1EEJA

Crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1eejA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eejA02
4I6XA 4ULXA 4OFTA 5GAPD 1FAAA 1YKAA 2NPBA 1THXA 2WRTA 3EU3A 3L9VA 2VIMA 2K18A 4GRFA 4CW9A 4DVCA 1OC8A 5GSTA 1XW5A 4GTUA 5KEJA 1XOAA 3DWVA 3KP8A 2VL2A 2HI7A 1Q4JA 5KN0A 1F2EA 2P0GA 1DBYA 2VCWA 5ECIB 1PA3A 6GSXA 3TGZA 3LXZA 2LEGA 1XVWA 4G2EA 3BJ5A 2D2ZA 3F8UA 5F07A 3ZZXA 5D9VA 3R2QA 2GT5A 1KEBA 5G30A 1F6MC 2CVKA 4WF4A 2GSQA 1XCCA 3DVWA 4ISDA 4JEDA 3K8NA 2H73A 1TK5B 4ECBA 1ZOFA 3DKSA 4JU5A 2P5QA 4L8EA 4WBJA 3P7XA 2YV7A 9GSSA 3DVXA 5D9TA 12GSA 4Z7XA 1EV9A 4KE3A 4PNFA 1SD9A 1V98A 1K0AA 3EE2A 5JCUA 5DJLA 4HZ4A 3HYPA 4LL4B 1EEJA 3TJBA 3VLNA 4K9ZA 1RQMA 3IXRA 2DJ1A 4WR4A 1T4ZA 4KDUA 1EGOA 2YN1A 5ECLB 3TKSC 4LMVA 3UVHA 1XWBA 2X8CA 3UOMA 4AGSA 3TOTA 4WBRD 3RDWA 1TRVA 2CZ3A 2TRCP 2JSZA 3QOUA 1DUGA 1UC7A 4TXOB 4RUVA 4DSRA 5CRDA 5KN2A 3LORA 3HHVA 3EMPA 2IL3A 5D96A 4OWYA 5ELGA 1SKSB 4POKA 3C1RA 2H75A 2BMXA 4HZ2A 1G6YA 1WPIA 2KP2A 1T00A 1JFUA 3C7MA 2RUFA 1ERUA 1EGRA 2OE1A 2LRCA 1PMTA 2DJ0A 4XS4A 4GQCA 2O87A 2GZPA 4MF7A 1MTCA 4NPBA 2JZSA 4ID0A 5E59A 4OO5A 5AIXA 1M7TA 3GFKA 1UA5A 1MEKA 1HNAA 1M99A 4J56E 3IK7A 1OYJA 4MMMA 2C3QA 1M2DA 1UN2A 2DIYA 5IM9A 4F2IA 2O85A 3ERWA 4KA0A 2GSTA 1GUKA 1NM3A 3KH9A 1TOFA 6GSYA 4IBPA 1W89A 4ACSA 6GSSA 5HQPA 2K8SA 1PKZA 1THOA 2F9SA 2O7KA 4IP1A 2FGXA 3Q18A 2M72A 3Q19A 2WULA 5J4UA 3IE3A 4FIWA 1R5AA 2IIYA 4N0ZA 2V41A 4ZBAA 1PX6A 2XPEA 2V6OA 1SYRA 2YJ7A 2PBJA 2R5GA 4YAPA 3GUSA 4OD7A 2H1BA 1WIKA 3D5JA 4IJIA 3CSJA 4IELA 2WCIA 2PU9C 2WFCA 2V32A 3TJGA 4RI6A 5J41A 2JZRA 3GL5A 1GL8A 3CYNA 2V1MA 2AV4A 1TP9A 3CTFA 1BQ7A 1Z5YE 2H66A 1AQWA 3U6VA 3M9KA 3WGEA 4X43A 1GLQA 4WKWA 4IW9A 3KMOA 3N5OA 2B7KA 14GSA 1OC3A 3DYRA 3ZREA 4TR0A 3J7Yb 2QKEA 3PH9A 1BJXA 1EOHA 2AAWA 1SJIA 5J9CA 4TR4A 2ES7A 2DC5A 4L0UA 1N2AA 1HQOA 3ZFLA 1A2LA 1B9XC 1T8EB 1OVNA 4FH8A 5ECPB 4WXTA 4PQIA 2PPTA 3EYTA 3KZQA 2LTKA 1SJZA 2OBKA 5FHIA 3I43A 4O92A 3O3TA 1AW9A 1HNCA 3KXOA 2H76A 3QMXA 5G1LA 1Z6MA 5A4VA 1J0FA 1IYIA 2VL2C 4HDEA 3IRAA 1SK0A 2VCZA 4HUAA 4HU9A 2C8UA 4K0GA 3DIEA 1B4PA 4WEYA 3VFIA 3ED3A 5C04A 2CX4A 3KP9A 10GSA 2DBCA 1ACVA 2HLSA 4O32A 4ZB9A 1H75A 3MWHA 4I2TA 1FVKA 3D4MA 3L9SA 1YJ6A 5ECQB 1HNBA 1VF4A 1OE7A 4V1Ag 1ZZYA 4OFNA 1SU9A 5CO3A 4MPGA 4XS6A 5DCHA 4I5QA 2J23A 1XWKA 3L78A 5G1KA 1VGLA 2YV9A 3GV1A 4KGIA 3C8EA 4MJCA 1JZDA 5GZZB 1U88A 2LV3A 2VO4A 4MZWA 3HJMA 3H79A 2ON7A 4JRRA 2X99A 3HCZA 5CREA 4EUYA 4J57E 3RBTA 3HZ4A 3GNJA 2G2QA 2YANA 4ZB8A 2LNTA 2B3SA 3GX0A 3UAPA 1O7UA 2PN8A 1GSYA 2EC4A 2F51A 2DSAA 2M46A 5DALA 2VAFA 4RI7A 4GLTA 4X1UA 3ZRDA 1R7HA 1FW1A 4QL7A 2GQMA 4FYCA 4MDCA 4O5RA 2GT6A 4XRDA 3WT2A 5LCZA 1GRXA 2JL4A 3DEXA 3IK9A 4PURA 1S3DA 3ZIJA 2DMMA 4K2DA 3ZYWA 4ML1A 2VM2A 4D73B 2C3NA 4CDOA 2K9FA 5D73A 3EMXA 2MMZA 3TKRA 1BAYA 3VWWA 2GGTA 1K0BA 3MDKA 2BJXA 4ECJA 3UEMA 5EPFA 3MNGA 1S3CA 5IMVA 2DIZA 2VCVA 2C1YA 3TJKA 1A8YA 3DRNA 5D93A 5IPGA 4FYBA 3H93A 3DMLA 1FB0A 2FCHA 3VWXA 3EVIA 1NHOA 1XWCA 2VL3A 3BBYA 2V6KA 3FR9A 3DXBA 5IMFA 3KEBA 4IJ3A 4J2FA 4AJ6A 2M80A 19GSA 1O8XA 4PQHA 4BVXA 2WS2A 2K8VA 5KN1A 3IAS2 3LEFA 2LNSA 2C80A 3TJJA 1XWGA 1TRWA 2FA4A 1EWXA 2VLTA 4QQ7A 2GQKA 2H01A 2RUEA 3TKQA 2HSYA 1PD21 2O89A 1XZOA 1X5DA 5D9WA 2CVDA 3D21A 1XW6A 2IN3A 4L5LA 2VLVA 3GH9A 1G0TA 1YZXA 2GZYA 5B8AA 2CVBA 1HD2A 4KAEA 5CP1A 4MK3A 2L5OA 3KJYA 2AJQB 2HXKA 2ZNMA 2JACA 2HRNA 3WT1A 2IY2A 2C0GA 2WZ9A 1MDJA 2MBTA 1PGTA 4PQ1A 3W8SA 3H1NA 4E8HA 5DQYA 3US3A 4IN0A 2IPAA 3FK8A 3KH7A 4TW5A 2H1DA 4GF0A 2AB6A 4KH7A 3QAWA 4TR1B 1Y6EA 2A2RA 1SKWB 3TOUA 5ID2B 5D8IA 3G7YA 1QQ2A 3WYWA 2HZEB 4GQFA 3BCKA 3NZNA 4N10A 2HFDA 6GSVA 1R26A 1B9YC 1SL1B 1B4QA 4IP6A 1H4OA 3E0UA 2Z9SA 2DJ3A 1K0DA 5DDLA 3ZITA 3N9JA 4Q5QA 1F3BA 5AN1A 5IPHA 2YOIA 5GAND 3EU4A 2N5AA 2F3MA 1E6BA 4XS1A 1T7PB 2KP1A 5DAKA 1SL2B 2JU5A 2L4CA 1GTAA 2LS5A 2K6VA 2ON5A 2FHEA 3ZL5A 1T1VA 5FT3A 3ZLPA 2IMIA 2MMNA 1A8LA 5ECMB 1AUCA 1QFNA 3APSA 4KDXA 2IMDA 2IFQA 5ENUA 1ST9A 2KHPA 3FW2A 3KIJA 2H0IA 4HQSA 1MDIA 2FWEA 2LRTA 1WE0A 1AC1A 4RQXA 1V9WA 4TVEA 1A2JA 2B5XA 1SD8A 3BCIA 3CSHA 4PGTA 3J7Yk 2LKUA 2YCDA 3PR8A 16GSA 1OC9B 2DLXA 3GKMA 4G10A 3VPTA 2WB9A 4K7IA 4KDYA 1XW9A 1MD3A 2YZUA 4HJMA 2LQQA 2WGRA 1N8JA 1X0RA 3TKSE 1UVZA 5CRWA 3APQA 4NHZA 5HR1A 2L6DA 5COHA 1GTBA 4MLYA 4IHUA 3KTLA 5IMDA 1YF1A 2IMEA 4GSSA 3F4TA 4TOPA 1R5PA 1T4YA 2H6XA 5CRGA 2YNXA 1VF3A 4RQRA 1XPVA 2C0DA 2FLSA 1B8XA 2WJUA 2HSHA 3KM6A 3V1WA 1FHEA 2CA8A 3EURA 3A3TA 2OKAA 3QDNA 3UIWA 4JE1A 4I97A 5HR0A 4EXJA 1NW2A 3LSZA 1F9MA 3F4RA 4K7NA 5IOXA 5IMAA 4GXZA 2RM5A 2GLRA 2DMLA 2YZHA 4NHWA 4WETA 2REMA 2DJJA 1SENA 1TTZA 2I1UA 5DAKB 3I9V2 3E9JB 8GSSA 2PERA 1O6JA 4F9ZA 1K0OA 3ME8A 2A4VA 4QL9A 3FKFA 3F9UA 4PNGA 2PWJA 5G2ZA 5JCWA 5H5RA 1LJRA 5J3RA 2YWMA 1M9BA 1TK8B 3GYKA 3RAZA 5IOWA 1PL1A 4EF0A 2L57A 1OE8A 2A2SA 3A5WA 1BG5A 5LNKe 3WGDA 1O8WA 3GRXA 4Q5RA 4NV2A 4XRAA 4ZL7A 1ERWA 2VL9A 3ISOA 3EWLA 2L4QA 1GLPA 5B6NA 2NTOA 3TRPA 3HA9A 1LBKA 4TRXA 4ZBDA 2VD0A 4NWYA 1I5GA 1MD4A 4F0BA 3VK9A 1ILOA 1PX7A 2GSSA 11GSA 1GSEA 2H74A 2XBQA 3F4SA 1V57A 4EDYA 5A4WA 4I8BA 2ALBA 5CNWA 2AYTA 2R37A 4XS4B 3GTUA 2AHEA 2X8HA 3Q74A 1ON4A 1HYUA 4K7OA 2HNLA 2B6MA 2R4VA 2MZCA 3HJOA 3QCPA 2EIQA 5DBQA 1XVQA 3C73A 3M9JA 1FG4A 1GH2A 4YQUA 4GWRA 1MDKA 2C4JA 3GHAA 1X9WB 1ZCPA 3F3QA 3W8JA 2HT9A 2KUCA 3HDCA 2QSIA 2V2GA 4BA7A 2YP6A 2YJHA 5JCGA 3LXTA 4KX4A 5DVBA 4JZQA 5IMCA 1EP7A 2QC7A 1A0FA 3FEUA 3QFBC 4DSSA 2KLXA 4TXVA 1EOGA 3D4TA 18GSA 3IC4A 2CX3A 5ECOB 3GSSA 2CAIA 3D6IA 4BL7A 4ECCA 1KTEA 3TJFA 3CRUA 1GUMA 3F63A 5ECRB 4MA9A 1KNGA 5E4WA 1R4WA 3FZ4A 1GSDA 1YEXA 3ERFA 2VM1A 1K0NA 3OR5A 4XCSA 4MH3A 2C0EA 3PINA 3JCML 1OKTA 3C1SA 1TDIA 3W6GA 1GNEA 4IKHA 5JWOB 4PXOA 4MABA 4CHSA 4LLRA 1V58A 2I4AA 1X5CA 4V2LA 2C0FA 5B6MA 2FD3A 4TN8A 5DJMA 3IDVA 2LJRA 3WD6A 2YPMA 1QK8A 3WGXA 2OJLA 2NBSA 1ZMAA 1A2MA 1Z7RA 3GTUB 2RM6A 2I3YA 3SBCA 1SK1A 1PN9A 4MJBA 1WOUA 4IVFA 3NIVA 2LQOA 5IQYA 2WDUA 3F6DA 2OE0A 1A0RP 3F0IA 3IA1A 4JR6A 5EVOA 1WJKA 3Q6OA 1ZL9A 1WRYA 5ECKB 4YQVA 3UL3A 4IQ1A 2PGTA 3UARA 1GTUA 2H70A 4X0XA 3GN3A 2OACA 6GSWA 3QR6A 3H4KA 2CT6A 1QXHA 1K0CA 1O73A 3TDGA 2H6YA 4ZB6A 2J9HA 5ECNB 2OADA 3EC3A 2H1GA 3UMAA 20GSA 5INYA 2FWHA 3CBUA 3HXSA 1EV4A 1K0MA 1PKWA 2GQLA 1GUHA 4ECIA 1QGVA 5B8BA 3CMIA 3GMFA 3GA4A 3I69A 3TRXA 4MJAA 4I2UA 1K3YA 1O85A 3A2VA 4IQAA 4GSNA 3O6TA 3U5RE 1XBSA 3ZFBA 4ZXGA 1B48A 2DJ2A 1EEMA 2C3TA 3LYKA 1A23A 1LU4A 1T3BA 3M1GA 5F05A 2LUSA 4POLA 3EINA 4KUNA 4TXOA 2OE3A 5H5SA 1JLWA 1GNWA 4H86A 4HOJA 3M0FA 4PUFC 1M2BA 2H1AA 4JBBA 2GTUA 1U6TA 1TRUA 2YWIA 2B7JA 4MF6A 3FHKA 5DALB 4BPYA 2CAQA 1ML6A 3M8NA 3VPQA 1FB6A 1GTIA 3HD5A 3L9UA 4WR5A 1TU7A 2XBIA 5IO0A 2H8LA 2JADA 5AIVA 1NSWA 1X9SB 3P90A 4ZL9A 5JWRB 4O7HA 2YWNA 3IPZA 5FWGA 3CTGA 5G5EA 5F06A 2MYGA 3PGTA 4FO5A 1S3AA 1TJDA 3D22A 4ZL8A 1GSFA 3FR3A 4KNDA 4LL1B 2PVOC 4F03A 2O8VB 2ZUPA 1RK4A 1URMA 4K0NA 4YH2A 3DGQA 3IOSA 3CRTA 1X5EA 4KSMA 4NXIA 4DEJA 4PX1A 1GSUA 3VWVA 5J9BA 5CAXA 5EY6A 5G5FA 3FY7A 3KD0A 2EIRA 1TI3A 2GDRA 2HYXA 4XIHA 5C00A 2G0FA 2CQ9A 2YWOA 2IYJA 2L6CA 2VOCA 4LA1A 3LG6A 1PL2A 1CQHA 1ERVA 3GIXA 2X64A 3QPMA 2GZZA 4MF5A 1GWCA 3ZVJA 4HI7A 1A24A 1YY7A 2FWFA 2EIOA 4XHMA 3A2XA 1BEDA 1BYEA 4L5OA 5DQSA 1FVJA 3TCOA 4P3YB 1G6WA 2F8FA 1WMJA 1TK0B 1F37A 2FY6A 3UVTA 4YQMA 4POMA 2L5LA 2E2GA 1U3IA 2XHFA 3KMNA 2N5BA 4KSOA 1SK2A 4EKZA 1TU8A 3FYGA 4NMUA 2LSTA 5A4UA 4EC0A 2VD1A 4GSTA 2ZCTA 4YAVA 5ABRA 3DD3A 4TKYA 1VF1A 3KGKA 2XPDA 2LJAA 4V2MA 1IYHA 2I81A 2CZ2A 3FR6A 2VCTA 4Q5NA 1ZYQB 1AIUA 5IIZA 3L4NA 1XIYA 3GKNA 3ZTLA 2LRNA 4ZILA 2DJKA 1Z7PA 1EZKA 3LGCA 3TKPA 3ZVJD 6GSTA 2H30A 1EP8A 3LJRA 3HVXA 3ZMKA 5CRHA 2FUG2 1ERTA 1JZOA 4EO3A 3TB2A 3E3EA 2N5FA 1TI1A 3QFAC 5B7CA 3S9FA 2NDOA 1GP1A 2H0GA 1YEPA 4MCUA 4ILFA 1E2YA 2NVLA 1VRSD 4AJ8A 17GSA 5AGYA 2IFQB 1Z3EA 2LJKA 2GVPA 4NV5A 4N30A 5EL8A 4OFMA 3ERGA 5JWQB 2FWGA 4N0VA 5IO2A 4TR3A 1U87A 1TKDB 1JLVA 2H19A 3VWUA 2FNOA 4V2NA 4BVYA 2JSYA 2B1KA 3RHBA 2R6KA 4EL1A 1VF2A 13GSA 1PRXA 3SWLA 3LWAA 3LFLA 1Q98A 2HRFA 4KW6A 2H72A 1Y25A 5HR3A 2B5YA 1V2AA 4OO4A 3UBLA 3HKRA 1KBNA 2B1LA 2PVQA 3QAGA 3GKXA 1BX9A 3HJPA 5ECSA 3P2AA 2MMOA 6GSUA 2GSRA 1M0UA 3QD9A 2X8GA 4Q5FA 5ECHB 4HEA2 4EVMA 1QMVA 2L59A 22GSA 3GX8A 3MAKA 4FYUA 1OKDA 1QUWA 2RIIA 3D0ZA 1JZWA 3QAVA 4MZCA 1M2AA 3GKKA 1AAZA 1F3AA 4KCEA 3M3MA 4LMWA 5D9XA 4L0WA 5HR2A 3FRCA 3FZAA 3CSIA 5AISA 5GSSA 4D73A 3GURA 2MBSA 1FOVA 1XWAA 3APOA 3TUEA 3BD2A 2GS3A 2QGVA 3IV4A 2IJYA 1GULA 2FA8A 1PSQA 1YDKA 1XFLA 1ABAA 4DSQA 1CQGA 3LYPA 1AQVA 5H5QA 2P5RA 3TKSA 3CXGA 1Z9HA 3UBKA 3RHCA 1GSSA 4OCFA 2IMFA 5KN3A 3GL3A 5LD0A 4GCIA 1Z6NA 5ELAA 1V40A 1X9MB 2E7PA 4V1Ap 1K3OA 4PUAA 2HZFA 3KCMA 5HFKA 3G7IA 2R3XA 1USBA 3I6AA 4MH2A 4HU7A 1FO5A 5F8BA 3TRQA 2PUKC 3C71A 1G7EA 5HFIA 3GSTA 3RPPA 3O76A 2F8AA 1XOBA 4MZBA 1W4VA 3ME7A 4ZBBA 2VCQA 4ZIJA 3MSZA 2R2JA 4BWSA 3IBHA 1SL0B 1OAZA 1ZGNA 4G9HA 2JZTA 2IMKA 3BOAA 3HVVA 3HZ8A 5F0GA 4HS1A 1U3AA 4XTSA 2H6ZA 4OMVA 1JHBA 4BWQA 1RW1A 2XC2A 3ZIVA 2RLIA 1ZYEA 1TXXA 4MPFA 2MMAA 4WF5A 4MJEA 1PQNA 2VCXA 1AQXA 1NHYA 3NOFA 1TW9A 4E8EA 3KTBA 1YQ1A 1XXUA 4HQZA 4POBA 2E2MA 5A5KA 3IHQA 1K3LA 4TR1A 1DE2A 1DSBA 2TRXA 3H8QA 1J08A 5ID2A 4KCAA 2HZEA 3FZ5A 4OCEA 7GSSA 2VLUA 1O81A 2H0HA 2HE3A 1JZRA 1M9AA 2BTOT 1TRSA 1SYXA 5CYYA 3UJ1A 4K8MA 4EDZA 3L0HA 5L71A 2OBIA 1SJ6A 4DSSB 5J5NA 4AJ7A 4F82A 3F6FA 2AUVA 1DE1A 3P8WA 2B5EA 4IS0A 2OA7A 3LQ7A 4AF2A 4HJ2A 1WP0A 3VI7A 1C72A 4K1FA 4EE0A 2PMTA 2E0QA 5HFGA 4IGJA 1WWJA 4F0CA 1GSQA 3RPNA 3VI5A 1YF0A 3HVSA 3A2WA 3AY8A 5G31A 3GH6A 1G7OA 3G9BA 3ZMLA 2I9HA 2CV4A 4G19A 1AXDA 1SKRB 2H71A 2VUPA 1J9BA 4K6XA 5DCGA 5IMZA 4JR4A 2TIRA 4N11A 3FZ9A 3HY2A 2IWTA 4MP4A 1YKCA 2P31A 3IAM2 3VURA 4ML6A 4KB3A 3IR4A 1I9DA 3F3RA 3G7JA 4NAXA 1OC9A 2KOKA
chains in the Genus database with same CATH superfamily
