA 2GSPA 4KZ1A 3NQZA 1NWWA 2Y73A 3K7CA 3MHEA 5G1KA 1J2BA 2CFGA 5CK6A 3H51A 4LSOA 2XGNA 2OWPA 3GZRA 2ZHXB 3CCV3 1YNVX 3NM7A 4LEHA 4DKIA 2CX1A 1W00A 1T2HA 4FCZA 1AV4A 1BRSA 1LNIA 2P09A 5I97A 3X40A 3AMOA 3NX0A 3TDGA 2UGIA 1E3VA 3F40A 2B1XB 1EQKA 4LGQA 2IY2A 2QEX3 1MNLA 5CXOA 1RKYA 1UGIA 3EHCA 1BRIA 2D1WA 2L4VA 1RN1A 1D6UA 4FR9A 4GHOA 1G0TA 2XR8B 1KSIA 2KF5A 2JQ5A 1RGGA 1FZUA 3IJEB 3ER7A 1N9EA 1SIHA 2C11A 1LQGC 3CCJ3 5AI1A 2CH9A 3G4S3 1D6ZA 2XF3A 2M7OA 2P0MA 3BLZA 2ML5A 3LXUX 5AIGA 2BNGA 1AVLA 5D83A 3SOAA 3RGAA 3ZFZA 3SXXA 2RCDA 4MEIA 3SEDA 2CW9A 1GMRA 2R4IA 5BU4A 1STDA 3FSDA 1MOLA 3NHXA 3CCS3 1AR0A 1RTUA 4GSPA 1IYYA 3CC73 1OCVA 1OUNA 5JBSA 3KSED 5HOHA 3CMA3 4BTWA 1Q864 1I3IA 4R9KA 1WTHA 4J9AA 1T3BA 1B2SA 2XGLA 5BXQA 1RDSA 3DM8A 1WNHA 1LXEA 2WGOA 3LZAA 1JN5B 1IVUA 4HVNA 2LYXA 4G1MB 1IV9A 5A0OB 5FGOA 1VZZA 1QMAA 3KCHA 4I4KA 1M1K4 4EW5A 3Q2PA 1B2ZA 2OQEA 4EXRA 4XB5A 3DGOA 4X2OA 1X1YA 1Q42A 3X42A 1BRKA 1I2EA 4KFDA 3K9MC 4OK0A 3B4PA 5M1AA 2I9WA 4BL2A 5JPUA 1VQQA 3LYGA 1BNRA 3PCSA 3S67A 1RGCA 1BNFA 1AVKA 4OUQA 2BIRA 5G1LA 3UNLA 2SARA 1N8R4 1IT8A 1EG9B 3D5IA 3MSOA 3CC23 5TGNA 2W04A 3HI7A 1WMNA 3KN4A 1VQM3 4ZM8A 2IMJA 4HM6B 9RNTA 3LT9A 1EEJA 1PYLA 4N6V0 1GY5A 2ZL8A 1X1XA 3JUOA 2GXFA 2W9PA 3ALAA 2F4YA 2CKFB 1A2PA 1JKGB 1QJGA 1FGTA 2CHCA 2QIYA 3CCL3 1YJN3 4K1VA 2OTL3 1ULJB 1SJWA 3HK4A 1YJ93 1TRPA 1M904 3DZLA 1I8VA 1LOXA 3IPTA 3WHOA 3HIGA 3M8CA 1R4YA 5GSPA 4BL3A 8CHOA 3VGNA 3OWSA 1W6GA 2XH9A 2W9QA 1RRLA 3HOHA 1IK3A 4BU4A 2YFJB 3WR2A 2XEPA 3D4AA 1LVNA 1EKMA 1NDOB 2YFLB 4IT7A 1CH0A 4CDLA 4EV5A 3DMCA 3X3YA 1JB4A 4LZIA 2C10A 1UCJA 3JUQA 3DXOA 5STDA 2H0GA 1CEWI 1W5ZA 3V92A 1RNTA 1W7CA 1U8CB 2STDA 3OX9A 1HYFA 1M9GA 4HJLB 5AYRB 3ZG0A 3DGLA 2OOVC 5DREA 1RRHA 1UI8A 4HM2B 1S723 3UB1A 3FCSB 1R4CA 4MMYB 3UJMA 1T5YA 1WMOA 2FXTA 1OF5B 5IG4A 1W4NA 4BIRA 1GY7A 1O7MB 2QGUA 2Y74A 1UCLA 1US1A 3CNXA 5LC6A 1VQN3 1G96A 1OGXA 2CFDA 1OPYA 2IUJA 1D6YA 3S27A 1NO3A 3N54B 4L8PA 1B2XA 1Q9EA 3GRDA 3CPW2 3D79A 3U97A 1VQP3 4L8OA 4HM8B 1OF5A 4HM4B 1FGQA 3B4OA 5CF2A 3JVCA 3EJVA 3D9RA 1RN7A 5ELUA 1DE3A 1BOXA 4HAAA 4L7KA 1TFKA 1BIRA 3KFQC 2KF4A 2A15A 4HYZA 2INXA 2KRTA 1NU3A 3KKGA 3F7XA 