1EEJA

Crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN
total genus 68
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1eejA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eejA02
4XS4B 4G19A 3KXOA 4IS0A 4PUAA 3GKXA 2JZRA 1W89A 2PVOC 1KBNA 6GSVA 1FOVA 4JRRA 2P0GA 4NAXA 1JFUA 4MJCA 3NIVA 2FD3A 3L9SA 4POBA 2CVBA 3QAGA 1RK4A 3UARA 3FR6A 3DWVA 3WGDA 5DDLA 5INYA 4HS1A 4J57E 3LEFA 6GSSA 3GTUA 1M99A 5HFKA 1ERTA 4TXVA 3PGTA 1B48A 3TCOA 3V1WA 3RPNA 22GSA 2IMKA 1EV9A 3QMXA 2M80A 4TKYA 2WFCA 4G2EA 2H6XA 4JZQA 2GQLA 3P7XA 2L5LA 1O85A 2XPDA 1B9YC 5C00A 2FA8A 1QGVA 1ERVA 1OKTA 2FWHA 5ECSA 4MCUA 2HLSA 1MDJA 3MDKA 4MZBA 3LYPA 1A24A 2B5XA 1B9XC 1AIUA 5D96A 4K9ZA 2VM2A 3VURA 3APQA 3DEXA 1SKWB 3FZ9A 4O5RA 1JLVA 4KB3A 1BG5A 1XW9A 2O87A 3L9VA 5ECRB 2K6VA 4ZBBA 1K0AA 1X9WB 2ON5A 4GQCA 3O6TA 1O81A 5G30A 1SD9A 5CAXA 1J0FA 1EOHA 5CRGA 3M8NA 2AB6A 1MTCA 3EWLA 5IO0A 2C0EA 2HI7A 4V2NA 2WB9A 3TKRA 1TKDB 3TKPA 5D9TA 11GSA 2PN8A 3QR6A 4AGSA 1VF2A 3GH9A 3WT2A 4BA7A 4WR5A 4WBRD 4OFTA 3TKQA 2E2GA 4XIHA 3M9KA 4NHZA 2AYTA 5GAPD 4MK3A 3HXSA 2H6YA 5ECLB 3LXTA 3GHAA 3GL3A 4F0CA 7GSSA 2GDRA 4XS1A 3VWXA 2X8CA 3QFBC 3ERWA 5JWOB 1I5GA 3GSSA 5AIVA 4OD7A 1YF1A 2CV4A 2GZYA 1GULA 1Q4JA 4LMWA 1GWCA 3ZYWA 4PQHA 4HZ4A 1F37A 4KE3A 1NW2A 3M3MA 5F0GA 2LJAA 4BVXA 2H8LA 4WEYA 4HI7A 1TXXA 3ISOA 2LQQA 1B4QA 2HNLA 2FWGA 1BYEA 1DBYA 3EU4A 2YWIA 4PX1A 4GF0A 5IMVA 3EURA 4ECIA 2AAWA 2MBTA 6GSUA 3QCPA 5AGYA 1A2LA 4IELA 1V57A 3TGZA 4E8HA 4L5LA 5G1KA 1AAZA 5G5EA 2H1AA 1J08A 3D4TA 3VFIA 2NDOA 1XIYA 5DAKA 4ZB6A 3UOMA 2GSRA 1JZOA 4FYUA 1WRYA 4J56E 4JR4A 1JLWA 2VCQA 2G0FA 2VM1A 4HQZA 4ISDA 1GH2A 1WWJA 2PUKC 3G9BA 3GV1A 4K2DA 5JWRB 4PNFA 1EP7A 2H19A 3HJMA 4AF2A 1AQWA 2QKEA 5HR3A 2CT6A 4YQVA 3AY8A 3DVXA 3FYGA 2TRXA 1TK8B 1F3AA 3I6AA 1GSYA 5J9BA 3IR4A 1FB6A 5JCGA 3ZMKA 2VL9A 1TW9A 1TK0B 2R4VA 9GSSA 1F2EA 3H93A 3VWWA 2AUVA 5J41A 1U3IA 3F4TA 2L57A 5GAND 2LEGA 1A23A 4MH2A 1ERUA 2HE3A 1EV4A 4AJ8A 2F8FA 1K3YA 5H5SA 4KDXA 1XWKA 4DSRA 4HEA2 1YKCA 4MJEA 5J5NA 2DBCA 3KP8A 3KMOA 4MF5A 5DJMA 4X0XA 1FHEA 2ZNMA 4NWYA 4ECBA 2DJ2A 3IOSA 4FO5A 2C0FA 2KP2A 2IMEA 4XRAA 3CSJA 1S3CA 2C3NA 2OACA 3A2VA 2GSSA 6GSYA 1M7TA 1O6JA 2V6KA 4ZL7A 3KCMA 3A5WA 2VL2A 2PPTA 3HVXA 3ZRDA 5ECKB 3SBCA 2H1BA 3RDWA 1GNWA 1QFNA 4F03A 2DIYA 4HJ2A 3ERFA 2RUEA 1GSUA 3KMNA 4GQFA 1LU4A 5IPHA 2FHEA 3O3TA 4EF0A 2PMTA 3ME7A 4GSSA 2FA4A 3Q6OA 3FEUA 2REMA 2L59A 1V40A 2FWFA 4IKHA 4KX4A 1ON4A 1WMJA 2VCWA 2VOCA 4TXOA 3R2QA 3GKNA 6GSXA 4NV2A 3RPPA 3ERGA 4HUAA 4K6XA 5KN1A 3ZL5A 2AJQB 3ZVJD 1KEBA 2PU9C 3C73A 2K8VA 1BX9A 1KNGA 1T4ZA 3EINA 2WJUA 1TI3A 3TKSC 1T8EB 3CSIA 4DSSB 4MPFA 2GS3A 5ECPB 2CX3A 3CXGA 1X0RA 4LL4B 3I9V2 1QQ2A 1SJ6A 1GSDA 4PQ1A 4WF5A 1OC8A 3LJRA 3Q19A 2H71A 1BJXA 1A0FA 4ZXGA 3N5OA 1SK1A 2VO4A 3GKMA 1WPIA 2CVDA 4JBBA 2KHPA 5ECNB 5JCWA 1AC1A 3CMIA 4TXOB 3DD3A 4OMVA 4PURA 3ZLPA 4MABA 2IY2A 1IYIA 5F8BA 1THXA 5JCUA 2H01A 5HR0A 5HR2A 1FW1A 4Q5FA 2I9HA 14GSA 3FK8A 2YPMA 2CAIA 5IMZA 3VPTA 2BTOT 4GCIA 2Z9SA 4KW6A 1RW1A 3UL3A 1VF3A 5E4WA 4HQSA 5ENUA 4K1FA 4IQ1A 1OAZA 4EL1A 1ZYEA 5A4WA 4F9ZA 12GSA 5CRWA 3KTBA 4WF4A 6GSWA 2CQ9A 3JCML 3IC4A 4ILFA 4D73A 3KZQA 4CDOA 4I5QA 2H0HA 2GT6A 5J9CA 3IAM2 1H4OA 5D93A 1R7HA 3ZIVA 4EO3A 3G7JA 3GA4A 1ACVA 3MSZA 1AQXA 2YJ7A 2K18A 2X8HA 4POMA 2GQKA 3LQ7A 1V2AA 3I69A 5LD0A 1V9WA 3UAPA 2RLIA 3LWAA 4RQXA 3HD5A 1X5EA 4N11A 5H5QA 4KCEA 1UVZA 1B8XA 2OE1A 1YJ6A 2M46A 4GXZA 3PH9A 3US3A 2IMDA 1JZWA 4JR6A 1G7EA 3NOFA 1AUCA 4HDEA 1XFLA 3BJ5A 1IYHA 2NBSA 3F4SA 3FHKA 2IMFA 1NHOA 3U5RE 2GSQA 4I97A 2YV7A 4NPBA 3TOUA 1GLPA 1FVJA 4NMUA 4OCEA 3LXZA 2NPBA 2WCIA 3KGKA 4WKWA 5IMAA 2R37A 4KUNA 5CREA 1EGOA 4MDCA 3H8QA 1XVQA 1SKSB 3D21A 2WULA 2YWMA 2C8UA 1GUHA 4BWSA 1EOGA 3BCIA 1DE1A 2DMLA 2C1YA 3TKSA 4EXJA 3K8NA 2R5GA 1SYRA 2YJHA 5ECMB 3TRQA 4JE1A 4NV5A 3GTUB 3BD2A 3LGCA 4TR1A 4TW5A 2OJLA 2V41A 4NXIA 2BMXA 20GSA 2DMMA 2IMIA 5EL8A 4YQUA 1OE7A 1EP8A 4YAPA 4K7IA 3W8SA 2F51A 5G5FA 2JU5A 3IK7A 1NSWA 3H79A 4XS4A 4RUVA 2HSHA 1FG4A 2YANA 1YF0A 3M9JA 5IMCA 3OR5A 3CBUA 1W4VA 3J7Yb 1LJRA 2XPEA 3KIJA 2A2SA 3KTLA 5IO2A 1U88A 4KCAA 4TN8A 1S3DA 5IIZA 2GSTA 2V2GA 3TJBA 4KSOA 4OFMA 3IPZA 4DEJA 1SK0A 2MMAA 1B4PA 4QQ7A 2GVPA 2CZ3A 3KEBA 1QMVA 3EC3A 4MLYA 4DSSA 3D5JA 1TRWA 4HZ2A 1Z7PA 1M9AA 2HZFA 2JACA 4IJ3A 1M2DA 2E7PA 1ZMAA 4CW9A 2F8AA 5DQYA 2N5FA 3F0IA 3WT1A 4ECCA 4KAEA 4OO5A 3TUEA 1G6WA 4OO4A 2B5EA 1USBA 5ECIB 3GRXA 1ZCPA 4P3YB 3GFKA 2PBJA 3ZVJA 4V2MA 2VCVA 2JSZA 2EC4A 1PA3A 3E3EA 5E59A 4KNDA 2H74A 1PSQA 1F3BA 3TKSE 3WGXA 1PGTA 5DJLA 2YOIA 4JEDA 4G10A 3F3RA 4LA1A 2H73A 3IK9A 3RBTA 2OA7A 1F6MC 1XWBA 2PGTA 2YCDA 4GRFA 5DBQA 3IXRA 4K0GA 5IMFA 2PVQA 1GUKA 1YQ1A 4XHMA 1U87A 1OKDA 3A3TA 4IP1A 1UN2A 1A2JA 4MF6A 1XWAA 3F3QA 4MF7A 3IAS2 3MAKA 3RHCA 4POLA 4RI6A 4ZL8A 3TJJA 3IHQA 3VI7A 4ACSA 1GLQA 4TVEA 2F9SA 2VAFA 1MEKA 1T00A 2B7KA 5F06A 1NHYA 4IP6A 1PD21 5AN1A 4F0BA 2HRNA 2L4QA 3EMPA 1SJZA 1DSBA 3VI5A 1G7OA 2C3QA 3N9JA 4X43A 4ZILA 2KLXA 4LL1B 3RAZA 5HR1A 3L9UA 4X1UA 3PR8A 4ZB8A 5LNKe 5DAKB 2LRCA 2QC7A 1ILOA 2MBSA 2IL3A 2A2RA 1CQHA 2CZ2A 1SJIA 4L8EA 4MZWA 4PNGA 4Q5RA 2F3MA 2FNOA 3D22A 1GTAA 2H75A 2H1DA 2B1LA 3FRCA 3QD9A 2VLVA 2LKUA 4MJAA 4D73B 4XS6A 3RHBA 8GSSA 4KH7A 1CQGA 5EPFA 2B6MA 1XBSA 5KN0A 4ZBDA 2XBQA 2CVKA 1X9MB 5CNWA 1OC9A 2GTUA 2DJ3A 1YY7A 1K3OA 1PQNA 5F07A 3GUSA 4L0WA 5B8BA 2OBKA 3TJKA 5IMDA 2IFQA 3D6IA 4QL7A 1OE8A 2LJKA 2FGXA 2VL3A 3KP9A 4NHWA 4OCFA 3HZ8A 2YZUA 2C0GA 4PGTA 1THOA 1K0MA 4POKA 2DIZA 2HT9A 3CRTA 2I3YA 2R3XA 3FR3A 1GSFA 1O8XA 1Z6MA 5KN2A 3P2AA 3LSZA 1UC7A 2WZ9A 1XCCA 4FYCA 3C7MA 3KM6A 4L5OA 1YEPA 3S9FA 4CHSA 3VWVA 2H1GA 1YEXA 5A5KA 2V6OA 1OVNA 3E0UA 2DJ0A 1ZOFA 1TTZA 5GZZB 1GRXA 4V1Ag 4ID0A 1K0CA 4Q5NA 2O7KA 4EE0A 3HCZA 1R4WA 4RI7A 2LQOA 1M2BA 2J9HA 1Z7RA 1N8JA 1SL0B 5IOXA 2LTKA 4K8MA 1JZRA 3QOUA 3CTFA 1GSEA 2DSAA 3GYKA 3TDGA 4F2IA 2EIQA 1GNEA 1HYUA 3NZNA 2LRNA 1I9DA 1JHBA 2YP6A 1SENA 2FUG2 1ZL9A 3ZFBA 4WBJA 1ZZYA 5J4UA 2FY6A 3UBKA 2WS2A 2MZCA 5H5RA 2VD1A 2N5BA 1SU9A 5IM9A 3QAVA 4BWQA 3J7Yk 5B6MA 1PRXA 3EU3A 5ABRA 4KDUA 4ULXA 5GSSA 1R5AA 1HNCA 4TR1B 3GX0A 3HY2A 2O89A 1O7UA 4IJIA 3DXBA 4FIWA 2B5YA 2ALBA 2X64A 3MNGA 3GIXA 1UA5A 1VRSD 4JU5A 3F4RA 2TRCP 3GH6A 3W8JA 1BAYA 3EMXA 2H30A 1VF4A 5L71A 2FWEA 3ED3A 2LNSA 4ZL9A 3MWHA 1HNBA 1XXUA 3DKSA 2B3SA 5A4VA 3TJGA 1AW9A 5ELGA 1AXDA 3HZ4A 1HD2A 4J2FA 1T4YA 1OYJA 5FWGA 3DYRA 3L0HA 4N0VA 1OC3A 2CAQA 2GZPA 3KD0A 2WGRA 1GTUA 5D73A 3BCKA 1R5PA 13GSA 1MDKA 3LFLA 4RQRA 1TOFA 2H70A 2DJJA 2LV3A 3CSHA 3HHVA 5J3RA 5DCHA 5LCZA 2H6ZA 1Y25A 1TRVA 1Z3EA 4V1Ap 2PERA 1S3AA 1TK5B 5IOWA 4YH2A 3GURA 5AIXA 2HYXA 5B8AA 5CP1A 2RM5A 4TOPA 1T3BA 2IWTA 2C80A 4GWRA 2A4VA 1PKWA 3IDVA 2LS5A 2HSYA 2YZHA 2K9FA 4EKZA 4GSNA 1O8WA 3GMFA 1TRUA 2HZEB 3IE3A 3G7IA 2VIMA 3ME8A 3G7YA 1WP0A 3TOTA 2M72A 4I2TA 4E8EA 2P5RA 2O8VB 1TRSA 3GSTA 1XWCA 3HVVA 4ZB9A 4BPYA 4K7OA 3CYNA 3CRUA 4MZCA 1QUWA 3VWUA 4XCSA 2DJKA 4IQAA 3ZMLA 4HJMA 3F9UA 2IN3A 2J23A 4N0ZA 3DMLA 1MDIA 1MD4A 3ZITA 2JZTA 4KSMA 3UVTA 2I4AA 2K8SA 3IA1A 3HJPA 3BBYA 2HZEA 5ECQB 2L5OA 5D9VA 2GLRA 4K7NA 1N2AA 4H86A 4MMMA 2JSYA 3VK9A 2R6KA 3Q18A 4BL7A 2AHEA 2I1UA 2RM6A 1FAAA 4N30A 2MMNA 4WXTA 3UMAA 3LG6A 4WETA 3H4KA 1R26A 2GT5A 4MA9A 2ON7A 4AJ6A 2B7JA 4K0NA 1T7PB 1ZYQB 2GZZA 2P31A 1V58A 2L4CA 5HFIA 2VCXA 5ECOB 4FYBA 2OBIA 3FW2A 2CA8A 5B7CA 1KTEA 5D9XA 1PMTA 4IVFA 3M1GA 2H0IA 1H75A 3L78A 3DGQA 4ZIJA 1WE0A 2VUPA 5COHA 4MH3A 5F05A 4KDYA 2MMOA 4XTSA 4EUYA 5ELAA 4GTUA 1LBKA 1Q98A 2IYJA 5KEJA 1ZGNA 2OE3A 1U3AA 5IQYA 4AJ7A 2EIOA 4O92A 1TDIA 4ECJA 4EVMA 1TJDA 1GTIA 2FLSA 2LUSA 5KN3A 3GKKA 2RIIA 4GSTA 1HNAA 2WRTA 1X9SB 1Z5YE 2RUFA 5ECHB 5C04A 2LNTA 4TR0A 1J9BA 3FY7A 1ML6A 3GL5A 1EWXA 5CRHA 18GSA 1V98A 3DVWA 1FB0A 4YAVA 3Q74A 19GSA 5AISA 3HA9A 3F8UA 1ERWA 1XOBA 1X5DA 4HOJA 3LYKA 2JL4A 4I8BA 3FZ5A 3WGEA 2V32A 2O85A 1EZKA 3UJ1A 1MD3A 4V2LA 3ZTLA 4O32A 1O73A 5DVBA 4TR3A 3ZREA 4EDZA 4PQIA 3KJYA 2GGTA 3VPQA 3C1SA 2VCZA 5FT3A 3DIEA 3D0ZA 4HU7A 5ID2A 4Z7XA 1XPVA 4IGJA 1M2AA 1NM3A 1Z6NA 2NVLA 1HQOA 1Z9HA 1E6BA 2YN1A 3SWLA 1BQ7A 4KGIA 3WD6A 3GX8A 4QL9A 1GP1A 2D2ZA 1ABAA 2I81A 2L6CA 1SK2A 3A2XA 5ID2B 1SD8A 4KA0A 2HXKA 1PL1A 1K0DA 2LRTA 3TB2A 1OC9B 1URMA 2VL2C 2ZUPA 2C4JA 2LSTA 3UIWA 1M0UA 2HRFA 1GUMA 2JZSA 3DRNA 3FR9A 3HYPA 2LJRA 4XRDA 1XW6A 4WR4A 4OFNA 3D4MA 4F82A 1FVKA 2N5AA 2DJ1A 3TJFA 2L6DA 1PKZA 1SL2B 4ML1A 2X8GA 5IPGA 2OADA 5B6NA 1U6TA 2KOKA 1SL1B 2HFDA 3C8EA 16GSA 1K0OA 2QSIA 3QDNA 5D8IA 1E2YA 4DVCA 3A2WA 3EYTA 1QK8A 4DSQA 1VF1A 3IRAA 3KH7A 2IJYA 4N10A 4OWYA 4LLRA 2IFQB 1BEDA 5G1LA 2C0DA 1TP9A 3C71A 4MJBA 5GSTA 5JWQB 2YNXA 1YDKA 3HDCA 3IV4A 1JZDA 5G31A 1K3LA 2H66A 3KH9A 1XZOA 5DQSA 2OE0A 3F6DA 5FHIA 4G9HA 3QFAC 5CO3A 1XOAA 5CRDA 3F6FA 2TIRA 2KP1A 2XHFA 3U6VA 4BVYA 4IW9A 1M9BA 3H1NA 2H0GA 2VLUA 3PINA 2IIYA 2E0QA 2KUCA 3HVSA 1EGRA 2P5QA 2BJXA 3APSA 1TU7A 4YQMA 3P90A 1A2MA 3GNJA 2QGVA 3ZZXA 5G2ZA 3CTGA 1GTBA 2V1MA 2H76A 2NTOA 5DCGA 4IHUA 1EEMA 2XC2A 4MP4A 2R2JA 4HU9A 4TR4A 1PN9A 1K0NA 4TRXA 3FZ4A 3ZFLA 2G2QA 1K0BA 2OKAA 1GSSA 2GQMA 3GN3A 3VLNA 1TI1A 2MYGA 1GL8A 1PL2A 1XVWA 3I43A 2IPAA 3FKFA 5DALB 4EC0A 3EVIA 5CYYA 4ZBAA 1F9MA 1TU8A 4I6XA 2ES7A 5A4UA 1RQMA 3FZAA 1YKAA 10GSA 2MMZA 3QAWA 2B1KA 2DLXA 1AQVA 4I2UA 3WYWA 1SYXA 3P8WA 2JADA 5D9WA 1WJKA 4EDYA 4PXOA 4FH8A 1XW5A 3QPMA 2X99A 2E2MA 17GSA 3C1RA 1A8YA 1X5CA 5EY6A 1VGLA 5HFGA 4IN0A 4MPGA 1WIKA 3LORA 1T1VA 3F63A 1A8LA 3TRPA 3E9JB 2ZCTA 1PX7A 1Y6EA 3O76A 4PUFC 3ZIJA 1A0RP 1XWGA 3HJOA 1FO5A 3UBLA 2YV9A 1PX6A 3UVHA 4O7HA 1DUGA 1QXHA 5DALA 4L0UA 4Q5QA 1ST9A 3TRXA 2YWOA 1GSQA 3APOA 3EE2A 1DE2A 1C72A 4ML6A 1G0TA 2VLTA 2WDUA 3W6GA 3UEMA 1YZXA 1EEJA 2C3TA 2VD0A 2EIRA 2H72A 2PWJA 2FCHA 2DC5A 3BOAA 3M0FA 6GSTA 5EVOA 2XBIA 3IBHA 4GLTA 2VCTA 1G6YA 3HKRA 3L4NA 1WOUA 5HQPA 4LMVA 1SKRB 2AV4A 4IBPA 2CX4A 2YWNA