5JPPA 4I6XA 1BIRA 1YIT3 4RBNA 4ULXA 3CU3A 2CH9A 4OFTA 1BGSA 5GAPD 1FAAA 1YKAA 2NPBA 1THXA 2WRTA 1IQYA 3EU3A 1E3RA 3L9VA 1RGEA 1TUHA 5KP3A 1FUWA 2K18A 2VIMA 4GRFA 2MC8A 3H3HA 4HZ9B 4CW9A 4QWTA 3CNMA 1DE3A 4DVCA 1OC8A 5GSTA 3CME3 1XW5A 4GTUA 5KEJA 1XOAA 3DWVA 3KP8A 2VL2A 2HI7A 1Q4JA 5KN0A 1F2EA 2P0GA 1DBYA 1AQZA 2VCWA 5ECIB 1PA3A 1LVNA 2O3OA 4G0LA 3TGZA 6GSXA 3LXZA 2LEGA 1XVWA 1AR0A 2PZVA 4G2EA 3BJ5A 2D2ZA 3V92A 2KF3A 3F8UA 4EYCA 5F07A 1Z1SA 3X41A 3ZZXA 5D9VA 3K63A 1GMPA 4HM4B 3R2QA 3SX1A 2GT5A 1OF5B 1KEBA 1M3JA 5G30A 1F6MC 2CVKA 4WF4A 5BRTA 1RSNA 1UCLA 2GSQA 2UX0A 1XCCA 3DVWA 4ISDA 4JEDA 3FCSB 3K8NA 2H73A 1MNLA 1TK5B 4ECBA 5DREA 1ZOFA 3DKSA 4JU5A 2P5QA 4R9KA 4L8EA 4WBJA 3P7XA 2YV7A 2P09A 9GSSA 3DVXA 5D9TA 4WFOA 1G96A 12GSA 4Z7XA 1EV9A 4KE3A 1NNVA 3IJEB 3CCS3 3FF2A 5LC6A 4PNFA 1SD9A 1V98A 2BHMA 1K0AA 3EE2A 3KIIA 5JCUA 4XBYA 5DJLA 4HZ4A 3HYPA 1SARA 4LL4B 1W02A 2KF6A 1EEJA 3TJBA 3VLNA 1LNHA 4K9ZA 1DVCA 1SQWA 3AMOB 3T8UA 1RQMA 3BNBA 3IXRA 2DJ1A 4WR4A 2GU3A 1T4ZA 4KDUA 1EGOA 2YN1A 5ECLB 4HM1B 3TKSC 4LMVA 3UVHA 1XWBA 2X8CA 3UOMA 4AGSA 4OVMA 3TOTA 2LQVA 4HM8B 4WBRD 3RDWA 1I8VA 1RMSA 1M3IA 1TRVA 2CZ3A 2TRCP 2JSZA 3QOUA 1LOXA 1DUGA 2B1XB 1UC7A 2CFKA 4TXOB 2XGNA 4RUVA 4DSRA 5CRDA 2HMNB 4RZMA 5KN2A 3LORA 3HHVA 1KWIA 3S67A 4J9AA 2IL3A 3EMPA 5D96A 4OWYA 5ELGA 1SKSB 1DYUA 4POKA 2P38A 3C1RA 2DKIA 1OGZA 2H75A 1BSEA 1IVWA 2BMXA 1LQMB 1G6YA 4HZ2A 1WPIA 2KP2A 1T00A 1JFUA 5DRVA 3C7MA 2RUFA 3NXJA 1ERUA 1EGRA 2OE1A 4FMBA 3VGNA 2LRCA 3EPTA 3S27A 1PMTA 2DJ0A 4XS4A 2J8XB 1ULIB 4GQCA 3E99A 2HOHA 2O87A 2GZPA 4MF7A 1MTCA 4USSA 4NPBA 2JZSA 4ID0A 5E59A 4OO5A 1EQKA 5CK6A 4X4JA 5AIXA 1M7TA 3GFKA 4HM2B 1UA5A 1MEKA 1ISKA 1HNAA 1M99A 4XM4A 4J56E 3IK7A 1OYJA 4MMMA 2C3QA 3URPA 1M2DA 1UN2A 2DIYA 5IM9A 2RNTA 3ZG0A 4F2IA 2O85A 1I3IA 1UCIA 3ERWA 5AIFA 4KA0A 4KT3B 2GSTA 1YGWA 1AY7A 1GUKA 1NM3A 3NUVA 1HYFA 3MSOA 1TOFA 3KH9A 6GSYA 4IBPA 1TFOA 1B21A 1W89A 3F7XA 2BMQB 4ACSA 2HMKB 1BRKA 6GSSA 5HQPA 1VQ83 2K8SA 5M18A 1PKZA 2JQ5A 1UDII 1THOA 2F9SA 2O7KA 4IP1A 2FGTA 2FGXA 3Q18A 3BNCA 2M72A 3Q19A 2WULA 4O5QA 4IPBA 5J4UA 3IE3A 4FIWA 4O3VA 1GOUA 1R5AA 2X4AA 1BAOA 4BL3A 2IIYA 4N0ZA 2V41A 1A2PA 1SIHA 4ZBAA 1PX6A 2XPEA 2V6OA 2C10A 1SYRA 1A2VA 2YJ7A 2WOFA 2PBJA 2R5GA 1W4NA 1MWUA 4YAPA 3GUSA 4OD7A 2H1BA 1WIKA 1FUTA 2STDA 1BNGA 3D5JA 4IJIA 3CSJA 1CEWI 4IELA 2XSOB 2WCIA 1QJGA 1STDA 2PU9C 2WFCA 2V32A 3TJGA 4RI6A 5J41A 3BIRA 2JZRA 3GL5A 1GL8A 1X1WA 3CYNA 1GS3A 2V1MA 2AV4A 1IT7A 3HIGA 1JBTA 1TP9A 3CTFA 1BQ7A 3GZBA 1Z5YE 1N9JA 1K9M4 1VQQA 1WTHA 2H66A 1AQWA 2CG0A 3U6VA 3DZLA 3M9KA 5HOHA 3WGEA 4X43A 3ER7A 1GLQA 4WKWA 4IW9A 3KMOA 4HSCX 1RN4A 3N5OA 1CH0A 2B7KA 14GSA 1OC3A 3DYRA 3BNDA 3ZREA 3CC73 4TR0A 3J7Yb 2QKEA 3PH9A 1BJXA 1YHQ3 1EOHA 2AAWA 4HKVB 1SJIA 4FMDA 4TR4A 5J9CA 3STDA 2XEPA 2ES7A 2XF3A 2DC5A 4L0UA 1N2AA 1WQLB 3PYJA 1HQOA 1GD3A 1A2LA 3ZFLA 1B9XC 1T8EB 3CCL3 1OVNA 4FH8A 3FKAA 5ECPB 4WXTA 4PQIA 2PPTA 1NO3A 2XRXB 3EYTA 3KCHA 3N54B 3KZQA 3K7CA 1SJZA 2LTKA 2F98A 2OBKA 5FHIA 4EIPA 3I43A 4O92A 1IVVA 1RGGA 3O3TA 1AW9A 1HNCA 3OXAA 3KXOA 1EG9B 4MMYB 3CCJ3 2H76A 2CFDA 3QMXA 5G1LA 4BIRA 1Z6MA 2CKFB 5A4VA 1J0FA 3DGOA 3NX0A 1U5OA 1IYIA 2VL2C 3NQYA 5D83A 1UUGB 4HDEA 3IRAA 1SK0A 1MGRA 1BVIA 2VCZA 4HUAA 4EC6A 2OTJ3 5M19A 4HU9A 2C8UA 1OUNA 5AYSC 3OX9A 2BU4A 2CFGA 4K0GA 2Z7AA 3DIEA 5KOWA 3FF0A 1B4PA 1BNEA 2D1WA 4WEYA 3VFIA 3ED3A 2MF7A 2CX4A 5C04A 4FCZA 3KP9A 1D6YA 5AIHA 1ASKA 1W01A 10GSA 2DBCA 1ACVA 2HLSA 4O32A 1DVDA 4ZB9A 1PYLA 3EC9A 1H75A 3MWHA 4I2TA 1FVKA 3D4MA 4KZ1A 3L9SA 1TFKA 4J5KA 1YJ6A 5ECQB 4G0KA 1MOLA 1HNBA 1VF4A 1OE7A 4V1Ag 1ZZYA 4OFNA 1SU9A 1OHPA 5CO3A 1BANA 4MPGA 4XS6A 3HI7A 2R0CA 1B2MA 4I5QA 5DCHA 2J23A 1W7CA 3KE7A 4BVYB 2F86B 4KF9A 1XWKA 1W6CA 2ML6A 3L78A 4K90B 5G1KA 1VGLA 2YV9A 3GV1A 1IYYA 3C8EA 4KGIA 4MJCA 1JZDA 1BNIA 5GZZB 2WGOA 4L8OA 5I97A 1U88A 2LV3A 2VO4A 2X49A 4MZWA 3HJMA 3H79A 2ON7A 4JRRA 2X99A 1U8CB 1RGHA 3HCZA 4K1VA 3BU4A 4H3UA 2CFLA 1K734 5CREA 4EUYA 4J57E 3RBTA 2KAAA 3HZ4A 3GNJA 2G2QA 1FUSA 2YANA 1JN5B 4WP5A 1VQO3 3CNXA 4ZB8A 4NHFA 2B3SA 2LNTA 3GX0A 3UAPA 4EIQA 4ORLA 1ZYNA 3GAXA 1UUVB 1O7UA 3MKIA 1GSYA 2PN8A 3KSED 2EC4A 3PXMA 2F51A 2DSAA 3J7Yd 5AEUB 2M46A 5DALA 2VAFA 4RI7A 4GLTA 4X1UA 3ZRDA 1Q40A 1R7HA 1FW1A 1Q42A 3LMLA 4QL7A 2GQMA 4FYCA 1NU3A 4MDCA 4O5RA 2GT6A 2KF4A 4XRDA 5EEOA 3WT2A 2JL4A 2W9PA 5LCZA 1GRXA 1RRLA 3DEXA 3IK9A 3MYDA 4PURA 1IVXA 1S3DA 3ZIJA 2DMMA 4K2DA 3ZYWA 4ML1A 2VM2A 1B2XA 4D73B 2C3NA 4CDOA 4WYKA 2K9FA 5D73A 3EMXA 2MMZA 3TKRA 1BAYA 4PTSA 3GZRA 1RGKA 1HU9A 3VWWA 2GGTA 1K0BA 3MDKA 4HAAA 2BJXA 4ECJA 3UEMA 5EPFA 3MNGA 5AIIA 1FA3A 1S3CA 5IMVA 2DIZA 1UCKA 4LMIA 2ZDJA 2VCVA 2C1YA 1RGLA 5CXOA 1A8YA 3TJKA 1BSCA 1T5YA 3DRNA 5D93A 5IPGA 3HX8A 4FYBA 2CWVA 3H93A 2BNGA 3DMCA 3DMLA 3LH4A 2SARA 3MYTA 1FB0A 2FCHA 5BXQA 3G16A 1D6UA 3G0KA 3VWXA 2GXFA 3EVIA 4R80A 1VQP3 1NHOA 1XWCA 2VL3A 3BBYA 2O9UX 2V6KA 1PFPA 1UGIA 3FR9A 3EQQB 1TIJA 3DXBA 5IMFA 3KEBA 1RGFA 4IJ3A 4XB5A 4J2FA 1RCLA 4AJ6A 2M80A 19GSA 1O8XA 4PQHA 4BVXA 3S28A 1DMMA 3KZTA 2K8VA 1O7PB 2R4IA 2WS2A 5KN1A 3IAS2 3LEFA 2LNSA 5IG4A 2C80A 3TJJA 1XWGA 1BNSA 4N6UA 3V99A 1TRWA 2FA4A 1EWXA 2VLTA 4QQ7A 1GSPA 1I3FA 2GQKA 2H01A 2RUEA 3TKQA 1YGEA 2HSYA 5FW5A 1Q7HA 1PD21 2O89A 1XZOA 1X5DA 5D9WA 2CVDA 2W0QA 3D21A 1XW6A 2R0GA 3L0RA 5IW9A 3JUMA 2IN3A 2XR8B 4L5LA 2VLVA 3GH9A 3DM8A 1G0TA 1XG8A 1YZXA 2GZYA 2QEX3 5B8AA 3PCSA 1S5AA 1Q824 2CVBA 5AYRB 3R3EA 2INXA 1HD2A 4KAEA 5CP1A 1B27A 2YFLB 4EXRA 4MK3A 2L5OA 3KJYA 2AJQB 2W6JH 1VQM3 2HXKA 2W56A 2JACA 2ZNMA 2HRNA 4MMZB 2GBXB 1O7MB 2ZHXB 1RCKA 3WT1A 2IY2A 2C0GA 2WZ9A 1N9EA 1MDJA 1AV4A 2MBTA 3Q3FA 2HMMB 1PGTA 4PQ1A 1VQ53 3W8SA 3H1NA 4E8HA 5DQYA 3US3A 4IN0A 2IPAA 3FK8A 1Q814 1IV7A 3KH7A 4TW5A 2H1DA 2M7OA 4GF0A 1VQN3 2AB6A 1DETA 4KH7A 2OOVA 1R4CA 8RNTA 2CHCA 3QAWA 4TR1B 1Y6EA 1LQGC 2A2RA 1SKWB 3TOUA 2IUJA 3PPUA 5ID2B 5D8IA 3G7YA 1QQ2A 4HM5B 3WYWA 2HZEB 4GQFA 3BCKA 3NZNA 4N10A 1L5GB 2HFDA 6GSVA 1R26A 1B9YC 3SYUA 3LTBA 1SL1B 1B4QA 4IP6A 1H4OA 3E0UA 2Z9SA 3BNEA 4EW5A 2DJ3A 1K0DA 5DDLA 3ZITA 3N9JA 4Q5QA 1F3BA 5AN1A 5IPHA 2YOIA 5GAND 3EU4A 1KQS2 2N5AA 2F3MA 1E6BA 4XS1A 1UUWB 3WA3A 1T7PB 2KP1A 5DAKA 3G6E3 2JU5A 1SL2B 3IMAB 2E2TA 2L4CA 4AKZA 5IF6A 1GTAA 2LS5A 2K6VA 1QMAA 1OPYA 3MG2A 1W6GA 2CK3H 2ON5A 2FHEA 1T2HA 3ZL5A 1T1VA 5FT3A 3ZLPA 4A5PA 1RHLA 2IMIA 2MMNA 1A8LA 5ECMB 1AUCA 1QFNA 3APSA 3AHSA 1X1XA 4KDXA 2IMDA 2IFQA 5ENUA 1ST9A 2KHPA 3FW2A 3KIJA 2H0IA 1OCVA 4HQSA 1MDIA 2FWEA 2R41A 1IDPA 2LRTA 1WE0A 1GD4A 1AC1A 4RQXA 1V9WA 4TVEA 1O7WB 4HOHA 1D6ZA 2F4YA 1A2JA 2B5XA 1SD8A 3BCIA 3CSHA 2WOHA 3OWSA 1C7HA 4PGTA 1IQ8A 3J7Yk 2LKUA 2YCDA 2Q07A 3VSYA 1QALA 16GSA 3PR8A 1YVSA 1OC9B 2DLXA 3GKMA 4G10A 3I0YA 4N6V0 3VPTA 2WB9A 4K7IA 4KDYA 1XW9A 1MD3A 2YZUA 3CCE3 4HJMA 2LQQA 2WGRA 1N8JA 1X0RA 3TKSE 1S723 1UVZA 5CRWA 1M1K4 2W03A 3X3YA 4EBGA 3APQA 4NHZA 5FGOA 2WO0A 1JB2A 5HR1A 2L6DA 5COHA 1GTBA 4MLYA 1BRNL 4IHUA 3KTLA 5IMDA 1YF1A 3NM7A 2IMEA 4GSSA 4XBXA 3F4TA 4TOPA 4FCMA 1MWTA 3LTDA 3AGNA 1W5ZA 1R5PA 1T4YA 2H6XA 3T0UA 5CRGA 4LZIA 2BMRB 2YNXA 1VF3A 4RQRA 1XPVA 2C0DA 2FLSA 2GBWB 1B8XA 2WJUA 2CX1A 3CPOA 2HSHA 3KM6A 3V1WA 1JKGA 1FHEA 2CA8A 3EURA 3A3TA 1DMQA 3FG4A 2OKAA 3DY5A 3QDNA 1JBSA 3UIWA 1QVF2 2AAEA 3F8XA 4JE1A 4I97A 3RNTA 5HR0A 3ZFZA 4EXJA 1NW2A 4Z2UA 3LSZA 1F9MA 3F4RA 3HVNA 4K7NA 5IOXA 5IMAA 4GXZA 2RM5A 1FGRA 2GLRA 3U97A 2DMLA 2YZHA 4NHWA 3RGRA 3KN4A 1TRPA 3FH1A 4WETA 2KXGA 2REMA 2DJJA 1SENA 1TTZA 5M1AA 2QA43 2I1UA 5DAKB 1UW1A 1IV9A 1LOVA 3BLZA 1VZZA 3I9V2 1FW7A 3E9JB 2KCDA 2PERA 8GSSA 1O6JA 4F9ZA 1K0OA 3ME8A 2W2CA 2A4VA 4X2HA 4QL9A 2F99A 4RNYA 1I2FA 3K9MC 3FKFA 3F9UA 4PNGA 2BO9B 2PWJA 5G2ZA 3Q1CA 5JCWA 3JUPA 1LJRA 5H5RA 5J3RA 2YWMA 1M9BA 1M1XB 2E2VA 1TK8B 3CXC2 3GYKA 3RAZA 5IOWA 1PL1A 4EF0A 4H61A 2L57A 4CY8A 1OE8A 1K8A4 2A2SA 3A5WA 3I553 2QA2A 3GSPA 1BG5A 5LNKe 3WGDA 1O8WA 3FZWA 3LOYA 3GRXA 2FNQA 5IENA 4NV2A 4Q5RA 2CFWA 4XRAA 3LTCA 3AGOA 3PS8A 3MWZA 1WMPA 3UNLA 1ERWA 4ZL7A 1OHOA 3EB8A 2VL9A 1JB5A 3ISOA 3EWLA 2L4QA 3DXOA 2ZL8A 1BUQA 1G02A 1GLPA 3D4AA 3CPW2 5B6NA 4HJLB 4L7KA 2NTOA 3TRPA 2ZA4A 3HA9A 3LT8A 1LBKA 4TRXA 1YJN3 2YFJB 4ZBDA 4XBTA 2VD0A 4NWYA 1I5GA 1MD4A 4F0BA 3VK9A 1ILOA 2OQEA 2ML5A 4Q53A 1YIJ3 3HK4A 1PX7A 2GSSA 11GSA 1QVG2 1GSEA 2H74A 2XBQA 3F4SA 4EV2A 1I2GA 2E2UA 1V57A 4EDYA 5A4WA 3WOEB 4I8BA 3BB9A 4IIAA 2ALBA 4K1UA 5CNWA 2AYTA 2R37A 4XS4B 3GTUA 2K3DA 4LYLB 2AHEA 2C4BA 2X8HA 3Q74A 1GOVA 1ON4A 1HYUA 4K7OA 2HNLA 2B6MA 1BNFA 3FLJA 2R4VA 1T2IA 1I2EA 1E97A 2MZCA 3HJOA 3QCPA 2EIQA 5DBQA 1XVQA 3KKGA 3RDEA 1BRGA 4HVNA 3C73A 7STDA 3M9JA 1FG4A 1GH2A 4YQUA 4GWRA 1MDKA 2C4JA 3GHAA 4YKFA 2CIUA 1X9WB 1ZCPA 3F3QA 1BNJA 3W8JA 5KP1A 2HT9A 1BNRA 2KUCA 3HDCA 3LXUX 1E3VA 2QSIA 1I0XA 5D82A 2V2GA 2UGIA 4BA7A 2YP6A 3UL5A 2YJHA 5JCGA 3O8YA 4GB5A 3LXTA 4KX4A 5DVBA 4JZQA 5IMCA 1EP7A 2UUGC 2QC7A 1A0FA 5BMUA 3FEUA 3QFBC 4DSSA 2KLXA 5JPUA 4TXVA 1EOGA 1ZYPA 1RN1A 1Q864 4Z2TA 3JUNA 3D4TA 1BRJA 3QRDA 1FGQA 18GSA 2CX3A 3IC4A 4KFEA 1PN0A 3D79A 1DMNA 5ECOB 2RBIA 3GSSA 2GU1A 1TTOA 3NV0A 5CLKA 2CAIA 4HM6B 3D6IA 4BL7A 4ECCA 1KTEA 3TJFA 3GRDA 5CF1A 3Q90A 3CQFA 2Z6BA 3CRUA 1GUMA 3ZG5A 2DKHA 4HZBB 3F63A 3MHEA 3F8HA 2RFRA 3FSDA 5IEPA 1MWSA 5ECRB 4CDLA 4MA9A 1KNGA 5E4WA 1R4WA 3DH2A 3FZ4A 4R4KA 3F40A 1GSDA 1YEXA 3ERFA 2VM1A 3CC43 1K0NA 3OR5A 4XCSA 2RSXA 2C11A 4MH3A 1FYSA 1RRHA 2C0EA 2GSPA 3PINA 3JCML 1OKTA 3C1SA 1TDIA 3W6GA 1Y4KA 2BIRA 1GNEA 4IKHA 5JWOB 4PXOA 4JRFA 4MABA 2OCTA 4CHSA 4LLRA 1BU4A 1B2ZA 1NWWA 1V58A 4WWUC 3D5IA 2I4AA 1X5CA 4V2LA 2C0FA 5B6MA 2FD3A 5HGRA 4TN8A 5DJMA 3IDVA 2LJRA 3WD6A 2YPMA 1QK8A 3WGXA 3KSPA 2D42A 2OJLA 2HSMA 1GY6A 5EVHA 2RCDA 2NBSA 1O7NB 1ZMAA 1A2MA 1Z7RA 3GTUB 3SVAA 2RM6A 3FG1A 2F56A 2I3YA 3GZXB 3SBCA 3U1WA 1PN9A 1SK1A 4MJBA 1WOUA 4IVFA 3NIVA 2LQOA 5IQYA 2WDUA 3F6DA 2OE0A 1A0RP 3X40A 3F0IA 3IA1A 4BTYA 4JR6A 5EVOA 1WJKA 1JB4A 3Q6OA 1ZL9A 1WRYA 5ECKB 3IHGA 4YQVA 3B4PA 1ULJB 3LTAA 1GMQA 3UL3A 4GHOA 2HRAA 4IQ1A 3WHOA 2PGTA 1N8QA 1OF5A 3UARA 1GTUA 2QIYA 2H70A 4X0XA 3DGLA 3GN3A 2OACA 2JDIH 1OHSA 6GSWA 3QR6A 2HMOB 3H4KA 1N5HA 3GWRA 1FGMA 2CT6A 3F14A 1QXHA 1K0CA 3CMA3 1YVBI 1O73A 3TDGA 2IA7A 9RNTA 2H6YA 4ZB6A 2HMLB 3UL6A 2J9HA 5ECNB 2OADA 5BVBA 3EC3A 2H1GA 3UMAA 20GSA 5INYA 2FWHA 3CBUA 3HXSA 1EV4A 1K0MA 1PKWA 2GQLA 1GUHA 2CG1A 4ECIA 1QGVA 3UB1A 1WNHA 5STDA 1S3RA 5B8BA 3CMIA 1TP6A 3CC23 3GMFA 3NQZA 4XDVA 3GA4A 3I69A 4O2HA 3TRXA 5BU4A 3AMOA 2LYXA 1A67A 4MJAA 4I2UA 3CCV3 1K3YA 3MG1A 1YJW3 1O85A 3A2VA 3CCR3 4GSNA 4IQAA 3O6TA 3U5RE 1XBSA 3CCM3 3B4OA 3ZFBA 1VQL3 4ZXGA 1B48A 2DJ2A 1EEMA 1IU7A 2C3TA 3F7SA 3LYKA 1A23A 1LU4A 5G2GA 3H51A 1T3BA 3M1GA 5F05A 2LUSA 3X42A 1I0VA 4POLA 3EINA 4CCVA 4KUNA 4TXOA 2OE3A 5H5SA 1UCJA 1QAFA 1JLWA 3KFQC 1GNWA 4H86A 4N3VA 4HOJA 3M0FA 4PUFC 4GSPA 3LT9A 1M2BA 2H1AA 4JBBA 2GTUA 4ZM8A 3M8CA 4EV5A 1U6TA 1BRIA 5JBSA 3EJVA 3B7CA 1TRUA 2YWIA 2B7JA 4MF6A 3FHKA 5DALB 4BPYA 1BUJA 1Q40B 2CAQA 1ML6A 3M8NA 3VPQA 3EE1A 4MMXB 1FB6A 4X2OA 1GTIA 1CQSA 3HD5A 1VQ93 1A2KA 3L9UA 4WR5A 5AIGA 1EA2A 1TU7A 2XBIA 5IO0A 1AVKA 2H8LA 2JADA 5AIVA 1NSWA 1K41A 4K61A 1X9SB 3S29A 3P90A 4ZL9A 2OQEC 4KFFA 5JWRB 3X3XA 1OACA 4O7HA 3NBBA 2YWNA 1F8NA 4WYKB 3IC8A 3IPZA 5FWGA 4N6NB 4N6LA 3CTGA 3N9HA 5F06A 5G5EA 2MYGA 3PGTA 4FO5A 1S3AA 1TJDA 2CWUA 3D22A 4ZL8A 1GSFA 3WMDA 3FR3A 2R0PA 4KNDA 4LL1B 1BRSA 4HM0B 2PVOC 4O02B 4F03A 1FGOA 2OTL3 1W00A 2W9QA 2O8VB 2ZUPA 1O7GB 1RK4A 1URMA 4BTWA 4K0NA 4DKIA 3RGAA 4YH2A 3DGQA 4XDWA 3WR2A 4MJDA 3IOSA 3CRTA 3ALAA 1X5EA 4KSMA 4NXIA 3HOHA 4HBRA 2B24B 1JRQA 3HZPA 1IT8A 1ROVA 2YX9A 4DEJA 1YNVX 4PX1A 1GSUA 3VWVA 4CY6A 5J9BA 1NJI4 5CAXA 5EY6A 5G5FA 3FY7A 3KD0A 2EIRA 1IK3A 1TI3A 1FOHA 2GDRA 2HYXA 3WOFB 4XIHA 5C00A 3PZWA 2G0FA 2CQ9A 2YWOA 1LXEA 2IYJA 2L6CA 4BU4A 2VOCA 4LA1A 3LG6A 1PL2A 1MWRA 1ZX2A 1BRHA 1CQHA 1ERVA 3GIXA 3HIIA 2X64A 3QPMA 2GZZA 4MF5A 1GWCA 3ZVJA 4BVXB 4HI7A 1A24A 2XFSA 1YY7A 2FWFA 2RGQA 5CF2A 2EIOA 4XHMA 3A2XA 1X1YA 1BEDA 1RN7A 1BYEA 2A15A 3SEDA 3LYGA 4L5OA 5DQSA 1CYUA 1FVJA 3TCOA 4P3YB 3OWYA 1G6WA 4O5UA 1V74A 1LOYA 1WMJA 2F8FA 1TK0B 3A76A 1F37A 2FY6A 3UVTA 4YQMA 4FQUA 4POMA 2L5LA 1U3IA 2E2GA 2XHFA 4GL6A 3KMNA 2N5BA 4FCJA 4KSOA 1UI7A 4BTXA 2W56B 1SK2A 5GSPA 1O7HB 4EKZA 1BSAA 1TU8A 3FYGA 4NMUA 2LSTA 6RNTA 5A4UA 4EC0A 2P05A 2VD1A 4GSTA 2ZCTA 4YAVA 1B3SA 5ABRA 3DD3A 1UI8A 4TKYA 2A2PA 2KRTA 1VF1A 3KGKA 2XPDA 1RDSA 2LJAA 2Z77A 4V2MA 1IYHA 2I81A 1OGXA 2PNCA 2CZ2A 2F5MA 5KP4A 1IVUA 3FR6A 3PCRA 4LSOA 4LGQA 3JUOA 2VCTA 4Q5NA 1ZYQB 4STDA 1GOYA 1R4YA 3K5TA 1AIUA 5IIZA 1W6YA 3L4NA 1XIYA 3GKNA 3ZTLA 2LRNA 4ZILA 4G1MB 2DJKA 1LOWA 5AEWB 1Z7PA 1JJ22 1EZKA 3JUQA 3LGCA 2KF5A 3TKPA 3ZVJD 1SIIA 6GSTA 1EUIC 3PGBA 1ZS7A 1KD14 3DGMA 1EP8A 2H30A 3LJRA 3HVXA 3ZMKA 5CRHA 2FUG2 1ERTA 1JZOA 4EO3A 1STFI 3MG3A 3E3EA 2N5FA 1TI1A 3QFAC 5B7CA 3TB2A 4JF8A 