1BUJA 1V57A 2RSXA 2IA7A 3KSPA 2HMMB 1W6CA 2WGQA 1OHPA 1GOVA 3CPOA 4HKVB 1RGEA 3RDEA 1RGHA 4R9LA 5DRVA 5HGRA 3EF8A 1RGLA 3B8LA 3T0UA 1UUVB 2RGQA 4KVHA 3GZYB 2W2CA 2B24B 3K63A 2BU4A 1VQ63 1JBRA 3LTDA 1VQO3 1KC84 3F14A 2J8XB 2UUGC 1F8NA 1K734 4RNTA 1JNQA 1JV2B 4CCVA 5CLKA 1WMPA 1EA2A 1RSNA 4FMBA 1I0XA 1RJOA 3BB9A 2CFWA 1BSBA 3KIIA 6RNTA 1FUWA 1YIJ3 3CU3A 1O7GB 3D5GA 2RBIA 3QRDA 2F86B 3FF0A 1Q7Y4 3FG3A 1B21A 3EBYA 2W6JH 3G0KA 2CG0A 3SYUA 5BIRA 4WP5A 1A2KA 5JPPA 3CCE3 3CCQ3 1N5PA 1I2GA 3K0ZA 4MMXB 4ILFA 2PNCA 1K8A4 2IUKA 1BVIA 4X2HA 3OXAA 2BMOB 4XBYA 3EC9A 1UW1A 3MYTA 1OHOA 1WQLB 2Z76A 1LOYA 2MC8A 1ISKA 2HMKB 2H0HA 1BRNL 2XFSA 2QA43 1FW7A 5G2GA 1MGRA 1NB5I 2Z7AA 1ROVA 3OWUA 1ROAA 3V98A 4KT3B 3MPHA 1JKGA 3CC43 2CX0A 1V74A 3FGYA 4WYKA 3S28A 1QAFA 1C54A 3B7CA 3AHSA 1BUQA 1BSEA
chains in the Genus database with same CATH topology
1GOYA 5GSPA 1R4YA 3BIRA 1BRGA 3Q3FA 6GSPA 1BNJA 3HOHA 2GSPA 4BU4A 1GSPA 3WR2A 3A5EA 3D4AA 7RNTA 2F5WA 1BRJA 1CH0A 3DH2A 1BANA 1YNVX 1I70A 1LOVA 1T2HA 1UCJA 1X1WA 1BRSA 1LNIA 1RCLA 1TTOA 1RNTA 1BSAA 2C4BA 1HYFA 1FUTA 3WHOA 1UCKA 2F5MA 2F56A 1BSCA 1YGWA 1BRIA 1RLSA 1RN1A 1X1UA 4GHOA 2KF5A 2AAEA 1LOWA 4BIRA 1RGGA 1FZUA 1BU4A 1BNSA 1HZ1A 1PY3A 1C54A 1I2FA 1RHLA 1G02A 1UCLA 1MGWA 1UCIA 1B2XA 1Q9EA 1GMRA 5BU4A 3AGOA 1RGAA 4J5GA 2RNTA 1RTUA 4GSPA 4J5KA 1BRHA 1IYYA 3BU4A 1DE3A 1BOXA 1GMQA 4HAAA 5HOHA 1BIRA 2KF4A 1I3IA 3URPA 1BUJA 1GOUA 1YVSA 1B2SA 1GOVA 1RN4A 1RGEA 1LRAA 1RGHA 1RDSA 2ZA4A 1B27A 1DETA 1RGLA 3DGYA 1B2MA 2BU4A 8RNTA 1JBRA 3KCHA 4RNTA 1AQZA 1B2ZA 1T2IA 2AADA 2KAAA 1BSDA 1RCKA 1RSNA 1X1YA 1I0XA 5RNTA 1BRKA 1I2EA 6RNTA 1BSBA 1SARA 3D5GA 2RBIA 1TRQA 1RNBA 3AGNA 1B20A 1B21A 1BNRA 3SYUA 5BIRA 1RGCA 1BNFA 2BIRA 2SARA 1BAOA 1BNIA 1BNGA 1I2GA 7GSPA 1BGSA 2KF6A 3GSPA 1FYSA 3D5IA 1BVIA 1B2UA 1I3FA 1GMPA 1FUSA 2HOHA 3RNTA 1LOYA 1RMSA 1B3SA 9RNTA 1BRNL 1AY7A 1PYLA 1I0VA 1ZGXA 3AHWA 1X1XA 4HOHA 1FW7A 1MGRA 1RGKA 1A2PA 2F4YA 1JBTA 1RGFA 1BNEA 2KF3A 1TRPA 1JBSA 1I8VA 3AHSA 1BSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOY A;  5GSP A;  1R4Y A;  3BIR A;  1BRG A;  3Q3F A;  6GSP A;  1BNJ A;  3HOH A;  2GSP A;  4BU4 A;  1GSP