chains in the Genus database with same CATH superfamily
1LOYA 4XS4B 2KXGA 1QJGA 3KXOA 4HM5B 1IVXA 4G19A 4IS0A 4PUAA 3GKXA 5GSPA 2JZRA 3DGYA 2DKHA 1W89A 2PVOC 2OQEC 1ASKA 1KBNA 6GSVA 5CXOA 1FOVA 1M3IA 4JRRA 4STDA 5IF6A 2P0GA 4NAXA 1JFUA 2Y74A 4MJCA 3NIVA 3UB1A 2FD3A 5M1AA 3L9SA 2BU4A 4POBA 2P05A 2GEYA 2CVBA 3QAGA 1RK4A 3UARA 3FR6A 4L8PA 1AVKA 3DWVA 3BB9A 3WGDA 5DDLA 3NHXA 3V98A 3CC43 3NBJA 2XF3A 2UGIA 5INYA 4HS1A 4J57E 3LEFA 6GSSA 3GTUA 1M99A 3HIGA 5HFKA 1ERTA 3MG1A 3SOAA 4TXVA 2HMJB 6RNTA 3PGTA 5AYRB 1G96A 3DUKA 1D6UA 1I8VA 1IV7A 3TCOA 3V1WA 3RPNA 1O7HB 5IW9A 22GSA 1I2GA 3HX8A 2IMKA 1EV9A 3QMXA 2M80A 2C4BA 4TKYA 4MNNA 1VQ73 4A5PA 2WFCA 4G2EA 2H6XA 3AGNA 4JZQA 2GQLA 3P7XA 1NB3I 3NQZA 2L5LA 1O85A 2XPDA 1B9YC 2GBWB 2FA8A 1JBRA 5C00A 1UCLA 1QGVA 1ERVA 1OACA 1OKTA 2FWHA 2QA43 4MCUA 2HLSA 3SOYA 5ECSA 1MDJA 1RHLA 3MDKA 4MZBA 1W6GA 3QRDA 1Z1SA 7STDA 3LYPA 1A24A 1ROAA 2B5XA 1B9XC 5KP1A 1O7MB 1AIUA 5D96A 4K9ZA 2VM2A 1YVBI 3VURA 3APQA 3NBRA 3DEXA 2WOFA 1SKWB 4O02B 3FZ9A 1BRIA 4O5RA 1JLVA 2YWNA 4KB3A 1BG5A 1XW9A 2XRXB 1VQ93 2CHCA 2O87A 1W01A 2HMOB 3L9VA 5ECRB 2K6VA 3QK9A 1WNHA 4ZBBA 1K0AA 1X9WB 2ON5A 4GQCA 3O6TA 1O81A 5G30A 1BSBA 4FMBA 1SD9A 3Q90A 4HM1B 2MC8A 5CAXA 1J0FA 1EOHA 3LW9A 5CRGA 4O3VA 1LXEA 3M8NA 2AB6A 3CCE3 1MTCA 3CCQ3 3EWLA 2W56A 4KFDA 5IEOA 5IO0A 2K3DA 1FOHA 2C0EA 2HI7A 4V2NA 1XG8A 2WB9A 3DGOA 3TKRA 4X2HA 1TKDB 3TKPA 1STDA 3V99A 5D9TA 5DRVA 2PN8A 11GSA 3OWYA 3QR6A 4AGSA 1VF2A 3GH9A 3WT2A 4BA7A 4RNYA 4WR5A 3KIIA 2CIUA 4WBRD 1UCJA 1I70A 4OFTA 3TKQA 2E2GA 4XIHA 3M9KA 4NHZA 3PXMA 3UL6A 4KZ1A 2AYTA 5GAPD 4MK3A 3HXSA 1UW1A 2H6YA 2UZ8A 1G02A 3I0YA 5ECLB 3LXTA 3GHAA 3GL3A 4F0CA 7GSSA 6GSPA 4FQUA 2GDRA 4XS1A 3VWXA 2X8CA 3IHGA 2Z7AA 3X3XA 1F8NA 3LXUX 4IIAA 3QFBC 1RGEA 2X4AA 3ERWA 5JWOB 3B4OA 4HM3B 1BSAA 1I5GA 3GSSA 5AIVA 3PCRA 4KT3B 4OD7A 1YF1A 2UUGC 2W9QA 2CV4A 2GZYA 4Z2TA 1GULA 1WMOA 1Q4JA 4LMWA 1GWCA 3ZYWA 4PQHA 4HZ4A 1F37A 4KE3A 4LGQA 3A76A 1NW2A 1YGEA 4R1KA 3M3MA 1KC84 3O8YA 5F0GA 2LJAA 1C7HA 2IA7A 2AAEA 1VQL3 4BVXA 2H8LA 4WEYA 1FUWA 4HI7A 1TXXA 3ISOA 2LQQA 1B4QA 2HNLA 4WHAA 2FWGA 5HOHA 1BYEA 1JN5B 1DBYA 1LNHA 3EU4A 1K41A 4Z2RA 2YWIA 1NWWA 4PX1A 4GF0A 5IMVA 3EURA 4ECIA 1Q7Y4 2AAWA 4XB5A 2MBTA 6GSUA 1VQ83 3F7SA 2WOHA 3QCPA 5AGYA 4AEQA 1A2LA 3H3HA 4IELA 1V57A 3TGZA 2E2UA 4E8HA 1X1UA 4L5LA 5G1KA 1AAZA 5G5EA 3ECFA 2H1AA 2DKIA 3AHWA 1J08A 3D4TA 5AIHA 1BUJA 3VFIA 2NDOA 1XIYA 5DAKA 4ZB6A 3UOMA 2GSRA 1JZOA 4FYUA 1WRYA 4J56E 4JR4A 1JLWA 2VCQA 2G0FA 2VM1A 4HQZA 3HOHA 1FGOA 4Q53A 4ISDA 1I0XA 1GH2A 1WWJA 2PUKC 3FLJA 3G9BA 3GV1A 4K2DA 5JWRB 4PNFA 1EP7A 2H19A 3HJMA 4AF2A 2R0CA 3X41A 1AQWA 2QKEA 3KN4A 5HR3A 2CT6A 3LTAA 4YQVA 3AY8A 3DVXA 2BMRB 3FYGA 2TRXA 1TK8B 1F3AA 3I6AA 1GSYA 5J9BA 3IR4A 1FB6A 5JCGA 1LQGC 3ZMKA 4J5GA 2VL9A 1TW9A 2STDA 1TK0B 3URPA 2R4VA 9GSSA 1IQXA 1F2EA 3H93A 3HVNA 3VWWA 2AUVA 5J41A 2XH9A 1U3IA 3F4TA 2L57A 5GAND 3K7CA 1HU9A 2LEGA 1A23A 1NO3A 1ERUA 4MH2A 2HE3A 1EV4A 4AJ8A 1VQP3 2F8FA 4PEJA 1RGKA 1K3YA 2HMKB 5H5SA 4KDXA 1BSCA 5CF2A 1XWKA 4DSRA 1SIHA 4HEA2 1YKCA 1LOXA 4MJEA 5J5NA 2DBCA 3KP8A 3KMOA 1FHEA 4MF5A 4X0XA 5DJMA 2ZNMA 1N9EA 5I97A 4NWYA 1K28A 4ECBA 1BNIA 2DJ2A 4R4KA 3IOSA 1GMPA 4IT7A 4FO5A 1RRLA 2KAAA 1LOWA 4XBXA 1RNTA 2C0FA 2KP2A 2IMEA 4XRAA 2KF6A 1CH0A 2B24B 3CSJA 1S3CA 2C3NA 2OACA 2Q07A 3A2VA 2X49A 7GSPA 2GSSA 6GSYA 3B4PA 1M7TA 1O6JA 2V6KA 4ZL7A 3KCMA 3A5WA 2VL2A 3WHOA 4K61A 2PPTA 3HVXA 3ZRDA 5ECKB 3SBCA 1UGIA 3X40A 2H1BA 3RDWA 3LT8A 1GNWA 1QFNA 3HI7A 2DIYA 4F03A 4HJ2A 3ERFA 1LQMB 2RUEA 1KQS2 1GSUA 1BANA 1RMSA 4EXRA 3KMNA 4GQFA 1RJOA 1LU4A 3DGNA 1L5GB 4CY6A 5IPHA 2FHEA 3O3TA 2Z76A 4EF0A 1BRSA 2PMTA 3ME7A 4GSSA 2FA4A 3Q6OA 3FEUA 2REMA 2L59A 1V40A 4BU4A 2FWFA 4IKHA 4KX4A 1ON4A 4G0KA 4MMXB 1WMJA 2B1XB 2VCWA 2VOCA 5FW5A 3K0ZA 4TXOA 1CQSA 4HBRA 1IVWA 3DY5A 1I0VA 4EBGA 4I4KA 1TIJA 3R2QA 4XM4A 1GS3A 3GKNA 2OCTA 6GSXA 3DMCA 4NV2A 3RPPA 3ERGA 4HUAA 1MWUA 3BNEA 1IT7A 4K6XA 5KN1A 1O7PB 3ZL5A 2AJQB 2WGQA 1GY6A 3ZVJD 1KEBA 2PU9C 3C73A 2K8VA 1BX9A 4HSCX 1KNGA 1T4ZA 3EINA 2WJUA 1YGWA 1TI3A 3WOFB 3TKSC 1N9JA 4K1VA 1PFOA 1T8EB 4KVHA 5EVHA 3CSIA 3FH1A 1GSPA 4DSSB 2W9PA 2GXFA 1BRKA 1ZYPA 4MPFA 2GS3A 5ECPB 2CX3A 3CXGA 3L0RA 1X0RA 4CDLA 4LL4B 2HMNB 3I9V2 1QQ2A 1SJ6A 2CFLA 3BNCA 4R80A 1GSDA 4PQ1A 4WF5A 1OC8A 3LJRA 3Q19A 1FGQA 2H71A 4X4JA 1BJXA 3RDEA 3FF2A 1A0FA 4ZXGA 3RNTA 3N5OA 1SK1A 2VO4A 3GKMA 2C10A 1WPIA 2CVDA 4JBBA 2BHMA 2KHPA 3S67A 5ECNB 5JCWA 1W5ZA 1AC1A 3CMIA 2WO0A 1YJ93 4TXOB 4G0IA 3DD3A 4OMVA 3FKAA 5AIFA 4PURA 1NNVA 5D83A 3ZLPA 3NUVA 4HM7B 4GL6A 4MABA 2IY2A 1IYIA 3AMOB 5F8BA 3LZAA 1THXA 5JCUA 2H01A 1A67A 5FGOA 5HR0A 5HR2A 1FW1A 4Q5FA 2F86B 2I9HA 3EBTA 14GSA 3FK8A 2IUJA 2YPMA 1R4YA 2CAIA 4O5QA 3Q3FA 1E97A 3FG4A 2W03A 5IMZA 3VPTA 1TU5A 2BTOT 4GCIA 3N9HA 2Z9SA 4KW6A 2OOVA 1K9M4 1RW1A 1N5HA 2P0XA 3UL3A 1VF3A 1SQWA 1J2BA 5E4WA 3DXOA 4HQSA 5ENUA 3LH4A 4K1FA 4HVNA 1JB5A 5IG5A 4IQ1A 1UGHI 2J8XB 1OAZA 1FA3A 4EL1A 1ZYEA 5A4WA 3SYUA 4F9ZA 12GSA 5CRWA 3KTBA 3LTBA 4WF4A 4EV5A 6GSWA 2CQ9A 3JCML 3Q1CA 3A5EA 3IC4A 4ILFA 1TUHA 1W02A 3EE1A 4D73A 3KZQA 2SBLA 4CDOA 4WYKA 4EV2A 2H0HA 4I5QA 2GT6A 5J9CA 3IAM2 4IPBA 1H4OA 3WODG 5D93A 1R7HA 1D6YA 2CX0A 3ZIVA 4EO3A 3G7JA 2BIRA 5AI1A 3GA4A 1RGCA 1YJW3 1ACVA 3MSZA 1AQXA 3ZG0A 4HZ9B 2YJ7A 2K18A 2X8HA 4POMA 2GQKA 1GOYA 3LQ7A 1V2AA 3I69A 5LD0A 1V9WA 1HKXA 4TX4A 3UAPA 2RLIA 3LWAA 4RQXA 3NM7A 1X5EA 3HD5A 4N11A 3F8XA 5H5QA 3MWZA 1W6CA 4KCEA 1HYFA 1UVZA 4WYKB 1B8XA 2OE1A 1YJ6A 2M46A 4GXZA 3CNXA 1RGGA 3PH9A 3US3A 2IMDA 2XFSA 1JZWA 4JR6A 3EX9A 1G7EA 3NOFA 1Y4KA 1AUCA 1GYBA 2P38A 4HDEA 1BNGA 1XFLA 3EPTA 3BJ5A 1IYHA 2NBSA 5BXQA 3F4SA 4CY8A 3FHKA 2IMFA 2RNTA 1NHOA 3U5RE 4ICYA 1TRPA 2GSQA 4I97A 3SXXA 1A2KA 4FCZA 3R3EA 2YV7A 4NPBA 3TOUA 3EJVA 5CF1A 1GLPA 2QA2A 4RNTA 2CWTA 1FVJA 4NMUA 4OCEA 3CCU3 3LXZA 2NPBA 3I563 2WCIA 3JUNA 4FMAA 5ELUA 3KGKA 4WKWA 5IMAA 3D9RA 2R37A 3S27A 4KUNA 5CREA 1EGOA 1DMQA 3H8QA 1XVQA 4MDCA 3WOEB 1U8CB 4K90B 2QGUA 1SKSB 3D21A 1T5YA 2WULA 2Z77A 2C8UA 2YWMA 4O8SA 5ELJA 3FF0A 2CKFB 1GUHA 2F5MA 4O2HA 4BWSA 1EOGA 3BCIA 1DE1A 1IDPA 1MGRA 2DMLA 2C1YA 3TKSA 1T2IA 4EXJA 3K8NA 2R5GA 1SYRA 1IYYA 4R9LA 2YJHA 5ECMB 2RGQA 3TRQA 1ZS7A 3K63A 4JE1A 4NV5A 2W2CA 1RCLA 1LVNA 3GTUB 3BD2A 3LGCA 4TR1A 4TW5A 2OJLA 4BVXB 3CU3A 3RGRA 2V41A 1YHQ3 4NXIA 2BMXA 3KKGA 20GSA 2DMMA 1I3FA 1RSNA 2IMIA 5EL8A 1GMQA 4YQUA 1OE7A 1QAFA 1EP8A 1PU4A 4YAPA 4K7IA 5D82A 3WMDA 3W8SA 2F51A 5G5FA 1BIRA 2JU5A 3HK4A 3PS8A 1FGTA 3IK7A 1NSWA 2V1LA 3K5TA 3STDA 4K2XA 2C11A 3EQQB 3OXAA 3H79A 4XS4A 2GU3A 4RUVA 1I2FA 1W6YA 2HSHA 1FG4A 2YANA 1YF0A 3M9JA 3BIRA 4YKGA 2A2PA 5IMCA 3CCS3 3OR5A 1IVUA 3CBUA 4Z2UA 3EC9A 5AIGA 1W4VA 3J7Yb 3ZG5A 1YNVX 3EBYA 1LJRA 2XPEA 3LT9A 1B2SA 3T8UA 1VQN3 3KIJA 2A2SA 8CHOA 3FSDA 3KTLA 5IO2A 1U88A 1RGHA 3F8HA 4KCAA 5AEWB 4TN8A 1S3DA 5IIZA 1GD3A 2YFJB 2GSTA 2GBXB 2V2GA 3TJBA 4KSOA 1CEWI 4OFMA 3F14A 3IPZA 4DEJA 4NHFA 1GOUA 1SK0A 1IVVA 3UL5A 3AHSA 3MHEA 2MMAA 1KSIA 1B4PA 4QQ7A 2GVPA 1UUGB 2CZ3A 2A15A 3KEBA 2CG0A 1QMVA 3EC3A 4MLYA 3NV0A 4DSSA 3D5JA 1TRWA 4HZ2A 1Z7PA 1M9AA 3U1WA 2HZFA 2JACA 1IT8A 4G1MB 4IJ3A 1UUVB 1FZUA 1M2DA 2E7PA 3MPHA 1ZMAA 2CWUA 4CW9A 2F8AA 1O7WB 5DQYA 2R4IA 1X1YA 1MNLA 2N5FA 4HM0B 3AMOA 3GAXA 2R0PA 3F0IA 3WT1A 4ECCA 4KAEA 4OO5A 3TUEA 4BIKA 1G6WA 4OO4A 2B5EA 1USBA 5ECIB 1N8QA 3GRXA 1ZCPA 4P3YB 3GFKA 3IC8A 3BNBA 2PBJA 3ZVJA 2K0MA 4V2MA 2VCVA 1JRQA 2YFIB 2JSZA 2EC4A 3MIXA 1JV2B 1PA3A 3E3EA 5E59A 4KNDA 2H74A 1PSQA 1BNJA 1F3BA 1BUQA 3TKSE 3G4S3 3WGXA 4J5KA 1EUIC 3S28A 1PGTA 2YOIA 5DJLA 4JEDA 4EIPA 4RZMA 3CCV3 4G10A 1EKMA 3F3RA 4LA1A 2H73A 3IK9A 5TGNA 2D1WA 1C54A 2CWVA 3RBTA 1ISKA 2OA7A 1F6MC 1XWBA 2PGTA 2YCDA 1OGXA 4GRFA 4HM6B 2M7OA 1NB5I 5DBQA 3IXRA 5D81A 4K0GA 5IMFA 4FR9A 1FGRA 1LRAA 1GUKA 2PVQA 1YQ1A 5M19A 4XHMA 2YFLB 5G2GA 2O3OA 1U87A 3WR2A 1OKDA 1LNIA 3A3TA 4IP1A 4G0LA 1DMNA 3D4AA 2Y73A 4HOHA 2BNGA 1UN2A 1A2JA 1VZZA 1XWAA 3ZFZA 3F3QA 1BOXA 4MF6A 3IAS2 4MF7A 3MAKA 2F5WA 1AQZA 3RHCA 5KOWA 4POLA 4RI6A 4ZL8A 4EC6A 3TJJA 2LYXA 1S3RA 3IHQA 3VI7A 4ACSA 1GLQA 4TVEA 3GZYB 2F9SA 2CC3A 2VAFA 1MEKA 1T00A 2B7KA 5F06A 1NHYA 1Q824 4BVYB 4IP6A 1PD21 5AN1A 1MWRA 4F0BA 2HRNA 2L4QA 2CFDA 4N6OB 3EMPA 1SJZA 1DSBA 1EA2A 5AEUB 3VI5A 1G7OA 2C3QA 3N9JA 4X43A 2PZVA 1NU3A 3RGAA 4ZILA 2KLXA 4LL1B 4RNZA 3RAZA 5HR1A 5JBSA 3L9UA 4X1UA 3PR8A 5BIRA 3HZPA 4ZB8A 4LMIA 5DAKB 2LRCA 5LNKe 2QC7A 1ILOA 1S723 2MBSA 2IL3A 2BO9B 3KFQC 2A2RA 1CQHA 2OTL3 2CZ2A 1SJIA 4XDVA 3S29A 3JUOA 4L8EA 4MZWA 4PNGA 1BRNL 4Q5RA 2F3MA 2FNOA 3D22A 1GTAA 2H75A 2H1DA 1WQLB 2B1LA 3FRCA 3QD9A 2VLVA 1VQQA 3D5GA 4HZBB 1BRJA 2LKUA 4MJAA 4D73B 4XS6A 3RHBA 8GSSA 4KH7A 1JNQA 1CQGA 5EPFA 2XGLA 2B6MA 1XBSA 1EQKA 5KN0A 4ZBDA 2XBQA 2CVKA 1MOLA 1X9MB 5CNWA 1OC9A 2CG1A 2GTUA 3FMWA 3GZXB 3NV0B 2DJ3A 1YVSA 1K3OA 1YY7A 1PQNA 1DETA 2ML6A 5F07A 1RNBA 3GUSA 4HKVB 4L0WA 5B8BA 2OBKA 1SIIA 4HM8B 1YIJ3 3TJKA 5IMDA 5DREA 2IFQA 3D6IA 1W7CA 4PTSA 3DZLA 4QL7A 1OE8A 2LJKA 2FGXA 2VL3A 1OHPA 3KP9A 4NHWA 4OCFA 3HZ8A 3LTCA 4HYZA 2YZUA 2C0GA 3PGBA 4PGTA 1THOA 1K0MA 4POKA 2DIZA 2HT9A 3CRTA 2I3YA 1Q40A 5LC7A 1DVDA 2R3XA 1GSFA 1O8XA 3FR3A 1Z6MA 5KN2A 3P2AA 3LSZA 1UC7A 2WZ9A 1O7GB 1FUSA 1XCCA 4FYCA 3C7MA 3KM6A 5KOXA 5IG3A 4H3UA 4L5OA 1YEPA 3S9FA 4CHSA 3VWVA 