3S9FA 1N8R4 3G713 4K5RA 1ZO2A 4FR9A 2NDOA 3D3LA 1GP1A 2H0GA 2CWTA 1YEPA 5IG0A 1FZUA 4ILFA 3NBJA 2A4HA 4MCUA 1E2YA 1M9GA 2NVLA 1MGWA 1VQK3 3NM2A 1VRSD 4AJ8A 17GSA 5AGYA 3WA2X 1EKMA 2IFQB 1Z3EA 2LJKA 2GVPA 1K28A 3N8BA 4N30A 4NV5A 1VQ43 5EL8A 4OFMA 4FMAA 3ERGA 3SLUA 4ICYA 2FWGA 1LNIA 4N0VA 5JWQB 5IO2A 4TR3A 2IUKA 1U87A 1TKDB 1JLVA 4IT7A 2H19A 3VWUA 2FNOA 3DGYA 4V2NA 5IG3A 3F9SA 4BVYA 2JSYA 3V98A 2B1KA 3RHBA 1RNBA 2R6KA 4EL1A 1VF2A 1YJ93 13GSA 3VF1A 1PRXA 1X1UA 3K0ZA 3SWLA 2SBLA 3LWAA 5RNTA 5EQLA 3LFLA 3EN1B 3OV4A 1Q98A 2HRFA 2F5WA 1BSDA 3UJMA 4KW6A 2H72A 1Y25A 5HR3A 1W2ZA 2B5YA 1V2AA 4OO4A 3ECFA 3UBLA 3HKRA 1KBNA 7GSPA 3EBTA 2B1LA 2CW9A 2PVQA 1GY5A 4R1KA 1HKXA 1CYVA 3QAGA 3GKXA 5ELJA 3OW22 1KSIA 4MEIA 4YKGA 1WMNA 3T8NA 1BX9A 4BL2A 3HJPA 5AI1A 1YI23 5ECSA 3P2AA 2MMOA 3EN8A 2Y73A 1A90A 1JN5A 1WMOA 4TX4A 6GSUA 2GSRA 3OWUA 1M0UA 3QD9A 2X8GA 4Q5FA 5ECHB 4HEA2 4EVMA 1QMVA 1RKYA 4N6MA 1TRQA 1Q9EA 3CD63 2L59A 1RJOA 22GSA 1BOXA 3GX8A 3DUKA 1IQXA 4MNNA 3MAKA 2Z76A 4FYUA 1OKDA 1QUWA 5A0OB 5TGNA 4HM7B 2RIIA 3D0ZA 1JZWA 3QAVA 4MZCA 3WODG 4RNZA 1US1A 3Q2PA 1M2AA 3GKKA 1AAZA 1F3AA 4KCEA 4N6OB 3SOYA 4LEHA 3M3MA 2XSHB 1JKGB 4NREA 4LMWA 4CJNA 5D9XA 4L0WA 5HR2A 3FRCA 3FZAA 3G8ZA 2P0XA 1PFOA 3CSIA 1NB5I 2K54A 5AISA 5GSSA 1RLSA 4D73A 3GURA 4G0IA 2MBSA 1FOVA 5D81A 1XWAA 2W04A 2OOVC 3APOA 4AEQA 2XFTA 3TUEA 3BD2A 2GS3A 2QGVA 3IV4A 2IJYA 1GULA 2FA8A 3GZYB 5IG5A 4PEJA 1PSQA 3LZAA 2XH9A 1PU4A 2OWPA 1YDKA 3QK9A 1J2BA 1XFLA 1ABAA 1SJWA 4DSQA 1CQGA 3LYPA 2IMJA 1AQVA 5H5QA 1AVLA 3NHXA 2P5RA 3TKSA 4KVHA 3CXGA 1Z9HA 2YFIB 4KFDA 3UBKA 3SXXA 1I70A 1GSSA 3RHCA 3X3ZA 4OCFA 2IMFA 5KN3A 3I563 3MIXA 3GL3A 3JVCA 5LD0A 4GCIA 3NBRA 1Z6NA 1V40A 5ELAA 1X9MB 2E7PA 3FGYA 4V1Ap 1NDOB 1K3OA 4PUAA 4AKYA 2HZFA 3KCMA 2CC3A 3FG3A 5HFKA 3G7IA 2R3XA 1USBA 3I6AA 4MH2A 2AADA 3MPHA 4HU7A 1RGCA 2HRKA 5F8BA 3TRQA 1FO5A 2PUKC 3C71A 1M904 3CCQ3 1G7EA 5HFIA 1ROAA 3GSTA 3RPPA 3O76A 2F8AA 1XOBA 4N6TA 4MZBA 1UGHI 1W4VA 1B2SA 3ME7A 4ZBBA 2XGLA 2VCQA 4ZIJA 3MSZA 2R2JA 4R9LA 1BSBA 4BWSA 3DGNA 3IBHA 1SL0B 1OAZA 1ZGNA 2QGUA 4G9HA 2JZTA 2IMKA 3BOAA 3HVVA 3HZ8A 5F0GA 2P0MA 1B20A 4HS1A 1U3AA 4XTSA 2H6ZA 4U13A 4OMVA 1JHBA 1FGTA 7RNTA 4BWQA 1SPUA 1RW1A 2XC2A 3ZIVA 3G4S3 2RLIA 1ZYEA 1TXXA 1JNQA 4K2XA 3FMWA 4MPFA 4OUQA 1RNTA 2MMAA 4WF5A 4HYZA 1PQNA 4MJEA 3D5GA 1KC84 1QAKA 2CX0A 2VCXA 1AQXA 3A5EA 1NHYA 3NOFA 2QA1A 1TW9A 4E8EA 3WDGB 3KTBA 2I9WA 1YQ1A 1XXUA 4Z2RA 2UZ8A 5ELUA 1RGAA 3EHCA 5BIRA 5KOXA 3A5IA 3S5CA 3SOAA 2WGQA 4HQZA 4POBA 2E2MA 5A5KA 3IHQA 1ZGXA 5IERA 4J5GA 1K3LA 1N5PA 4TR1A 1DE2A 1DSBA 1JBRA 2TRXA 3H8QA 4OK0A 1J08A 5ID2A 1TU5A 1GY7A 4KCAA 2HZEA 3FZ5A 4OCEA 1PY3A 7GSSA 2VLUA 1O81A 2H0HA 2HE3A 1GYBA 2K0MA 1JZRA 1M9AA 4K5SA 2BTOT 1TRSA 1SYXA 1B2UA 4WHAA 5CYYA 3UJ1A 4K8MA 4EDZA 3L0HA 5L71A 2OBIA 1OH0A 1SJ6A 4DSSB 1GMRA 5J5NA 4AJ7A 4F82A 3F6FA 4I4KA 2GEYA 1Q7Y4 4CPKA 2AUVA 5LC7A 3CCU3 1DE1A 6GSPA 3P8WA 2B5EA 4IS0A 2OA7A 1HZ1A 4L8PA 2GEXA 3EF8A 4BIKA 3NV0B 3LQ7A 1JV2B 6STDA 4HJ2A 4AF2A 4FMCA 1WP0A 1C72A 3VI7A 4K1FA 4BL7B 3IPTA 4EE0A 2PMTA 2E0QA 5HFGA 4IGJA 1WWJA 4F0CA 4HM3B 1GSQA 2L4VA 1NB3I 3LW9A 3RPNA 3VI5A 1YF0A 3EX9A 3HVSA 3A2WA 8CHOA 3AY8A 5G31A 3GH6A 3AHWA 4J8TA 5IEOA 1G7OA 3G9BA 2FXTA 2Y74A 3ZMLA 2I9HA 1W2B2 1LRAA 2CV4A 4G19A 3EBYA 2L1SA 1AXDA 1SKRB 2V1LA 2H71A 1RTUA 2VUPA 3ROBA 1J9BA 4K6XA 5DCGA 1VQ73 5IMZA 2BMOB 1C54A 4JR4A 1VQ63 2TIRA 4N11A 3FZ9A 3HY2A 4RNTA 2BT3A 2IWTA 3D9RA 1YKCA 4MP4A 2P31A 3IAM2 3VURA 4ML6A 4KB3A 2HMJB 3IR4A 1I9DA 3F3RA 3G7JA 3B8LA 4NAXA 1OC9A 2KOKA 4O8SA
chains in the Genus database with same CATH topology
4I6XA 4ULXA 4OFTA 5GAPD 1FAAA 1YKAA 2NPBA 1THXA 2WRTA 3EU3A 3L9VA 2VIMA 2K18A 4GRFA 4CW9A 4DVCA 1OC8A 5GSTA 1XW5A 4GTUA 5KEJA 1XOAA 3DWVA 3KP8A 2VL2A 2HI7A 1Q4JA 5KN0A 1F2EA 2P0GA 1DBYA 2VCWA 5ECIB 1PA3A 6GSXA 4G0LA 3TGZA 3LXZA 2LEGA 1XVWA 4G2EA 3BJ5A 2D2ZA 3F8UA 5F07A 3ZZXA 5D9VA 3R2QA 2GT5A 1KEBA 5G30A 1F6MC 2CVKA 4WF4A 5BRTA 2GSQA 1XCCA 3DVWA 4ISDA 4JEDA 3K8NA 2H73A 1TK5B 4ECBA 1ZOFA 3DKSA 4JU5A 2P5QA 4L8EA 4WBJA 3P7XA 2YV7A 9GSSA 3DVXA 5D9TA 12GSA 4Z7XA 1EV9A 4KE3A 4PNFA 1SD9A 1V98A 1K0AA 3EE2A 5JCUA 5DJLA 4HZ4A 3HYPA 4LL4B 1EEJA 3TJBA 3VLNA 4K9ZA 1RQMA 3IXRA 2DJ1A 4WR4A 1T4ZA 4KDUA 1EGOA 2YN1A 5ECLB 3TKSC 4LMVA 3UVHA 1XWBA 2X8CA 3UOMA 4AGSA 3TOTA 4WBRD 3RDWA 1TRVA 2CZ3A 2TRCP 2JSZA 3QOUA 1DUGA 1UC7A 4TXOB 4RUVA 4DSRA 5CRDA 5KN2A 3LORA 3HHVA 3EMPA 2IL3A 5D96A 4OWYA 5ELGA 1SKSB 4POKA 3C1RA 2DKIA 2H75A 2BMXA 4HZ2A 1G6YA 1WPIA 2KP2A 1T00A 1JFUA 3C7MA 2RUFA 1ERUA 1EGRA 2OE1A 2LRCA 3EPTA 1PMTA 2DJ0A 4XS4A 4GQCA 2O87A 2GZPA 4MF7A 1MTCA 4USSA 4NPBA 2JZSA 4ID0A 5E59A 4OO5A 4X4JA 5AIXA 1M7TA 3GFKA 1UA5A 1MEKA 1HNAA 1M99A 4J56E 3IK7A 1OYJA 4MMMA 2C3QA 1M2DA 1UN2A 2DIYA 5IM9A 4F2IA 2O85A 3ERWA 4KA0A 2GSTA 1GUKA 1NM3A 3KH9A 1TOFA 6GSYA 4IBPA 1W89A 4ACSA 6GSSA 5HQPA 2K8SA 1PKZA 1THOA 2F9SA 2O7KA 4IP1A 2FGXA 3Q18A 2M72A 3Q19A 2WULA 4O5QA 5J4UA 3IE3A 4FIWA 1R5AA 2X4AA 2IIYA 4N0ZA 2V41A 4ZBAA 1PX6A 2XPEA 2V6OA 1SYRA 2YJ7A 2PBJA 2R5GA 4YAPA 3GUSA 4OD7A 2H1BA 1WIKA 3D5JA 4IJIA 3CSJA 4IELA 2WCIA 2PU9C 2WFCA 2V32A 3TJGA 4RI6A 5J41A 2JZRA 3GL5A 1GL8A 3CYNA 2V1MA 2AV4A 1TP9A 3CTFA 1BQ7A 1Z5YE 2H66A 1AQWA 3U6VA 3M9KA 3WGEA 4X43A 1GLQA 4WKWA 4IW9A 3KMOA 3N5OA 2B7KA 14GSA 1OC3A 3DYRA 3ZREA 4TR0A 3J7Yb 2QKEA 3PH9A 1BJXA 1EOHA 2AAWA 1SJIA 5J9CA 4TR4A 2ES7A 2DC5A 4L0UA 1N2AA 1HQOA 3ZFLA 1A2LA 1B9XC 1T8EB 1OVNA 4FH8A 5ECPB 4WXTA 4PQIA 2PPTA 3EYTA 3KZQA 2LTKA 1SJZA 2OBKA 5FHIA 4EIPA 3I43A 4O92A 3O3TA 1AW9A 1HNCA 3KXOA 2H76A 3QMXA 5G1LA 1Z6MA 5A4VA 1J0FA 1IYIA 2VL2C 4HDEA 3IRAA 1SK0A 2VCZA 4HUAA 4HU9A 2C8UA 4K0GA 3DIEA 5KOWA 1B4PA 4WEYA 3VFIA 3ED3A 5C04A 2CX4A 3KP9A 10GSA 2DBCA 1ACVA 2HLSA 4O32A 4ZB9A 1H75A 3MWHA 4I2TA 1FVKA 3D4MA 3L9SA 1YJ6A 5ECQB 4G0KA 1HNBA 1VF4A 1OE7A 4V1Ag 1ZZYA 4OFNA 1SU9A 5CO3A 4MPGA 4XS6A 2R0CA 5DCHA 4I5QA 2J23A 4BVYB 4KF9A 1XWKA 3L78A 5G1KA 1VGLA 2YV9A 3GV1A 4KGIA 3C8EA 4MJCA 1JZDA 5GZZB 1U88A 2LV3A 2VO4A 2X49A 4MZWA 3HJMA 3H79A 2ON7A 4JRRA 2X99A 3HCZA 5CREA 4EUYA 4J57E 3RBTA 3HZ4A 3GNJA 2G2QA 2YANA 4ZB8A 2LNTA 2B3SA 3GX0A 3UAPA 4EIQA 1ZYNA 1O7UA 2PN8A 1GSYA 2EC4A 2F51A 2DSAA 2M46A 5DALA 2VAFA 4RI7A 4GLTA 4X1UA 3ZRDA 1R7HA 1FW1A 4QL7A 2GQMA 4FYCA 4MDCA 4O5RA 2GT6A 4XRDA 3WT2A 5LCZA 1GRXA 2JL4A 3DEXA 3IK9A 3MYDA 4PURA 1S3DA 3ZIJA 2DMMA 4K2DA 3ZYWA 4ML1A 2VM2A 4D73B 2C3NA 4CDOA 2K9FA 5D73A 3EMXA 2MMZA 3TKRA 1BAYA 4PTSA 3VWWA 2GGTA 1K0BA 3MDKA 2BJXA 4ECJA 3UEMA 5EPFA 3MNGA 1S3CA 5IMVA 2DIZA 2VCVA 2C1YA 3TJKA 1A8YA 3DRNA 5D93A 5IPGA 4FYBA 3H93A 3DMLA 1FB0A 2FCHA 3VWXA 3EVIA 1NHOA 1XWCA 2VL3A 3BBYA 2V6KA 3FR9A 3DXBA 5IMFA 3KEBA 4IJ3A 4J2FA 4AJ6A 2M80A 19GSA 1O8XA 4PQHA 4BVXA 2WS2A 2K8VA 5KN1A 3IAS2 3LEFA 2LNSA 2C80A 3TJJA 1XWGA 1TRWA 2FA4A 1EWXA 2VLTA 4QQ7A 2GQKA 2H01A 2RUEA 3TKQA 2HSYA 1PD21 2O89A 1XZOA 1X5DA 5D9WA 2CVDA 3D21A 1XW6A 2R0GA 2IN3A 4L5LA 2VLVA 3GH9A 1G0TA 1YZXA 2GZYA 5B8AA 2CVBA 3R3EA 1HD2A 4KAEA 5CP1A 4MK3A 2L5OA 3KJYA 2AJQB 2HXKA 2ZNMA 2JACA 2HRNA 3WT1A 2IY2A 2C0GA 2WZ9A 1MDJA 2MBTA 1PGTA 4PQ1A 3W8SA 3H1NA 4E8HA 5DQYA 3US3A 4IN0A 2IPAA 3FK8A 3KH7A 4TW5A 2H1DA 4GF0A 2AB6A 4KH7A 3QAWA 4TR1B 1Y6EA 2A2RA 1SKWB 3TOUA 3PPUA 5ID2B 5D8IA 3G7YA 1QQ2A 3WYWA 2HZEB 4GQFA 3BCKA 3NZNA 4N10A 2HFDA 6GSVA 1R26A 1B9YC 1SL1B 1B4QA 4IP6A 1H4OA 3E0UA 2Z9SA 2DJ3A 1K0DA 5DDLA 3ZITA 3N9JA 4Q5QA 1F3BA 5AN1A 5IPHA 2YOIA 5GAND 3EU4A 2N5AA 2F3MA 1E6BA 4XS1A 1T7PB 2KP1A 5DAKA 1SL2B 2JU5A 2L4CA 1GTAA 2LS5A 2K6VA 2ON5A 2FHEA 3ZL5A 1T1VA 5FT3A 3ZLPA 4A5PA 2IMIA 2MMNA 1A8LA 5ECMB 1AUCA 1QFNA 3APSA 4KDXA 2IMDA 2IFQA 5ENUA 1ST9A 2KHPA 3FW2A 3KIJA 2H0IA 4HQSA 1MDIA 2FWEA 2LRTA 1WE0A 1AC1A 4RQXA 1V9WA 4TVEA 1A2JA 2B5XA 1SD8A 3BCIA 3CSHA 4PGTA 3J7Yk 2LKUA 2YCDA 3PR8A 16GSA 1OC9B 2DLXA 3GKMA 4G10A 3VPTA 2WB9A 4K7IA 4KDYA 1XW9A 1MD3A 2YZUA 4HJMA 2LQQA 2WGRA 1N8JA 1X0RA 3TKSE 1UVZA 5CRWA 3APQA 4NHZA 5HR1A 2L6DA 5COHA 1GTBA 4MLYA 4IHUA 3KTLA 5IMDA 1YF1A 2IMEA 4GSSA 3F4TA 4TOPA 1R5PA 1T4YA 2H6XA 5CRGA 2YNXA 1VF3A 4RQRA 1XPVA 2C0DA 2FLSA 1B8XA 2WJUA 2HSHA 3KM6A 3V1WA 1FHEA 2CA8A 3EURA 3A3TA 2OKAA 3QDNA 3UIWA 4JE1A 4I97A 5HR0A 4EXJA 1NW2A 4Z2UA 3LSZA 1F9MA 3F4RA 4K7NA 5IOXA 5IMAA 4GXZA 2RM5A 2GLRA 2DMLA 2YZHA 4NHWA 4WETA 2REMA 2DJJA 1SENA 1TTZA 2I1UA 5DAKB 3I9V2 3E9JB 8GSSA 2PERA 1O6JA 4F9ZA 1K0OA 3ME8A 2A4VA 4QL9A 3FKFA 3F9UA 4PNGA 2PWJA 5G2ZA 5JCWA 5H5RA 1LJRA 5J3RA 2YWMA 1M9BA 1TK8B 3GYKA 3RAZA 5IOWA 1PL1A 4EF0A 2L57A 4CY8A 1OE8A 2A2SA 3A5WA 2QA2A 1BG5A 5LNKe 3WGDA 1O8WA 3GRXA 4Q5RA 4NV2A 4XRAA 4ZL7A 1ERWA 2VL9A 3ISOA 3EWLA 2L4QA 1GLPA 5B6NA 2NTOA 3TRPA 3HA9A 1LBKA 4TRXA 4ZBDA 2VD0A 4NWYA 1I5GA 1MD4A 4F0BA 3VK9A 1ILOA 1PX7A 2GSSA 11GSA 1GSEA 2H74A 2XBQA 3F4SA 1V57A 4EDYA 5A4WA 4I8BA 2ALBA 5CNWA 2AYTA 2R37A 4XS4B 3GTUA 2AHEA 2X8HA 3Q74A 1ON4A 1HYUA 4K7OA 2HNLA 2B6MA 2R4VA 2MZCA 3HJOA 3QCPA 2EIQA 5DBQA 1XVQA 3C73A 3M9JA 1FG4A 1GH2A 4YQUA 4GWRA 1MDKA 2C4JA 3GHAA 4YKFA 1X9WB 1ZCPA 3F3QA 3W8JA 2HT9A 2KUCA 3HDCA 2QSIA 2V2GA 4BA7A 2YP6A 2YJHA 5JCGA 3LXTA 4KX4A 5DVBA 4JZQA 5IMCA 1EP7A 2QC7A 1A0FA 5BMUA 3FEUA 3QFBC 4DSSA 2KLXA 4TXVA 1EOGA 1ZYPA 4Z2TA 3D4TA 18GSA 3IC4A 2CX3A 1PN0A 5ECOB 3GSSA 2CAIA 3D6IA 4BL7A 4ECCA 1KTEA 3TJFA 3CRUA 1GUMA 2DKHA 3F63A 5ECRB 4MA9A 1KNGA 5E4WA 1R4WA 3FZ4A 1GSDA 1YEXA 3ERFA 2VM1A 1K0NA 3OR5A 4XCSA 4MH3A 2C0EA 3PINA 3JCML 1OKTA 3C1SA 1TDIA 3W6GA 1GNEA 4IKHA 5JWOB 4PXOA 4MABA 4CHSA 4LLRA 1V58A 2I4AA 1X5CA 4V2LA 2C0FA 5B6MA 2FD3A 4TN8A 5DJMA 3IDVA 2LJRA 3WD6A 2YPMA 1QK8A 3WGXA 2OJLA 2HSMA 2NBSA 1ZMAA 1A2MA 1Z7RA 3GTUB 2RM6A 2I3YA 3SBCA 1SK1A 1PN9A 4MJBA 1WOUA 4IVFA 3NIVA 2LQOA 5IQYA 2WDUA 3F6DA 2OE0A 1A0RP 3F0IA 3IA1A 4JR6A 5EVOA 1WJKA 3Q6OA 1ZL9A 1WRYA 5ECKB 3IHGA 4YQVA 3UL3A 2HRAA 4IQ1A 2PGTA 3UARA 1GTUA 2H70A 4X0XA 3GN3A 2OACA 6GSWA 3QR6A 3H4KA 2CT6A 1QXHA 1K0CA 1O73A 3TDGA 2H6YA 4ZB6A 2J9HA 5ECNB 2OADA 3EC3A 2H1GA 3UMAA 20GSA 5INYA 2FWHA 3CBUA 3HXSA 1EV4A 1K0MA 1PKWA 2GQLA 1GUHA 4ECIA 1QGVA 5B8BA 3CMIA 3GMFA 3GA4A 3I69A 3TRXA 4MJAA 4I2UA 1K3YA 1O85A 3A2VA 4IQAA 4GSNA 3O6TA 3U5RE 1XBSA 3ZFBA 4ZXGA 1B48A 2DJ2A 1EEMA 2C3TA 3LYKA 1A23A 1LU4A 1T3BA 3M1GA 5F05A 2LUSA 4POLA 3EINA 4KUNA 4TXOA 2OE3A 5H5SA 1JLWA 1GNWA 4H86A 4HOJA 3M0FA 4PUFC 1M2BA 2H1AA 4JBBA 2GTUA 1U6TA 1TRUA 2YWIA 2B7JA 4MF6A 3FHKA 5DALB 4BPYA 2CAQA 1ML6A 3M8NA 3VPQA 1FB6A 1GTIA 3HD5A 3L9UA 4WR5A 1TU7A 2XBIA 5IO0A 2H8LA 2JADA 5AIVA 1NSWA 1X9SB 3P90A 4ZL9A 5JWRB 4O7HA 2YWNA 3IC8A 3IPZA 5FWGA 3CTGA 5G5EA 5F06A 2MYGA 3PGTA 4FO5A 1S3AA 1TJDA 3D22A 4ZL8A 1GSFA 3FR3A 2R0PA 4KNDA 4LL1B 2PVOC 4F03A 2O8VB 2ZUPA 1RK4A 1URMA 4K0NA 4YH2A 3DGQA 3IOSA 3CRTA 1X5EA 4KSMA 4NXIA 4DEJA 4PX1A 1GSUA 3VWVA 4CY6A 5J9BA 5CAXA 5EY6A 5G5FA 3FY7A 3KD0A 2EIRA 1TI3A 2GDRA 1FOHA 2HYXA 4XIHA 5C00A 2G0FA 2CQ9A 2YWOA 2IYJA 2L6CA 2VOCA 4LA1A 3LG6A 1PL2A 1CQHA 1ERVA 3GIXA 2X64A 3QPMA 2GZZA 4MF5A 1GWCA 3ZVJA 4BVXB 4HI7A 1A24A 1YY7A 2FWFA 2EIOA 4XHMA 3A2XA 1BEDA 1BYEA 4L5OA 5DQSA 1FVJA 3TCOA 4P3YB 1G6WA 4O5UA 2F8FA 1WMJA 1TK0B 1F37A 2FY6A 3UVTA 4YQMA 4FQUA 4POMA 2L5LA 2E2GA 1U3IA 2XHFA 3KMNA 2N5BA 4KSOA 1SK2A 4EKZA 1TU8A 3FYGA 4NMUA 2LSTA 5A4UA 4EC0A 2VD1A 4GSTA 2ZCTA 4YAVA 5ABRA 3DD3A 4TKYA 2A2PA 1VF1A 3KGKA 2XPDA 2LJAA 4V2MA 1IYHA 2I81A 2CZ2A 3FR6A 2VCTA 4Q5NA 1ZYQB 1AIUA 5IIZA 3L4NA 