A;  3WR2 A;  3A5E A;  3D4A A;  7RNT A;  2F5W A;  1BRJ A;  1CH0 A;  3DH2 A;  1BAN A;  1YNV X;  1I70 A;  1LOV A;  1T2H A;  1UCJ A;  1X1W A;  1BRS A;  1LNI A;  1RCL A;  1TTO A;  1RNT A;  1BSA A;  2C4B A;  1HYF A;  1FUT A;  3WHO A;  1UCK A;  2F5M A;  2F56 A;  1BSC A;  1YGW A;  1BRI A;  1RLS A;  1RN1 A;  1X1U A;  4GHO A;  2KF5 A;  2AAE A;  1LOW A;  4BIR A;  1RGG A;  1FZU A;  1BU4 A;  1BNS A;  1HZ1 A;  1PY3 A;  1C54 A;  1I2F A;  1RHL A;  1G02 A;  1UCL A;  1MGW A;  1UCI A;  1B2X A;  1Q9E A;  1GMR A;  5BU4 A;  3AGO A;  1RGA A;  4J5G A;  2RNT A;  1RTU A;  4GSP A;  4J5K A;  1BRH A;  1IYY A;  3BU4 A;  1DE3 A;  1BOX A;  1GMQ A;  4HAA A;  5HOH A;  1BIR A;  2KF4 A;  1I3I A;  3URP A;  1BUJ A;  1GOU A;  1YVS A;  1B2S A;  1GOV A;  1RN4 A;  1RGE A;  1LRA A;  1RGH A;  1RDS A;  2ZA4 A;  1B27 A;  1DET A;  1RGL A;  3DGY A;  1B2M A;  2BU4 A;  8RNT A;  1JBR A;  3KCH A;  4RNT A;  1AQZ A;  1B2Z A;  1T2I A;  2AAD A;  2KAA A;  1BSD A;  1RCK A;  1RSN A;  1X1Y A;  1I0X A;  5RNT A;  1BRK A;  1I2E A;  6RNT A;  1BSB A;  1SAR A;  3D5G A;  2RBI A;  1TRQ A;  1RNB A;  3AGN A;  1B20 A;  1B21 A;  1BNR A;  3SYU A;  5BIR A;  1RGC A;  1BNF A;  2BIR A;  2SAR A;  1BAO A;  1BNI A;  1BNG A;  1I2G A;  7GSP A;  1BGS A;  2KF6 A;  3GSP A;  1FYS A;  3D5I A;  1BVI A;  1B2U A;  1I3F A;  1GMP A;  1FUS A;  2HOH A;  3RNT A;  1LOY A;  1RMS A;  1B3S A;  9RNT A;  1BRN L;  1AY7 A;  1PYL A;  1I0V A;  1ZGX A;  3AHW A;  1X1X A;  4HOH A;  1FW7 A;  1MGR A;  1RGK A;  1A2P A;  2F4Y A;  1JBT A;  1RGF A;  1BNE A;  2KF3 A;  1TRP A;  1JBS A;  1I8V A;  3AHS A;  1BSE A; 
#chains in the Genus database with same CATH topology
 2HMN B;  1NB3 I;  1GOY A;  3HII A;  5AII A;  3BIR A;  3ZG5 A;  2R41 A;  3KZT A;  3Q3F A;  1M1X B;  4RNZ A;  1BNJ A;  5D82 A;  4AKZ A;  1OGZ A;  3SVA A;  1GSP A;  2FGT A;  3GWR A;  4N6M A;  3A5E A;  1IQY A;  1IVX A;  2XRX B;  4WHA A;  1YI2 3;  2CG1 A;  3KE7 A;  4TX4 A;  3V99 A;  2F5W A;  1BRJ A;  2GU1 A;  1K28 A;  2V1L A;  1I70 A;  1QAL A;  2BMQ B;  1STF I;  1VQ7 3;  2W56 B;  1E97 A;  2IYJ A;  2OTJ 3;  1TIJ A;  1RCL A;  3BND A;  4XDV A;  1O7N B;  2BO9 B;  4O3V A;  2KCD A;  1FUT A;  5AIH