2HMMB 2H1GA 1YEXA 5A5KA 2INXA 1AR0A 2V6OA 1OVNA 3E0UA 1NJI4 1E3RA 1GY7A 2DJ0A 1ZOFA 1TTZA 5GZZB 2KF3A 2W6JH 1W2ZA 1GRXA 4V1Ag 4ID0A 1K0CA 4Q5NA 2O7KA 4EE0A 2BT3A 1GMRA 3HCZA 1R4WA 2R41A 3M8CA 4RI7A 2LQOA 1M2BA 4BL7B 2P09A 2J9HA 1Z7RA 4N6UA 3EF8A 2E2VA 3KCHA 3SVAA 1N8JA 1W00A 3PPUA 1SL0B 5IOXA 2LTKA 2KF4A 4K8MA 4HJLB 4H61A 1JZRA 3QOUA 3CTFA 1GSEA 3NQYA 1CYUA 2DSAA 3CMA3 3GYKA 3TDGA 4F2IA 2FGTA 3E99A 2EIQA 1K8A4 3ALAA 4N6NB 1GNEA 1HYUA 3NZNA 2LRNA 1I9DA 1JHBA 2YP6A 4L7KA 1SENA 3WA3A 3KE7A 2GEXA 2FUG2 1ZL9A 4OK0A 1RN1A 3ZFBA 3IPTA 4WBJA 1ZZYA 5J4UA 4RBNA 1DYUA 3CCL3 2FY6A 3UBKA 3NBBA 2WS2A 1Q864 2MZCA 3G0KA 5H5RA 1W4NA 1Q9EA 1IU7A 2VD1A 3K9MC 2N5BA 1BNFA 1SU9A 5IM9A 3QAVA 4BWQA 3J7Yk 5B6MA 3KZTA 2RSXA 1PRXA 3EU3A 5ABRA 4KDUA 2XSHB 4ULXA 2OWPA 1MWSA 5GSSA 1O7NB 1M1XB 5EEOA 4EW5A 1R5AA 1PYLA 2PNCA 1HNCA 4TR1B 3FZWA 3GX0A 3HY2A 5LC6A 2O89A 4X2OA 1BGSA 1O7UA 4IJIA 3DXBA 4FIWA 3I553 2HRAA 1T2HA 3D3LA 2B5YA 2ALBA 3G16A 2X64A 1W2B2 3MNGA 3WA2X 3GIXA 1UA5A 1VRSD 4JU5A 1GOVA 1OGZA 2KRTA 2TRCP 3F4RA 3GH6A 3W8JA 2AADA 2KF5A 1BAYA 3EMXA 2H30A 2ZA4A 1LOVA 1VF4A 2FWEA 5L71A 3ED3A 3PCSA 1TRQA 2IMJA 2LNSA 3G6E3 2OQEA 4ZL9A 1B27A 3MWHA 1HNBA 1JKGA 1ZO2A 2WGOA 1XXUA 3DKSA 2B3SA 5A4VA 3NX0A 1RN4A 2RFRA 3TJGA 3DGMA 2XEPA 1AW9A 4QWTA 1B2ZA 5ELGA 1AXDA 3HZ4A 1HD2A 2YX9A 4J2FA 2SARA 1T4YA 1QMAA 1OYJA 3KSED 1KWIA 5FWGA 2O9UX 3DYRA 3L0HA 4N0VA 2QA1A 1OC3A 2CAQA 2GZPA 1VQO3 1KD14 3KD0A 3OWUA 4FCJA 4FCMA 2WGRA 5IENA 2GSPA 1GTUA 2QEX3 5D73A 1X1XA 4GSPA 3BCKA 1R5PA 3SEDA 13GSA 1MDKA 3LFLA 1K734 4RQRA 1TOFA 2H70A 2DJJA 1HZ1A 2LV3A 1ZYNA 3CSHA 4WWUC 3HHVA 5J3RA 5DCHA 5LCZA 2H6ZA 1Y25A 1TRVA 1Z3EA 4V1Ap 2PERA 8RNTA 3SLUA 1S3AA 1TK5B 3FCSB 5IOWA 4YH2A 4GHOA 3GURA 3SX1A 2HYXA 5AIXA 3Q2PA 5B8AA 5CP1A 2RM5A 4TOPA 1T3BA 4R9KA 2IWTA 2C80A 2FXTA 4GWRA 1OHSA 2A4VA 1GD4A 3B8LA 1PKWA 3IDVA 3LOYA 2LS5A 2HSYA 2HOHA 2YZHA 1RTUA 2JQ5A 2K9FA 4EKZA 1BSDA 4DKIA 4MMZB 4GSNA 3GRDA 1O8WA 2HSMA 1TRUA 2ZL8A 2HZEB 3GMFA 3IE3A 1ULJB 2KCDA 3G7IA 3GWRA 2VIMA 3ME8A 3G7YA 1JJ22 1WP0A 3TOTA 2M72A 4I2TA 1RGAA 1OH0A 4E8EA 2P5RA 2O8VB 1TRSA 3GSTA 1BSEA 1XWCA 3HVVA 4ZB9A 4BPYA 4K7OA 3CYNA 3CRUA 4MZCA 1QUWA 2A4HA 3VWUA 4XCSA 4JF8A 4XBTA 1N8R4 2DJKA 1UDII 4IQAA 3ZMLA 4HJMA 3F9UA 2IN3A 2J23A 4N0ZA 3DMLA 1MDIA 1MD4A 4L8OA 3ZITA 1RDSA 2JZTA 2MF7A 4KSMA 3UVTA 2I4AA 2K8SA 3IA1A 1RLSA 3HJPA 3BBYA 2HZEA 4J8TA 5ECQB 2L5OA 5D9VA 2GLRA 2F99A 4K7NA 4EIQA 1N2AA 4H86A 4MMMA 2JSYA 1DVCA 3VK9A 2R6KA 3Q18A 4N6MA 4ZM8A 3ER7A 4BL7A 2F4YA 2AHEA 9RNTA 2I1UA 2RM6A 1FAAA 4N30A 2MMNA 5IG4A 2OTJ3 4WXTA 3UMAA 3LG6A 4WETA 3NM2A 3H4KA 1SARA 1R26A 1PY3A 3UNLA 1PN0A 2GT5A 3AGOA 5IEPA 4MA9A 2ON7A 1BNSA 4AJ6A 2B7JA 5BU4A 5KP4A 4K0NA 1ZYQB 1T7PB 2GZZA 3VSYA 5BVBA 3T8NA 1EG9B 2P31A 1V58A 1ZX2A 2RBIA 2L4CA 5HFIA 2VCXA 3OX9A 5ECOB 2L4VA 1YJN3 3EB8A 4MJDA 1DE3A 4FYBA 4KFEA 3CD63 2Z6BA 2OBIA 4BTXA 3FW2A 1GY5A 2CA8A 5B7CA 1KTEA 5D9XA 1MGWA 1PMTA 2RCDA 4IVFA 3M1GA 2H0IA 1H75A 4NREA 3L78A 3HIIA 3DGQA 4ZIJA 4BL2A 1WE0A 1ULIB 3X3ZA 2VUPA 5COHA 4MH3A 3JUPA 5F05A 4KDYA 2MMOA 4XTSA 4EUYA 5ELAA 2K54A 4GTUA 2CFKA 1LBKA 1Q98A 1AVLA 2IYJA 5KEJA 1ZGNA 1QAKA 2OE3A 1U3AA 5A0OB 1UUWB 2F56A 5IQYA 1B3SA 4AJ7A 2EIOA 3GZBA 6STDA 4O92A 1TDIA 4ECJA 4EVMA 1TJDA 1GTIA 2FLSA 2LUSA 1OUNA 5KN3A 1QVF2 2ZHXB 3GKKA 3VF1A 2RIIA 4GSTA 3EHCA 1HNAA 2F98A 2WRTA 1X9SB 1Z5YE 2RUFA 1B2XA 3B7CA 5ECHB 5C04A 2LNTA 1QVG2 1AY7A 4TR0A 1J9BA 3FY7A 1ML6A 3UJMA 3GL5A 1EWXA 3GSPA 5CRHA 18GSA 1V98A 3DVWA 3WDGB 3MG2A 1SPUA 1FB0A 4YAVA 3Q74A 4XBYA 19GSA 5AISA 3HA9A 3F8UA 1ERWA 1XOBA 1Q42A 1VQM3 1M3JA 1JB2A 3J7Yd 1I2EA 1X5DA 4FMDA 4CJNA 4HOJA 1BU4A 3LYKA 1PFPA 2UX0A 2JL4A 4I8BA 3FZ5A 3WGEA 1UCKA 2CW9A 1B2UA 3U97A 2V32A 4KFFA 2O85A 1EZKA 3UJ1A 2XSOB 1A2VA 1VQK3 1MD3A 4K1UA 4V2LA 1N5PA 1RGLA 3ZTLA 1STFI 4O32A 2IUKA 1O73A 5DVBA 4OUQA 4TR3A 3ZREA 4EDZA 2ML5A 4PQIA 3KJYA 2GGTA 2XFTA 3VPQA 1A2PA 1FYSA 3C1SA 2VCZA 5FT3A 3DIEA 3D0ZA 1WMNA 4HU7A 3G713 5ID2A 4Z7XA 1XPVA 1DMMA 4N3VA 4IGJA 1M2AA 1NM3A 1Z6NA 2NVLA 1HQOA 1Z9HA 1IQYA 1E6BA 4O5UA 2YN1A 3SWLA 2D42A 1BRHA 1BQ7A 4KGIA 1FGMA 3WD6A 3GX8A 4QL9A 1GP1A 2CFGA 4K5RA 3MYTA 2D2ZA 1Q7HA 1ABAA 2W56B 2I81A 5RNTA 2L6CA 1SK2A 3A2XA 5ID2B 3GZRA 1SD8A 4KA0A 2CX1A 4N6V0 2HXKA 1OF5B 1PL1A 1V74A 5CLKA 1K0DA 2LRTA 3TB2A 1BNRA 1OC9B 1URMA 1WTHA 3BNDA 2VL2C 4N6LA 2ZUPA 2C4JA 2LSTA 4FMCA 3UIWA 3X3YA 1M0UA 4HAAA 2HRFA 3F40A 4GB5A 3VGNA 5IERA 1GUMA 2JZSA 3DRNA 3FR9A 3HYPA 2LJRA 4XRDA 1UCIA 4OVMA 1XW6A 4WR4A 1Q814 4OFNA 3D4MA 4F82A 2L1SA 1U5OA 3CNMA 1FVKA 2N5AA 2DJ1A 4J9AA 5JPUA 1VQ43 1BRGA 3TJFA 2L6DA 1PKZA 1SL2B 4ML1A 2X8GA 5IPGA 2OADA 4ORLA 4MMYB 5JPPA 1U6TA 5B6NA 2KOKA 5IG0A 1SL1B 2HFDA 1QALA 1X1WA 3C8EA 1E3VA 1CYVA 16GSA 1K0OA 1IV9A 2QSIA 3QDNA 5D8IA 1BAOA 1E2YA 4DVCA 3A2WA 4USSA 3PYJA 4WP5A 4AKYA 3EYTA 1QK8A 1VQ53 1VF1A 4DSQA 1TFKA 3N8BA 4LEHA 3IRAA 3KSPA 3X42A 4LZIA 3EN8A 3KH7A 2IJYA 4N10A 4OWYA 4LLRA 2IFQB 1BEDA 5G1LA 3F7XA 2CFWA 2XGNA 4JRFA 2C0DA 4WFOA 1TP9A 3C71A 3JUMA 4MJBA 5GSTA 3BLZA 5JWQB 2YNXA 1YDKA 3HDCA 3IV4A 1JZDA 3F9SA 3PZWA 5G31A 2BMQB 1K3LA 2H66A 1BNEA 3KH9A 1XZOA 1OPYA 1OF5A 5DQSA 2OE0A 3F6DA 5CK6A 5FHIA 4G9HA 4XDWA 1ROVA 3QFAC 1R4CA 2ZDJA 5CO3A 2I9WA 1XOAA 5CRDA 3F6FA 2TIRA 2KP1A 2XHFA 3U6VA 4BVYA 4IW9A 1M9BA 1RRHA 3JVCA 3H1NA 4N6TA 3CXC2 1YIT3 2H0GA 2VLUA 3PINA 2IIYA 2E0QA 2KUCA 3HVSA 3LTDA 1EGRA 2P5QA 2BJXA 3APSA 3IMAB 1TU7A 3DM8A 3EN1B 4U13A 4YQMA 2QIYA 3P90A 1Q40B 1A2MA 3GNJA 4CCVA 2QGVA 2P0MA 1B2MA 3ZZXA 5G2ZA 3CTGA 1GTBA 2V1MA 3BU4A 3MG3A 2H76A 2NTOA 5DCGA 4IHUA 3MSOA 4MEIA 1OHOA 1EEMA 1B21A 3FG3A 2XC2A 4MP4A 2R2JA 4HU9A 4TR4A 1PN9A 1K0NA 4HM2B 3DGLA 4TRXA 3FZ4A 1JBSA 3ZFLA 2G2QA 1K0BA 1RGFA 1TP6A 2HRKA 2OKAA 1GSSA 3OW22 2GQMA 3GN3A 1NDOB 4EYCA 3VLNA 1TI1A 3CC73 4KF9A 2OOVC 2GU1A 2MYGA 1IK3A 1GL8A 1FW7A 1PL2A 1XVWA 2R0GA 1AV4A 2E2TA 3CC23 1JN5A 3I43A 3N54B 1JB4A 2IPAA 3FKFA 5DALB 4EC0A 3FGYA 3EVIA 1VQ63 5CYYA 5STDA 4ZBAA 5M18A 1RN7A 1F9MA 1TU8A 4I6XA 3S5CA 2ES7A 2XR8B 5A4UA 1RQMA 3FZAA 1OCVA 1YKAA 2JDIH 10GSA 2MMZA 5KP3A 3CME3 3CQFA 3QAWA 2B1KA 2DLXA 1AQVA 3OWSA 2LQVA 4I2UA 3WYWA 3OV4A 1SYXA 3H51A 3P8WA 2HMLB 2JADA 5D9WA 1WJKA 4EDYA 2CK3H 4PXOA 4BIRA 5EQLA 4FH8A 2CH9A 1SJWA 1IQ8A 1BVIA 7RNTA 1XW5A 3QPMA 2X99A 2E2MA 4LYLB 17GSA 2FNQA 3C1RA 1A8YA 1X5CA 4CPKA 3D79A 5EY6A 1VGLA 1ZGXA 5HFGA 4BTWA 4IN0A 4MPGA 1WIKA 1UI8A 3LORA 1T1VA 3F63A 1M9GA 1A8LA 3TRPA 3CCR3 3CPW2 3E9JB 3G8ZA 2ZCTA 1PX7A 3JUQA 2W0QA 1Y6EA 4YKFA 3MKIA 2W04A 3O76A 4PUFC 3ZIJA 1A0RP 1XWGA 1TTOA 5AYSC 3HJOA 1B20A 3D5IA 3UBLA 1FO5A 1YI23 3IJEB 2YV9A 4BL3A 1PX6A 1RCKA 4AKZA 3UVHA 4O7HA 1DUGA 1QXHA 5DALA 4L0UA 5BRTA 1A90A 4Q5QA 1ST9A 5HGRA 3TRXA 3CCJ3 2YWOA 1UI7A 1WMPA 1GSQA 2BMOB 1FUTA 3APOA 3EE2A 1DE2A 5AIIA 1C72A 4ML6A 1G0TA 2VLTA 3CCM3 2WDUA 4HM4B 3W6GA 3UEMA 1YZXA 1MWTA 1US1A 1EEJA 1M1K4 1M904 2C3TA 2VD0A 4K5SA 1I3IA 3LYGA 2EIRA 2H72A 2PWJA 1JKGB 2FCHA 2DC5A 1TFOA 3MYDA 3BOAA 3M0FA 3FG1A 1RKYA 6GSTA 3NXJA 5EVOA 2XBIA 3T0UA 1D6ZA 1S5AA 4BTYA 3CPOA 3IBHA 4GLTA 3DH2A 2VCTA 3LMLA 3V92A 5BMUA 1G6YA 3HKRA 1JBTA 3A5IA 4LSOA 3L4NA 1WOUA 5HQPA 4LMVA 1SKRB 3ROBA 2AV4A 2CX4A 4IBPA 1B48A
chains in the Genus database with same CATH topology
4XS4B 4G19A 3KXOA 4IS0A 4PUAA 3GKXA 2JZRA 2DKHA 1W89A 2PVOC 1KBNA 6GSVA 1FOVA 4JRRA 2P0GA 4NAXA 1JFUA 4MJCA 3NIVA 2FD3A 3L9SA 4POBA 2CVBA 3QAGA 1RK4A 3UARA 3FR6A 3DWVA 3WGDA 5DDLA 5INYA 4HS1A 4J57E 3LEFA 6GSSA 3GTUA 1M99A 5HFKA 1ERTA 4TXVA 3PGTA 1B48A 3TCOA 3V1WA 3RPNA 22GSA 2IMKA 1EV9A 3QMXA 2M80A 4TKYA 4MNNA 4A5PA 2WFCA 4G2EA 2H6XA 4JZQA 2GQLA 3P7XA 2L5LA 1O85A 2XPDA 1B9YC 5C00A 2FA8A 1QGVA 1ERVA 1OKTA 2FWHA 5ECSA 4MCUA 2HLSA 1MDJA 3MDKA 4MZBA 3LYPA 1A24A 2B5XA 1B9XC 1AIUA 5D96A 4K9ZA 2VM2A 3VURA 3APQA 3DEXA 1SKWB 3FZ9A 4O5RA 1JLVA 4KB3A 1BG5A 1XW9A 2O87A 3L9VA 5ECRB 2K6VA 4ZBBA 1K0AA 1X9WB 2ON5A 4GQCA 3O6TA 1O81A 5G30A 1SD9A 5CAXA 1J0FA 1EOHA 3LW9A 5CRGA 3M8NA 2AB6A 1MTCA 3EWLA 5IO0A 1FOHA 2C0EA 2HI7A 4V2NA 2WB9A 3TKRA 1TKDB 3TKPA 5D9TA 11GSA 2PN8A 3QR6A 4AGSA 1VF2A 3GH9A 3WT2A 4BA7A 4WR5A 4WBRD 4OFTA 3TKQA 2E2GA 4XIHA 3M9KA 4NHZA 2AYTA 5GAPD 4MK3A 3HXSA 2H6YA 2UZ8A 5ECLB 3LXTA 3GHAA 3GL3A 4F0CA 7GSSA 4FQUA 2GDRA 4XS1A 3VWXA 2X8CA 3IHGA 3QFBC 2X4AA 3ERWA 5JWOB 1I5GA 3GSSA 5AIVA 4OD7A 1YF1A 4Z2TA 2CV4A 2GZYA 1GULA 1Q4JA 4LMWA 1GWCA 3ZYWA 4PQHA 4HZ4A 1F37A 4KE3A 1NW2A 3M3MA 5F0GA 2LJAA 4BVXA 2H8LA 4WEYA 4HI7A 1TXXA 3ISOA 2LQQA 1B4QA 2HNLA 2FWGA 1BYEA 1DBYA 3EU4A 4Z2RA 2YWIA 4PX1A 4GF0A 5IMVA 3EURA 4ECIA 2AAWA 2MBTA 6GSUA 3QCPA 5AGYA 1A2LA 4IELA 1V57A 3TGZA 4E8HA 4L5LA 5G1KA 1AAZA 5G5EA 2H1AA 2DKIA 1J08A 3D4TA 3VFIA 2NDOA 1XIYA 5DAKA 4ZB6A 3UOMA 2GSRA 1JZOA 4FYUA 1WRYA 4J56E 4JR4A 1JLWA 2VCQA 2G0FA 2VM1A 4HQZA 4ISDA 1GH2A 1WWJA 2PUKC 3G9BA 3GV1A 4K2DA 5JWRB 4PNFA 1EP7A 2H19A 3HJMA 4AF2A 2R0CA 1AQWA 2QKEA 5HR3A 2CT6A 4YQVA 3AY8A 3DVXA 3FYGA 2TRXA 1TK8B 1F3AA 3I6AA 1GSYA 5J9BA 3IR4A 1FB6A 5JCGA 3ZMKA 2VL9A 1TW9A 1TK0B 2R4VA 9GSSA 1F2EA 3H93A 3VWWA 2AUVA 5J41A 1U3IA 3F4TA 2L57A 5GAND 2LEGA 1A23A 4MH2A 1ERUA 2HE3A 1EV4A 4AJ8A 2F8FA 1K3YA 5H5SA 4KDXA 1XWKA 4DSRA 4HEA2 1YKCA 4MJEA 5J5NA 2DBCA 3KP8A 3KMOA 4MF5A 5DJMA 4X0XA 1FHEA 2ZNMA 4NWYA 4ECBA 2DJ2A 3IOSA 4FO5A 2C0FA 2KP2A 2IMEA 4XRAA 3CSJA 1S3CA 2C3NA 2OACA 3A2VA 2X49A 2GSSA 6GSYA 1M7TA 1O6JA 2V6KA 4ZL7A 3KCMA 3A5WA 2VL2A 2PPTA 3HVXA 3ZRDA 5ECKB 3SBCA 2H1BA 3RDWA 1GNWA 1QFNA 4F03A 2DIYA 4HJ2A 3ERFA 2RUEA 1GSUA 3KMNA 4GQFA 1LU4A 4CY6A 5IPHA 2FHEA 3O3TA 4EF0A 2PMTA 3ME7A 4GSSA 2FA4A 3Q6OA 3FEUA 2REMA 