1XIYA 3GKNA 3ZTLA 2LRNA 4ZILA 2DJKA 1Z7PA 1EZKA 3LGCA 3TKPA 3ZVJD 6GSTA 2H30A 1EP8A 3LJRA 3HVXA 3ZMKA 5CRHA 2FUG2 1ERTA 1JZOA 4EO3A 3TB2A 3E3EA 2N5FA 1TI1A 3QFAC 5B7CA 3S9FA 4K5RA 2NDOA 1GP1A 2H0GA 1YEPA 4MCUA 4ILFA 2A4HA 1E2YA 2NVLA 1VRSD 4AJ8A 17GSA 5AGYA 2IFQB 1Z3EA 2LJKA 2GVPA 4NV5A 4N30A 5EL8A 4OFMA 3ERGA 4ICYA 2FWGA 4N0VA 5JWQB 5IO2A 4TR3A 1U87A 1TKDB 1JLVA 2H19A 3VWUA 2FNOA 4V2NA 4BVYA 2JSYA 2B1KA 3RHBA 2R6KA 4EL1A 1VF2A 13GSA 1PRXA 3SWLA 3LWAA 3LFLA 1Q98A 2HRFA 4KW6A 2H72A 1Y25A 5HR3A 2B5YA 1V2AA 4OO4A 3UBLA 3HKRA 1KBNA 2B1LA 2PVQA 3QAGA 3GKXA 4YKGA 1BX9A 3HJPA 5ECSA 3P2AA 2MMOA 6GSUA 2GSRA 1M0UA 3QD9A 2X8GA 4Q5FA 5ECHB 4HEA2 4EVMA 1QMVA 2L59A 22GSA 3GX8A 4MNNA 3MAKA 4FYUA 1OKDA 1QUWA 2RIIA 3D0ZA 1JZWA 3QAVA 4MZCA 1M2AA 3GKKA 1AAZA 1F3AA 4KCEA 3M3MA 4LMWA 5D9XA 4L0WA 5HR2A 3FRCA 3FZAA 3CSIA 5AISA 5GSSA 4D73A 3GURA 4G0IA 2MBSA 1FOVA 1XWAA 3APOA 3TUEA 3BD2A 2GS3A 2QGVA 3IV4A 2IJYA 1GULA 2FA8A 1PSQA 1YDKA 1XFLA 1ABAA 4DSQA 1CQGA 3LYPA 1AQVA 5H5QA 2P5RA 3TKSA 3CXGA 1Z9HA 3UBKA 3RHCA 1GSSA 4OCFA 2IMFA 5KN3A 3MIXA 3GL3A 5LD0A 4GCIA 1Z6NA 5ELAA 1V40A 1X9MB 2E7PA 4V1Ap 1K3OA 4PUAA 2HZFA 3KCMA 5HFKA 3G7IA 2R3XA 1USBA 3I6AA 4MH2A 4HU7A 2HRKA 5F8BA 3TRQA 1FO5A 2PUKC 3C71A 1G7EA 5HFIA 3GSTA 3RPPA 3O76A 2F8AA 1XOBA 4MZBA 1W4VA 3ME7A 4ZBBA 2VCQA 4ZIJA 3MSZA 2R2JA 4BWSA 3IBHA 1SL0B 1OAZA 1ZGNA 4G9HA 2JZTA 2IMKA 3BOAA 3HVVA 3HZ8A 5F0GA 4HS1A 1U3AA 4XTSA 2H6ZA 4OMVA 1JHBA 4BWQA 1RW1A 2XC2A 3ZIVA 2RLIA 1ZYEA 1TXXA 4K2XA 3FMWA 4MPFA 2MMAA 4WF5A 4MJEA 1PQNA 2VCXA 1AQXA 1NHYA 3NOFA 2QA1A 1TW9A 4E8EA 3KTBA 1YQ1A 1XXUA 4Z2RA 2UZ8A 5KOXA 3A5IA 4HQZA 4POBA 2E2MA 5A5KA 3IHQA 1K3LA 4TR1A 1DE2A 1DSBA 2TRXA 3H8QA 1J08A 5ID2A 4KCAA 2HZEA 3FZ5A 4OCEA 7GSSA 2VLUA 1O81A 2H0HA 2HE3A 1JZRA 1M9AA 4K5SA 2BTOT 1TRSA 1SYXA 5CYYA 3UJ1A 4K8MA 4EDZA 3L0HA 5L71A 2OBIA 1SJ6A 4DSSB 5J5NA 4AJ7A 4F82A 3F6FA 2AUVA 1DE1A 3P8WA 2B5EA 4IS0A 2OA7A 3LQ7A 4AF2A 4HJ2A 1WP0A 3VI7A 1C72A 4K1FA 4BL7B 4EE0A 2PMTA 2E0QA 5HFGA 4IGJA 1WWJA 4F0CA 1GSQA 3LW9A 3RPNA 3VI5A 1YF0A 3HVSA 3A2WA 3AY8A 5G31A 3GH6A 1G7OA 3G9BA 3ZMLA 2I9HA 2CV4A 4G19A 1AXDA 1SKRB 2H71A 2VUPA 1J9BA 4K6XA 5DCGA 5IMZA 4JR4A 2TIRA 4N11A 3FZ9A 3HY2A 2IWTA 4MP4A 1YKCA 2P31A 3IAM2 3VURA 4ML6A 4KB3A 3IR4A 1I9DA 3F3RA 3G7JA 4NAXA 1OC9A 2KOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6X A;  4ULX A;  4OFT A;  5GAP D;  1FAA A;  1YKA A;  2NPB A;  1THX A;  2WRT A;  3EU3 A;  3L9V A;  2VIM A;  2K18 A;  4GRF A;  4CW9 A;  4DVC A;  1OC8 A;  5GST A;  1XW5 A;  4GTU A;  5KEJ A;  1XOA A;  3DWV A;  3KP8 A;  2VL2 A;  2HI7 A;  1Q4J A;  5KN0 A;  1F2E A;  2P0G A;  1DBY A;  2VCW A;  5ECI B;  1PA3 A;  6GSX A;  3TGZ A;  3LXZ A;  2LEG A;  1XVW A;  4G2E A;  3BJ5 A;  2D2Z A;  3F8U A;  5F07 A;  3ZZX A;  5D9V A;  3R2Q A;  2GT5 A;  1KEB A;  5G30 A;  1F6M C;  2CVK A;  4WF4 A;  2GSQ A;  1XCC A;  3DVW A;  4ISD A;  4JED A;  3K8N A;  2H73 A;  1TK5 B;  4ECB A;  1ZOF A;  3DKS A;  4JU5 A;  2P5Q A;  4L8E A;  4WBJ A;  3P7X A;  2YV7 A;  9GSS A;  3DVX A;  5D9T A;  12GS A;  4Z7X A;  1EV9 A;  4KE3 A;  4PNF A;  1SD9 A;  1V98 A;  1K0A A;  3EE2 A;  5JCU A;  5DJL A;  4HZ4 A;  3HYP A;  4LL4 B;  1EEJ A;  3TJB A;  3VLN A;  4K9Z A;  1RQM A;  3IXR A;  2DJ1 A;  4WR4 A;  1T4Z A;  4KDU A;  1EGO A;  2YN1 A;  5ECL B;  3TKS C;  4LMV A;  3UVH A;  1XWB A;  2X8C A;  3UOM A;  4AGS A;  3TOT A;  4WBR D;  3RDW A;  1TRV A;  2CZ3 A;  2TRC P;  2JSZ A;  3QOU A;  1DUG A;  1UC7 A;  4TXO B;  4RUV A;  4DSR A;  5CRD A;  5KN2 A;  3LOR A;  3HHV A;  3EMP A;  2IL3 A;  5D96 A;  4OWY A;  5ELG A;  1SKS B;  4POK A;  3C1R A;  2H75 A;  2BMX A;  4HZ2 A;  1G6Y A;  1WPI A;  2KP2 A;  1T00 A;  1JFU A;  3C7M A;  2RUF A;  1ERU A;  1EGR A;  2OE1 A;  2LRC A;  1PMT A;  2DJ0 A;  4XS4 A;  4GQC A;  2O87 A;  2GZP A;  4MF7 A;  1MTC A;  4NPB A;  2JZS A;  4ID0 A;  5E59 A;  4OO5 A;  5AIX A;  1M7T A;  3GFK A;  1UA5 A;  1MEK A;  1HNA A;  1M99 A;  4J56 E;  3IK7 A;  1OYJ A;  4MMM A;  2C3Q A;  1M2D A;  1UN2 A;  2DIY A;  5IM9 A;  4F2I A;  2O85 A;  3ERW A;  4KA0 A;  2GST A;  1GUK A;  1NM3 A;  3KH9 A;  1TOF A;  6GSY A;  4IBP A;  1W89 A;  4ACS A;  6GSS A;  5HQP A;  2K8S A;  1PKZ A;  1THO A;  2F9S A;  2O7K A;  4IP1 A;  2FGX A;  3Q18 A;  2M72 A;  3Q19 A;  2WUL A;  5J4U A;  3IE3 A;  4FIW A;  1R5A A;  2IIY A;  4N0Z A;  2V41 A;  4ZBA A;  1PX6 A;  2XPE A;  2V6O A;  1SYR A;  2YJ7 A;  2PBJ A;  2R5G A;  4YAP A;  3GUS A;  4OD7 A;  2H1B A;  1WIK A;  3D5J A;  4IJI A;  3CSJ A;  4IEL A;  2WCI A;  2PU9 C;  2WFC A;  2V32 A;  3TJG A;  4RI6 A;  5J41 A;  2JZR A;  3GL5 A;  1GL8 A;  3CYN A;  2V1M A;  2AV4 A;  1TP9 A;  3CTF A;  1BQ7 A;  1Z5Y E;  2H66 A;  1AQW A;  3U6V A;  3M9K A;  3WGE A;  4X43 A;  1GLQ A;  4WKW A;  4IW9 A;  3KMO A;  3N5O A;  2B7K A;  14GS A;  1OC3 A;  3DYR A;  3ZRE A;  4TR0 A;  3J7Y b;  2QKE A;  3PH9 A;  1BJX A;  1EOH A;  2AAW A;  1SJI A;  5J9C A;  4TR4 A;  2ES7 A;  2DC5 A;  4L0U A;  1N2A A;  1HQO A;  3ZFL A;  1A2L A;  1B9X C;  1T8E B;  1OVN A;  4FH8 A;  5ECP B;  4WXT A;  4PQI A;  2PPT A;  3EYT A;  3KZQ A;  2LTK A;  1SJZ A;  2OBK A;  5FHI A;  3I43 A;  4O92 A;  3O3T A;  1AW9 A;  1HNC A;  3KXO A;  2H76 A;  3QMX A;  5G1L A;  1Z6M A;  5A4V A;  1J0F A;  1IYI A;  2VL2 C;  4HDE A;  3IRA A;  1SK0 A;  2VCZ A;  4HUA A;  4HU9 A;  2C8U A;  4K0G A;  3DIE A;  1B4P A;  4WEY A;  3VFI A;  3ED3 A;  5C04 A;  2CX4 A;  3KP9 A;  10GS A;  2DBC A;  1ACV A;  2HLS A;  4O32 A;  4ZB9 A;  1H75 A;  3MWH A;  4I2T A;  1FVK A;  3D4M A;  3L9S A;  1YJ6 A;  5ECQ B;  1HNB A;  1VF4 A;  1OE7 A;  4V1A g;  1ZZY A;  4OFN A;  1SU9 A;  5CO3 A;  4MPG A;  4XS6 A;  5DCH A;  4I5Q A;  2J23 A;  1XWK A;  3L78 A;  5G1K A;  1VGL A;  2YV9 A;  3GV1 A;  4KGI A;  3C8E A;  4MJC A;  1JZD A;  5GZZ B;  1U88 A;  2LV3 A;  2VO4 A;  4MZW A;  3HJM A;  3H79 A;  2ON7 A;  4JRR A;  2X99 A;  3HCZ A;  5CRE A;  4EUY A;  4J57 E;  3RBT A;  3HZ4 A;  3GNJ A;  2G2Q A;  2YAN A;  4ZB8 A;  2LNT A;  2B3S A;  3GX0 A;  3UAP A;  1O7U A;  2PN8 A;  1GSY A;  2EC4 A;  2F51 A;  2DSA A;  2M46 A;  5DAL A;  2VAF A;  4RI7 A;  4GLT A;  4X1U A;  3ZRD A;  1R7H A;  1FW1 A;  4QL7 A;  2GQM A;  4FYC A;  4MDC A;  4O5R A;  2GT6 A;  4XRD A;  3WT2 A;  5LCZ A;  1GRX A;  2JL4 A;  3DEX A;  3IK9 A;  4PUR A;  1S3D A;  3ZIJ A;  2DMM A;  4K2D A;  3ZYW A;  4ML1 A;  2VM2 A;  4D73 B;  2C3N A;  4CDO A;  2K9F A;  5D73 A;  3EMX A;  2MMZ A;  3TKR A;  1BAY A;  3VWW A;  2GGT A;  1K0B A;  3MDK A;  2BJX A;  4ECJ A;  3UEM A;  5EPF A;  3MNG A;  1S3C A;  5IMV A;  2DIZ A;  2VCV A;  2C1Y A;  3TJK A;  1A8Y A;  3DRN A;  5D93 A;  5IPG A;  4FYB A;  3H93 A;  3DML A;  1FB0 A;  2FCH A;  3VWX A;  3EVI A;  1NHO A;  1XWC A;  2VL3 A;  3BBY A;  2V6K A;  3FR9 A;  3DXB A;  5IMF A;  3KEB A;  4IJ3 A;  4J2F A;  4AJ6 A;  2M80 A;  19GS A;  1O8X A;  4PQH A;  4BVX A;  2WS2 A;  2K8V A;  5KN1 A;  3IAS 2;  3LEF A;  2LNS A;  2C80 A;  3TJJ A;  1XWG A;  1TRW A;  2FA4 A;  1EWX A;  2VLT A;  4QQ7 A;  2GQK A;  2H01 A;  2RUE A;  3TKQ A;  2HSY A;  1PD2 1;  2O89 A;  1XZO A;  1X5D A;  5D9W A;  2CVD A;  3D21 A;  1XW6 A;  2IN3 A;  4L5L A;  2VLV A;  3GH9 A;  1G0T A;  1YZX A;  2GZY A;  5B8A A;  2CVB A;  1HD2 A;  4KAE A;  5CP1 A;  4MK3 A;  2L5O A;  3KJY A;  2AJQ B;  2HXK A;  2ZNM A;  2JAC A;  2HRN A;  3WT1 A;  2IY2 A;  2C0G A;  2WZ9 A;  1MDJ A;  2MBT A;  1PGT A;  4PQ1 A;  3W8S A;  3H1N A;  4E8H A;  5DQY A;  3US3 A;  4IN0 A;  2IPA A;  3FK8 A;  3KH7 A;  4TW5 A;  2H1D A;  4GF0 A;  2AB6 A;  4KH7 A;  3QAW A;  4TR1 B;  1Y6E A;  2A2R A;  1SKW B;  3TOU A;  5ID2 B;  5D8I A;  3G7Y A;  1QQ2 A;  3WYW A;  2HZE B;  4GQF A;  3BCK A;  3NZN A;  4N10 A;  2HFD A;  6GSV A;  1R26 A;  1B9Y C;  1SL1 B;  1B4Q A;  4IP6 A;  1H4O A;  3E0U A;  2Z9S A;  2DJ3 A;  1K0D A;  5DDL A;  3ZIT A;  3N9J A;  4Q5Q A;  1F3B A;  5AN1 A;  5IPH A;  2YOI A;  5GAN D;  3EU4 A;  2N5A A;  2F3M A;  1E6B A;  4XS1 A;  1T7P B;  2KP1 A;  5DAK A;  1SL2 B;  2JU5 A;  2L4C A;  1GTA A;  2LS5 A;  2K6V A;  2ON5 A;  2FHE A;  3ZL5 A;  1T1V A;  5FT3 A;  3ZLP A;  2IMI A;  2MMN A;  1A8L A;  5ECM B;  1AUC A;  1QFN A;  3APS A;  4KDX A;  2IMD A;  2IFQ A;  5ENU A;  1ST9 A;  2KHP A;  3FW2 A;  3KIJ A;  2H0I A;  4HQS A;  1MDI A;  2FWE A;  2LRT A;  1WE0 A;  1AC1 A;  4RQX A;  1V9W A;  4TVE A;  1A2J A;  2B5X A;  1SD8 A;  3BCI A;  3CSH A;  4PGT A;  3J7Y k;  2LKU A;  2YCD A;  3PR8 A;  16GS A;  1OC9 B;  2DLX A;  3GKM A;  4G10 A;  3VPT A;  2WB9 A;  4K7I A;  4KDY A;  1XW9 A;  1MD3 A;  2YZU A;  4HJM A;  2LQQ A;  2WGR A;  1N8J A;  1X0R A;  3TKS E;  1UVZ A;  5CRW A;  3APQ A;  4NHZ A;  5HR1 A;  2L6D A;  5COH A;  1GTB A;  4MLY A;  4IHU A;  3KTL A;  5IMD A;  1YF1 A;  2IME A;  4GSS A;  3F4T A;  4TOP A;  1R5P A;  1T4Y A;  2H6X A;  5CRG A;  2YNX A;  1VF3 A;  4RQR A;  1XPV A;  2C0D A;  2FLS A;  1B8X A;  2WJU A;  2HSH A;  3KM6 A;  3V1W A;  1FHE A;  2CA8 A;  3EUR A;  3A3T A;  2OKA A;  3QDN A;  3UIW A;  4JE1 A;  4I97 A;  5HR0 A;  4EXJ A;  1NW2 A;  3LSZ A;  1F9M A;  3F4R A;  4K7N A;  5IOX A;  5IMA A;  4GXZ A;  2RM5 A;  2GLR A;  2DML A;  2YZH A;  4NHW A;  4WET A;  2REM A;  2DJJ A;  1SEN A;  1TTZ A;  2I1U A;  5DAK B;  3I9V 2;  3E9J B;  8GSS A;  2PER A;  1O6J A;  4F9Z A;  1K0O A;  3ME8 A;  2A4V A;  4QL9 A;  3FKF A;  3F9U A;  4PNG A;  2PWJ A;  5G2Z A;  5JCW A;  5H5R A;  1LJR A;  5J3R A;  2YWM A;  1M9B A;  1TK8 B;  3GYK A;  3RAZ A;  5IOW A;  1PL1 A;  4EF0 A;  2L57 A;  1OE8 A;  2A2S A;  3A5W A;  1BG5 A;  5LNK e;  3WGD A;  1O8W A;  3GRX A;  4Q5R A;  4NV2 A;  4XRA A;  4ZL7 A;  1ERW A;  2VL9 A;  3ISO A;  3EWL A;  2L4Q A;  1GLP A;  5B6N A;  2NTO A;  3TRP A;  3HA9 A;  1LBK A;  4TRX A;  4ZBD A;  2VD0 A;  4NWY A;  1I5G A;  1MD4 A;  4F0B A;  3VK9 A;  1ILO A;  1PX7 A;  2GSS A;  11GS A;  1GSE A;  2H74 A;  2XBQ A;  3F4S A;  1V57 A;  4EDY A;  5A4W A;  4I8B A;  2ALB A;  5CNW A;  2AYT A;  2R37 A;  4XS4 B;  3GTU A;  2AHE A;  2X8H A;  3Q74 A;  1ON4 A;  1HYU A;  4K7O A;  2HNL A;  2B6M A;  2R4V A;  2MZC A;  3HJO A;  3QCP A;  2EIQ A;  5DBQ A;  1XVQ A;  3C73 A;  3M9J A;  1FG4 A;  1GH2 A;  4YQU A;  4GWR A;  1MDK A;  2C4J A;  3GHA A;  1X9W B;  1ZCP A;  3F3Q A;  3W8J A;  2HT9 A;  2KUC A;  3HDC A;  2QSI A;  2V2G A;  4BA7 A;  2YP6 A;  2YJH A;  5JCG A;  3LXT A;  4KX4 A;  5DVB A;  4JZQ A;  5IMC A;  1EP7 A;  2QC7 A;  1A0F A;  3FEU A;  3QFB C;  4DSS A;  2KLX A;  4TXV A;  1EOG A;  3D4T A;  18GS A;  3IC4 A;  2CX3 A;  5ECO B;  3GSS A;  2CAI A;  3D6I A;  4BL7 A;  4ECC A;  1KTE A;  3TJF A;  3CRU A;  1GUM A;  3F63 A;  5ECR B;  4MA9 A;  1KNG A;  5E4W A;  1R4W A;  3FZ4 A;  1GSD A;  1YEX A;  3ERF A;  2VM1 A;  1K0N A;  3OR5 A;  4XCS A;  4MH3 A;  2C0E A;  3PIN A;  3JCM L;  1OKT A;  3C1S A;  1TDI A;  3W6G A;  1GNE A;  4IKH A;  5JWO B;  4PXO A;  4MAB A;  4CHS A;  4LLR A;  1V58 A;  2I4A A;  1X5C A;  4V2L A;  2C0F A;  5B6M A;  2FD3 A;  4TN8 A;  5DJM A;  3IDV A;  2LJR A;  3WD6 A;  2YPM A;  1QK8 A;  3WGX A;  2OJL A;  2NBS A;  1ZMA A;  1A2M A;  1Z7R A;  3GTU B;  2RM6 A;  2I3Y A;  3SBC A;  1SK1 A;  1PN9 A;  4MJB A;  1WOU A;  4IVF A;  3NIV A;  2LQO A;  5IQY A;  2WDU A;  3F6D A;  2OE0 A;  1A0R P;  3F0I A;  3IA1 A;  4JR6 A;  5EVO A;  1WJK A;  3Q6O A;  1ZL9 A;  1WRY A;  5ECK B;  4YQV A;  3UL3 A;  4IQ1 A;  2PGT A;  3UAR A;  1GTU A;  2H70 A;  4X0X A;  3GN3 A;  2OAC