A;  1VQ9 3;  2F5M A;  3EB8 A;  4I5Q A;  5EVH A;  2BMR B;  1Q40 A;  5FW5 A;  3EE1 A;  1ZS7 A;  1DMM A;  2P05 A;  1FGO A;  1RLS A;  2W0Q A;  3WOD G;  4H3U A;  3NBJ A;  2WOH A;  4N6L A;  4FCM A;  2W56 A;  1HZ1 A;  1BU4 A;  1BNS A;  1MWR A;  1N5H A;  1PY3 A;  1Y4K A;  3NV0 A;  4WFO A;  4AKY A;  5IEP A;  1OAC A;  3A76 A;  3DGM A;  1G02 A;  4O2H A;  4AEQ A;  3SX1 A;  2Z6B A;  1IVV A;  3LML A;  1MGW A;  4BTY A;  1JB5 A;  7STD A;  3PCR A;  3VF1 A;  3LH4 A;  1UCI A;  3S29 A;  3JUN A;  3S5C A;  3NUV A;  2ZDJ A;  4NRE A;  3HX8 A;  1RGA A;  5AEU B;  4J5G A;  1VQK 3;  2RNT A;  1V58 A;  2F98 A;  2LQV A;  2XFT A;  1IQ8 A;  4J5K A;  2FNQ A;  3BU4 A;  2HML B;  5AEW B;  3SLU A;  1A2V A;  1C7H A;  3GZB A;  3EX9 A;  3FG1 A;  4GL6 A;  1KD1 4;  3GZX B;  3IMA B;  3JUP A;  3LT8 A;  4K61 A;  2L1S A;  1GOU A;  1HKX A;  1W01 A;  2RFR A;  2KXG A;  1YVS A;  2GBW B;  3AMO B;  2CFL A;  1LRA A;  5KP4 A;  2ZA4 A;  2GU3 A;  1B27 A;  1DET A;  1O7W B;  4Q53 A;  1B2M A;  1IV7 A;  3ROB A;  4HM3 B;  3OWY A;  3J7Y d;  2CFK A;  2XSH B;  1CQS A;  1TJD A;  4FCJ A;  4IPB A;  3T8U A;  3FG4 A;  1QVF 2;  1Q40 B;  1UUW B;  1T2I A;  2KAA A;  1FGM A;  3L0R A;  1IQX A;  1RCK A;  1DYU A;  1N9J A;  3F9S A;  5RNT A;  1Q7H A;  2CIU A;  3Q90 A;  2GBX B;  1LNH A;  1L5G B;  2OQE C;  2HMO B;  3DGN A;  4WYK B;  3EQQ B;  1TRQ A;  3CME 3;  3CCU 3;  3CCM 3;  1B20 A;  1PFP A;  4R80 A;  4NHF A;  3OV4 A;  1EUI C;  3PGB A;  4K90 B;  1DMN A;  2E2V A;  1BAO A;  4MJD A;  1PU4 A;  1JB2 A;  7GSP A;  1SQW A;  1GY6 A;  3WOE B;  3MG1 A;  3GSP A;  1FYS A;  1GS3 A;  1O7H B;  2WO0 A;  1B2U A;  2HMJ B;  4O8S A;  1KWI A;  1TU5 A;  4KFF A;  1I3F A;  1JRQ A;  1FUS A;  2UX0 A;  3EN1 B;  2HOH A;  2WOF A;  3NQY A;  4JF8 A;  3RNT A;  3CCR 3;  4N6O B;  4N6N B;  4QWT A;  5CF1 A;  1FA3 A;  4R1K A;  1DVD A;  1NNV A;  1NJI 4;  1DVC A;  1AY7 A;  4RZM A;  1ZGX A;  3AHW A;  3EN8 A;  3PYJ A;  1RGK A;  2ML6 A;  1RGF A;  2BHM A;  2Q07 A;  1U5O A;  1MWS A;  1ZX2 A;  1TUH A;  2KF3 A;  3NBR A;  2O9U X;  1JBS A;  2CWT A;  3FKA A;  3N8B A;  4HZB B;  4K1U A;  3BNC A;  3DY5 A;  5EEO A;  3WA3 A;  3X3Z A;  1GYB A;  2SBL A;  6GSP A;  1JZO A;  