2L59A 1V40A 2FWFA 4IKHA 4KX4A 1ON4A 4G0KA 1WMJA 2VCWA 2VOCA 4TXOA 3R2QA 3GKNA 6GSXA 4NV2A 3RPPA 3ERGA 4HUAA 4K6XA 5KN1A 3ZL5A 2AJQB 3ZVJD 1KEBA 2PU9C 3C73A 2K8VA 1BX9A 1KNGA 1T4ZA 3EINA 2WJUA 1TI3A 3TKSC 1T8EB 3CSIA 4DSSB 1ZYPA 4MPFA 2GS3A 5ECPB 2CX3A 3CXGA 1X0RA 4LL4B 3I9V2 1QQ2A 1SJ6A 1GSDA 4PQ1A 4WF5A 1OC8A 3LJRA 3Q19A 2H71A 4X4JA 1BJXA 1A0FA 4ZXGA 3N5OA 1SK1A 2VO4A 3GKMA 1WPIA 2CVDA 4JBBA 2KHPA 5ECNB 5JCWA 1AC1A 3CMIA 4TXOB 4G0IA 3DD3A 4OMVA 4PURA 3ZLPA 4MABA 2IY2A 1IYIA 5F8BA 1THXA 5JCUA 2H01A 5HR0A 5HR2A 1FW1A 4Q5FA 2I9HA 14GSA 3FK8A 2YPMA 2CAIA 4O5QA 5IMZA 3VPTA 2BTOT 4GCIA 2Z9SA 4KW6A 1RW1A 3UL3A 1VF3A 5E4WA 4HQSA 5ENUA 4K1FA 4IQ1A 1OAZA 4EL1A 1ZYEA 5A4WA 4F9ZA 12GSA 5CRWA 3KTBA 4WF4A 6GSWA 2CQ9A 3JCML 3IC4A 4ILFA 4D73A 3KZQA 4CDOA 4I5QA 2H0HA 2GT6A 5J9CA 3IAM2 1H4OA 5D93A 1R7HA 3ZIVA 4EO3A 3G7JA 3GA4A 1ACVA 3MSZA 1AQXA 2YJ7A 2K18A 2X8HA 4POMA 2GQKA 3LQ7A 1V2AA 3I69A 5LD0A 1V9WA 3UAPA 2RLIA 3LWAA 4RQXA 3HD5A 1X5EA 4N11A 5H5QA 4KCEA 1UVZA 1B8XA 2OE1A 1YJ6A 2M46A 4GXZA 3PH9A 3US3A 2IMDA 1JZWA 4JR6A 1G7EA 3NOFA 1AUCA 4HDEA 1XFLA 3EPTA 3BJ5A 1IYHA 2NBSA 3F4SA 4CY8A 3FHKA 2IMFA 1NHOA 3U5RE 4ICYA 2GSQA 4I97A 3R3EA 2YV7A 4NPBA 3TOUA 1GLPA 2QA2A 1FVJA 4NMUA 4OCEA 3LXZA 2NPBA 2WCIA 3KGKA 4WKWA 5IMAA 2R37A 4KUNA 5CREA 1EGOA 4MDCA 3H8QA 1XVQA 1SKSB 3D21A 2WULA 2YWMA 2C8UA 1GUHA 4BWSA 1EOGA 3BCIA 1DE1A 2DMLA 2C1YA 3TKSA 4EXJA 3K8NA 2R5GA 1SYRA 2YJHA 5ECMB 3TRQA 4JE1A 4NV5A 3GTUB 3BD2A 3LGCA 4TR1A 4TW5A 2OJLA 4BVXB 2V41A 4NXIA 2BMXA 20GSA 2DMMA 2IMIA 5EL8A 4YQUA 1OE7A 1EP8A 4YAPA 4K7IA 3W8SA 2F51A 5G5FA 2JU5A 3IK7A 1NSWA 4K2XA 3H79A 4XS4A 4RUVA 2HSHA 1FG4A 2YANA 1YF0A 3M9JA 4YKGA 2A2PA 5IMCA 3OR5A 4Z2UA 3CBUA 1W4VA 3J7Yb 1LJRA 2XPEA 3KIJA 2A2SA 3KTLA 5IO2A 1U88A 4KCAA 4TN8A 1S3DA 5IIZA 2GSTA 2V2GA 3TJBA 4KSOA 4OFMA 3IPZA 4DEJA 1SK0A 2MMAA 1B4PA 4QQ7A 2GVPA 2CZ3A 3KEBA 1QMVA 3EC3A 4MLYA 4DSSA 3D5JA 1TRWA 4HZ2A 1Z7PA 1M9AA 2HZFA 2JACA 4IJ3A 1M2DA 2E7PA 1ZMAA 4CW9A 2F8AA 5DQYA 2N5FA 2R0PA 3F0IA 3WT1A 4ECCA 4KAEA 4OO5A 3TUEA 1G6WA 4OO4A 2B5EA 1USBA 5ECIB 3GRXA 1ZCPA 4P3YB 3GFKA 3IC8A 2PBJA 3ZVJA 4V2MA 2VCVA 2JSZA 2EC4A 3MIXA 1PA3A 3E3EA 5E59A 4KNDA 2H74A 1PSQA 1F3BA 3TKSE 3WGXA 1PGTA 5DJLA 4EIPA 2YOIA 4JEDA 4G10A 3F3RA 4LA1A 2H73A 3IK9A 3RBTA 2OA7A 1F6MC 1XWBA 2PGTA 2YCDA 4GRFA 5DBQA 3IXRA 4K0GA 5IMFA 2PVQA 1GUKA 1YQ1A 4XHMA 1U87A 1OKDA 3A3TA 4IP1A 4G0LA 1UN2A 1A2JA 4MF6A 1XWAA 3F3QA 4MF7A 3IAS2 3MAKA 3RHCA 5KOWA 4POLA 4RI6A 4ZL8A 3TJJA 3IHQA 3VI7A 4ACSA 1GLQA 4TVEA 2F9SA 2VAFA 1MEKA 1T00A 2B7KA 5F06A 1NHYA 4BVYB 4IP6A 1PD21 5AN1A 4F0BA 2HRNA 2L4QA 3EMPA 1SJZA 1DSBA 3VI5A 1G7OA 2C3QA 3N9JA 4X43A 4ZILA 2KLXA 4LL1B 3RAZA 5HR1A 3L9UA 4X1UA 3PR8A 4ZB8A 5LNKe 5DAKB 2LRCA 2QC7A 1ILOA 2MBSA 2IL3A 2A2RA 1CQHA 2CZ2A 1SJIA 4L8EA 4MZWA 4PNGA 4Q5RA 2F3MA 2FNOA 3D22A 1GTAA 2H75A 2H1DA 2B1LA 3FRCA 3QD9A 2VLVA 2LKUA 4MJAA 4D73B 4XS6A 3RHBA 8GSSA 4KH7A 1CQGA 5EPFA 2B6MA 1XBSA 5KN0A 4ZBDA 2XBQA 2CVKA 1X9MB 5CNWA 1OC9A 2GTUA 3FMWA 2DJ3A 1YY7A 1K3OA 1PQNA 5F07A 3GUSA 4L0WA 5B8BA 2OBKA 3TJKA 5IMDA 2IFQA 3D6IA 4PTSA 4QL7A 1OE8A 2LJKA 2FGXA 2VL3A 3KP9A 4NHWA 4OCFA 3HZ8A 2YZUA 2C0GA 4PGTA 1THOA 1K0MA 4POKA 2DIZA 2HT9A 3CRTA 2I3YA 2R3XA 3FR3A 1GSFA 1O8XA 1Z6MA 5KN2A 3P2AA 3LSZA 1UC7A 2WZ9A 1XCCA 4FYCA 3C7MA 3KM6A 5KOXA 4L5OA 1YEPA 3S9FA 4CHSA 3VWVA 2H1GA 1YEXA 5A5KA 2V6OA 1OVNA 3E0UA 2DJ0A 1ZOFA 1TTZA 5GZZB 1GRXA 4V1Ag 4ID0A 1K0CA 4Q5NA 2O7KA 4EE0A 3HCZA 1R4WA 4RI7A 2LQOA 1M2BA 4BL7B 2J9HA 1Z7RA 1N8JA 3PPUA 1SL0B 5IOXA 2LTKA 4K8MA 1JZRA 3QOUA 3CTFA 1GSEA 2DSAA 3GYKA 3TDGA 4F2IA 2EIQA 1GNEA 1HYUA 3NZNA 2LRNA 1I9DA 1JHBA 2YP6A 1SENA 2FUG2 1ZL9A 3ZFBA 4WBJA 1ZZYA 5J4UA 2FY6A 3UBKA 2WS2A 2MZCA 5H5RA 2VD1A 2N5BA 1SU9A 5IM9A 3QAVA 4BWQA 3J7Yk 5B6MA 1PRXA 3EU3A 5ABRA 4KDUA 4ULXA 5GSSA 1R5AA 1HNCA 4TR1B 3GX0A 3HY2A 2O89A 1O7UA 4IJIA 3DXBA 4FIWA 2HRAA 2B5YA 2ALBA 2X64A 3MNGA 3GIXA 1UA5A 1VRSD 4JU5A 3F4RA 2TRCP 3GH6A 3W8JA 1BAYA 3EMXA 2H30A 1VF4A 5L71A 2FWEA 3ED3A 2LNSA 4ZL9A 3MWHA 1HNBA 1XXUA 3DKSA 2B3SA 5A4VA 3TJGA 1AW9A 5ELGA 1AXDA 3HZ4A 1HD2A 4J2FA 1T4YA 1OYJA 5FWGA 3DYRA 4N0VA 3L0HA 2QA1A 1OC3A 2CAQA 2GZPA 3KD0A 2WGRA 1GTUA 5D73A 3BCKA 1R5PA 13GSA 1MDKA 3LFLA 4RQRA 1TOFA 2H70A 2DJJA 2LV3A 1ZYNA 3CSHA 3HHVA 5J3RA 5DCHA 5LCZA 2H6ZA 1Y25A 1TRVA 1Z3EA 4V1Ap 2PERA 1S3AA 1TK5B 5IOWA 4YH2A 3GURA 5AIXA 2HYXA 5B8AA 5CP1A 2RM5A 4TOPA 1T3BA 2IWTA 2C80A 4GWRA 2A4VA 1PKWA 3IDVA 2LS5A 2HSYA 2YZHA 2K9FA 4EKZA 4GSNA 1O8WA 2HSMA 1TRUA 2HZEB 3GMFA 3IE3A 3G7IA 2VIMA 3ME8A 3G7YA 1WP0A 3TOTA 2M72A 4I2TA 4E8EA 2P5RA 2O8VB 1TRSA 3GSTA 1XWCA 3HVVA 4ZB9A 4BPYA 4K7OA 3CYNA 3CRUA 4MZCA 1QUWA 2A4HA 3VWUA 4XCSA 2DJKA 4IQAA 3ZMLA 4HJMA 3F9UA 2IN3A 2J23A 4N0ZA 3DMLA 1MDIA 1MD4A 3ZITA 2JZTA 4KSMA 3UVTA 2I4AA 2K8SA 3IA1A 3HJPA 3BBYA 2HZEA 5ECQB 2L5OA 5D9VA 2GLRA 4K7NA 4EIQA 1N2AA 4H86A 4MMMA 2JSYA 3VK9A 2R6KA 3Q18A 4BL7A 2AHEA 2I1UA 2RM6A 1FAAA 4N30A 2MMNA 4WXTA 3UMAA 3LG6A 4WETA 3H4KA 1R26A 1PN0A 2GT5A 4MA9A 2ON7A 4AJ6A 2B7JA 4K0NA 1T7PB 1ZYQB 2GZZA 2P31A 1V58A 2L4CA 5HFIA 2VCXA 5ECOB 4FYBA 2OBIA 3FW2A 2CA8A 5B7CA 1KTEA 5D9XA 1PMTA 4IVFA 3M1GA 2H0IA 1H75A 3L78A 3DGQA 4ZIJA 1WE0A 2VUPA 5COHA 4MH3A 5F05A 4KDYA 2MMOA 4XTSA 4EUYA 5ELAA 4GTUA 1LBKA 1Q98A 2IYJA 5KEJA 1ZGNA 2OE3A 1U3AA 5IQYA 4AJ7A 2EIOA 4O92A 1TDIA 4ECJA 4EVMA 1TJDA 1GTIA 2FLSA 2LUSA 5KN3A 3GKKA 2RIIA 4GSTA 1HNAA 2WRTA 1X9SB 1Z5YE 2RUFA 5ECHB 5C04A 2LNTA 4TR0A 1J9BA 3FY7A 1ML6A 3GL5A 1EWXA 5CRHA 18GSA 1V98A 3DVWA 1FB0A 4YAVA 3Q74A 19GSA 5AISA 3HA9A 3F8UA 1ERWA 1XOBA 1X5DA 4HOJA 3LYKA 2JL4A 4I8BA 3FZ5A 3WGEA 2V32A 2O85A 1EZKA 3UJ1A 1MD3A 4V2LA 3ZTLA 4O32A 1O73A 5DVBA 4TR3A 3ZREA 4EDZA 4PQIA 3KJYA 2GGTA 3VPQA 3C1SA 2VCZA 5FT3A 3DIEA 3D0ZA 4HU7A 5ID2A 4Z7XA 1XPVA 4IGJA 1M2AA 1NM3A 1Z6NA 2NVLA 1HQOA 1Z9HA 1E6BA 4O5UA 2YN1A 3SWLA 1BQ7A 4KGIA 3WD6A 3GX8A 4QL9A 1GP1A 4K5RA 2D2ZA 1ABAA 2I81A 2L6CA 1SK2A 3A2XA 5ID2B 1SD8A 4KA0A 2HXKA 1PL1A 1K0DA 2LRTA 3TB2A 1OC9B 1URMA 2VL2C 2ZUPA 2C4JA 2LSTA 3UIWA 1M0UA 2HRFA 1GUMA 2JZSA 3DRNA 3FR9A 3HYPA 2LJRA 4XRDA 1XW6A 4WR4A 4OFNA 3D4MA 4F82A 1FVKA 2N5AA 2DJ1A 3TJFA 2L6DA 1PKZA 1SL2B 4ML1A 2X8GA 5IPGA 2OADA 5B6NA 1U6TA 2KOKA 1SL1B 2HFDA 3C8EA 16GSA 1K0OA 2QSIA 3QDNA 5D8IA 1E2YA 4DVCA 3A2WA 4USSA 3EYTA 1QK8A 4DSQA 1VF1A 3IRAA 3KH7A 2IJYA 4N10A 4OWYA 4LLRA 2IFQB 1BEDA 5G1LA 2C0DA 1TP9A 3C71A 4MJBA 5GSTA 5JWQB 2YNXA 1YDKA 3HDCA 3IV4A 1JZDA 5G31A 1K3LA 2H66A 3KH9A 1XZOA 5DQSA 2OE0A 3F6DA 5FHIA 4G9HA 3QFAC 5CO3A 1XOAA 5CRDA 3F6FA 2TIRA 2KP1A 2XHFA 3U6VA 4BVYA 4IW9A 1M9BA 3H1NA 2H0GA 2VLUA 3PINA 2IIYA 2E0QA 2KUCA 3HVSA 1EGRA 2P5QA 2BJXA 3APSA 1TU7A 4YQMA 3P90A 1A2MA 3GNJA 2QGVA 3ZZXA 5G2ZA 3CTGA 1GTBA 2V1MA 2H76A 2NTOA 5DCGA 4IHUA 1EEMA 2XC2A 4MP4A 2R2JA 4HU9A 4TR4A 1PN9A 1K0NA 4TRXA 3FZ4A 3ZFLA 2G2QA 1K0BA 2OKAA 2HRKA 1GSSA 2GQMA 3GN3A 3VLNA 1TI1A 4KF9A 2MYGA 1GL8A 1PL2A 1XVWA 2R0GA 3I43A 2IPAA 3FKFA 5DALB 4EC0A 3EVIA 5CYYA 4ZBAA 1F9MA 1TU8A 4I6XA 2ES7A 5A4UA 1RQMA 3FZAA 1YKAA 10GSA 2MMZA 3QAWA 2B1KA 2DLXA 1AQVA 4I2UA 3WYWA 1SYXA 3P8WA 2JADA 5D9WA 1WJKA 4EDYA 4PXOA 4FH8A 1XW5A 3QPMA 2X99A 2E2MA 17GSA 3C1RA 1A8YA 1X5CA 5EY6A 1VGLA 5HFGA 4IN0A 4MPGA 1WIKA 3LORA 1T1VA 3F63A 1A8LA 3TRPA 3E9JB 2ZCTA 1PX7A 1Y6EA 4YKFA 3O76A 4PUFC 3ZIJA 1A0RP 1XWGA 3HJOA 1FO5A 3UBLA 2YV9A 1PX6A 3UVHA 4O7HA 1DUGA 1QXHA 5DALA 4L0UA 5BRTA 4Q5QA 1ST9A 3TRXA 2YWOA 1GSQA 3APOA 3EE2A 1DE2A 1C72A 4ML6A 1G0TA 2VLTA 2WDUA 3W6GA 3UEMA 1YZXA 1EEJA 2C3TA 2VD0A 4K5SA 2EIRA 2H72A 2PWJA 2FCHA 2DC5A 3MYDA 3BOAA 3M0FA 6GSTA 5EVOA 2XBIA 3IBHA 4GLTA 2VCTA 5BMUA 1G6YA 3HKRA 3A5IA 3L4NA 1WOUA 5HQPA 4LMVA 1SKRB 2AV4A 4IBPA 2CX4A 2YWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 B;  4G19 A;  3KXO A;  4IS0 A;  4PUA A;  3GKX A;  2JZR A;  1W89 A;  2PVO C;  1KBN A;  6GSV A;  1FOV A;  4JRR A;  2P0G A;  4NAX A;  1JFU A;  4MJC A;  3NIV A;  2FD3 A;  3L9S A;  4POB A;  2CVB A;  3QAG A;  1RK4 A;  3UAR A;  3FR6 A;  3DWV A;  3WGD A;  5DDL A;  5INY A;  4HS1 A;  4J57 E;  3LEF A;  6GSS A;  3GTU A;  1M99 A;  5HFK A;  1ERT A;  4TXV A;  3PGT A;  1B48 A;  3TCO A;  3V1W A;  3RPN A;  22GS A;  2IMK A;  1EV9 A;  3QMX A;  2M80 A;  4TKY A;  2WFC A;  4G2E A;  2H6X A;  4JZQ A;  2GQL A;  3P7X A;  2L5L A;  1O85 A;  2XPD A;  1B9Y C;  5C00 A;  2FA8 A;  1QGV A;  1ERV A;  1OKT A;  2FWH A;  5ECS A;  4MCU A;  2HLS A;  1MDJ A;  3MDK A;  4MZB A;  3LYP A;  1A24 A;  2B5X A;  1B9X C;  1AIU A;  5D96 A;  4K9Z A;  2VM2 A;  3VUR A;  3APQ A;  3DEX A;  1SKW B;  3FZ9 A;  4O5R A;  1JLV A;  4KB3 A;  1BG5 A;  1XW9 A;  2O87 A;  3L9V A;  5ECR B;  2K6V A;  4ZBB A;  1K0A A;  1X9W B;  2ON5 A;  4GQC A;  3O6T A;  1O81 A;  5G30 A;  1SD9 A;  5CAX A;  1J0F A;  1EOH A;  5CRG A;  3M8N A;  2AB6 A;  1MTC A;  3EWL A;  5IO0 A;  2C0E A;  2HI7 A;  4V2N A;  2WB9 A;  3TKR A;  1TKD B;  3TKP A;  5D9T A;  11GS A;  2PN8 A;  3QR6 A;  4AGS A;  1VF2 A;  3GH9 A;  3WT2 A;  4BA7 A;  4WR5 A;  4WBR D;  4OFT A;  3TKQ A;  2E2G A;  4XIH A;  3M9K A;  4NHZ A;  2AYT A;  5GAP D;  4MK3 A;  3HXS A;  2H6Y A;  5ECL B;  3LXT A;  3GHA A;  3GL3 A;  4F0C A;  7GSS A;  2GDR A;  4XS1 A;  3VWX A;  2X8C A;  3QFB C;  3ERW A;  5JWO B;  1I5G A;  3GSS A;  5AIV A;  4OD7 A;  1YF1 A;  2CV4 A;  2GZY A;  1GUL A;  1Q4J A;  4LMW A;  1GWC A;  3ZYW A;  4PQH A;  4HZ4 A;  1F37 A;  4KE3 A;  1NW2 A;  3M3M A;  5F0G A;  2LJA A;  4BVX A;  2H8L A;  4WEY A;  4HI7 A;  1TXX A;  3ISO A;  2LQQ A;  1B4Q A;  2HNL A;  2FWG A;  1BYE A;  1DBY A;  3EU4 A;  2YWI A;  4PX1 A;  4GF0 A;  