A;  6GSW A;  3QR6 A;  3H4K A;  2CT6 A;  1QXH A;  1K0C A;  1O73 A;  3TDG A;  2H6Y A;  4ZB6 A;  2J9H A;  5ECN B;  2OAD A;  3EC3 A;  2H1G A;  3UMA A;  20GS A;  5INY A;  2FWH A;  3CBU A;  3HXS A;  1EV4 A;  1K0M A;  1PKW A;  2GQL A;  1GUH A;  4ECI A;  1QGV A;  5B8B A;  3CMI A;  3GMF A;  3GA4 A;  3I69 A;  3TRX A;  4MJA A;  4I2U A;  1K3Y A;  1O85 A;  3A2V A;  4IQA A;  4GSN A;  3O6T A;  3U5R E;  1XBS A;  3ZFB A;  4ZXG A;  1B48 A;  2DJ2 A;  1EEM A;  2C3T A;  3LYK A;  1A23 A;  1LU4 A;  1T3B A;  3M1G A;  5F05 A;  2LUS A;  4POL A;  3EIN A;  4KUN A;  4TXO A;  2OE3 A;  5H5S A;  1JLW A;  1GNW A;  4H86 A;  4HOJ A;  3M0F A;  4PUF C;  1M2B A;  2H1A A;  4JBB A;  2GTU A;  1U6T A;  1TRU A;  2YWI A;  2B7J A;  4MF6 A;  3FHK A;  5DAL B;  4BPY A;  2CAQ A;  1ML6 A;  3M8N A;  3VPQ A;  1FB6 A;  1GTI A;  3HD5 A;  3L9U A;  4WR5 A;  1TU7 A;  2XBI A;  5IO0 A;  2H8L A;  2JAD A;  5AIV A;  1NSW A;  1X9S B;  3P90 A;  4ZL9 A;  5JWR B;  4O7H A;  2YWN A;  3IPZ A;  5FWG A;  3CTG A;  5G5E A;  5F06 A;  2MYG A;  3PGT A;  4FO5 A;  1S3A A;  1TJD A;  3D22 A;  4ZL8 A;  1GSF A;  3FR3 A;  4KND A;  4LL1 B;  2PVO C;  4F03 A;  2O8V B;  2ZUP A;  1RK4 A;  1URM A;  4K0N A;  4YH2 A;  3DGQ A;  3IOS A;  3CRT A;  1X5E A;  4KSM A;  4NXI A;  4DEJ A;  4PX1 A;  1GSU A;  3VWV A;  5J9B A;  5CAX A;  5EY6 A;  5G5F A;  3FY7 A;  3KD0 A;  2EIR A;  1TI3 A;  2GDR A;  2HYX A;  4XIH A;  5C00 A;  2G0F A;  2CQ9 A;  2YWO A;  2IYJ A;  2L6C A;  2VOC A;  4LA1 A;  3LG6 A;  1PL2 A;  1CQH A;  1ERV A;  3GIX A;  2X64 A;  3QPM A;  2GZZ A;  4MF5 A;  1GWC A;  3ZVJ A;  4HI7 A;  1A24 A;  1YY7 A;  2FWF A;  2EIO A;  4XHM A;  3A2X A;  1BED A;  1BYE A;  4L5O A;  5DQS A;  1FVJ A;  3TCO A;  4P3Y B;  1G6W A;  2F8F A;  1WMJ A;  1TK0 B;  1F37 A;  2FY6 A;  3UVT A;  4YQM A;  4POM A;  2L5L A;  2E2G A;  1U3I A;  2XHF A;  3KMN A;  2N5B A;  4KSO A;  1SK2 A;  4EKZ A;  1TU8 A;  3FYG A;  4NMU A;  2LST A;  5A4U A;  4EC0 A;  2VD1 A;  4GST A;  2ZCT A;  4YAV A;  5ABR A;  3DD3 A;  4TKY A;  1VF1 A;  3KGK A;  2XPD A;  2LJA A;  4V2M A;  1IYH A;  2I81 A;  2CZ2 A;  3FR6 A;  2VCT A;  4Q5N A;  1ZYQ B;  1AIU A;  5IIZ A;  3L4N A;  1XIY A;  3GKN A;  3ZTL A;  2LRN A;  4ZIL A;  2DJK A;  1Z7P A;  1EZK A;  3LGC A;  3TKP A;  3ZVJ D;  6GST A;  2H30 A;  1EP8 A;  3LJR A;  3HVX A;  3ZMK A;  5CRH A;  2FUG 2;  1ERT A;  1JZO A;  4EO3 A;  3TB2 A;  3E3E A;  2N5F A;  1TI1 A;  3QFA C;  5B7C A;  3S9F A;  2NDO A;  1GP1 A;  2H0G A;  1YEP A;  4MCU A;  4ILF A;  1E2Y A;  2NVL A;  1VRS D;  4AJ8 A;  17GS A;  5AGY A;  2IFQ B;  1Z3E A;  2LJK A;  2GVP A;  4NV5 A;  4N30 A;  5EL8 A;  4OFM A;  3ERG A;  5JWQ B;  2FWG A;  4N0V A;  5IO2 A;  4TR3 A;  1U87 A;  1TKD B;  1JLV A;  2H19 A;  3VWU A;  2FNO A;  4V2N A;  4BVY A;  2JSY A;  2B1K A;  3RHB A;  2R6K A;  4EL1 A;  1VF2 A;  13GS A;  1PRX A;  3SWL A;  3LWA A;  3LFL A;  1Q98 A;  2HRF A;  4KW6 A;  2H72 A;  1Y25 A;  5HR3 A;  2B5Y A;  1V2A A;  4OO4 A;  3UBL A;  3HKR A;  1KBN A;  2B1L A;  2PVQ A;  3QAG A;  3GKX A;  1BX9 A;  3HJP A;  5ECS A;  3P2A A;  2MMO A;  6GSU A;  2GSR A;  1M0U A;  3QD9 A;  2X8G A;  4Q5F A;  5ECH B;  4HEA 2;  4EVM A;  1QMV A;  2L59 A;  22GS A;  3GX8 A;  3MAK A;  4FYU A;  1OKD A;  1QUW A;  2RII A;  3D0Z A;  1JZW A;  3QAV A;  4MZC A;  1M2A A;  3GKK A;  1AAZ A;  1F3A A;  4KCE A;  3M3M A;  4LMW A;  5D9X A;  4L0W A;  5HR2 A;  3FRC A;  3FZA A;  3CSI A;  5AIS A;  5GSS A;  4D73 A;  3GUR A;  2MBS A;  1FOV A;  1XWA A;  3APO A;  3TUE A;  3BD2 A;  2GS3 A;  2QGV A;  3IV4 A;  2IJY A;  1GUL A;  2FA8 A;  1PSQ A;  1YDK A;  1XFL A;  1ABA A;  4DSQ A;  1CQG A;  3LYP A;  1AQV A;  5H5Q A;  2P5R A;  3TKS A;  3CXG A;  1Z9H A;  3UBK A;  3RHC A;  1GSS A;  4OCF A;  2IMF A;  5KN3 A;  3GL3 A;  5LD0 A;  4GCI A;  1Z6N A;  5ELA A;  1V40 A;  1X9M B;  2E7P A;  4V1A p;  1K3O A;  4PUA A;  2HZF A;  3KCM A;  5HFK A;  3G7I A;  2R3X A;  1USB A;  3I6A A;  4MH2 A;  4HU7 A;  1FO5 A;  5F8B A;  3TRQ A;  2PUK C;  3C71 A;  1G7E A;  5HFI A;  3GST A;  3RPP A;  3O76 A;  2F8A A;  1XOB A;  4MZB A;  1W4V A;  3ME7 A;  4ZBB A;  2VCQ A;  4ZIJ A;  3MSZ A;  2R2J A;  4BWS A;  3IBH A;  1SL0 B;  1OAZ A;  1ZGN A;  4G9H A;  2JZT A;  2IMK A;  3BOA A;  3HVV A;  3HZ8 A;  5F0G A;  4HS1 A;  1U3A A;  4XTS A;  2H6Z A;  4OMV A;  1JHB A;  4BWQ A;  1RW1 A;  2XC2 A;  3ZIV A;  2RLI A;  1ZYE A;  1TXX A;  4MPF A;  2MMA A;  4WF5 A;  4MJE A;  1PQN A;  2VCX A;  1AQX A;  1NHY A;  3NOF A;  1TW9 A;  4E8E A;  3KTB A;  1YQ1 A;  1XXU A;  4HQZ A;  4POB A;  2E2M A;  5A5K A;  3IHQ A;  1K3L A;  4TR1 A;  1DE2 A;  1DSB A;  2TRX A;  3H8Q A;  1J08 A;  5ID2 A;  4KCA A;  2HZE A;  3FZ5 A;  4OCE A;  7GSS A;  2VLU A;  1O81 A;  2H0H A;  2HE3 A;  1JZR A;  1M9A A;  2BTO T;  1TRS A;  1SYX A;  5CYY A;  3UJ1 A;  4K8M A;  4EDZ A;  3L0H A;  5L71 A;  2OBI A;  1SJ6 A;  4DSS B;  5J5N A;  4AJ7 A;  4F82 A;  3F6F A;  2AUV A;  1DE1 A;  3P8W A;  2B5E A;  4IS0 A;  2OA7 A;  3LQ7 A;  4AF2 A;  4HJ2 A;  1WP0 A;  3VI7 A;  1C72 A;  4K1F A;  4EE0 A;  2PMT A;  2E0Q A;  5HFG A;  4IGJ A;  1WWJ A;  4F0C A;  1GSQ A;  3RPN A;  3VI5 A;  1YF0 A;  3HVS A;  3A2W A;  3AY8 A;  5G31 A;  3GH6 A;  1G7O A;  3G9B A;  3ZML A;  2I9H A;  2CV4 A;  4G19 A;  1AXD A;  1SKR B;  2H71 A;  2VUP A;  1J9B A;  4K6X A;  5DCG A;  5IMZ A;  4JR4 A;  2TIR A;  4N11 A;  3FZ9 A;  3HY2 A;  2IWT A;  4MP4 A;  1YKC A;  2P31 A;  3IAM 2;  3VUR A;  4ML6 A;  4KB3 A;  3IR4 A;  1I9D A;  3F3R A;  3G7J A;  4NAX A;  1OC9 A;  2KOK A; 
#chains in the Genus database with same CATH topology
 5JPP A;  4I6X A;  1BIR A;  1YIT 3;  4RBN A;  4ULX A;  3CU3 A;  2CH9 A;  4OFT A;  1BGS A;  5GAP D;  1FAA A;  1YKA A;  2NPB A;  1THX A;  2WRT A;  1IQY A;  3EU3 A;  1E3R A;  3L9V A;  1RGE A;  1TUH A;  5KP3 A;  1FUW A;  2K18 A;  2VIM A;  4GRF A;  2MC8 A;  3H3H A;  4HZ9 B;  4CW9 A;  4QWT A;  3CNM A;  1DE3 A;  4DVC A;  1OC8 A;  5GST A;  3CME 3;  1XW5 A;  4GTU A;  5KEJ A;  1XOA A;  3DWV A;  3KP8 A;  2VL2 A;  2HI7 A;  1Q4J A;  5KN0 A;  1F2E A;  2P0G A;  1DBY A;  1AQZ A;  2VCW A;  5ECI B;  1PA3 A;  1LVN A;  2O3O A;  4G0L A;  3TGZ A;  6GSX A;  3LXZ A;  2LEG A;  1XVW A;  1AR0 A;  2PZV A;  4G2E A;  3BJ5 A;  2D2Z A;  3V92 A;  2KF3 A;  3F8U A;  4EYC A;  5F07 A;  1Z1S A;  3X41 A;  3ZZX A;  5D9V A;  3K63 A;  1GMP A;  4HM4 B;  3R2Q A;  3SX1 A;  2GT5 A;  1OF5 B;  1KEB A;  1M3J A;  5G30 A;  1F6M C;  2CVK A;  4WF4 A;  5BRT A;  1RSN A;  1UCL A;  2GSQ A;  2UX0 A;  1XCC A;  3DVW A;  4ISD A;  4JED A;  3FCS B;  3K8N A;  2H73 A;  1MNL A;  1TK5 B;  4ECB A;  5DRE A;  1ZOF A;  3DKS A;  4JU5 A;  2P5Q A;  4R9K A;  4L8E A;  4WBJ A;  3P7X A;  2YV7 A;  2P09 A;  9GSS A;  3DVX A;  5D9T A;  4WFO A;  1G96 A;  12GS A;  4Z7X A;  1EV9 A;  4KE3 A;  1NNV A;  3IJE B;  3CCS 3;  3FF2 A;  5LC6 A;  4PNF A;  1SD9 A;  1V98 A;  2BHM A;  1K0A A;  3EE2 A;  3KII A;  5JCU A;  4XBY A;  5DJL A;  4HZ4 A;  3HYP A;  1SAR A;  4LL4 B;  1W02 A;  2KF6 A;  1EEJ A;  3TJB A;  3VLN A;  1LNH A;  4K9Z A;  1DVC A;  1SQW A;  3AMO B;  3T8U A;  1RQM A;  3BNB A;  3IXR A;  2DJ1 A;  4WR4 A;  2GU3 A;  1T4Z A;  4KDU A;  1EGO A;  2YN1 A;  5ECL B;  4HM1 B;  3TKS C;  4LMV A;  3UVH A;  1XWB A;  2X8C A;  3UOM A;  4AGS A;  4OVM A;  3TOT A;  2LQV A;  4HM8 B;  4WBR D;  3RDW A;  1I8V A;  1RMS A;  1M3I A;  1TRV A;  2CZ3 A;  2TRC P;  2JSZ A;  3QOU A;  1LOX A;  1DUG A;  2B1X B;  1UC7 A;  2CFK A;  4TXO B;  2XGN A;  4RUV A;  4DSR A;  5CRD A;  2HMN B;  4RZM A;  5KN2 A;  3LOR A;  3HHV A;  1KWI A;  3S67 A;  4J9A A;  2IL3 A;  3EMP A;  5D96 A;  4OWY A;  5ELG A;  1SKS B;  1DYU A;  4POK A;  2P38 A;  3C1R A;  2DKI A;  1OGZ A;  2H75 A;  1BSE A;  1IVW A;  2BMX A;  1LQM B;  1G6Y A;  4HZ2 A;  1WPI A;  2KP2 A;  1T00 A;  1JFU A;  5DRV A;  3C7M A;  2RUF A;  3NXJ A;  1ERU A;  1EGR A;  2OE1 A;  4FMB A;  3VGN A;  2LRC A;  3EPT A;  3S27 A;  1PMT A;  2DJ0 A;  4XS4 A;  2J8X B;  1ULI B;  4GQC A;  3E99 A;  2HOH A;  2O87 A;  2GZP A;  4MF7 A;  1MTC A;  4USS A;  4NPB A;  2JZS A;  4ID0 A;  5E59 A;  4OO5 A;  1EQK A;  5CK6 A;  4X4J A;  5AIX A;  1M7T A;  3GFK A;  4HM2 B;  1UA5 A;  1MEK A;  1ISK A;  1HNA A;  1M99 A;  4XM4 A;  4J56 E;  3IK7 A;  1OYJ A;  4MMM A;  2C3Q A;  3URP A;  1M2D A;  1UN2 A;  2DIY A;  5IM9 A;  2RNT A;  3ZG0 A;  4F2I A;  2O85 A;  1I3I A;  1UCI A;  3ERW A;  5AIF A;  4KA0 A;  4KT3 B;  2GST A;  1YGW A;  1AY7 A;  1GUK A;  1NM3 A;  3NUV A;  1HYF A;  3MSO A;  1TOF A;  3KH9 A;  6GSY A;  4IBP A;  1TFO A;  1B21 A;  1W89 A;  3F7X A;  2BMQ B;  4ACS A;  2HMK B;  1BRK A;  6GSS A;  5HQP A;  1VQ8 3;  2K8S A;  5M18 A;  1PKZ A;  2JQ5 A;  1UDI I;  1THO A;  2F9S A;  2O7K A;  4IP1 A;  2FGT A;  2FGX A;  3Q18 A;  3BNC A;  2M72 A;  3Q19 A;  2WUL A;  4O5Q A;  4IPB A;  5J4U A;  3IE3 A;  4FIW A;  4O3V A;  1GOU A;  1R5A A;  2X4A A;  1BAO A;  4BL3 A;  2IIY A;  4N0Z A;  2V41 A;  1A2P A;  1SIH A;  4ZBA A;  1PX6 A;  2XPE A;  2V6O A;  2C10 A;  1SYR A;  1A2V A;  2YJ7 A;  2WOF A;  2PBJ A;  2R5G A;  1W4N A;  1MWU A;  4YAP A;  3GUS A;  4OD7 A;  2H1B A;  1WIK A;  1FUT A;  2STD A;  1BNG A;  3D5J A;  4IJI A;  3CSJ A;  1CEW I;  4IEL A;  2XSO B;  2WCI A;  1QJG A;  1STD A;  2PU9 C;  2WFC A;  2V32 A;  3TJG A;  4RI6 A;  5J41 A;  3BIR A;  2JZR A;  3GL5 A;  1GL8 A;  1X1W A;  3CYN A;  1GS3 A;  2V1M A;  2AV4 A;  1IT7 A;  3HIG A;  1JBT A;  1TP9 A;  3CTF A;  1BQ7 A;  3GZB A;  1Z5Y E;  1N9J A;  1K9M 4;  1VQQ A;  1WTH A;  2H66 A;  1AQW A;  2CG0 A;  3U6V A;  3DZL A;  3M9K A;  5HOH A;  3WGE A;  4X43 A;  3ER7 A;  1GLQ A;  4WKW A;  4IW9 A;  3KMO A;  4HSC X;  1RN4 A;  3N5O A;  1CH0 A;  2B7K A;  14GS A;  1OC3 A;  3DYR A;  3BND A;  3ZRE A;  3CC7 3;  4TR0 A;  3J7Y b;  2QKE A;  3PH9 A;  1BJX A;  1YHQ 3;  1EOH A;  2AAW A;  4HKV B;  1SJI A;  4FMD A;  4TR4 A;  5J9C A;  3STD A;  2XEP A;  2ES7 A;  2XF3 A;  2DC5 A;  4L0U A;  1N2A A;  1WQL B;  3PYJ A;  1HQO A;  1GD3 A;  1A2L A;  3ZFL A;  1B9X C;  1T8E B;  3CCL 3;  1OVN A;  4FH8 A;  3FKA A;  5ECP B;  4WXT A;  4PQI A;  2PPT A;  1NO3 A;  2XRX B;  3EYT A;  3KCH A;  3N54 B;  3KZQ A;  3K7C A;  1SJZ A;  2LTK A;  2F98 A;  2OBK A;  5FHI A;  4EIP A;  3I43 A;  4O92 A;  1IVV A;  1RGG A;  3O3T A;  1AW9 A;  1HNC A;  3OXA A;  3KXO A;  1EG9 B;  4MMY B;  3CCJ 3;  2H76 A;  2CFD A;  3QMX A;  5G1L A;  4BIR A;  1Z6M A;  2CKF B;  5A4V A;  1J0F A;  3DGO A;  3NX0 A;  1U5O A;  1IYI A;  2VL2 C;  3NQY A;  5D83 A;  1UUG B;  4HDE A;  3IRA A;  1SK0 A;  1MGR A;  1BVI A;  2VCZ A;  4HUA A;  4EC6 A;  2OTJ 3;  5M19 A;  4HU9 A;  2C8U A;  1OUN A;  5AYS C;  3OX9 A;  2BU4 A;  2CFG A;  4K0G A;  2Z7A A;  3DIE A;  5KOW A;  3FF0 A;  1B4P A;  1BNE A;  2D1W A;  4WEY A;  3VFI A;  3ED3 A;  2MF7 A;  2CX4 A;  5C04 A;  4FCZ A;  3KP9 A;  1D6Y A;  5AIH A;  1ASK A;  1W01 A;  10GS A;  2DBC A;  1ACV A;  2HLS A;  4O32 A;  1DVD A;  4ZB9 A;  1PYL A;  3EC9 A;  1H75 A;  3MWH A;  4I2T A;  1FVK A;  3D4M A;  4KZ1 A;  3L9S A;  1TFK A;  4J5K A;  1YJ6 A;  5ECQ B;  4G0K A;  1MOL A;  1HNB A;  1VF4 A;  1OE7 A;  4V1A g;  1ZZY A;  4OFN A;  1SU9 A;  1OHP A;  5CO3 A;  1BAN A;  4MPG A;  4XS6 A;  3HI7 A;  2R0C A;  1B2M A;  4I5Q A;  5DCH A;  2J23 A;  1W7C A;  3KE7 A;  4BVY B;  2F86 B;  4KF9 A;  1XWK A;  1W6C A;  2ML6 A;  3L78 A;  4K90 B;  5G1K A;  1VGL A;  2YV9 A;  3GV1 A;  1IYY A;  3C8E A;  4KGI A;  4MJC A;  1JZD A;  1BNI A;  