3E99 A;  1CYU A;  4XBX A;  4N3V A;  3G6E 3;  1W6Y A;  2CC3 A;  5IEO A;  3K5T A;  1Z1S A;  7RNT A;  4EC6 A;  3LTC A;  3DH2 A;  4XBT A;  3GAX A;  1BAN A;  3OW2 2;  1KQS 2;  1A90 A;  1CYV A;  3LTB A;  4N6T A;  1LOV A;  3X3X A;  1X1W A;  4MMZ B;  2P38 A;  1YVB I;  1IT7 A;  1TTO A;  1BSA A;  2C4B A;  5M18 A;  3T8N A;  3NM2 A;  1UCK A;  2O3O A;  2F56 A;  3DUK A;  3F8H A;  3UL6 A;  1BSC A;  2CWV A;  1YGW A;  1YJW 3;  2W03 A;  3LTA A;  4H61 A;  5LC7 A;  3G71 3;  5IEN A;  1X1U A;  2K0M A;  3N9H A;  1TP6 A;  1UI7 A;  4O02 B;  3PZW A;  1JN5 A;  1Q82 4;  2AAE A;  1LOW A;  3PXM A;  2K3D A;  2YX9 A;  1HU9 A;  2YFI B;  1I2F A;  1OH0 A;  1RHL A;  3H3H A;  3RGR A;  3U1W A;  4EBG A;  1O7P B;  3FZW A;  4LMI A;  3WOF B;  5IW9 A;  1YIT 3;  5IG0 A;  4HM1 B;  1Q81 4;  4HM5 B;  3NV0 B;  3FF2 A;  3VSY A;  3WA2 X;  3D3L A;  3STD A;  3WDG B;  3AGO A;  5BVB A;  4RNY A;  1UDI I;  3MWZ A;  4NPB A;  4R4K A;  3SOY A;  3MKI A;  2OCT A;  2E2U A;  1BRH A;  3QK9 A;  4HZ9 B;  3Q1C A;  4HM0 B;  5AIF A;  3UL5 A;  3FLJ A;  4EYC A;  1GMQ A;  1UUG B;  2K54 A;  4J8T A;  3EBT A;  2BT3 A;  1VQ8 3;  1A67 A;  4XM4 A;  3JUM A;  3MG3 A;  1OHS A;  3URP A;  5M19 A;  2H0I A;  4FMA A;  5KP3 A;  1JJ2 2;  2PZV A;  4WWU C;  4PEJ A;  2CK3 H;  1RN4 A;  3I56 3;  2D42 A;  3F8X A;  1FGR A;  4XDW A;  3O8Y A;  3DGY A;  1SPU A;  3BNB A;  4FMD A;  3CXC 2;  1SII A;  1TFO A;  1S5A A;  2XSO B;  5IG5 A;  1ZO2 A;  8RNT A;  3WMD A;  5AYS C;  3LOY A;  5EQL A;  3X41 A;  2P0X A;  1AQZ A;  2AAD A;  2JDI H;  5D81 A;  1BSD A;  4RBN A;  1QVG 2;  4N6U A;  5IG3 A;  1K9M 4;  1VQL 3;  2Z77 A;  5IER A;  3I0Y A;  1GD4 A;  1W2B 2;  1SAR A;  1IVW A;  1K41 A;  1YGE A;  4HM7 B;  5IF6 A;  3AGN A;  1RNB A;  3BNE A;  2GEY A;  3G16 A;  4LYL B;  3CNM A;  3G8Z A;  3ECF A;  1MWT A;  1N8Q A;  1BNI A;  4ORL A;  1QAK A;  1MWU A;  1BNG A;  4BTX A;  1BGS A;  2KF6 A;  3FH1 A;  4STD A;  1IU7 A;  1E3R A;  4JRF A;  1ASK A;  1GMP A;  2MF7 A;  4FMC A;  3I55 3;  4KFE A;  1YHQ 3;  1RMS A;  2OOV A;  1B3S A;  1W2Z A;  4OVM A;  4CJN A;  1DMQ A;  3PS8 A;  4U13 A;  1IDP A;  1I0V A;  1VQ5 3;  3F7S A;  4HOH A;  3MG2 A;  2CWU A;  4IIA A;  4HBR A;  