5IMV A;  3EUR A;  4ECI A;  2AAW A;  2MBT A;  6GSU A;  3QCP A;  5AGY A;  1A2L A;  4IEL A;  1V57 A;  3TGZ A;  4E8H A;  4L5L A;  5G1K A;  1AAZ A;  5G5E A;  2H1A A;  1J08 A;  3D4T A;  3VFI A;  2NDO A;  1XIY A;  5DAK A;  4ZB6 A;  3UOM A;  2GSR A;  1JZO A;  4FYU A;  1WRY A;  4J56 E;  4JR4 A;  1JLW A;  2VCQ A;  2G0F A;  2VM1 A;  4HQZ A;  4ISD A;  1GH2 A;  1WWJ A;  2PUK C;  3G9B A;  3GV1 A;  4K2D A;  5JWR B;  4PNF A;  1EP7 A;  2H19 A;  3HJM A;  4AF2 A;  1AQW A;  2QKE A;  5HR3 A;  2CT6 A;  4YQV A;  3AY8 A;  3DVX A;  3FYG A;  2TRX A;  1TK8 B;  1F3A A;  3I6A A;  1GSY A;  5J9B A;  3IR4 A;  1FB6 A;  5JCG A;  3ZMK A;  2VL9 A;  1TW9 A;  1TK0 B;  2R4V A;  9GSS A;  1F2E A;  3H93 A;  3VWW A;  2AUV A;  5J41 A;  1U3I A;  3F4T A;  2L57 A;  5GAN D;  2LEG A;  1A23 A;  4MH2 A;  1ERU A;  2HE3 A;  1EV4 A;  4AJ8 A;  2F8F A;  1K3Y A;  5H5S A;  4KDX A;  1XWK A;  4DSR A;  4HEA 2;  1YKC A;  4MJE A;  5J5N A;  2DBC A;  3KP8 A;  3KMO A;  4MF5 A;  5DJM A;  4X0X A;  1FHE A;  2ZNM A;  4NWY A;  4ECB A;  2DJ2 A;  3IOS A;  4FO5 A;  2C0F A;  2KP2 A;  2IME A;  4XRA A;  3CSJ A;  1S3C A;  2C3N A;  2OAC A;  3A2V A;  2GSS A;  6GSY A;  1M7T A;  1O6J A;  2V6K A;  4ZL7 A;  3KCM A;  3A5W A;  2VL2 A;  2PPT A;  3HVX A;  3ZRD A;  5ECK B;  3SBC A;  2H1B A;  3RDW A;  1GNW A;  1QFN A;  4F03 A;  2DIY A;  4HJ2 A;  3ERF A;  2RUE A;  1GSU A;  3KMN A;  4GQF A;  1LU4 A;  5IPH A;  2FHE A;  3O3T A;  4EF0 A;  2PMT A;  3ME7 A;  4GSS A;  2FA4 A;  3Q6O A;  3FEU A;  2REM A;  2L59 A;  1V40 A;  2FWF A;  4IKH A;  4KX4 A;  1ON4 A;  1WMJ A;  2VCW A;  2VOC A;  4TXO A;  3R2Q A;  3GKN A;  6GSX A;  4NV2 A;  3RPP A;  3ERG A;  4HUA A;  4K6X A;  5KN1 A;  3ZL5 A;  2AJQ B;  3ZVJ D;  1KEB A;  2PU9 C;  3C73 A;  2K8V A;  1BX9 A;  1KNG A;  1T4Z A;  3EIN A;  2WJU A;  1TI3 A;  3TKS C;  1T8E B;  3CSI A;  4DSS B;  4MPF A;  2GS3 A;  5ECP B;  2CX3 A;  3CXG A;  1X0R A;  4LL4 B;  3I9V 2;  1QQ2 A;  1SJ6 A;  1GSD A;  4PQ1 A;  4WF5 A;  1OC8 A;  3LJR A;  3Q19 A;  2H71 A;  1BJX A;  1A0F A;  4ZXG A;  3N5O A;  1SK1 A;  2VO4 A;  3GKM A;  1WPI A;  2CVD A;  4JBB A;  2KHP A;  5ECN B;  5JCW A;  1AC1 A;  3CMI A;  4TXO B;  3DD3 A;  4OMV A;  4PUR A;  3ZLP A;  4MAB A;  2IY2 A;  1IYI A;  5F8B A;  1THX A;  5JCU A;  2H01 A;  5HR0 A;  5HR2 A;  1FW1 A;  4Q5F A;  2I9H A;  14GS A;  3FK8 A;  2YPM A;  2CAI A;  5IMZ A;  3VPT A;  2BTO T;  4GCI A;  2Z9S A;  4KW6 A;  1RW1 A;  3UL3 A;  1VF3 A;  5E4W A;  4HQS A;  5ENU A;  4K1F A;  4IQ1 A;  1OAZ A;  4EL1 A;  1ZYE A;  5A4W A;  4F9Z A;  12GS A;  5CRW A;  3KTB A;  4WF4 A;  6GSW A;  2CQ9 A;  3JCM L;  3IC4 A;  4ILF A;  4D73 A;  3KZQ A;  4CDO A;  4I5Q A;  2H0H A;  2GT6 A;  5J9C A;  3IAM 2;  1H4O A;  5D93 A;  1R7H A;  3ZIV A;  4EO3 A;  3G7J A;  3GA4 A;  1ACV A;  3MSZ A;  1AQX A;  2YJ7 A;  2K18 A;  2X8H A;  4POM A;  2GQK A;  3LQ7 A;  1V2A A;  3I69 A;  5LD0 A;  1V9W A;  3UAP A;  2RLI A;  3LWA A;  4RQX A;  3HD5 A;  1X5E A;  4N11 A;  5H5Q A;  4KCE A;  1UVZ A;  1B8X A;  2OE1 A;  1YJ6 A;  2M46 A;  4GXZ A;  3PH9 A;  3US3 A;  2IMD A;  1JZW A;  4JR6 A;  1G7E A;  3NOF A;  1AUC A;  4HDE A;  1XFL A;  3BJ5 A;  1IYH A;  2NBS A;  3F4S A;  3FHK A;  2IMF A;  1NHO A;  3U5R E;  2GSQ A;  4I97 A;  2YV7 A;  4NPB A;  3TOU A;  1GLP A;  1FVJ A;  4NMU A;  4OCE A;  3LXZ A;  2NPB A;  2WCI A;  3KGK A;  4WKW A;  5IMA A;  2R37 A;  4KUN A;  5CRE A;  1EGO A;  4MDC A;  3H8Q A;  1XVQ A;  1SKS B;  3D21 A;  2WUL A;  2YWM A;  2C8U A;  1GUH A;  4BWS A;  1EOG A;  3BCI A;  1DE1 A;  2DML A;  2C1Y A;  3TKS A;  4EXJ A;  3K8N A;  2R5G A;  1SYR A;  2YJH A;  5ECM B;  3TRQ A;  4JE1 A;  4NV5 A;  3GTU B;  3BD2 A;  3LGC A;  4TR1 A;  4TW5 A;  2OJL A;  2V41 A;  4NXI A;  2BMX A;  20GS A;  2DMM A;  2IMI A;  5EL8 A;  4YQU A;  1OE7 A;  1EP8 A;  4YAP A;  4K7I A;  3W8S A;  2F51 A;  5G5F A;  2JU5 A;  3IK7 A;  1NSW A;  3H79 A;  4XS4 A;  4RUV A;  2HSH A;  1FG4 A;  2YAN A;  1YF0 A;  3M9J A;  5IMC A;  3OR5 A;  3CBU A;  1W4V A;  3J7Y b;  1LJR A;  2XPE A;  3KIJ A;  2A2S A;  3KTL A;  5IO2 A;  1U88 A;  4KCA A;  4TN8 A;  1S3D A;  5IIZ A;  2GST A;  2V2G A;  3TJB A;  4KSO A;  4OFM A;  3IPZ A;  4DEJ A;  1SK0 A;  2MMA A;  1B4P A;  4QQ7 A;  2GVP A;  2CZ3 A;  3KEB A;  1QMV A;  3EC3 A;  4MLY A;  4DSS A;  3D5J A;  1TRW A;  4HZ2 A;  1Z7P A;  1M9A A;  2HZF A;  2JAC A;  4IJ3 A;  1M2D A;  2E7P A;  1ZMA A;  4CW9 A;  2F8A A;  5DQY A;  2N5F A;  3F0I A;  3WT1 A;  4ECC A;  4KAE A;  4OO5 A;  3TUE A;  1G6W A;  4OO4 A;  2B5E A;  1USB A;  5ECI B;  3GRX A;  1ZCP A;  4P3Y B;  3GFK A;  2PBJ A;  3ZVJ A;  4V2M A;  2VCV A;  2JSZ A;  2EC4 A;  1PA3 A;  3E3E A;  5E59 A;  4KND A;  2H74 A;  1PSQ A;  1F3B A;  3TKS E;  3WGX A;  1PGT A;  5DJL A;  2YOI A;  4JED A;  4G10 A;  3F3R A;  4LA1 A;  2H73 A;  3IK9 A;  3RBT A;  2OA7 A;  1F6M C;  1XWB A;  2PGT A;  2YCD A;  4GRF A;  5DBQ A;  3IXR A;  4K0G A;  5IMF A;  2PVQ A;  1GUK A;  1YQ1 A;  4XHM A;  1U87 A;  1OKD A;  3A3T A;  4IP1 A;  1UN2 A;  1A2J A;  4MF6 A;  1XWA A;  3F3Q A;  4MF7 A;  3IAS 2;  3MAK A;  3RHC A;  4POL A;  4RI6 A;  4ZL8 A;  3TJJ A;  3IHQ A;  3VI7 A;  4ACS A;  1GLQ A;  4TVE A;  2F9S A;  2VAF A;  1MEK A;  1T00 A;  2B7K A;  5F06 A;  1NHY A;  4IP6 A;  1PD2 1;  5AN1 A;  4F0B A;  2HRN A;  2L4Q A;  3EMP A;  1SJZ A;  1DSB A;  3VI5 A;  1G7O A;  2C3Q A;  3N9J A;  4X43 A;  4ZIL A;  2KLX A;  4LL1 B;  3RAZ A;  5HR1 A;  3L9U A;  4X1U A;  3PR8 A;  4ZB8 A;  5LNK e;  5DAK B;  2LRC A;  2QC7 A;  1ILO A;  2MBS A;  2IL3 A;  2A2R A;  1CQH A;  2CZ2 A;  1SJI A;  4L8E A;  4MZW A;  4PNG A;  4Q5R A;  2F3M A;  2FNO A;  3D22 A;  1GTA A;  2H75 A;  2H1D A;  2B1L A;  3FRC A;  3QD9 A;  2VLV A;  2LKU A;  4MJA A;  4D73 B;  4XS6 A;  3RHB A;  8GSS A;  4KH7 A;  1CQG A;  5EPF A;  2B6M A;  1XBS A;  5KN0 A;  4ZBD A;  2XBQ A;  2CVK A;  1X9M B;  5CNW A;  1OC9 A;  2GTU A;  2DJ3 A;  1YY7 A;  1K3O A;  1PQN A;  5F07 A;  3GUS A;  4L0W A;  5B8B A;  2OBK A;  3TJK A;  5IMD A;  2IFQ A;  3D6I A;  4QL7 A;  1OE8 A;  2LJK A;  2FGX A;  2VL3 A;  3KP9 A;  4NHW A;  4OCF A;  3HZ8 A;  2YZU A;  2C0G A;  4PGT A;  1THO A;  1K0M A;  4POK A;  2DIZ A;  2HT9 A;  3CRT A;  2I3Y A;  2R3X A;  3FR3 A;  1GSF A;  1O8X A;  1Z6M A;  5KN2 A;  3P2A A;  3LSZ A;  1UC7 A;  2WZ9 A;  1XCC A;  4FYC A;  3C7M A;  3KM6 A;  4L5O A;  1YEP A;  3S9F A;  4CHS A;  3VWV A;  2H1G A;  1YEX A;  5A5K A;  2V6O A;  1OVN A;  3E0U A;  2DJ0 A;  1ZOF A;  1TTZ A;  5GZZ B;  1GRX A;  4V1A g;  4ID0 A;  1K0C A;  4Q5N A;  2O7K A;  4EE0 A;  3HCZ A;  1R4W A;  4RI7 A;  2LQO A;  1M2B A;  2J9H A;  1Z7R A;  1N8J A;  1SL0 B;  5IOX A;  2LTK A;  4K8M A;  1JZR A;  3QOU A;  3CTF A;  1GSE A;  2DSA A;  3GYK A;  3TDG A;  4F2I A;  2EIQ A;  1GNE A;  1HYU A;  3NZN A;  2LRN A;  1I9D A;  1JHB A;  2YP6 A;  1SEN A;  2FUG 2;  1ZL9 A;  3ZFB A;  4WBJ A;  1ZZY A;  5J4U A;  2FY6 A;  3UBK A;  2WS2 A;  2MZC A;  5H5R A;  2VD1 A;  2N5B A;  1SU9 A;  5IM9 A;  3QAV A;  4BWQ A;  3J7Y k;  5B6M A;  1PRX A;  3EU3 A;  5ABR A;  4KDU A;  4ULX A;  5GSS A;  1R5A A;  1HNC A;  4TR1 B;  3GX0 A;  3HY2 A;  2O89 A;  1O7U A;  4IJI A;  3DXB A;  4FIW A;  2B5Y A;  2ALB A;  2X64 A;  3MNG A;  3GIX A;  1UA5 A;  1VRS D;  4JU5 A;  3F4R A;  2TRC P;  3GH6 A;  3W8J A;  1BAY A;  3EMX A;  2H30 A;  1VF4 A;  5L71 A;  2FWE A;  3ED3 A;  2LNS A;  4ZL9 A;  3MWH A;  1HNB A;  1XXU A;  3DKS A;  2B3S A;  5A4V A;  3TJG A;  1AW9 A;  5ELG A;  1AXD A;  3HZ4 A;  1HD2 A;  4J2F A;  1T4Y A;  1OYJ A;  5FWG A;  3DYR A;  3L0H A;  4N0V A;  1OC3 A;  2CAQ A;  2GZP A;  3KD0 A;  2WGR A;  1GTU A;  5D73 A;  3BCK A;  1R5P A;  13GS A;  1MDK A;  3LFL A;  4RQR A;  1TOF A;  2H70 A;  2DJJ A;  2LV3 A;  3CSH A;  3HHV A;  5J3R A;  5DCH A;  5LCZ A;  2H6Z A;  1Y25 A;  1TRV A;  1Z3E A;  4V1A p;  2PER A;  1S3A A;  1TK5 B;  5IOW A;  4YH2 A;  3GUR A;  5AIX A;  2HYX A;  5B8A A;  5CP1 A;  2RM5 A;  4TOP A;  1T3B A;  2IWT A;  2C80 A;  4GWR A;  2A4V A;  1PKW A;  3IDV A;  2LS5 A;  2HSY A;  2YZH A;  2K9F A;  4EKZ A;  4GSN A;  1O8W A;  3GMF A;  1TRU A;  2HZE B;  3IE3 A;  3G7I A;  2VIM A;  3ME8 A;  3G7Y A;  1WP0 A;  3TOT A;  2M72 A;  4I2T A;  4E8E A;  2P5R A;  2O8V B;  1TRS A;  3GST A;  1XWC A;  3HVV A;  4ZB9 A;  4BPY A;  4K7O A;  3CYN A;  3CRU A;  4MZC A;  1QUW A;  3VWU A;  4XCS A;  2DJK A;  4IQA A;  3ZML A;  4HJM A;  3F9U A;  2IN3 A;  2J23 A;  4N0Z A;  3DML A;  1MDI A;  1MD4 A;  3ZIT A;  2JZT A;  4KSM A;  3UVT A;  2I4A A;  2K8S A;  3IA1 A;  3HJP A;  3BBY A;  2HZE A;  5ECQ B;  2L5O A;  5D9V A;  2GLR A;  4K7N A;  1N2A A;  4H86 A;  4MMM A;  2JSY A;  3VK9 A;  2R6K A;  3Q18 A;  4BL7 A;  2AHE A;  2I1U A;  2RM6 A;  1FAA A;  4N30 A;  2MMN A;  4WXT A;  3UMA A;  3LG6 A;  4WET A;  3H4K A;  1R26 A;  2GT5 A;  4MA9 A;  2ON7 A;  4AJ6 A;  2B7J A;  4K0N A;  1T7P B;  1ZYQ B;  2GZZ A;  2P31 A;  1V58 A;  2L4C A;  5HFI A;  2VCX A;  5ECO B;  4FYB A;  2OBI A;  3FW2 A;  2CA8 A;  5B7C A;  1KTE A;  5D9X A;  1PMT A;  4IVF A;  3M1G A;  2H0I A;  1H75 A;  3L78 A;  3DGQ A;  4ZIJ A;  1WE0 A;  2VUP A;  5COH A;  4MH3 A;  5F05 A;  4KDY A;  2MMO A;  4XTS A;  4EUY A;  5ELA A;  4GTU A;  1LBK A;  1Q98 A;  2IYJ A;  5KEJ A;  1ZGN A;  2OE3 A;  1U3A A;  5IQY A;  4AJ7 A;  2EIO A;  4O92 A;  1TDI A;  4ECJ A;  4EVM A;  1TJD A;  1GTI A;  2FLS A;  2LUS A;  5KN3 A;  3GKK A;  2RII A;  4GST A;  1HNA A;  2WRT A;  1X9S B;  1Z5Y E;  2RUF A;  5ECH B;  5C04 A;  2LNT A;  4TR0 A;  1J9B A;  3FY7 A;  1ML6 A;  3GL5 A;  1EWX A;  5CRH A;  18GS A;  1V98 A;  3DVW A;  1FB0 A;  4YAV A;  3Q74 A;  19GS A;  5AIS A;  3HA9 A;  3F8U A;  1ERW