5GZZ B;  2WGO A;  4L8O A;  5I97 A;  1U88 A;  2LV3 A;  2VO4 A;  2X49 A;  4MZW A;  3HJM A;  3H79 A;  2ON7 A;  4JRR A;  2X99 A;  1U8C B;  1RGH A;  3HCZ A;  4K1V A;  3BU4 A;  4H3U A;  2CFL A;  1K73 4;  5CRE A;  4EUY A;  4J57 E;  3RBT A;  2KAA A;  3HZ4 A;  3GNJ A;  2G2Q A;  1FUS A;  2YAN A;  1JN5 B;  4WP5 A;  1VQO 3;  3CNX A;  4ZB8 A;  4NHF A;  2B3S A;  2LNT A;  3GX0 A;  3UAP A;  4EIQ A;  4ORL A;  1ZYN A;  3GAX A;  1UUV B;  1O7U A;  3MKI A;  1GSY A;  2PN8 A;  3KSE D;  2EC4 A;  3PXM A;  2F51 A;  2DSA A;  3J7Y d;  5AEU B;  2M46 A;  5DAL A;  2VAF A;  4RI7 A;  4GLT A;  4X1U A;  3ZRD A;  1Q40 A;  1R7H A;  1FW1 A;  1Q42 A;  3LML A;  4QL7 A;  2GQM A;  4FYC A;  1NU3 A;  4MDC A;  4O5R A;  2GT6 A;  2KF4 A;  4XRD A;  5EEO A;  3WT2 A;  2JL4 A;  2W9P A;  5LCZ A;  1GRX A;  1RRL A;  3DEX A;  3IK9 A;  3MYD A;  4PUR A;  1IVX A;  1S3D A;  3ZIJ A;  2DMM A;  4K2D A;  3ZYW A;  4ML1 A;  2VM2 A;  1B2X A;  4D73 B;  2C3N A;  4CDO A;  4WYK A;  2K9F A;  5D73 A;  3EMX A;  2MMZ A;  3TKR A;  1BAY A;  4PTS A;  3GZR A;  1RGK A;  1HU9 A;  3VWW A;  2GGT A;  1K0B A;  3MDK A;  4HAA A;  2BJX A;  4ECJ A;  3UEM A;  5EPF A;  3MNG A;  5AII A;  1FA3 A;  1S3C A;  5IMV A;  2DIZ A;  1UCK A;  4LMI A;  2ZDJ A;  2VCV A;  2C1Y A;  1RGL A;  5CXO A;  1A8Y A;  3TJK A;  1BSC A;  1T5Y A;  3DRN A;  5D93 A;  5IPG A;  3HX8 A;  4FYB A;  2CWV A;  3H93 A;  2BNG A;  3DMC A;  3DML A;  3LH4 A;  2SAR A;  3MYT A;  1FB0 A;  2FCH A;  5BXQ A;  3G16 A;  1D6U A;  3G0K A;  3VWX A;  2GXF A;  3EVI A;  4R80 A;  1VQP 3;  1NHO A;  1XWC A;  2VL3 A;  3BBY A;  2O9U X;  2V6K A;  1PFP A;  1UGI A;  3FR9 A;  3EQQ B;  1TIJ A;  3DXB A;  5IMF A;  3KEB A;  1RGF A;  4IJ3 A;  4XB5 A;  4J2F A;  1RCL A;  4AJ6 A;  2M80 A;  19GS A;  1O8X A;  4PQH A;  4BVX A;  3S28 A;  1DMM A;  3KZT A;  2K8V A;  1O7P B;  2R4I A;  2WS2 A;  5KN1 A;  3IAS 2;  3LEF A;  2LNS A;  5IG4 A;  2C80 A;  3TJJ A;  1XWG A;  1BNS A;  4N6U A;  3V99 A;  1TRW A;  2FA4 A;  1EWX A;  2VLT A;  4QQ7 A;  1GSP A;  1I3F A;  2GQK A;  2H01 A;  2RUE A;  3TKQ A;  1YGE A;  2HSY A;  5FW5 A;  1Q7H A;  1PD2 1;  2O89 A;  1XZO A;  1X5D A;  5D9W A;  2CVD A;  2W0Q A;  3D21 A;  1XW6 A;  2R0G A;  3L0R A;  5IW9 A;  3JUM A;  2IN3 A;  2XR8 B;  4L5L A;  2VLV A;  3GH9 A;  3DM8 A;  1G0T A;  1XG8 A;  1YZX A;  2GZY A;  2QEX 3;  5B8A A;  3PCS A;  1S5A A;  1Q82 4;  2CVB A;  5AYR B;  3R3E A;  2INX A;  1HD2 A;  4KAE A;  5CP1 A;  1B27 A;  2YFL B;  4EXR A;  4MK3 A;  2L5O A;  3KJY A;  2AJQ B;  2W6J H;  1VQM 3;  2HXK A;  2W56 A;  2JAC A;  2ZNM A;  2HRN A;  4MMZ B;  2GBX B;  1O7M B;  2ZHX B;  1RCK A;  3WT1 A;  2IY2 A;  2C0G A;  2WZ9 A;  1N9E A;  1MDJ A;  1AV4 A;  2MBT A;  3Q3F A;  2HMM B;  1PGT A;  4PQ1 A;  1VQ5 3;  3W8S A;  3H1N A;  4E8H A;  5DQY A;  3US3 A;  4IN0 A;  2IPA A;  3FK8 A;  1Q81 4;  1IV7 A;  3KH7 A;  4TW5 A;  2H1D A;  2M7O A;  4GF0 A;  1VQN 3;  2AB6 A;  1DET A;  4KH7 A;  2OOV A;  1R4C A;  8RNT A;  2CHC A;  3QAW A;  4TR1 B;  1Y6E A;  1LQG C;  2A2R A;  1SKW B;  3TOU A;  2IUJ A;  3PPU A;  5ID2 B;  5D8I A;  3G7Y A;  1QQ2 A;  4HM5 B;  3WYW A;  2HZE B;  4GQF A;  3BCK A;  3NZN A;  4N10 A;  1L5G B;  2HFD A;  6GSV A;  1R26 A;  1B9Y C;  3SYU A;  3LTB A;  1SL1 B;  1B4Q A;  4IP6 A;  1H4O A;  3E0U A;  2Z9S A;  3BNE A;  4EW5 A;  2DJ3 A;  1K0D A;  5DDL A;  3ZIT A;  3N9J A;  4Q5Q A;  1F3B A;  5AN1 A;  5IPH A;  2YOI A;  5GAN D;  3EU4 A;  1KQS 2;  2N5A A;  2F3M A;  1E6B A;  4XS1 A;  1UUW B;  3WA3 A;  1T7P B;  2KP1 A;  5DAK A;  3G6E 3;  2JU5 A;  1SL2 B;  3IMA B;  2E2T A;  2L4C A;  4AKZ A;  5IF6 A;  1GTA A;  2LS5 A;  2K6V A;  1QMA A;  1OPY A;  3MG2 A;  1W6G A;  2CK3 H;  2ON5 A;  2FHE A;  1T2H A;  3ZL5 A;  1T1V A;  5FT3 A;  3ZLP A;  4A5P A;  1RHL A;  2IMI A;  2MMN A;  1A8L A;  5ECM B;  1AUC A;  1QFN A;  3APS A;  3AHS A;  1X1X A;  4KDX A;  2IMD A;  2IFQ A;  5ENU A;  1ST9 A;  2KHP A;  3FW2 A;  3KIJ A;  2H0I A;  1OCV A;  4HQS A;  1MDI A;  2FWE A;  2R41 A;  1IDP A;  2LRT A;  1WE0 A;  1GD4 A;  1AC1 A;  4RQX A;  1V9W A;  4TVE A;  1O7W B;  4HOH A;  1D6Z A;  2F4Y A;  1A2J A;  2B5X A;  1SD8 A;  3BCI A;  3CSH A;  2WOH A;  3OWS A;  1C7H A;  4PGT A;  1IQ8 A;  3J7Y k;  2LKU A;  2YCD A;  2Q07 A;  3VSY A;  1QAL A;  16GS A;  3PR8 A;  1YVS A;  1OC9 B;  2DLX A;  3GKM A;  4G10 A;  3I0Y A;  4N6V 0;  3VPT A;  2WB9 A;  4K7I A;  4KDY A;  1XW9 A;  1MD3 A;  2YZU A;  3CCE 3;  4HJM A;  2LQQ A;  2WGR A;  1N8J A;  1X0R A;  3TKS E;  1S72 3;  1UVZ A;  5CRW A;  1M1K 4;  2W03 A;  3X3Y A;  4EBG A;  3APQ A;  4NHZ A;  5FGO A;  2WO0 A;  1JB2 A;  5HR1 A;  2L6D A;  5COH A;  1GTB A;  4MLY A;  1BRN L;  4IHU A;  3KTL A;  5IMD A;  1YF1 A;  3NM7 A;  2IME A;  4GSS A;  4XBX A;  3F4T A;  4TOP A;  4FCM A;  1MWT A;  3LTD A;  3AGN A;  1W5Z A;  1R5P A;  1T4Y A;  2H6X A;  3T0U A;  5CRG A;  4LZI A;  2BMR B;  2YNX A;  1VF3 A;  4RQR A;  1XPV A;  2C0D A;  2FLS A;  2GBW B;  1B8X A;  2WJU A;  2CX1 A;  3CPO A;  2HSH A;  3KM6 A;  3V1W A;  1JKG A;  1FHE A;  2CA8 A;  3EUR A;  3A3T A;  1DMQ A;  3FG4 A;  2OKA A;  3DY5 A;  3QDN A;  1JBS A;  3UIW A;  1QVF 2;  2AAE A;  3F8X A;  4JE1 A;  4I97 A;  3RNT A;  5HR0 A;  3ZFZ A;  4EXJ A;  1NW2 A;  4Z2U A;  3LSZ A;  1F9M A;  3F4R A;  3HVN A;  4K7N A;  5IOX A;  5IMA A;  4GXZ A;  2RM5 A;  1FGR A;  2GLR A;  3U97 A;  2DML A;  2YZH A;  4NHW A;  3RGR A;  3KN4 A;  1TRP A;  3FH1 A;  4WET A;  2KXG A;  2REM A;  2DJJ A;  1SEN A;  1TTZ A;  5M1A A;  2QA4 3;  2I1U A;  5DAK B;  1UW1 A;  1IV9 A;  1LOV A;  3BLZ A;  1VZZ A;  3I9V 2;  1FW7 A;  3E9J B;  2KCD A;  2PER A;  8GSS A;  1O6J A;  4F9Z A;  1K0O A;  3ME8 A;  2W2C A;  2A4V A;  4X2H A;  4QL9 A;  2F99 A;  4RNY A;  1I2F A;  3K9M C;  3FKF A;  3F9U A;  4PNG A;  2BO9 B;  2PWJ A;  5G2Z A;  3Q1C A;  5JCW A;  3JUP A;  1LJR A;  5H5R A;  5J3R A;  2YWM A;  1M9B A;  1M1X B;  2E2V A;  1TK8 B;  3CXC 2;  3GYK A;  3RAZ A;  5IOW A;  1PL1 A;  4EF0 A;  4H61 A;  2L57 A;  4CY8 A;  1OE8 A;  1K8A 4;  2A2S A;  3A5W A;  3I55 3;  2QA2 A;  3GSP A;  1BG5 A;  5LNK e;  3WGD A;  1O8W A;  3FZW A;  3LOY A;  3GRX A;  2FNQ A;  5IEN A;  4NV2 A;  4Q5R A;  2CFW A;  4XRA A;  3LTC A;  3AGO A;  3PS8 A;  3MWZ A;  1WMP A;  3UNL A;  1ERW A;  4ZL7 A;  1OHO A;  3EB8 A;  2VL9 A;  1JB5 A;  3ISO A;  3EWL A;  2L4Q A;  3DXO A;  2ZL8 A;  1BUQ A;  1G02 A;  1GLP A;  3D4A A;  3CPW 2;  5B6N A;  4HJL B;  4L7K A;  2NTO A;  3TRP A;  2ZA4 A;  3HA9 A;  3LT8 A;  1LBK A;  4TRX A;  1YJN 3;  2YFJ B;  4ZBD A;  4XBT A;  2VD0 A;  4NWY A;  1I5G A;  1MD4 A;  4F0B A;  3VK9 A;  1ILO A;  2OQE A;  2ML5 A;  4Q53 A;  1YIJ 3;  3HK4 A;  1PX7 A;  2GSS A;  11GS A;  1QVG 2;  1GSE A;  2H74 A;  2XBQ A;  3F4S A;  4EV2 A;  1I2G A;  2E2U A;  1V57 A;  4EDY A;  5A4W A;  3WOE B;  4I8B A;  3BB9 A;  4IIA A;  2ALB A;  4K1U A;  5CNW A;  2AYT A;  2R37 A;  4XS4 B;  3GTU A;  2K3D A;  4LYL B;  2AHE A;  2C4B A;  2X8H A;  3Q74 A;  1GOV A;  1ON4 A;  1HYU A;  4K7O A;  2HNL A;  2B6M A;  1BNF A;  3FLJ A;  2R4V A;  1T2I A;  1I2E A;  1E97 A;  2MZC A;  3HJO A;  3QCP A;  2EIQ A;  5DBQ A;  1XVQ A;  3KKG A;  3RDE A;  1BRG A;  4HVN A;  3C73 A;  7STD A;  3M9J A;  1FG4 A;  1GH2 A;  4YQU A;  4GWR A;  1MDK A;  2C4J A;  3GHA A;  4YKF A;  2CIU A;  1X9W B;  1ZCP A;  3F3Q A;  1BNJ A;  3W8J A;  5KP1 A;  2HT9 A;  1BNR A;  2KUC A;  3HDC A;  3LXU X;  1E3V A;  2QSI A;  1I0X A;  5D82 A;  2V2G A;  2UGI A;  4BA7 A;  2YP6 A;  3UL5 A;  2YJH A;  5JCG A;  3O8Y A;  4GB5 A;  3LXT A;  4KX4 A;  5DVB A;  4JZQ A;  5IMC A;  1EP7 A;  2UUG C;  2QC7 A;  1A0F A;  5BMU A;  3FEU A;  3QFB C;  4DSS A;  2KLX A;  5JPU A;  4TXV A;  1EOG A;  1ZYP A;  1RN1 A;  1Q86 4;  4Z2T A;  3JUN A;  3D4T A;  1BRJ A;  3QRD A;  1FGQ A;  18GS A;  2CX3 A;  3IC4 A;  4KFE A;  1PN0 A;  3D79 A;  1DMN A;  5ECO B;  2RBI A;  3GSS A;  2GU1 A;  1TTO A;  3NV0 A;  5CLK A;  2CAI A;  4HM6 B;  3D6I A;  4BL7 A;  4ECC A;  1KTE A;  3TJF A;  3GRD A;  5CF1 A;  3Q90 A;  3CQF A;  2Z6B A;  3CRU A;  1GUM A;  3ZG5 A;  2DKH A;  4HZB B;  3F63 A;  3MHE A;  3F8H A;  2RFR A;  3FSD A;  5IEP A;  1MWS A;  5ECR B;  4CDL A;  4MA9 A;  1KNG A;  5E4W A;  1R4W A;  3DH2 A;  3FZ4 A;  4R4K A;  3F40 A;  1GSD A;  1YEX A;  3ERF A;  2VM1 A;  3CC4 3;  1K0N A;  3OR5 A;  4XCS A;  2RSX A;  2C11 A;  4MH3 A;  1FYS A;  1RRH A;  2C0E A;  2GSP A;  3PIN A;  3JCM L;  1OKT A;  3C1S A;  1TDI A;  3W6G A;  1Y4K A;  2BIR A;  1GNE A;  4IKH A;  5JWO B;  4PXO A;  4JRF A;  4MAB A;  2OCT A;  4CHS A;  4LLR A;  1BU4 A;  1B2Z A;  1NWW A;  1V58 A;  4WWU C;  3D5I A;  2I4A A;  1X5C A;  4V2L A;  2C0F A;  5B6M A;  2FD3 A;  5HGR A;  4TN8 A;  5DJM A;  3IDV A;  2LJR A;  3WD6 A;  2YPM A;  1QK8 A;  3WGX A;  3KSP A;  2D42 A;  2OJL A;  2HSM A;  1GY6 A;  5EVH A;  2RCD A;  2NBS A;  1O7N B;  1ZMA A;  1A2M A;  1Z7R A;  3GTU B;  3SVA A;  2RM6 A;  3FG1 A;  2F56 A;  2I3Y A;  3GZX B;  3SBC A;  3U1W A;  1PN9 A;  1SK1 A;  4MJB A;  1WOU A;  4IVF A;  3NIV A;  2LQO A;  5IQY A;  2WDU A;  3F6D A;  2OE0 A;  1A0R P;  3X40 A;  3F0I A;  3IA1 A;  4BTY A;  4JR6 A;  5EVO A;  1WJK A;  1JB4 A;  3Q6O A;  1ZL9 A;  1WRY A;  5ECK B;  3IHG A;  4YQV A;  3B4P A;  1ULJ B;  3LTA A;  1GMQ A;  3UL3 A;  4GHO A;  2HRA A;  4IQ1 A;  3WHO A;  2PGT A;  1N8Q A;  1OF5 A;  3UAR A;  1GTU A;  2QIY A;  2H70 A;  4X0X A;  3DGL A;  3GN3 A;  2OAC A;  2JDI H;  1OHS A;  6GSW A;  3QR6 A;  2HMO B;  3H4K A;  1N5H A;  3GWR A;  1FGM A;  2CT6 A;  3F14 A;  1QXH A;  1K0C A;  3CMA 3;  1YVB I;  1O73 A;  3TDG A;  2IA7 A;  9RNT A;  2H6Y A;  4ZB6 A;  2HML B;  3UL6 A;  2J9H A;  5ECN B;  2OAD A;  5BVB A;  3EC3 A;  2H1G A;  3UMA A;  20GS A;  5INY A;  2FWH A;  3CBU A;  3HXS A;  1EV4 A;  1K0M A;  1PKW A;  2GQL A;  1GUH A;  2CG1 A;  4ECI A;  1QGV A;  3UB1 A;  1WNH A;  5STD A;  1S3R A;  5B8B A;  3CMI A;  1TP6 A;  3CC2 3;  3GMF A;  3NQZ A;  4XDV A;  3GA4 A;  3I69 A;  4O2H A;  3TRX A;  5BU4 A;  3AMO A;  2LYX A;  1A67 A;  4MJA A;  4I2U A;  3CCV 3;  1K3Y A;  3MG1 A;  1YJW 3;  1O85 A;  3A2V A;  3CCR 3;  4GSN A;  4IQA A;  3O6T A;  3U5R E;  1XBS A;  3CCM 3;  3B4O A;  3ZFB A;  1VQL 3;  4ZXG A;  1B48 A;  2DJ2 A;  1EEM A;  1IU7 A;  2C3T A;  3F7S A;  3LYK A;  1A23 A;  1LU4 A;  5G2G A;  3H51 A;  1T3B A;  3M1G A;  5F05 A;  2LUS A;  3X42 A;  1I0V A;  4POL A;  3EIN A;  4CCV A;  4KUN A;  4TXO A;  2OE3 A;  5H5S A;  1UCJ A;  1QAF A;  1JLW A;  3KFQ C;  1GNW A;  4H86 A;  4N3V A;  4HOJ A;  3M0F A;  4PUF C;  4GSP A;  3LT9 A;  1M2B A;  2H1A A;  4JBB A;  2GTU A;  4ZM8 A;  3M8C A;  4EV5 A;  1U6T A;  1BRI A;  5JBS A;  3EJV A;  3B7C A;  1TRU A;  2YWI A;  2B7J A;  4MF6 A;  3FHK A;  5DAL B;  4BPY A;  1BUJ A;  1Q40 B;  2CAQ A;  1ML6 A;  3M8N A;  3VPQ A;  3EE1 A;  4MMX B;  1FB6 A;  4X2O A;  1GTI A;  1CQS A;  3HD5 A;  1VQ9 3;  1A2K A;  3L9U A;  4WR5 A;  5AIG A;  1EA2 A;  1TU7 A;  2XBI A;  5IO0 A;  1AVK A;  2H8L A;  2JAD A;  5AIV A;  1NSW A;  1K41 A;  4K61 A;  1X9S B;  3S29 A;  3P90 A;  4ZL9 A;  2OQE C;  4KFF A;  5JWR B;  3X3X A;  1OAC A;  4O7H A;  3NBB A;  2YWN A;  1F8N A;  4WYK B;  3IC8 A;  3IPZ A;  5FWG A;  4N6N B;  4N6L A;  3CTG A;  3N9H A;  5F06 A;  5G5E A;  2MYG A;  3PGT A;  4FO5 A;  1S3A A;  1TJD A;  2CWU A;  3D22 A;  4ZL8 A;  1GSF A;  3WMD A;  3FR3 A;  2R0P A;  4KND A;  4LL1 B;  1BRS A;  4HM0 B;  2PVO C;  4O02 B;  4F03 A;  1FGO A;  2OTL 3;  1W00 A;  2W9Q A;  