1JBT A;  1W02 A;  4GB5 A;  6STD A;  5KP1 A;  1UGH I;  2GEX A;  2E2T A;  1ULI B;  3NXJ A;  1BNE A;  1LQM B;  3HZP A;  4EV2 A;  3CD6 3;  1GD3 A;  2F99 A;  5ELJ A;  1BRG A;  1JZD A;  1VQ4 3;  3NBB A;  4CPK A;  2GSP A;  4KZ1 A;  3NQZ A;  1NWW A;  2Y73 A;  3K7C A;  3MHE A;  5G1K A;  1J2B A;  2CFG A;  5CK6 A;  3H51 A;  4LSO A;  2XGN A;  2OWP A;  3GZR A;  2ZHX B;  3CCV 3;  1YNV X;  3NM7 A;  4LEH A;  4DKI A;  2CX1 A;  1W00 A;  1T2H A;  4FCZ A;  1AV4 A;  1BRS A;  1LNI A;  2P09 A;  5I97 A;  3X40 A;  3AMO A;  3NX0 A;  3TDG A;  2UGI A;  1E3V A;  3F40 A;  2B1X B;  1EQK A;  4LGQ A;  2IY2 A;  2QEX 3;  1MNL A;  5CXO A;  1RKY A;  1UGI A;  3EHC A;  1BRI A;  2D1W A;  2L4V A;  1RN1 A;  1D6U A;  4FR9 A;  4GHO A;  1G0T A;  2XR8 B;  1KSI A;  2KF5 A;  2JQ5 A;  1RGG A;  1FZU A;  3IJE B;  3ER7 A;  1N9E A;  1SIH A;  2C11 A;  1LQG C;  3CCJ 3;  5AI1 A;  2CH9 A;  3G4S 3;  1D6Z A;  2XF3 A;  2M7O A;  2P0M A;  3BLZ A;  2ML5 A;  3LXU X;  5AIG A;  2BNG A;  1AVL A;  5D83 A;  3SOA A;  3RGA A;  3ZFZ A;  3SXX A;  2RCD A;  4MEI A;  3SED A;  2CW9 A;  1GMR A;  2R4I A;  5BU4 A;  1STD A;  3FSD A;  1MOL A;  3NHX A;  3CCS 3;  1AR0 A;  1RTU A;  4GSP A;  1IYY A;  3CC7 3;  1OCV A;  1OUN A;  5JBS A;  3KSE D;  5HOH A;  3CMA 3;  4BTW A;  1Q86 4;  1I3I A;  4R9K A;  1WTH A;  4J9A A;  1T3B A;  1B2S A;  2XGL A;  5BXQ A;  1RDS A;  3DM8 A;  1WNH A;  1LXE A;  2WGO A;  3LZA A;  1JN5 B;  1IVU A;  4HVN A;  2LYX A;  4G1M B;  1IV9 A;  5A0O B;  5FGO A;  1VZZ A;  1QMA A;  3KCH A;  4I4K A;  1M1K 4;  4EW5 A;  3Q2P A;  1B2Z A;  2OQE A;  4EXR A;  4XB5 A;  3DGO A;  4X2O A;  1X1Y A;  1Q42 A;  3X42 A;  1BRK A;  1I2E A;  4KFD A;  3K9M C;  4OK0 A;  3B4P A;  5M1A A;  2I9W A;  4BL2 A;  5JPU A;  1VQQ A;  3LYG A;  1BNR A;  3PCS A;  3S67 A;  1RGC A;  1BNF A;  1AVK A;  4OUQ A;  2BIR A;  5G1L A;  3UNL A;  2SAR A;  1N8R 4;  1IT8 A;  1EG9 B;  3D5I A;  3MSO A;  3CC2 3;  5TGN A;  2W04 A;  3HI7 A;  1WMN A;  3KN4 A;  1VQM 3;  4ZM8 A;  2IMJ A;  4HM6 B;  9RNT A;  3LT9 A;  1EEJ A;  1PYL A;  4N6V 0;  1GY5 A;  2ZL8 A;  1X1X A;  3JUO A;  2GXF A;  2W9P A;  3ALA A;  2F4Y A;  2CKF B;  1A2P A;  1JKG B;  1QJG A;  1FGT A;  2CHC A;  