A;  1XOB A;  1X5D A;  4HOJ A;  3LYK A;  2JL4 A;  4I8B A;  3FZ5 A;  3WGE A;  2V32 A;  2O85 A;  1EZK A;  3UJ1 A;  1MD3 A;  4V2L A;  3ZTL A;  4O32 A;  1O73 A;  5DVB A;  4TR3 A;  3ZRE A;  4EDZ A;  4PQI A;  3KJY A;  2GGT A;  3VPQ A;  3C1S A;  2VCZ A;  5FT3 A;  3DIE A;  3D0Z A;  4HU7 A;  5ID2 A;  4Z7X A;  1XPV A;  4IGJ A;  1M2A A;  1NM3 A;  1Z6N A;  2NVL A;  1HQO A;  1Z9H A;  1E6B A;  2YN1 A;  3SWL A;  1BQ7 A;  4KGI A;  3WD6 A;  3GX8 A;  4QL9 A;  1GP1 A;  2D2Z A;  1ABA A;  2I81 A;  2L6C A;  1SK2 A;  3A2X A;  5ID2 B;  1SD8 A;  4KA0 A;  2HXK A;  1PL1 A;  1K0D A;  2LRT A;  3TB2 A;  1OC9 B;  1URM A;  2VL2 C;  2ZUP A;  2C4J A;  2LST A;  3UIW A;  1M0U A;  2HRF A;  1GUM A;  2JZS A;  3DRN A;  3FR9 A;  3HYP A;  2LJR A;  4XRD A;  1XW6 A;  4WR4 A;  4OFN A;  3D4M A;  4F82 A;  1FVK A;  2N5A A;  2DJ1 A;  3TJF A;  2L6D A;  1PKZ A;  1SL2 B;  4ML1 A;  2X8G A;  5IPG A;  2OAD A;  5B6N A;  1U6T A;  2KOK A;  1SL1 B;  2HFD A;  3C8E A;  16GS A;  1K0O A;  2QSI A;  3QDN A;  5D8I A;  1E2Y A;  4DVC A;  3A2W A;  3EYT A;  1QK8 A;  4DSQ A;  1VF1 A;  3IRA A;  3KH7 A;  2IJY A;  4N10 A;  4OWY A;  4LLR A;  2IFQ B;  1BED A;  5G1L A;  2C0D A;  1TP9 A;  3C71 A;  4MJB A;  5GST A;  5JWQ B;  2YNX A;  1YDK A;  3HDC A;  3IV4 A;  1JZD A;  5G31 A;  1K3L A;  2H66 A;  3KH9 A;  1XZO A;  5DQS A;  2OE0 A;  3F6D A;  5FHI A;  4G9H A;  3QFA C;  5CO3 A;  1XOA A;  5CRD A;  3F6F A;  2TIR A;  2KP1 A;  2XHF A;  3U6V A;  4BVY A;  4IW9 A;  1M9B A;  3H1N A;  2H0G A;  2VLU A;  3PIN A;  2IIY A;  2E0Q A;  2KUC A;  3HVS A;  1EGR A;  2P5Q A;  2BJX A;  3APS A;  1TU7 A;  4YQM A;  3P90 A;  1A2M A;  3GNJ A;  2QGV A;  3ZZX A;  5G2Z A;  3CTG A;  1GTB A;  2V1M A;  2H76 A;  2NTO A;  5DCG A;  4IHU A;  1EEM A;  2XC2 A;  4MP4 A;  2R2J A;  4HU9 A;  4TR4 A;  1PN9 A;  1K0N A;  4TRX A;  3FZ4 A;  3ZFL A;  2G2Q A;  1K0B A;  2OKA A;  1GSS A;  2GQM A;  3GN3 A;  3VLN A;  1TI1 A;  2MYG A;  1GL8 A;  1PL2 A;  1XVW A;  3I43 A;  2IPA A;  3FKF A;  5DAL B;  4EC0 A;  3EVI A;  5CYY A;  4ZBA A;  1F9M A;  1TU8 A;  4I6X A;  2ES7 A;  5A4U A;  1RQM A;  3FZA A;  1YKA A;  10GS A;  2MMZ A;  3QAW A;  2B1K A;  2DLX A;  1AQV A;  4I2U A;  3WYW A;  1SYX A;  3P8W A;  2JAD A;  5D9W A;  1WJK A;  4EDY A;  4PXO A;  4FH8 A;  1XW5 A;  3QPM A;  2X99 A;  2E2M A;  17GS A;  3C1R A;  1A8Y A;  1X5C A;  5EY6 A;  1VGL A;  5HFG A;  4IN0 A;  4MPG A;  1WIK A;  3LOR A;  1T1V A;  3F63 A;  1A8L A;  3TRP A;  3E9J B;  2ZCT A;  1PX7 A;  1Y6E A;  3O76 A;  4PUF C;  3ZIJ A;  1A0R P;  1XWG A;  3HJO A;  1FO5 A;  3UBL A;  2YV9 A;  1PX6 A;  3UVH A;  4O7H A;  1DUG A;  1QXH A;  5DAL A;  4L0U A;  4Q5Q A;  1ST9 A;  3TRX A;  2YWO A;  1GSQ A;  3APO A;  3EE2 A;  1DE2 A;  1C72 A;  4ML6 A;  1G0T A;  2VLT A;  2WDU A;  3W6G A;  3UEM A;  1YZX A;  1EEJ A;  2C3T A;  2VD0 A;  2EIR A;  2H72 A;  2PWJ A;  2FCH A;  2DC5 A;  3BOA A;  3M0F A;  6GST A;  5EVO A;  2XBI A;  3IBH A;  4GLT A;  2VCT A;  1G6Y A;  3HKR A;  3L4N A;  1WOU A;  5HQP A;  4LMV A;  1SKR B;  2AV4 A;  4IBP A;  2CX4 A;  2YWN A; 
#chains in the Genus database with same CATH topology
 1LOY A;  4XS4 B;  2KXG A;  1QJG A;  3KXO A;  4HM5 B;  1IVX A;  4G19 A;  4IS0 A;  4PUA A;  3GKX A;  5GSP A;  2JZR A;  3DGY A;  2DKH A;  1W89 A;  2PVO C;  2OQE C;  1ASK A;  1KBN A;  6GSV A;  5CXO A;  1FOV A;  1M3I A;  4JRR A;  4STD A;  5IF6 A;  2P0G A;  4NAX A;  1JFU A;  2Y74 A;  4MJC A;  3NIV A;  3UB1 A;  2FD3 A;  5M1A A;  3L9S A;  2BU4 A;  4POB A;  2P05 A;  2GEY A;  2CVB A;  3QAG A;  1RK4 A;  3UAR A;  3FR6 A;  4L8P A;  1AVK A;  3DWV A;  3BB9 A;  3WGD A;  5DDL A;  3NHX A;  3V98 A;  3CC4 3;  3NBJ A;  2XF3 A;  2UGI A;  5INY A;  4HS1 A;  4J57 E;  3LEF A;  6GSS A;  3GTU A;  1M99 A;  3HIG A;  5HFK A;  1ERT A;  3MG1 A;  3SOA A;  4TXV A;  2HMJ B;  6RNT A;  3PGT A;  5AYR B;  1G96 A;  3DUK A;  1D6U A;  1I8V A;  1IV7 A;  3TCO A;  3V1W A;  3RPN A;  1O7H B;  5IW9 A;  22GS A;  1I2G A;  3HX8 A;  2IMK A;  1EV9 A;  3QMX A;  2M80 A;  2C4B A;  4TKY A;  4MNN A;  1VQ7 3;  4A5P A;  2WFC A;  4G2E A;  2H6X A;  3AGN A;  4JZQ A;  2GQL A;  3P7X A;  1NB3 I;  3NQZ A;  2L5L A;  1O85 A;  2XPD A;  1B9Y C;  2GBW B;  2FA8 A;  1JBR A;  5C00 A;  1UCL A;  1QGV A;  1ERV A;  1OAC A;  1OKT A;  2FWH A;  2QA4 3;  4MCU A;  2HLS A;  3SOY A;  5ECS A;  1MDJ A;  1RHL A;  3MDK A;  4MZB A;  1W6G A;  3QRD A;  1Z1S A;  7STD A;  3LYP A;  1A24 A;  1ROA A;  2B5X A;  1B9X C;  5KP1 A;  1O7M B;  1AIU A;  5D96 A;  4K9Z A;  2VM2 A;  1YVB I;  3VUR A;  3APQ A;  3NBR A;  3DEX A;  2WOF A;  1SKW B;  4O02 B;  3FZ9 A;  1BRI A;  4O5R A;  1JLV A;  2YWN A;  4KB3 A;  1BG5 A;  1XW9 A;  2XRX B;  1VQ9 3;  2CHC A;  2O87 A;  1W01 A;  2HMO B;  3L9V A;  5ECR B;  2K6V A;  3QK9 A;  1WNH A;  4ZBB A;  1K0A A;  1X9W B;  2ON5 A;  4GQC A;  3O6T A;  1O81 A;  5G30 A;  1BSB A;  4FMB A;  1SD9 A;  3Q90 A;  4HM1 B;  2MC8 A;  5CAX A;  1J0F A;  1EOH A;  3LW9 A;  5CRG A;  4O3V A;  1LXE A;  3M8N A;  2AB6 A;  3CCE 3;  1MTC A;  3CCQ 3;  3EWL A;  2W56 A;  4KFD A;  5IEO A;  5IO0 A;  2K3D A;  1FOH A;  2C0E A;  2HI7 A;  4V2N A;  1XG8 A;  2WB9 A;  3DGO A;  3TKR A;  4X2H A;  1TKD B;  3TKP A;  1STD A;  3V99 A;  5D9T A;  5DRV A;  2PN8 A;  11GS A;  3OWY A;  3QR6 A;  4AGS A;  1VF2 A;  3GH9 A;  3WT2 A;  4BA7 A;  4RNY A;  4WR5 A;  3KII A;  2CIU A;  4WBR D;  1UCJ A;  1I70 A;  4OFT A;  3TKQ A;  2E2G A;  4XIH A;  3M9K A;  4NHZ A;  3PXM A;  3UL6 A;  4KZ1 A;  2AYT A;  5GAP D;  4MK3 A;  3HXS A;  1UW1 A;  2H6Y A;  2UZ8 A;  1G02 A;  3I0Y A;  5ECL B;  3LXT A;  3GHA A;  3GL3 A;  4F0C A;  7GSS A;  6GSP A;  4FQU A;  2GDR A;  4XS1 A;  3VWX A;  2X8C A;  3IHG A;  2Z7A A;  3X3X A;  1F8N A;  3LXU X;  4IIA A;  3QFB C;  1RGE A;  2X4A A;  3ERW A;  5JWO B;  3B4O A;  4HM3 B;  1BSA A;  1I5G A;  3GSS A;  5AIV A;  3PCR A;  4KT3 B;  4OD7 A;  1YF1 A;  2UUG C;  2W9Q A;  2CV4 A;  2GZY A;  4Z2T A;  1GUL A;  1WMO A;  1Q4J A;  4LMW A;  1GWC A;  3ZYW A;  4PQH A;  4HZ4 A;  1F37 A;  4KE3 A;  4LGQ A;  3A76 A;  1NW2 A;  1YGE A;  4R1K A;  3M3M A;  1KC8 4;  3O8Y A;  5F0G A;  2LJA A;  1C7H A;  2IA7 A;  2AAE A;  1VQL 3;  4BVX A;  2H8L A;  4WEY A;  1FUW A;  4HI7 A;  1TXX A;  3ISO A;  2LQQ A;  1B4Q A;  2HNL A;  4WHA A;  2FWG A;  5HOH A;  1BYE A;  1JN5 B;  1DBY A;  1LNH A;  3EU4 A;  1K41 A;  4Z2R A;  2YWI A;  1NWW A;  4PX1 A;  4GF0 A;  5IMV A;  3EUR A;  4ECI A;  1Q7Y 4;  2AAW A;  4XB5 A;  2MBT A;  6GSU A;  1VQ8 3;  3F7S A;  2WOH A;  3QCP A;  5AGY A;  4AEQ A;  1A2L A;  3H3H A;  4IEL A;  1V57 A;  3TGZ A;  2E2U A;  4E8H A;  1X1U A;  4L5L A;  5G1K A;  1AAZ A;  5G5E A;  3ECF A;  2H1A A;  2DKI A;  3AHW A;  1J08 A;  3D4T A;  5AIH A;  1BUJ A;  3VFI A;  2NDO A;  1XIY A;  5DAK A;  4ZB6 A;  3UOM A;  2GSR A;  1JZO A;  4FYU A;  1WRY A;  4J56 E;  4JR4 A;  1JLW A;  2VCQ A;  2G0F A;  2VM1 A;  4HQZ A;  3HOH A;  1FGO A;  4Q53 A;  4ISD A;  1I0X A;  1GH2 A;  1WWJ A;  2PUK C;  3FLJ A;  3G9B A;  3GV1 A;  4K2D A;  5JWR B;  4PNF A;  1EP7 A;  2H19 A;  3HJM A;  4AF2 A;  2R0C A;  3X41 A;  1AQW A;  2QKE A;  3KN4 A;  5HR3 A;  2CT6 A;  3LTA A;  4YQV A;  3AY8 A;  3DVX A;  2BMR B;  3FYG A;  2TRX A;  1TK8 B;  1F3A A;  3I6A A;  1GSY A;  5J9B A;  3IR4 A;  1FB6 A;  5JCG A;  1LQG C;  3ZMK A;  4J5G A;  2VL9 A;  1TW9 A;  2STD A;  1TK0 B;  3URP A;  2R4V A;  9GSS A;  1IQX A;  1F2E A;  3H93 A;  3HVN A;  3VWW A;  2AUV A;  5J41 A;  2XH9 A;  1U3I A;  3F4T A;  2L57 A;  5GAN D;  3K7C A;  1HU9 A;  2LEG A;  1A23 A;  1NO3 A;  1ERU A;  4MH2 A;  2HE3 A;  1EV4 A;  4AJ8 A;  1VQP 3;  2F8F A;  4PEJ A;  1RGK A;  1K3Y A;  2HMK B;  5H5S A;  4KDX A;  1BSC A;  5CF2 A;  1XWK A;  4DSR A;  1SIH A;  4HEA 2;  1YKC A;  1LOX A;  4MJE A;  5J5N A;  2DBC A;  3KP8 A;  3KMO A;  1FHE A;  4MF5 A;  4X0X A;  5DJM A;  2ZNM A;  1N9E A;  5I97 A;  4NWY A;  1K28 A;  4ECB A;  1BNI A;  2DJ2 A;  4R4K A;  3IOS A;  1GMP A;  4IT7 A;  4FO5 A;  1RRL A;  2KAA A;  1LOW A;  4XBX A;  1RNT A;  2C0F A;  2KP2 A;  2IME A;  4XRA A;  2KF6 A;  1CH0 A;  2B24 B;  3CSJ A;  1S3C A;  2C3N A;  2OAC A;  2Q07 A;  3A2V A;  2X49 A;  7GSP A;  2GSS A;  6GSY A;  3B4P A;  1M7T A;  1O6J A;  2V6K A;  4ZL7 A;  3KCM A;  3A5W A;  2VL2 A;  3WHO A;  4K61 A;  2PPT A;  3HVX A;  3ZRD A;  5ECK B;  3SBC A;  1UGI A;  3X40 A;  2H1B A;  3RDW A;  3LT8 A;  1GNW A;  1QFN A;  3HI7 A;  2DIY A;  4F03 A;  4HJ2 A;  3ERF A;  1LQM B;  2RUE A;  1KQS 2;  1GSU A;  1BAN A;  1RMS A;  4EXR A;  3KMN A;  4GQF A;  1RJO A;  1LU4 A;  3DGN A;  1L5G B;  4CY6 A;  5IPH A;  2FHE A;  3O3T A;  2Z76 A;  4EF0 A;  1BRS A;  2PMT A;  3ME7 A;  4GSS A;  2FA4 A;  3Q6O A;  3FEU A;  2REM A;  2L59 A;  1V40 A;  4BU4 A;  2FWF A;  4IKH A;  4KX4 A;  1ON4 A;  4G0K A;  4MMX B;  1WMJ A;  2B1X B;  2VCW A;  2VOC A;  5FW5 A;  3K0Z A;  4TXO A;  1CQS A;  4HBR A;  1IVW A;  3DY5 A;  1I0V A;  4EBG A;  4I4K A;  1TIJ A;  3R2Q A;  4XM4 A;  1GS3 A;  3GKN A;  2OCT A;  6GSX A;  3DMC A;  4NV2 A;  3RPP A;  3ERG A;  4HUA A;  1MWU A;  3BNE A;  1IT7 A;  4K6X A;  5KN1 A;  1O7P B;  3ZL5 A;  2AJQ B;  2WGQ A;  1GY6 A;  3ZVJ D;  1KEB A;  2PU9 C;  3C73 A;  2K8V A;  1BX9 A;  4HSC X;  1KNG A;  1T4Z A;  3EIN A;  2WJU A;  1YGW A;  1TI3 A;  3WOF B;  3TKS C;  1N9J A;  4K1V A;  1PFO A;  1T8E B;  4KVH A;  5EVH A;  3CSI A;  3FH1 A;  1GSP A;  4DSS B;  2W9P A;  2GXF A;  1BRK A;  1ZYP A;  4MPF A;  2GS3 A;  5ECP B;  2CX3 A;  3CXG A;  3L0R A;  1X0R A;  4CDL A;  4LL4 B;  2HMN B;  3I9V 2;  1QQ2 A;  1SJ6 A;  2CFL A;  3BNC A;  4R80 A;  1GSD A;  4PQ1 A;  4WF5 A;  1OC8 A;  3LJR A;  3Q19 A;  1FGQ A;  2H71 A;  