2O8V B;  2ZUP A;  1O7G B;  1RK4 A;  1URM A;  4BTW A;  4K0N A;  4DKI A;  3RGA A;  4YH2 A;  3DGQ A;  4XDW A;  3WR2 A;  4MJD A;  3IOS A;  3CRT A;  3ALA A;  1X5E A;  4KSM A;  4NXI A;  3HOH A;  4HBR A;  2B24 B;  1JRQ A;  3HZP A;  1IT8 A;  1ROV A;  2YX9 A;  4DEJ A;  1YNV X;  4PX1 A;  1GSU A;  3VWV A;  4CY6 A;  5J9B A;  1NJI 4;  5CAX A;  5EY6 A;  5G5F A;  3FY7 A;  3KD0 A;  2EIR A;  1IK3 A;  1TI3 A;  1FOH A;  2GDR A;  2HYX A;  3WOF B;  4XIH A;  5C00 A;  3PZW A;  2G0F A;  2CQ9 A;  2YWO A;  1LXE A;  2IYJ A;  2L6C A;  4BU4 A;  2VOC A;  4LA1 A;  3LG6 A;  1PL2 A;  1MWR A;  1ZX2 A;  1BRH A;  1CQH A;  1ERV A;  3GIX A;  3HII A;  2X64 A;  3QPM A;  2GZZ A;  4MF5 A;  1GWC A;  3ZVJ A;  4BVX B;  4HI7 A;  1A24 A;  2XFS A;  1YY7 A;  2FWF A;  2RGQ A;  5CF2 A;  2EIO A;  4XHM A;  3A2X A;  1X1Y A;  1BED A;  1RN7 A;  1BYE A;  2A15 A;  3SED A;  3LYG A;  4L5O A;  5DQS A;  1CYU A;  1FVJ A;  3TCO A;  4P3Y B;  3OWY A;  1G6W A;  4O5U A;  1V74 A;  1LOY A;  1WMJ A;  2F8F A;  1TK0 B;  3A76 A;  1F37 A;  2FY6 A;  3UVT A;  4YQM A;  4FQU A;  4POM A;  2L5L A;  1U3I A;  2E2G A;  2XHF A;  4GL6 A;  3KMN A;  2N5B A;  4FCJ A;  4KSO A;  1UI7 A;  4BTX A;  2W56 B;  1SK2 A;  5GSP A;  1O7H B;  4EKZ A;  1BSA A;  1TU8 A;  3FYG A;  4NMU A;  2LST A;  6RNT A;  5A4U A;  4EC0 A;  2P05 A;  2VD1 A;  4GST A;  2ZCT A;  4YAV A;  1B3S A;  5ABR A;  3DD3 A;  1UI8 A;  4TKY A;  2A2P A;  2KRT A;  1VF1 A;  3KGK A;  2XPD A;  1RDS A;  2LJA A;  2Z77 A;  4V2M A;  1IYH A;  2I81 A;  1OGX A;  2PNC A;  2CZ2 A;  2F5M A;  5KP4 A;  1IVU A;  3FR6 A;  3PCR A;  4LSO A;  4LGQ A;  3JUO A;  2VCT A;  4Q5N A;  1ZYQ B;  4STD A;  1GOY A;  1R4Y A;  3K5T A;  1AIU A;  5IIZ A;  1W6Y A;  3L4N A;  1XIY A;  3GKN A;  3ZTL A;  2LRN A;  4ZIL A;  4G1M B;  2DJK A;  1LOW A;  5AEW B;  1Z7P A;  1JJ2 2;  1EZK A;  3JUQ A;  3LGC A;  2KF5 A;  3TKP A;  3ZVJ D;  1SII A;  6GST A;  1EUI C;  3PGB A;  1ZS7 A;  1KD1 4;  3DGM A;  1EP8 A;  2H30 A;  3LJR A;  3HVX A;  3ZMK A;  5CRH A;  2FUG 2;  1ERT A;  1JZO A;  4EO3 A;  1STF I;  3MG3 A;  3E3E A;  2N5F A;  1TI1 A;  3QFA C;  5B7C A;  3TB2 A;  4JF8 A;  3S9F A;  1N8R 4;  3G71 3;  4K5R A;  1ZO2 A;  4FR9 A;  2NDO A;  3D3L A;  1GP1 A;  2H0G A;  2CWT A;  1YEP A;  5IG0 A;  1FZU A;  4ILF A;  3NBJ A;  2A4H A;  4MCU A;  1E2Y A;  1M9G A;  2NVL A;  1MGW A;  1VQK 3;  3NM2 A;  1VRS D;  4AJ8 A;  17GS A;  5AGY A;  3WA2 X;  1EKM A;  2IFQ B;  1Z3E A;  2LJK A;  2GVP A;  1K28 A;  3N8B A;  4N30 A;  4NV5 A;  1VQ4 3;  5EL8 A;  4OFM A;  4FMA A;  3ERG A;  3SLU A;  4ICY A;  2FWG A;  1LNI A;  4N0V A;  5JWQ B;  5IO2 A;  4TR3 A;  2IUK A;  1U87 A;  1TKD B;  1JLV A;  4IT7 A;  2H19 A;  3VWU A;  2FNO A;  3DGY A;  4V2N A;  5IG3 A;  3F9S A;  4BVY A;  2JSY A;  3V98 A;  2B1K A;  3RHB A;  1RNB A;  2R6K A;  4EL1 A;  1VF2 A;  1YJ9 3;  13GS A;  3VF1 A;  1PRX A;  1X1U A;  3K0Z A;  3SWL A;  2SBL A;  3LWA A;  5RNT A;  5EQL A;  3LFL A;  3EN1 B;  3OV4 A;  1Q98 A;  2HRF A;  2F5W A;  1BSD A;  3UJM A;  4KW6 A;  2H72 A;  1Y25 A;  5HR3 A;  1W2Z A;  2B5Y A;  1V2A A;  4OO4 A;  3ECF A;  3UBL A;  3HKR A;  1KBN A;  7GSP A;  3EBT A;  2B1L A;  2CW9 A;  2PVQ A;  1GY5 A;  4R1K A;  1HKX A;  1CYV A;  3QAG A;  3GKX A;  5ELJ A;  3OW2 2;  1KSI A;  4MEI A;  4YKG A;  1WMN A;  3T8N A;  1BX9 A;  4BL2 A;  3HJP A;  5AI1 A;  1YI2 3;  5ECS A;  3P2A A;  2MMO A;  3EN8 A;  2Y73 A;  1A90 A;  1JN5 A;  1WMO A;  4TX4 A;  6GSU A;  2GSR A;  3OWU A;  1M0U A;  3QD9 A;  2X8G A;  4Q5F A;  5ECH B;  4HEA 2;  4EVM A;  1QMV A;  1RKY A;  4N6M A;  1TRQ A;  1Q9E A;  3CD6 3;  2L59 A;  1RJO A;  22GS A;  1BOX A;  3GX8 A;  3DUK A;  1IQX A;  4MNN A;  3MAK A;  2Z76 A;  4FYU A;  1OKD A;  1QUW A;  5A0O B;  5TGN A;  4HM7 B;  2RII A;  3D0Z A;  1JZW A;  3QAV A;  4MZC A;  3WOD G;  4RNZ A;  1US1 A;  3Q2P A;  1M2A A;  3GKK A;  1AAZ A;  1F3A A;  4KCE A;  4N6O B;  3SOY A;  4LEH A;  3M3M A;  2XSH B;  1JKG B;  4NRE A;  4LMW A;  4CJN A;  5D9X A;  4L0W A;  5HR2 A;  3FRC A;  3FZA A;  3G8Z A;  2P0X A;  1PFO A;  3CSI A;  1NB5 I;  2K54 A;  5AIS A;  5GSS A;  1RLS A;  4D73 A;  3GUR A;  4G0I A;  2MBS A;  1FOV A;  5D81 A;  1XWA A;  2W04 A;  2OOV C;  3APO A;  4AEQ A;  2XFT A;  3TUE A;  3BD2 A;  2GS3 A;  2QGV A;  3IV4 A;  2IJY A;  1GUL A;  2FA8 A;  3GZY B;  5IG5 A;  4PEJ A;  1PSQ A;  3LZA A;  2XH9 A;  1PU4 A;  2OWP A;  1YDK A;  3QK9 A;  1J2B A;  1XFL A;  1ABA A;  1SJW A;  4DSQ A;  1CQG A;  3LYP A;  2IMJ A;  1AQV A;  5H5Q A;  1AVL A;  3NHX A;  2P5R A;  3TKS A;  4KVH A;  3CXG A;  1Z9H A;  2YFI B;  4KFD A;  3UBK A;  3SXX A;  1I70 A;  1GSS A;  3RHC A;  3X3Z A;  4OCF A;  2IMF A;  5KN3 A;  3I56 3;  3MIX A;  3GL3 A;  3JVC A;  5LD0 A;  4GCI A;  3NBR A;  1Z6N A;  1V40 A;  5ELA A;  1X9M B;  2E7P A;  3FGY A;  4V1A p;  1NDO B;  1K3O A;  4PUA A;  4AKY A;  2HZF A;  3KCM A;  2CC3 A;  3FG3 A;  5HFK A;  3G7I A;  2R3X A;  1USB A;  3I6A A;  4MH2 A;  2AAD A;  3MPH A;  4HU7 A;  1RGC A;  2HRK A;  5F8B A;  3TRQ A;  1FO5 A;  2PUK C;  3C71 A;  1M90 4;  3CCQ 3;  1G7E A;  5HFI A;  1ROA A;  3GST A;  3RPP A;  3O76 A;  2F8A A;  1XOB A;  4N6T A;  4MZB A;  1UGH I;  1W4V A;  1B2S A;  3ME7 A;  4ZBB A;  2XGL A;  2VCQ A;  4ZIJ A;  3MSZ A;  2R2J A;  4R9L A;  1BSB A;  4BWS A;  3DGN A;  3IBH A;  1SL0 B;  1OAZ A;  1ZGN A;  2QGU A;  4G9H A;  2JZT A;  2IMK A;  3BOA A;  3HVV A;  3HZ8 A;  5F0G A;  2P0M A;  1B20 A;  4HS1 A;  1U3A A;  4XTS A;  2H6Z A;  4U13 A;  4OMV A;  1JHB A;  1FGT A;  7RNT A;  4BWQ A;  1SPU A;  1RW1 A;  2XC2 A;  3ZIV A;  3G4S 3;  2RLI A;  1ZYE A;  1TXX A;  1JNQ A;  4K2X A;  3FMW A;  4MPF A;  4OUQ A;  1RNT A;  2MMA A;  4WF5 A;  4HYZ A;  1PQN A;  4MJE A;  3D5G A;  1KC8 4;  1QAK A;  2CX0 A;  2VCX A;  1AQX A;  3A5E A;  1NHY A;  3NOF A;  2QA1 A;  1TW9 A;  4E8E A;  3WDG B;  3KTB A;  2I9W A;  1YQ1 A;  1XXU A;  4Z2R A;  2UZ8 A;  5ELU A;  1RGA A;  3EHC A;  5BIR A;  5KOX A;  3A5I A;  3S5C A;  3SOA A;  2WGQ A;  4HQZ A;  4POB A;  2E2M A;  5A5K A;  3IHQ A;  1ZGX A;  5IER A;  4J5G A;  1K3L A;  1N5P A;  4TR1 A;  1DE2 A;  1DSB A;  1JBR A;  2TRX A;  3H8Q A;  4OK0 A;  1J08 A;  5ID2 A;  1TU5 A;  1GY7 A;  4KCA A;  2HZE A;  3FZ5 A;  4OCE A;  1PY3 A;  7GSS A;  2VLU A;  1O81 A;  2H0H A;  2HE3 A;  1GYB A;  2K0M A;  1JZR A;  1M9A A;  4K5S A;  2BTO T;  1TRS A;  1SYX A;  1B2U A;  4WHA A;  5CYY A;  3UJ1 A;  4K8M A;  4EDZ A;  3L0H A;  5L71 A;  2OBI A;  1OH0 A;  1SJ6 A;  4DSS B;  1GMR A;  5J5N A;  4AJ7 A;  4F82 A;  3F6F A;  4I4K A;  2GEY A;  1Q7Y 4;  4CPK A;  2AUV A;  5LC7 A;  3CCU 3;  1DE1 A;  6GSP A;  3P8W A;  2B5E A;  4IS0 A;  2OA7 A;  1HZ1 A;  4L8P A;  2GEX A;  3EF8 A;  4BIK A;  3NV0 B;  3LQ7 A;  1JV2 B;  6STD A;  4HJ2 A;  4AF2 A;  4FMC A;  1WP0 A;  1C72 A;  3VI7 A;  4K1F A;  4BL7 B;  3IPT A;  4EE0 A;  2PMT A;  2E0Q A;  5HFG A;  4IGJ A;  1WWJ A;  4F0C A;  4HM3 B;  1GSQ A;  2L4V A;  1NB3 I;  3LW9 A;  3RPN A;  3VI5 A;  1YF0 A;  3EX9 A;  3HVS A;  3A2W A;  8CHO A;  3AY8 A;  5G31 A;  3GH6 A;  3AHW A;  4J8T A;  5IEO A;  1G7O A;  3G9B A;  2FXT A;  2Y74 A;  3ZML A;  2I9H A;  1W2B 2;  1LRA A;  2CV4 A;  4G19 A;  3EBY A;  2L1S A;  1AXD A;  1SKR B;  2V1L A;  2H71 A;  1RTU A;  2VUP A;  3ROB A;  1J9B A;  4K6X A;  5DCG A;  1VQ7 3;  5IMZ A;  2BMO B;  1C54 A;  4JR4 A;  1VQ6 3;  2TIR A;  4N11 A;  3FZ9 A;  3HY2 A;  4RNT A;  2BT3 A;  2IWT A;  3D9R A;  1YKC A;  4MP4 A;  2P31 A;  3IAM 2;  3VUR A;  4ML6 A;  4KB3 A;  2HMJ B;  3IR4 A;  1I9D A;  3F3R A;  3G7J A;  3B8L A;  4NAX A;  1OC9 A;  2KOK A;  4O8S A; 
#chains in the Genus database with same CATH homology
 4I6X A;  4ULX A;  4OFT A;  5GAP D;  1FAA A;  1YKA A;  2NPB A;  1THX A;  2WRT A;  3EU3 A;  3L9V A;  2VIM A;  2K18 A;  4GRF A;  4CW9 A;  4DVC A;  1OC8 A;  5GST A;  1XW5 A;  4GTU A;  5KEJ A;  1XOA A;  3DWV A;  3KP8 A;  2VL2 A;  2HI7 A;  1Q4J A;  5KN0 A;  1F2E A;  2P0G A;  1DBY A;  2VCW A;  5ECI B;  1PA3 A;  6GSX A;  4G0L A;  3TGZ A;  3LXZ A;  2LEG A;  1XVW A;  4G2E A;  3BJ5 A;  2D2Z A;  3F8U A;  5F07 A;  3ZZX A;  5D9V A;  3R2Q A;  2GT5 A;  1KEB A;  5G30 A;  1F6M C;  2CVK A;  4WF4 A;  5BRT A;  2GSQ A;  1XCC A;  3DVW A;  4ISD A;  4JED A;  3K8N A;  2H73 A;  1TK5 B;  4ECB A;  1ZOF A;  3DKS A;  4JU5 A;  2P5Q A;  4L8E A;  4WBJ A;  3P7X A;  2YV7 A;  9GSS A;  3DVX A;  5D9T A;  12GS A;  4Z7X A;  1EV9 A;  4KE3 A;  4PNF A;  1SD9 A;  1V98 A;  1K0A A;  3EE2 A;  5JCU A;  5DJL A;  4HZ4 A;  3HYP A;  4LL4 B;  1EEJ A;  3TJB A;  3VLN A;  4K9Z A;  1RQM A;  3IXR A;  2DJ1 A;  4WR4 A;  1T4Z A;  4KDU A;  1EGO A;  2YN1 A;  5ECL B;  3TKS C;  4LMV A;  3UVH A;  1XWB A;  2X8C A;  3UOM A;  4AGS A;  3TOT A;  4WBR D;  3RDW A;  1TRV A;  2CZ3 A;  2TRC P;  2JSZ A;  3QOU A;  1DUG A;  1UC7 A;  4TXO B;  4RUV A;  4DSR A;  5CRD A;  5KN2 A;  3LOR A;  3HHV A;  3EMP A;  2IL3 A;  5D96 A;  4OWY A;  5ELG A;  1SKS B;  4POK A;  3C1R A;  2DKI A;  2H75 A;  2BMX A;  4HZ2 A;  1G6Y A;  1WPI A;  2KP2 A;  1T00 A;  1JFU A;  3C7M A;  2RUF A;  1ERU A;  1EGR A;  2OE1 A;  2LRC A;  3EPT A;  1PMT A;  2DJ0 A;  4XS4 A;  4GQC A;  2O87 A;  2GZP A;  4MF7 A;  1MTC A;  4USS A;  4NPB A;  2JZS A;  4ID0 A;  5E59 A;  4OO5 A;  4X4J A;  5AIX A;  1M7T A;  3GFK A;  1UA5 A;  1MEK A;  1HNA A;  1M99 A;  4J56 E;  3IK7 A;  1OYJ A;  4MMM A;  2C3Q A;  1M2D A;  1UN2 A;  2DIY A;  5IM9 A;  4F2I A;  2O85 A;  3ERW A;  4KA0 A;  2GST A;  1GUK A;  1NM3 A;  3KH9 A;  1TOF A;  6GSY A;  4IBP A;  1W89 A;  4ACS A;  6GSS A;  5HQP A;  2K8S A;  1PKZ A;  1THO A;  2F9S A;  2O7K A;  4IP1 A;  2FGX A;  3Q18 A;  2M72 A;  3Q19 A;  2WUL A;  4O5Q A;  5J4U A;  3IE3 A;  4FIW A;  1R5A A;  2X4A A;  2IIY A;  4N0Z A;  2V41 A;  4ZBA A;  1PX6 A;  2XPE A;  2V6O A;  1SYR A;  2YJ7 A;  2PBJ A;  2R5G A;  4YAP A;  3GUS A;  4OD7 A;  2H1B A;  1WIK A;  3D5J A;  4IJI A;  3CSJ A;  4IEL A;  2WCI A;  2PU9 C;  2WFC A;  2V32 A;  3TJG A;  4RI6 A;  5J41 A;  2JZR A;  3GL5 A;  1GL8 A;  3CYN A;  2V1M A;  2AV4 A;  1TP9 A;  3CTF A;  1BQ7 A;  1Z5Y E;  2H66 A;  1AQW A;  3U6V A;  3M9K A;  3WGE A;  4X43 A;  1GLQ A;  4WKW A;  4IW9 A;  3KMO A;  3N5O A;  2B7K A;  14GS A;  1OC3 A;  3DYR A;  3ZRE A;  4TR0 A;  3J7Y b;  2QKE A;  3PH9 A;  1BJX A;  1EOH A;  2AAW A;  1SJI A;  5J9C A;  4TR4 A;  2ES7 A;  2DC5 A;  4L0U A;  1N2A A;  1HQO A;  3ZFL A;  1A2L A;  1B9X C;  1T8E B;  1OVN A;  4FH8 A;  5ECP B;  4WXT A;  4PQI A;  2PPT A;  3EYT A;  3KZQ A;  2LTK A;  1SJZ A;  2OBK A;  5FHI A;  4EIP A;  3I43 A;  4O92 A;  3O3T A;  1AW9 A;  1HNC A;  3KXO A;  2H76 A;  3QMX A;  5G1L A;  1Z6M A;  5A4V A;  1J0F A;  1IYI A;  2VL2 C;  4HDE A;  3IRA A;  1SK0 A;  2VCZ A;  4HUA A;  4HU9 A;  2C8U A;  4K0G A;  3DIE A;  5KOW A;  1B4P A;  4WEY A;  3VFI A;  3ED3 A;  5C04 A;  2CX4 A;  3KP9 A;  10GS A;  2DBC A;  1ACV A;  2HLS A;  4O32 A;  4ZB9 A;  1H75 A;  3MWH A;  4I2T A;  1FVK A;  3D4M A;  3L9S A;  1YJ6 A;  5ECQ B;  4G0K A;  1HNB A;  1VF4 A;  1OE7 A;  4V1A g;  1ZZY A;  4OFN A;  1SU9 A;  5CO3 A;  4MPG A;  4XS6 A;  2R0C A;  5DCH A;  4I5Q A;  2J23 A;  4BVY B;  4KF9 A;  1XWK A;  3L78 A;  5G1K A;  1VGL A;  2YV9 A;  3GV1 A;  4KGI A;  3C8E A;  4MJC A;  1JZD A;  5GZZ B;  1U88 A;  2LV3 A;  2VO4 A;  2X49 A;  4MZW A;  3HJM A;  3H79 A;  2ON7 A;  4JRR A;  2X99 A;  3HCZ A;  5CRE A;  4EUY A;  4J57 E;  3RBT A;  3HZ4 A;  3GNJ A;  2G2Q A;  2YAN A;  4ZB8 A;  2LNT A;  