2QIY A;  3CCL 3;  1YJN 3;  4K1V A;  2OTL 3;  1ULJ B;  1SJW A;  3HK4 A;  1YJ9 3;  1TRP A;  1M90 4;  3DZL A;  1I8V A;  1LOX A;  3IPT A;  3WHO A;  3HIG A;  3M8C A;  1R4Y A;  5GSP A;  4BL3 A;  8CHO A;  3VGN A;  3OWS A;  1W6G A;  2XH9 A;  2W9Q A;  1RRL A;  3HOH A;  1IK3 A;  4BU4 A;  2YFJ B;  3WR2 A;  2XEP A;  3D4A A;  1LVN A;  1EKM A;  1NDO B;  2YFL B;  4IT7 A;  1CH0 A;  4CDL A;  4EV5 A;  3DMC A;  3X3Y A;  1JB4 A;  4LZI A;  2C10 A;  1UCJ A;  3JUQ A;  3DXO A;  5STD A;  2H0G A;  1CEW I;  1W5Z A;  3V92 A;  1RNT A;  1W7C A;  1U8C B;  2STD A;  3OX9 A;  1HYF A;  1M9G A;  4HJL B;  5AYR B;  3ZG0 A;  3DGL A;  2OOV C;  5DRE A;  1RRH A;  1UI8 A;  4HM2 B;  1S72 3;  3UB1 A;  3FCS B;  1R4C A;  4MMY B;  3UJM A;  1T5Y A;  1WMO A;  2FXT A;  1OF5 B;  5IG4 A;  1W4N A;  4BIR A;  1GY7 A;  1O7M B;  2QGU A;  2Y74 A;  1UCL A;  1US1 A;  3CNX A;  5LC6 A;  1VQN 3;  1G96 A;  1OGX A;  2CFD A;  1OPY A;  2IUJ A;  1D6Y A;  3S27 A;  1NO3 A;  3N54 B;  4L8P A;  1B2X A;  1Q9E A;  3GRD A;  3CPW 2;  3D79 A;  3U97 A;  1VQP 3;  4L8O A;  4HM8 B;  1OF5 A;  4HM4 B;  1FGQ A;  3B4O A;  5CF2 A;  3JVC A;  3EJV A;  3D9R A;  1RN7 A;  5ELU A;  1DE3 A;  1BOX A;  4HAA A;  4L7K A;  1TFK A;  1BIR A;  3KFQ C;  2KF4 A;  2A15 A;  4HYZ A;  2INX A;  2KRT A;  1NU3 A;  3KKG A;  3F7X A;  1BUJ A;  1V57 A;  2RSX A;  2IA7 A;  3KSP A;  2HMM B;  1W6C A;  2WGQ A;  1OHP A;  1GOV A;  3CPO A;  4HKV B;  1RGE A;  3RDE A;  1RGH A;  4R9L A;  5DRV A;  5HGR A;  3EF8 A;  1RGL A;  3B8L A;  3T0U A;  1UUV B;  2RGQ A;  4KVH A;  3GZY B;  2W2C A;  2B24 B;  3K63 A;  2BU4 A;  1VQ6 3;  1JBR A;  3LTD A;  1VQO 3;  1KC8 4;  3F14 A;  2J8X B;  2UUG C;  1F8N A;  1K73 4;  4RNT A;  1JNQ A;  1JV2 B;  4CCV A;  5CLK A;  1WMP A;  1EA2 A;  1RSN A;  4FMB A;  1I0X A;  1RJO A;  3BB9 A;  2CFW A;  1BSB A;  3KII A;  6RNT A;  1FUW A;  1YIJ 3;  3CU3 A;  1O7G B;  3D5G A;  2RBI A;  3QRD A;  2F86 B;  3FF0 A;  1Q7Y 4;  3FG3 A;  1B21 A;  3EBY A;  2W6J H;  3G0K A;  2CG0 A;  3SYU A;  5BIR A;  4WP5 A;  1A2K A;  5JPP A;  3CCE 3;  3CCQ 3;  1N5P A;  1I2G A;  3K0Z A;  4MMX B;  4ILF A;  2PNC A;  1K8A 4;  2IUK A;  1BVI A;  4X2H A;  3OXA A;  2BMO B;  4XBY A;  3EC9 