4X4J A;  1BJX A;  3RDE A;  3FF2 A;  1A0F A;  4ZXG A;  3RNT A;  3N5O A;  1SK1 A;  2VO4 A;  3GKM A;  2C10 A;  1WPI A;  2CVD A;  4JBB A;  2BHM A;  2KHP A;  3S67 A;  5ECN B;  5JCW A;  1W5Z A;  1AC1 A;  3CMI A;  2WO0 A;  1YJ9 3;  4TXO B;  4G0I A;  3DD3 A;  4OMV A;  3FKA A;  5AIF A;  4PUR A;  1NNV A;  5D83 A;  3ZLP A;  3NUV A;  4HM7 B;  4GL6 A;  4MAB A;  2IY2 A;  1IYI A;  3AMO B;  5F8B A;  3LZA A;  1THX A;  5JCU A;  2H01 A;  1A67 A;  5FGO A;  5HR0 A;  5HR2 A;  1FW1 A;  4Q5F A;  2F86 B;  2I9H A;  3EBT A;  14GS A;  3FK8 A;  2IUJ A;  2YPM A;  1R4Y A;  2CAI A;  4O5Q A;  3Q3F A;  1E97 A;  3FG4 A;  2W03 A;  5IMZ A;  3VPT A;  1TU5 A;  2BTO T;  4GCI A;  3N9H A;  2Z9S A;  4KW6 A;  2OOV A;  1K9M 4;  1RW1 A;  1N5H A;  2P0X A;  3UL3 A;  1VF3 A;  1SQW A;  1J2B A;  5E4W A;  3DXO A;  4HQS A;  5ENU A;  3LH4 A;  4K1F A;  4HVN A;  1JB5 A;  5IG5 A;  4IQ1 A;  1UGH I;  2J8X B;  1OAZ A;  1FA3 A;  4EL1 A;  1ZYE A;  5A4W A;  3SYU A;  4F9Z A;  12GS A;  5CRW A;  3KTB A;  3LTB A;  4WF4 A;  4EV5 A;  6GSW A;  2CQ9 A;  3JCM L;  3Q1C A;  3A5E A;  3IC4 A;  4ILF A;  1TUH A;  1W02 A;  3EE1 A;  4D73 A;  3KZQ A;  2SBL A;  4CDO A;  4WYK A;  4EV2 A;  2H0H A;  4I5Q A;  2GT6 A;  5J9C A;  3IAM 2;  4IPB A;  1H4O A;  3WOD G;  5D93 A;  1R7H A;  1D6Y A;  2CX0 A;  3ZIV A;  4EO3 A;  3G7J A;  2BIR A;  5AI1 A;  3GA4 A;  1RGC A;  1YJW 3;  1ACV A;  3MSZ A;  1AQX A;  3ZG0 A;  4HZ9 B;  2YJ7 A;  2K18 A;  2X8H A;  4POM A;  2GQK A;  1GOY A;  3LQ7 A;  1V2A A;  3I69 A;  5LD0 A;  1V9W A;  1HKX A;  4TX4 A;  3UAP A;  2RLI A;  3LWA A;  4RQX A;  3NM7 A;  1X5E A;  3HD5 A;  4N11 A;  3F8X A;  5H5Q A;  3MWZ A;  1W6C A;  4KCE A;  1HYF A;  1UVZ A;  4WYK B;  1B8X A;  2OE1 A;  1YJ6 A;  2M46 A;  4GXZ A;  3CNX A;  1RGG A;  3PH9 A;  3US3 A;  2IMD A;  2XFS A;  1JZW A;  4JR6 A;  3EX9 A;  1G7E A;  3NOF A;  1Y4K A;  1AUC A;  1GYB A;  2P38 A;  4HDE A;  1BNG A;  1XFL A;  3EPT A;  3BJ5 A;  1IYH A;  2NBS A;  5BXQ A;  3F4S A;  4CY8 A;  3FHK A;  2IMF A;  2RNT A;  1NHO A;  3U5R E;  4ICY A;  1TRP A;  2GSQ A;  4I97 A;  3SXX A;  1A2K A;  4FCZ A;  3R3E A;  2YV7 A;  4NPB A;  3TOU A;  3EJV A;  5CF1 A;  1GLP A;  2QA2 A;  4RNT A;  2CWT A;  1FVJ A;  4NMU A;  4OCE A;  3CCU 3;  3LXZ A;  2NPB A;  3I56 3;  2WCI A;  3JUN A;  4FMA A;  5ELU A;  3KGK A;  4WKW A;  5IMA A;  3D9R A;  2R37 A;  3S27 A;  4KUN A;  5CRE A;  1EGO A;  1DMQ A;  3H8Q A;  1XVQ A;  4MDC A;  3WOE B;  1U8C B;  4K90 B;  2QGU A;  1SKS B;  3D21 A;  1T5Y A;  2WUL A;  2Z77 A;  2C8U A;  2YWM A;  4O8S A;  5ELJ A;  3FF0 A;  2CKF B;  1GUH A;  2F5M A;  4O2H A;  4BWS A;  1EOG A;  3BCI A;  1DE1 A;  1IDP A;  1MGR A;  2DML A;  2C1Y A;  3TKS A;  1T2I A;  4EXJ A;  3K8N A;  2R5G A;  1SYR A;  1IYY A;  4R9L A;  2YJH A;  5ECM B;  2RGQ A;  3TRQ A;  1ZS7 A;  3K63 A;  4JE1 A;  4NV5 A;  2W2C A;  1RCL A;  1LVN A;  3GTU B;  3BD2 A;  3LGC A;  4TR1 A;  4TW5 A;  2OJL A;  4BVX B;  3CU3 A;  3RGR A;  2V41 A;  1YHQ 3;  4NXI A;  2BMX A;  3KKG A;  20GS A;  2DMM A;  1I3F A;  1RSN A;  2IMI A;  5EL8 A;  1GMQ A;  4YQU A;  1OE7 A;  1QAF A;  1EP8 A;  1PU4 A;  4YAP A;  4K7I A;  5D82 A;  3WMD A;  3W8S A;  2F51 A;  5G5F A;  1BIR A;  2JU5 A;  3HK4 A;  3PS8 A;  1FGT A;  3IK7 A;  1NSW A;  2V1L A;  3K5T A;  3STD A;  4K2X A;  2C11 A;  3EQQ B;  3OXA A;  3H79 A;  4XS4 A;  2GU3 A;  4RUV A;  1I2F A;  1W6Y A;  2HSH A;  1FG4 A;  2YAN A;  1YF0 A;  3M9J A;  3BIR A;  4YKG A;  2A2P A;  5IMC A;  3CCS 3;  3OR5 A;  1IVU A;  3CBU A;  4Z2U A;  3EC9 A;  5AIG A;  1W4V A;  3J7Y b;  3ZG5 A;  1YNV X;  3EBY A;  1LJR A;  2XPE A;  3LT9 A;  1B2S A;  3T8U A;  1VQN 3;  3KIJ A;  2A2S A;  8CHO A;  3FSD A;  3KTL A;  5IO2 A;  1U88 A;  1RGH A;  3F8H A;  4KCA A;  5AEW B;  4TN8 A;  1S3D A;  5IIZ A;  1GD3 A;  2YFJ B;  2GST A;  2GBX B;  2V2G A;  3TJB A;  4KSO A;  1CEW I;  4OFM A;  3F14 A;  3IPZ A;  4DEJ A;  4NHF A;  1GOU A;  1SK0 A;  1IVV A;  3UL5 A;  3AHS A;  3MHE A;  2MMA A;  1KSI A;  1B4P A;  4QQ7 A;  2GVP A;  1UUG B;  2CZ3 A;  2A15 A;  3KEB A;  2CG0 A;  1QMV A;  3EC3 A;  4MLY A;  3NV0 A;  4DSS A;  3D5J A;  1TRW A;  4HZ2 A;  1Z7P A;  1M9A A;  3U1W A;  2HZF A;  2JAC A;  1IT8 A;  4G1M B;  4IJ3 A;  1UUV B;  1FZU A;  1M2D A;  2E7P A;  3MPH A;  1ZMA A;  2CWU A;  4CW9 A;  2F8A A;  1O7W B;  5DQY A;  2R4I A;  1X1Y A;  1MNL A;  2N5F A;  4HM0 B;  3AMO A;  3GAX A;  2R0P A;  3F0I A;  3WT1 A;  4ECC A;  4KAE A;  4OO5 A;  3TUE A;  4BIK A;  1G6W A;  4OO4 A;  2B5E A;  1USB A;  5ECI B;  1N8Q A;  3GRX A;  1ZCP A;  4P3Y B;  3GFK A;  3IC8 A;  3BNB A;  2PBJ A;  3ZVJ A;  2K0M A;  4V2M A;  2VCV A;  1JRQ A;  2YFI B;  2JSZ A;  2EC4 A;  3MIX A;  1JV2 B;  1PA3 A;  3E3E A;  5E59 A;  4KND A;  2H74 A;  1PSQ A;  1BNJ A;  1F3B A;  1BUQ A;  3TKS E;  3G4S 3;  3WGX A;  4J5K A;  1EUI C;  3S28 A;  1PGT A;  2YOI A;  5DJL A;  4JED A;  4EIP A;  4RZM A;  3CCV 3;  4G10 A;  1EKM A;  3F3R A;  4LA1 A;  2H73 A;  3IK9 A;  5TGN A;  2D1W A;  1C54 A;  2CWV A;  3RBT A;  1ISK A;  2OA7 A;  1F6M C;  1XWB A;  2PGT A;  2YCD A;  1OGX A;  4GRF A;  4HM6 B;  2M7O A;  1NB5 I;  5DBQ A;  3IXR A;  5D81 A;  4K0G A;  5IMF A;  4FR9 A;  1FGR A;  1LRA A;  1GUK A;  2PVQ A;  1YQ1 A;  5M19 A;  4XHM A;  2YFL B;  5G2G A;  2O3O A;  1U87 A;  3WR2 A;  1OKD A;  1LNI A;  3A3T A;  4IP1 A;  4G0L A;  1DMN A;  3D4A A;  2Y73 A;  4HOH A;  2BNG A;  1UN2 A;  1A2J A;  1VZZ A;  1XWA A;  3ZFZ A;  3F3Q A;  1BOX A;  4MF6 A;  3IAS 2;  4MF7 A;  3MAK A;  2F5W A;  1AQZ A;  3RHC A;  5KOW A;  4POL A;  4RI6 A;  4ZL8 A;  4EC6 A;  3TJJ A;  2LYX A;  1S3R A;  3IHQ A;  3VI7 A;  4ACS A;  1GLQ A;  4TVE A;  3GZY B;  2F9S A;  2CC3 A;  2VAF A;  1MEK A;  1T00 A;  2B7K A;  5F06 A;  1NHY A;  1Q82 4;  4BVY B;  4IP6 A;  1PD2 1;  5AN1 A;  1MWR A;  4F0B A;  2HRN A;  2L4Q A;  2CFD A;  4N6O B;  3EMP A;  1SJZ A;  1DSB A;  1EA2 A;  5AEU B;  3VI5 A;  1G7O A;  2C3Q A;  3N9J A;  4X43 A;  2PZV A;  1NU3 A;  3RGA A;  4ZIL A;  2KLX A;  4LL1 B;  4RNZ A;  3RAZ A;  5HR1 A;  5JBS A;  3L9U A;  4X1U A;  3PR8 A;  5BIR A;  3HZP A;  4ZB8 A;  4LMI A;  5DAK B;  2LRC A;  5LNK e;  2QC7 A;  1ILO A;  1S72 3;  2MBS A;  2IL3 A;  2BO9 B;  3KFQ C;  2A2R A;  1CQH A;  2OTL 3;  2CZ2 A;  1SJI A;  4XDV A;  3S29 A;  3JUO A;  4L8E A;  4MZW A;  4PNG A;  1BRN L;  4Q5R A;  2F3M A;  2FNO A;  3D22 A;  1GTA A;  2H75 A;  2H1D A;  1WQL B;  2B1L A;  3FRC A;  3QD9 A;  2VLV A;  1VQQ A;  3D5G A;  4HZB B;  1BRJ A;  2LKU A;  4MJA A;  4D73 B;  4XS6 A;  3RHB A;  8GSS A;  4KH7 A;  1JNQ A;  1CQG A;  5EPF A;  2XGL A;  2B6M A;  1XBS A;  1EQK A;  5KN0 A;  4ZBD A;  2XBQ A;  2CVK A;  1MOL A;  1X9M B;  5CNW A;  1OC9 A;  2CG1 A;  2GTU A;  3FMW A;  3GZX B;  3NV0 B;  2DJ3 A;  1YVS A;  1K3O A;  1YY7 A;  1PQN A;  1DET A;  2ML6 A;  5F07 A;  1RNB A;  3GUS A;  4HKV B;  4L0W A;  5B8B A;  2OBK A;  1SII A;  4HM8 B;  1YIJ 3;  3TJK A;  5IMD A;  5DRE A;  2IFQ A;  3D6I A;  1W7C A;  4PTS A;  3DZL A;  4QL7 A;  1OE8 A;  2LJK A;  2FGX A;  2VL3 A;  1OHP A;  3KP9 A;  4NHW A;  4OCF A;  3HZ8 A;  3LTC A;  4HYZ A;  2YZU A;  2C0G A;  3PGB A;  4PGT A;  1THO A;  1K0M A;  4POK A;  2DIZ A;  2HT9 A;  3CRT A;  2I3Y A;  1Q40 A;  5LC7 A;  1DVD A;  2R3X A;  1GSF A;  1O8X A;  3FR3 A;  1Z6M A;  5KN2 A;  3P2A A;  3LSZ A;  1UC7 A;  2WZ9 A;  1O7G B;  1FUS A;  1XCC A;  4FYC A;  3C7M A;  3KM6 A;  5KOX A;  5IG3 A;  4H3U A;  4L5O A;  1YEP A;  3S9F A;  4CHS A;  3VWV A;  2HMM B;  2H1G A;  1YEX A;  5A5K A;  2INX A;  1AR0 A;  2V6O A;  1OVN A;  3E0U A;  1NJI 4;  1E3R A;  1GY7 A;  2DJ0 A;  1ZOF A;  1TTZ A;  5GZZ B;  2KF3 A;  2W6J H;  1W2Z A;  1GRX A;  4V1A g;  4ID0 A;  1K0C A;  4Q5N A;  2O7K A;  4EE0 A;  2BT3 A;  1GMR A;  3HCZ A;  1R4W A;  2R41 A;  3M8C A;  4RI7 A;  2LQO A;  1M2B A;  4BL7 B;  2P09 A;  2J9H A;  1Z7R A;  4N6U A;  3EF8 A;  2E2V A;  3KCH A;  3SVA A;  1N8J A;  1W00 A;  3PPU A;  1SL0 B;  5IOX A;  2LTK A;  2KF4 A;  4K8M A;  4HJL B;  4H61 A;  1JZR A;  3QOU A;  3CTF A;  1GSE A;  3NQY A;  1CYU A;  2DSA A;  3CMA 3;  3GYK A;  3TDG A;  4F2I A;  2FGT A;  3E99 A;  2EIQ A;  1K8A 4;  3ALA A;  4N6N B;  1GNE A;  1HYU A;  3NZN A;  2LRN A;  1I9D A;  1JHB A;  2YP6 A;  4L7K A;  1SEN A;  3WA3 A;  3KE7 A;  2GEX A;  2FUG 2;  1ZL9 A;  4OK0 A;  1RN1 A;  3ZFB A;  3IPT A;  4WBJ A;  1ZZY A;  5J4U A;  4RBN A;  1DYU A;  3CCL 3;  2FY6 A;  3UBK A;  3NBB A;  2WS2 A;  1Q86 4;  2MZC A;  3G0K A;  5H5R A;  1W4N A;  1Q9E A;  1IU7 A;  2VD1 A;  3K9M C;  2N5B A;  1BNF A;  1SU9 A;  5IM9 A;  3QAV A;  4BWQ A;  3J7Y k;  5B6M A;  3KZT A;  2RSX A;  1PRX A;  3EU3 A;  5ABR A;  4KDU A;  2XSH B;  4ULX A;  2OWP A;  1MWS A;  5GSS A;  1O7N B;  1M1X B;  5EEO A;  4EW5 A;  1R5A A;  1PYL A;  2PNC A;  1HNC A;  4TR1 B;  3FZW A;  3GX0 A;  3HY2 A;  5LC6 A;  2O89 A;  4X2O A;  1BGS A;  1O7U A;  4IJI A;  3DXB A;  4FIW A;  3I55 3;  2HRA A;  1T2H A;  3D3L A;  2B5Y A;  2ALB A;  3G16 A;  2X64 A;  1W2B 2;  3MNG A;  3WA2 X;  3GIX A;  1UA5 A;  1VRS D;  4JU5 A;  1GOV A;  1OGZ A;  2KRT A;  2TRC P;  3F4R A;  3GH6 A;  3W8J A;  2AAD A;  2KF5 A;  1BAY A;  3EMX A;  2H30 A;  2ZA4 A;  1LOV A;  1VF4 A;  2FWE A;  5L71 A;  3ED3 A;  3PCS A;  1TRQ A;  2IMJ A;  2LNS A;  3G6E 3;  2OQE A;  4ZL9 A;  1B27 A;  3MWH A;  1HNB A;  1JKG A;  1ZO2 A;  2WGO A;  1XXU A;  3DKS A;  2B3S A;  5A4V A;  3NX0 A;  1RN4 A;  2RFR A;  3TJG A;  3DGM A;  2XEP A;  1AW9 A;  4QWT A;  1B2Z A;  5ELG A;  1AXD A;  3HZ4 A;  1HD2 A;  2YX9 A;  4J2F A;  2SAR A;  1T4Y A;  1QMA A;  1OYJ A;  3KSE D;  1KWI A;  5FWG A;  2O9U X;  3DYR A;  3L0H A;  4N0V A;  2QA1 A;  1OC3 A;  2CAQ A;  