2B3S A;  3GX0 A;  3UAP A;  4EIQ A;  1ZYN A;  1O7U A;  2PN8 A;  1GSY A;  2EC4 A;  2F51 A;  2DSA A;  2M46 A;  5DAL A;  2VAF A;  4RI7 A;  4GLT A;  4X1U A;  3ZRD A;  1R7H A;  1FW1 A;  4QL7 A;  2GQM A;  4FYC A;  4MDC A;  4O5R A;  2GT6 A;  4XRD A;  3WT2 A;  5LCZ A;  1GRX A;  2JL4 A;  3DEX A;  3IK9 A;  3MYD A;  4PUR A;  1S3D A;  3ZIJ A;  2DMM A;  4K2D A;  3ZYW A;  4ML1 A;  2VM2 A;  4D73 B;  2C3N A;  4CDO A;  2K9F A;  5D73 A;  3EMX A;  2MMZ A;  3TKR A;  1BAY A;  4PTS A;  3VWW A;  2GGT A;  1K0B A;  3MDK A;  2BJX A;  4ECJ A;  3UEM A;  5EPF A;  3MNG A;  1S3C A;  5IMV A;  2DIZ A;  2VCV A;  2C1Y A;  3TJK A;  1A8Y A;  3DRN A;  5D93 A;  5IPG A;  4FYB A;  3H93 A;  3DML A;  1FB0 A;  2FCH A;  3VWX A;  3EVI A;  1NHO A;  1XWC A;  2VL3 A;  3BBY A;  2V6K A;  3FR9 A;  3DXB A;  5IMF A;  3KEB A;  4IJ3 A;  4J2F A;  4AJ6 A;  2M80 A;  19GS A;  1O8X A;  4PQH A;  4BVX A;  2WS2 A;  2K8V A;  5KN1 A;  3IAS 2;  3LEF A;  2LNS A;  2C80 A;  3TJJ A;  1XWG A;  1TRW A;  2FA4 A;  1EWX A;  2VLT A;  4QQ7 A;  2GQK A;  2H01 A;  2RUE A;  3TKQ A;  2HSY A;  1PD2 1;  2O89 A;  1XZO A;  1X5D A;  5D9W A;  2CVD A;  3D21 A;  1XW6 A;  2R0G A;  2IN3 A;  4L5L A;  2VLV A;  3GH9 A;  1G0T A;  1YZX A;  2GZY A;  5B8A A;  2CVB A;  3R3E A;  1HD2 A;  4KAE A;  5CP1 A;  4MK3 A;  2L5O A;  3KJY A;  2AJQ B;  2HXK A;  2ZNM A;  2JAC A;  2HRN A;  3WT1 A;  2IY2 A;  2C0G A;  2WZ9 A;  1MDJ A;  2MBT A;  1PGT A;  4PQ1 A;  3W8S A;  3H1N A;  4E8H A;  5DQY A;  3US3 A;  4IN0 A;  2IPA A;  3FK8 A;  3KH7 A;  4TW5 A;  2H1D A;  4GF0 A;  2AB6 A;  4KH7 A;  3QAW A;  4TR1 B;  1Y6E A;  2A2R A;  1SKW B;  3TOU A;  3PPU A;  5ID2 B;  5D8I A;  3G7Y A;  1QQ2 A;  3WYW A;  2HZE B;  4GQF A;  3BCK A;  3NZN A;  4N10 A;  2HFD A;  6GSV A;  1R26 A;  1B9Y C;  1SL1 B;  1B4Q A;  4IP6 A;  1H4O A;  3E0U A;  2Z9S A;  2DJ3 A;  1K0D A;  5DDL A;  3ZIT A;  3N9J A;  4Q5Q A;  1F3B A;  5AN1 A;  5IPH A;  2YOI A;  5GAN D;  3EU4 A;  2N5A A;  2F3M A;  1E6B A;  4XS1 A;  1T7P B;  2KP1 A;  5DAK A;  1SL2 B;  2JU5 A;  2L4C A;  1GTA A;  2LS5 A;  2K6V A;  2ON5 A;  2FHE A;  3ZL5 A;  1T1V A;  5FT3 A;  3ZLP A;  4A5P A;  2IMI A;  2MMN A;  1A8L A;  5ECM B;  1AUC A;  1QFN A;  3APS A;  4KDX A;  2IMD A;  2IFQ A;  5ENU A;  1ST9 A;  2KHP A;  3FW2 A;  3KIJ A;  2H0I A;  4HQS A;  1MDI A;  2FWE A;  2LRT A;  1WE0 A;  1AC1 A;  4RQX A;  1V9W A;  4TVE A;  1A2J A;  2B5X A;  1SD8 A;  3BCI A;  3CSH A;  4PGT A;  3J7Y k;  2LKU A;  2YCD A;  3PR8 A;  16GS A;  1OC9 B;  2DLX A;  3GKM A;  4G10 A;  3VPT A;  2WB9 A;  4K7I A;  4KDY A;  1XW9 A;  1MD3 A;  2YZU A;  4HJM A;  2LQQ A;  2WGR A;  1N8J A;  1X0R A;  3TKS E;  1UVZ A;  5CRW A;  3APQ A;  4NHZ A;  5HR1 A;  2L6D A;  5COH A;  1GTB A;  4MLY A;  4IHU A;  3KTL A;  5IMD A;  1YF1 A;  2IME A;  4GSS A;  3F4T A;  4TOP A;  1R5P A;  1T4Y A;  2H6X A;  5CRG A;  2YNX A;  1VF3 A;  4RQR A;  1XPV A;  2C0D A;  2FLS A;  1B8X A;  2WJU A;  2HSH A;  3KM6 A;  3V1W A;  1FHE A;  2CA8 A;  3EUR A;  3A3T A;  2OKA A;  3QDN A;  3UIW A;  4JE1 A;  4I97 A;  5HR0 A;  4EXJ A;  1NW2 A;  4Z2U A;  3LSZ A;  1F9M A;  3F4R A;  4K7N A;  5IOX A;  5IMA A;  4GXZ A;  2RM5 A;  2GLR A;  2DML A;  2YZH A;  4NHW A;  4WET A;  2REM A;  2DJJ A;  1SEN A;  1TTZ A;  2I1U A;  5DAK B;  3I9V 2;  3E9J B;  8GSS A;  2PER A;  1O6J A;  4F9Z A;  1K0O A;  3ME8 A;  2A4V A;  4QL9 A;  3FKF A;  3F9U A;  4PNG A;  2PWJ A;  5G2Z A;  5JCW A;  5H5R A;  1LJR A;  5J3R A;  2YWM A;  1M9B A;  1TK8 B;  3GYK A;  3RAZ A;  5IOW A;  1PL1 A;  4EF0 A;  2L57 A;  4CY8 A;  1OE8 A;  2A2S A;  3A5W A;  2QA2 A;  1BG5 A;  5LNK e;  3WGD A;  1O8W A;  3GRX A;  4Q5R A;  4NV2 A;  4XRA A;  4ZL7 A;  1ERW A;  2VL9 A;  3ISO A;  3EWL A;  2L4Q A;  1GLP A;  5B6N A;  2NTO A;  3TRP A;  3HA9 A;  1LBK A;  4TRX A;  4ZBD A;  2VD0 A;  4NWY A;  1I5G A;  1MD4 A;  4F0B A;  3VK9 A;  1ILO A;  1PX7 A;  2GSS A;  11GS A;  1GSE A;  2H74 A;  2XBQ A;  3F4S A;  1V57 A;  4EDY A;  5A4W A;  4I8B A;  2ALB A;  5CNW A;  2AYT A;  2R37 A;  4XS4 B;  3GTU A;  2AHE A;  2X8H A;  3Q74 A;  1ON4 A;  1HYU A;  4K7O A;  2HNL A;  2B6M A;  2R4V A;  2MZC A;  3HJO A;  3QCP A;  2EIQ A;  5DBQ A;  1XVQ A;  3C73 A;  3M9J A;  1FG4 A;  1GH2 A;  4YQU A;  4GWR A;  1MDK A;  2C4J A;  3GHA A;  4YKF A;  1X9W B;  1ZCP A;  3F3Q A;  3W8J A;  2HT9 A;  2KUC A;  3HDC A;  2QSI A;  2V2G A;  4BA7 A;  2YP6 A;  2YJH A;  5JCG A;  3LXT A;  4KX4 A;  5DVB A;  4JZQ A;  5IMC A;  1EP7 A;  2QC7 A;  1A0F A;  5BMU A;  3FEU A;  3QFB C;  4DSS A;  2KLX A;  4TXV A;  1EOG A;  1ZYP A;  4Z2T A;  3D4T A;  18GS A;  3IC4 A;  2CX3 A;  1PN0 A;  5ECO B;  3GSS A;  2CAI A;  3D6I A;  4BL7 A;  4ECC A;  1KTE A;  3TJF A;  3CRU A;  1GUM A;  2DKH A;  3F63 A;  5ECR B;  4MA9 A;  1KNG A;  5E4W A;  1R4W A;  3FZ4 A;  1GSD A;  1YEX A;  3ERF A;  2VM1 A;  1K0N A;  3OR5 A;  4XCS A;  4MH3 A;  2C0E A;  3PIN A;  3JCM L;  1OKT A;  3C1S A;  1TDI A;  3W6G A;  1GNE A;  4IKH A;  5JWO B;  4PXO A;  4MAB A;  4CHS A;  4LLR A;  1V58 A;  2I4A A;  1X5C A;  4V2L A;  2C0F A;  5B6M A;  2FD3 A;  4TN8 A;  5DJM A;  3IDV A;  2LJR A;  3WD6 A;  2YPM A;  1QK8 A;  3WGX A;  2OJL A;  2HSM A;  2NBS A;  1ZMA A;  1A2M A;  1Z7R A;  3GTU B;  2RM6 A;  2I3Y A;  3SBC A;  1SK1 A;  1PN9 A;  4MJB A;  1WOU A;  4IVF A;  3NIV A;  2LQO A;  5IQY A;  2WDU A;  3F6D A;  2OE0 A;  1A0R P;  3F0I A;  3IA1 A;  4JR6 A;  5EVO A;  1WJK A;  3Q6O A;  1ZL9 A;  1WRY A;  5ECK B;  3IHG A;  4YQV A;  3UL3 A;  2HRA A;  4IQ1 A;  2PGT A;  3UAR A;  1GTU A;  2H70 A;  4X0X A;  3GN3 A;  2OAC A;  6GSW A;  3QR6 A;  3H4K A;  2CT6 A;  1QXH A;  1K0C A;  1O73 A;  3TDG A;  2H6Y A;  4ZB6 A;  2J9H A;  5ECN B;  2OAD A;  3EC3 A;  2H1G A;  3UMA A;  20GS A;  5INY A;  2FWH A;  3CBU A;  3HXS A;  1EV4 A;  1K0M A;  1PKW A;  2GQL A;  1GUH A;  4ECI A;  1QGV A;  5B8B A;  3CMI A;  3GMF A;  3GA4 A;  3I69 A;  3TRX A;  4MJA A;  4I2U A;  1K3Y A;  1O85 A;  3A2V A;  4IQA A;  4GSN A;  3O6T A;  3U5R E;  1XBS A;  3ZFB A;  4ZXG A;  1B48 A;  2DJ2 A;  1EEM A;  2C3T A;  3LYK A;  1A23 A;  1LU4 A;  1T3B A;  3M1G A;  5F05 A;  2LUS A;  4POL A;  3EIN A;  4KUN A;  4TXO A;  2OE3 A;  5H5S A;  1JLW A;  1GNW A;  4H86 A;  4HOJ A;  3M0F A;  4PUF C;  1M2B A;  2H1A A;  4JBB A;  2GTU A;  1U6T A;  1TRU A;  2YWI A;  2B7J A;  4MF6 A;  3FHK A;  5DAL B;  4BPY A;  2CAQ A;  1ML6 A;  3M8N A;  3VPQ A;  1FB6 A;  1GTI A;  3HD5 A;  3L9U A;  4WR5 A;  1TU7 A;  2XBI A;  5IO0 A;  2H8L A;  2JAD A;  5AIV A;  1NSW A;  1X9S B;  3P90 A;  4ZL9 A;  5JWR B;  4O7H A;  2YWN A;  3IC8 A;  3IPZ A;  5FWG A;  3CTG A;  5G5E A;  5F06 A;  2MYG A;  3PGT A;  4FO5 A;  1S3A A;  1TJD A;  3D22 A;  4ZL8 A;  1GSF A;  3FR3 A;  2R0P A;  4KND A;  4LL1 B;  2PVO C;  4F03 A;  2O8V B;  2ZUP A;  1RK4 A;  1URM A;  4K0N A;  4YH2 A;  3DGQ A;  3IOS A;  3CRT A;  1X5E A;  4KSM A;  4NXI A;  4DEJ A;  4PX1 A;  1GSU A;  3VWV A;  4CY6 A;  5J9B A;  5CAX A;  5EY6 A;  5G5F A;  3FY7 A;  3KD0 A;  2EIR A;  1TI3 A;  2GDR A;  1FOH A;  2HYX A;  4XIH A;  5C00 A;  2G0F A;  2CQ9 A;  2YWO A;  2IYJ A;  2L6C A;  2VOC A;  4LA1 A;  3LG6 A;  1PL2 A;  1CQH A;  1ERV A;  3GIX A;  2X64 A;  3QPM A;  2GZZ A;  4MF5 A;  1GWC A;  3ZVJ A;  4BVX B;  4HI7 A;  1A24 A;  1YY7 A;  2FWF A;  2EIO A;  4XHM A;  3A2X A;  1BED A;  1BYE A;  4L5O A;  5DQS A;  1FVJ A;  3TCO A;  4P3Y B;  1G6W A;  4O5U A;  2F8F A;  1WMJ A;  1TK0 B;  1F37 A;  2FY6 A;  3UVT A;  4YQM A;  4FQU A;  4POM A;  2L5L A;  2E2G A;  1U3I A;  2XHF A;  3KMN A;  2N5B A;  4KSO A;  1SK2 A;  4EKZ A;  1TU8 A;  3FYG A;  4NMU A;  2LST A;  5A4U A;  4EC0 A;  2VD1 A;  4GST A;  2ZCT A;  4YAV A;  5ABR A;  3DD3 A;  4TKY A;  2A2P A;  1VF1 A;  3KGK A;  2XPD A;  2LJA A;  4V2M A;  1IYH A;  2I81 A;  2CZ2 A;  3FR6 A;  2VCT A;  4Q5N A;  1ZYQ B;  1AIU A;  5IIZ A;  3L4N A;  1XIY A;  3GKN A;  3ZTL A;  2LRN A;  4ZIL A;  2DJK A;  1Z7P A;  1EZK A;  3LGC A;  3TKP A;  3ZVJ D;  6GST A;  2H30 A;  1EP8 A;  3LJR A;  3HVX A;  3ZMK A;  5CRH A;  2FUG 2;  1ERT A;  1JZO A;  4EO3 A;  3TB2 A;  3E3E A;  2N5F A;  1TI1 A;  3QFA C;  5B7C A;  3S9F A;  4K5R A;  2NDO A;  1GP1 A;  2H0G A;  1YEP A;  4MCU A;  4ILF A;  2A4H A;  1E2Y A;  2NVL A;  1VRS D;  4AJ8 A;  17GS A;  5AGY A;  2IFQ B;  1Z3E A;  2LJK A;  2GVP A;  4NV5 A;  4N30 A;  5EL8 A;  4OFM A;  3ERG A;  4ICY A;  2FWG A;  4N0V A;  5JWQ B;  5IO2 A;  4TR3 A;  1U87 A;  1TKD B;  1JLV A;  2H19 A;  3VWU A;  2FNO A;  4V2N A;  4BVY A;  2JSY A;  2B1K A;  3RHB A;  2R6K A;  4EL1 A;  1VF2 A;  13GS A;  1PRX A;  3SWL A;  3LWA A;  3LFL A;  1Q98 A;  2HRF A;  4KW6 A;  2H72 A;  1Y25 A;  5HR3 A;  2B5Y A;  1V2A A;  4OO4 A;  3UBL A;  3HKR A;  1KBN A;  2B1L A;  2PVQ A;  3QAG A;  3GKX A;  4YKG A;  1BX9 A;  3HJP A;  5ECS A;  3P2A A;  2MMO A;  6GSU A;  2GSR A;  1M0U A;  3QD9 A;  2X8G A;  4Q5F A;  5ECH B;  4HEA 2;  4EVM A;  1QMV A;  2L59 A;  22GS A;  3GX8 A;  4MNN A;  3MAK A;  4FYU A;  1OKD A;  1QUW A;  2RII A;  3D0Z A;  1JZW A;  3QAV A;  4MZC A;  1M2A A;  3GKK A;  1AAZ A;  1F3A A;  4KCE A;  3M3M A;  4LMW A;  5D9X A;  4L0W A;  5HR2 A;  3FRC A;  3FZA A;  3CSI A;  5AIS A;  5GSS A;  4D73 A;  3GUR A;  4G0I A;  2MBS A;  1FOV A;  1XWA A;  3APO A;  3TUE A;  3BD2 A;  2GS3 A;  2QGV A;  3IV4 A;  2IJY A;  1GUL A;  2FA8 A;  1PSQ A;  1YDK A;  1XFL A;  1ABA A;  4DSQ A;  1CQG A;  3LYP A;  1AQV A;  5H5Q A;  2P5R A;  3TKS A;  3CXG A;  1Z9H A;  3UBK A;  3RHC A;  1GSS A;  4OCF A;  2IMF A;  5KN3 A;  3MIX A;  3GL3 A;  5LD0 A;  4GCI A;  1Z6N A;  5ELA A;  1V40 A;  1X9M B;  2E7P A;  4V1A p;  1K3O A;  4PUA A;  2HZF A;  3KCM A;  5HFK A;  3G7I A;  2R3X A;  1USB A;  3I6A A;  4MH2 A;  4HU7 A;  2HRK A;  5F8B A;  3TRQ A;  1FO5 A;  2PUK C;  3C71 A;  1G7E A;  5HFI A;  3GST A;  3RPP A;  3O76 A;  2F8A A;  1XOB A;  4MZB A;  1W4V A;  3ME7 A;  4ZBB A;  2VCQ A;  4ZIJ A;  3MSZ A;  2R2J A;  4BWS A;  3IBH A;  1SL0 B;  1OAZ A;  1ZGN A;  4G9H A;  2JZT A;  2IMK A;  3BOA A;  3HVV A;  3HZ8 A;  5F0G A;  4HS1 A;  1U3A A;  4XTS A;  2H6Z A;  4OMV A;  1JHB A;  4BWQ A;  1RW1 A;  2XC2 A;  3ZIV A;  2RLI A;  1ZYE A;  1TXX A;  4K2X A;  3FMW A;  4MPF A;  2MMA A;  4WF5 A;  4MJE A;  1PQN A;  2VCX A;  1AQX A;  1NHY A;  3NOF A;  2QA1 A;  1TW9 A;  4E8E A;  3KTB A;  1YQ1 A;  1XXU A;  4Z2R A;  2UZ8 A;  5KOX A;  3A5I A;  4HQZ A;  4POB A;  2E2M A;  5A5K A;  3IHQ A;  1K3L A;  4TR1 A;  1DE2 A;  1DSB A;  2TRX A;  3H8Q A;  1J08 A;  5ID2 A;  4KCA A;  2HZE A;  3FZ5 A;  4OCE A;  7GSS A;  2VLU A;  1O81 A;  2H0H A;  2HE3 A;  1JZR A;  1M9A A;  4K5S A;  2BTO T;  1TRS A;  1SYX A;  5CYY A;  3UJ1 A;  4K8M A;  4EDZ A;  3L0H A;  5L71 A;  2OBI A;  1SJ6 A;  4DSS B;  5J5N A;  4AJ7 A;  4F82 A;  3F6F A;  2AUV A;  1DE1 A;  3P8W A;  2B5E A;  4IS0 A;  2OA7 A;  3LQ7 A;  4AF2 A;  4HJ2 A;  1WP0 A;  3VI7 A;  1C72 A;  4K1F A;  4BL7 B;  4EE0 A;  2PMT A;  2E0Q A;  5HFG A;  4IGJ A;  1WWJ A;  4F0C A;  1GSQ A;  3LW9 A;  3RPN A;  3VI5 A;  1YF0 A;  3HVS A;  3A2W A;  3AY8 A;  5G31 A;  3GH6 A;  1G7O A;  3G9B A;  3ZML A;  2I9H A;  2CV4 A;  4G19 A;  1AXD A;  1SKR B;  2H71 A;  2VUP A;  1J9B A;  4K6X A;  5DCG A;  5IMZ A;  4JR4 A;  2TIR A;  4N11 A;  3FZ9 A;  3HY2 A;  2IWT A;  4MP4 A;  1YKC A;  2P31 A;  3IAM 2;  3VUR A;  4ML6 A;  4KB3 A;  3IR4 A;  1I9D A;  3F3R A;  3G7J A;  4NAX A;  1OC9 A;  2KOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...