A;  1UW1 A;  3MYT A;  1OHO A;  1WQL B;  2Z76 A;  1LOY A;  2MC8 A;  1ISK A;  2HMK B;  2H0H A;  1BRN L;  2XFS A;  2QA4 3;  1FW7 A;  5G2G A;  1MGR A;  1NB5 I;  2Z7A A;  1ROV A;  3OWU A;  1ROA A;  3V98 A;  4KT3 B;  3MPH A;  1JKG A;  3CC4 3;  2CX0 A;  1V74 A;  3FGY A;  4WYK A;  3S28 A;  1QAF A;  1C54 A;  3B7C A;  3AHS A;  1BUQ A;  1BSE A; 
#chains in the Genus database with same CATH homology
 1GOY A;  5GSP A;  1R4Y A;  3BIR A;  1BRG A;  3Q3F A;  6GSP A;  1BNJ A;  3HOH A;  2GSP A;  4BU4 A;  1GSP A;  3WR2 A;  3A5E A;  3D4A A;  7RNT A;  2F5W A;  1BRJ A;  1CH0 A;  3DH2 A;  1BAN A;  1YNV X;  1I70 A;  1LOV A;  1T2H A;  1UCJ A;  1X1W A;  1BRS A;  1LNI A;  1RCL A;  1TTO A;  1RNT A;  1BSA A;  2C4B A;  1HYF A;  1FUT A;  3WHO A;  1UCK A;  2F5M A;  2F56 A;  1BSC A;  1YGW A;  1BRI A;  1RLS A;  1RN1 A;  1X1U A;  4GHO A;  2KF5 A;  2AAE A;  1LOW A;  4BIR A;  1RGG A;  1FZU A;  1BU4 A;  1BNS A;  1HZ1 A;  1PY3 A;  1C54 A;  1I2F A;  1RHL A;  1G02 A;  1UCL A;  1MGW A;  1UCI A;  1B2X A;  1Q9E A;  1GMR A;  5BU4 A;  3AGO A;  1RGA A;  4J5G A;  2RNT A;  1RTU A;  4GSP A;  4J5K A;  1BRH A;  1IYY A;  3BU4 A;  1DE3 A;  1BOX A;  1GMQ A;  4HAA A;  5HOH A;  1BIR A;  2KF4 A;  1I3I A;  3URP A;  1BUJ A;  1GOU A;  1YVS A;  1B2S A;  1GOV A;  1RN4 A;  1RGE A;  1LRA A;  1RGH A;  1RDS A;  2ZA4 A;  1B27 A;  1DET A;  1RGL A;  3DGY A;  1B2M A;  2BU4 A;  8RNT A;  1JBR A;  3KCH A;  4RNT A;  1AQZ A;  1B2Z A;  1T2I A;  2AAD A;  2KAA A;  1BSD A;  1RCK A;  1RSN A;  1X1Y A;  1I0X A;  5RNT A;  1BRK A;  1I2E A;  6RNT A;  1BSB A;  1SAR A;  3D5G A;  2RBI A;  1TRQ A;  1RNB A;  3AGN A;  1B20 A;  1B21 A;  1BNR A;  3SYU A;  5BIR A;  1RGC A;  1BNF A;  2BIR A;  2SAR A;  1BAO A;  1BNI A;  1BNG A;  1I2G A;  7GSP A;  1BGS A;  2KF6 A;  3GSP A;  1FYS A;  3D5I A;  1BVI A;  1B2U A;  1I3F A;  1GMP A;  1FUS A;  2HOH A;  3RNT A;  1LOY A;  1RMS A;  1B3S A;  9RNT A;  1BRN L;  1AY7 A;  1PYL A;  1I0V A;  1ZGX A;  3AHW A;  1X1X A;  4HOH A;  1FW7 A;  1MGR A;  1RGK A;  1A2P A;  2F4Y A;  1JBT A;  1RGF A;  1BNE A;  2KF3 A;  1TRP A;  1JBS A;  1I8V A;  3AHS A;  1BSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...