2GZP A;  1VQO 3;  1KD1 4;  3KD0 A;  3OWU A;  4FCJ A;  4FCM A;  2WGR A;  5IEN A;  2GSP A;  1GTU A;  2QEX 3;  5D73 A;  1X1X A;  4GSP A;  3BCK A;  1R5P A;  3SED A;  13GS A;  1MDK A;  3LFL A;  1K73 4;  4RQR A;  1TOF A;  2H70 A;  2DJJ A;  1HZ1 A;  2LV3 A;  1ZYN A;  3CSH A;  4WWU C;  3HHV A;  5J3R A;  5DCH A;  5LCZ A;  2H6Z A;  1Y25 A;  1TRV A;  1Z3E A;  4V1A p;  2PER A;  8RNT A;  3SLU A;  1S3A A;  1TK5 B;  3FCS B;  5IOW A;  4YH2 A;  4GHO A;  3GUR A;  3SX1 A;  2HYX A;  5AIX A;  3Q2P A;  5B8A A;  5CP1 A;  2RM5 A;  4TOP A;  1T3B A;  4R9K A;  2IWT A;  2C80 A;  2FXT A;  4GWR A;  1OHS A;  2A4V A;  1GD4 A;  3B8L A;  1PKW A;  3IDV A;  3LOY A;  2LS5 A;  2HSY A;  2HOH A;  2YZH A;  1RTU A;  2JQ5 A;  2K9F A;  4EKZ A;  1BSD A;  4DKI A;  4MMZ B;  4GSN A;  3GRD A;  1O8W A;  2HSM A;  1TRU A;  2ZL8 A;  2HZE B;  3GMF A;  3IE3 A;  1ULJ B;  2KCD A;  3G7I A;  3GWR A;  2VIM A;  3ME8 A;  3G7Y A;  1JJ2 2;  1WP0 A;  3TOT A;  2M72 A;  4I2T A;  1RGA A;  1OH0 A;  4E8E A;  2P5R A;  2O8V B;  1TRS A;  3GST A;  1BSE A;  1XWC A;  3HVV A;  4ZB9 A;  4BPY A;  4K7O A;  3CYN A;  3CRU A;  4MZC A;  1QUW A;  2A4H A;  3VWU A;  4XCS A;  4JF8 A;  4XBT A;  1N8R 4;  2DJK A;  1UDI I;  4IQA A;  3ZML A;  4HJM A;  3F9U A;  2IN3 A;  2J23 A;  4N0Z A;  3DML A;  1MDI A;  1MD4 A;  4L8O A;  3ZIT A;  1RDS A;  2JZT A;  2MF7 A;  4KSM A;  3UVT A;  2I4A A;  2K8S A;  3IA1 A;  1RLS A;  3HJP A;  3BBY A;  2HZE A;  4J8T A;  5ECQ B;  2L5O A;  5D9V A;  2GLR A;  2F99 A;  4K7N A;  4EIQ A;  1N2A A;  4H86 A;  4MMM A;  2JSY A;  1DVC A;  3VK9 A;  2R6K A;  3Q18 A;  4N6M A;  4ZM8 A;  3ER7 A;  4BL7 A;  2F4Y A;  2AHE A;  9RNT A;  2I1U A;  2RM6 A;  1FAA A;  4N30 A;  2MMN A;  5IG4 A;  2OTJ 3;  4WXT A;  3UMA A;  3LG6 A;  4WET A;  3NM2 A;  3H4K A;  1SAR A;  1R26 A;  1PY3 A;  3UNL A;  1PN0 A;  2GT5 A;  3AGO A;  5IEP A;  4MA9 A;  2ON7 A;  1BNS A;  4AJ6 A;  2B7J A;  5BU4 A;  5KP4 A;  4K0N A;  1ZYQ B;  1T7P B;  2GZZ A;  3VSY A;  5BVB A;  3T8N A;  1EG9 B;  2P31 A;  1V58 A;  1ZX2 A;  2RBI A;  2L4C A;  5HFI A;  2VCX A;  3OX9 A;  5ECO B;  2L4V A;  1YJN 3;  3EB8 A;  4MJD A;  1DE3 A;  4FYB A;  4KFE A;  3CD6 3;  2Z6B A;  2OBI A;  4BTX A;  3FW2 A;  1GY5 A;  2CA8 A;  5B7C A;  1KTE A;  5D9X A;  1MGW A;  1PMT A;  2RCD A;  4IVF A;  3M1G A;  2H0I A;  1H75 A;  4NRE A;  3L78 A;  3HII A;  3DGQ A;  4ZIJ A;  4BL2 A;  1WE0 A;  1ULI B;  3X3Z A;  2VUP A;  5COH A;  4MH3 A;  3JUP A;  5F05 A;  4KDY A;  2MMO A;  4XTS A;  4EUY A;  5ELA A;  2K54 A;  4GTU A;  2CFK A;  1LBK A;  1Q98 A;  1AVL A;  2IYJ A;  5KEJ A;  1ZGN A;  1QAK A;  2OE3 A;  1U3A A;  5A0O B;  1UUW B;  2F56 A;  5IQY A;  1B3S A;  4AJ7 A;  2EIO A;  3GZB A;  6STD A;  4O92 A;  1TDI A;  4ECJ A;  4EVM A;  1TJD A;  1GTI A;  2FLS A;  2LUS A;  1OUN A;  5KN3 A;  1QVF 2;  2ZHX B;  3GKK A;  3VF1 A;  2RII A;  4GST A;  3EHC A;  1HNA A;  2F98 A;  2WRT A;  1X9S B;  1Z5Y E;  2RUF A;  1B2X A;  3B7C A;  5ECH B;  5C04 A;  2LNT A;  1QVG 2;  1AY7 A;  4TR0 A;  1J9B A;  3FY7 A;  1ML6 A;  3UJM A;  3GL5 A;  1EWX A;  3GSP A;  5CRH A;  18GS A;  1V98 A;  3DVW A;  3WDG B;  3MG2 A;  1SPU A;  1FB0 A;  4YAV A;  3Q74 A;  4XBY A;  19GS A;  5AIS A;  3HA9 A;  3F8U A;  1ERW A;  1XOB A;  1Q42 A;  1VQM 3;  1M3J A;  1JB2 A;  3J7Y d;  1I2E A;  1X5D A;  4FMD A;  4CJN A;  4HOJ A;  1BU4 A;  3LYK A;  1PFP A;  2UX0 A;  2JL4 A;  4I8B A;  3FZ5 A;  3WGE A;  1UCK A;  2CW9 A;  1B2U A;  3U97 A;  2V32 A;  4KFF A;  2O85 A;  1EZK A;  3UJ1 A;  2XSO B;  1A2V A;  1VQK 3;  1MD3 A;  4K1U A;  4V2L A;  1N5P A;  1RGL A;  3ZTL A;  1STF I;  4O32 A;  2IUK A;  1O73 A;  5DVB A;  4OUQ A;  4TR3 A;  3ZRE A;  4EDZ A;  2ML5 A;  4PQI A;  3KJY A;  2GGT A;  2XFT A;  3VPQ A;  1A2P A;  1FYS A;  3C1S A;  2VCZ A;  5FT3 A;  3DIE A;  3D0Z A;  1WMN A;  4HU7 A;  3G71 3;  5ID2 A;  4Z7X A;  1XPV A;  1DMM A;  4N3V A;  4IGJ A;  1M2A A;  1NM3 A;  1Z6N A;  2NVL A;  1HQO A;  1Z9H A;  1IQY A;  1E6B A;  4O5U A;  2YN1 A;  3SWL A;  2D42 A;  1BRH A;  1BQ7 A;  4KGI A;  1FGM A;  3WD6 A;  3GX8 A;  4QL9 A;  1GP1 A;  2CFG A;  4K5R A;  3MYT A;  2D2Z A;  1Q7H A;  1ABA A;  2W56 B;  2I81 A;  5RNT A;  2L6C A;  1SK2 A;  3A2X A;  5ID2 B;  3GZR A;  1SD8 A;  4KA0 A;  2CX1 A;  4N6V 0;  2HXK A;  1OF5 B;  1PL1 A;  1V74 A;  5CLK A;  1K0D A;  2LRT A;  3TB2 A;  1BNR A;  1OC9 B;  1URM A;  1WTH A;  3BND A;  2VL2 C;  4N6L A;  2ZUP A;  2C4J A;  2LST A;  4FMC A;  3UIW A;  3X3Y A;  1M0U A;  4HAA A;  2HRF A;  3F40 A;  4GB5 A;  3VGN A;  5IER A;  1GUM A;  2JZS A;  3DRN A;  3FR9 A;  3HYP A;  2LJR A;  4XRD A;  1UCI A;  4OVM A;  1XW6 A;  4WR4 A;  1Q81 4;  4OFN A;  3D4M A;  4F82 A;  2L1S A;  1U5O A;  3CNM A;  1FVK A;  2N5A A;  2DJ1 A;  4J9A A;  5JPU A;  1VQ4 3;  1BRG A;  3TJF A;  2L6D A;  1PKZ A;  1SL2 B;  4ML1 A;  2X8G A;  5IPG A;  2OAD A;  4ORL A;  4MMY B;  5JPP A;  1U6T A;  5B6N A;  2KOK A;  5IG0 A;  1SL1 B;  2HFD A;  1QAL A;  1X1W A;  3C8E A;  1E3V A;  1CYV A;  16GS A;  1K0O A;  1IV9 A;  2QSI A;  3QDN A;  5D8I A;  1BAO A;  1E2Y A;  4DVC A;  3A2W A;  4USS A;  3PYJ A;  4WP5 A;  4AKY A;  3EYT A;  1QK8 A;  1VQ5 3;  1VF1 A;  4DSQ A;  1TFK A;  3N8B A;  4LEH A;  3IRA A;  3KSP A;  3X42 A;  4LZI A;  3EN8 A;  3KH7 A;  2IJY A;  4N10 A;  4OWY A;  4LLR A;  2IFQ B;  1BED A;  5G1L A;  3F7X A;  2CFW A;  2XGN A;  4JRF A;  2C0D A;  4WFO A;  1TP9 A;  3C71 A;  3JUM A;  4MJB A;  5GST A;  3BLZ A;  5JWQ B;  2YNX A;  1YDK A;  3HDC A;  3IV4 A;  1JZD A;  3F9S A;  3PZW A;  5G31 A;  2BMQ B;  1K3L A;  2H66 A;  1BNE A;  3KH9 A;  1XZO A;  1OPY A;  1OF5 A;  5DQS A;  2OE0 A;  3F6D A;  5CK6 A;  5FHI A;  4G9H A;  4XDW A;  1ROV A;  3QFA C;  1R4C A;  2ZDJ A;  5CO3 A;  2I9W A;  1XOA A;  5CRD A;  3F6F A;  2TIR A;  2KP1 A;  2XHF A;  3U6V A;  4BVY A;  4IW9 A;  1M9B A;  1RRH A;  3JVC A;  3H1N A;  4N6T A;  3CXC 2;  1YIT 3;  2H0G A;  2VLU A;  3PIN A;  2IIY A;  2E0Q A;  2KUC A;  3HVS A;  3LTD A;  1EGR A;  2P5Q A;  2BJX A;  3APS A;  3IMA B;  1TU7 A;  3DM8 A;  3EN1 B;  4U13 A;  4YQM A;  2QIY A;  3P90 A;  1Q40 B;  1A2M A;  3GNJ A;  4CCV A;  2QGV A;  2P0M A;  1B2M A;  3ZZX A;  5G2Z A;  3CTG A;  1GTB A;  2V1M A;  3BU4 A;  3MG3 A;  2H76 A;  2NTO A;  5DCG A;  4IHU A;  3MSO A;  4MEI A;  1OHO A;  1EEM A;  1B21 A;  3FG3 A;  2XC2 A;  4MP4 A;  2R2J A;  4HU9 A;  4TR4 A;  1PN9 A;  1K0N A;  4HM2 B;  3DGL A;  4TRX A;  3FZ4 A;  1JBS A;  3ZFL A;  2G2Q A;  1K0B A;  1RGF A;  1TP6 A;  2HRK A;  2OKA A;  1GSS A;  3OW2 2;  2GQM A;  3GN3 A;  1NDO B;  4EYC A;  3VLN A;  1TI1 A;  3CC7 3;  4KF9 A;  2OOV C;  2GU1 A;  2MYG A;  1IK3 A;  1GL8 A;  1FW7 A;  1PL2 A;  1XVW A;  2R0G A;  1AV4 A;  2E2T A;  3CC2 3;  1JN5 A;  3I43 A;  3N54 B;  1JB4 A;  2IPA A;  3FKF A;  5DAL B;  4EC0 A;  3FGY A;  3EVI A;  1VQ6 3;  5CYY A;  5STD A;  4ZBA A;  5M18 A;  1RN7 A;  1F9M A;  1TU8 A;  4I6X A;  3S5C A;  2ES7 A;  2XR8 B;  5A4U A;  1RQM A;  3FZA A;  1OCV A;  1YKA A;  2JDI H;  10GS A;  2MMZ A;  5KP3 A;  3CME 3;  3CQF A;  3QAW A;  2B1K A;  2DLX A;  1AQV A;  3OWS A;  2LQV A;  4I2U A;  3WYW A;  3OV4 A;  1SYX A;  3H51 A;  3P8W A;  2HML B;  2JAD A;  5D9W A;  1WJK A;  4EDY A;  2CK3 H;  4PXO A;  4BIR A;  5EQL A;  4FH8 A;  2CH9 A;  1SJW A;  1IQ8 A;  1BVI A;  7RNT A;  1XW5 A;  3QPM A;  2X99 A;  2E2M A;  4LYL B;  17GS A;  2FNQ A;  3C1R A;  1A8Y A;  1X5C A;  4CPK A;  3D79 A;  5EY6 A;  1VGL A;  1ZGX A;  5HFG A;  4BTW A;  4IN0 A;  4MPG A;  1WIK A;  1UI8 A;  3LOR A;  1T1V A;  3F63 A;  1M9G A;  1A8L A;  3TRP A;  3CCR 3;  3CPW 2;  3E9J B;  3G8Z A;  2ZCT A;  1PX7 A;  3JUQ A;  2W0Q A;  1Y6E A;  4YKF A;  3MKI A;  2W04 A;  3O76 A;  4PUF C;  3ZIJ A;  1A0R P;  1XWG A;  1TTO A;  5AYS C;  3HJO A;  1B20 A;  3D5I A;  3UBL A;  1FO5 A;  1YI2 3;  3IJE B;  2YV9 A;  4BL3 A;  1PX6 A;  1RCK A;  4AKZ A;  3UVH A;  4O7H A;  1DUG A;  1QXH A;  5DAL A;  4L0U A;  5BRT A;  1A90 A;  4Q5Q A;  1ST9 A;  5HGR A;  3TRX A;  3CCJ 3;  2YWO A;  1UI7 A;  1WMP A;  1GSQ A;  2BMO B;  1FUT A;  3APO A;  3EE2 A;  1DE2 A;  5AII A;  1C72 A;  4ML6 A;  1G0T A;  2VLT A;  3CCM 3;  2WDU A;  4HM4 B;  3W6G A;  3UEM A;  1YZX A;  1MWT A;  1US1 A;  1EEJ A;  1M1K 4;  1M90 4;  2C3T A;  2VD0 A;  4K5S A;  1I3I A;  3LYG A;  2EIR A;  2H72 A;  2PWJ A;  1JKG B;  2FCH A;  2DC5 A;  1TFO A;  3MYD A;  3BOA A;  3M0F A;  3FG1 A;  1RKY A;  6GST A;  3NXJ A;  5EVO A;  2XBI A;  3T0U A;  1D6Z A;  1S5A A;  4BTY A;  3CPO A;  3IBH A;  4GLT A;  3DH2 A;  2VCT A;  3LML A;  3V92 A;  5BMU A;  1G6Y A;  3HKR A;  1JBT A;  3A5I A;  4LSO A;  3L4N A;  1WOU A;  5HQP A;  4LMV A;  1SKR B;  3ROB A;  2AV4 A;  2CX4 A;  4IBP A;  1B48 A; 
#chains in the Genus database with same CATH homology
 4XS4 B;  4G19 A;  3KXO A;  4IS0 A;  4PUA A;  3GKX A;  2JZR A;  2DKH A;  1W89 A;  2PVO C;  1KBN A;  6GSV A;  1FOV A;  4JRR A;  2P0G A;  4NAX A;  1JFU A;  4MJC A;  3NIV A;  2FD3 A;  3L9S A;  4POB A;  2CVB A;  3QAG A;  1RK4 A;  3UAR A;  3FR6 A;  3DWV A;  3WGD A;  5DDL A;  5INY A;  4HS1 A;  4J57 E;  3LEF A;  6GSS A;  3GTU A;  1M99 A;  5HFK A;  1ERT A;  4TXV A;  3PGT A;  1B48 A;  3TCO A;  3V1W A;  3RPN A;  22GS A;  2IMK A;  1EV9 A;  3QMX A;  2M80 A;  4TKY A;  4MNN A;  4A5P A;  2WFC A;  4G2E A;  2H6X A;  4JZQ A;  2GQL A;  3P7X A;  2L5L A;  1O85 A;  2XPD A;  1B9Y C;  5C00 A;  2FA8 A;  1QGV A;  1ERV A;  1OKT A;  2FWH A;  5ECS A;  4MCU A;  2HLS A;  1MDJ A;  3MDK A;  4MZB A;  3LYP A;  1A24 A;  2B5X A;  1B9X C;  1AIU A;  5D96 A;  4K9Z A;  2VM2 A;  3VUR A;  3APQ A;  3DEX A;  1SKW B;  3FZ9 A;  4O5R A;  1JLV A;  4KB3 A;  1BG5 A;  1XW9 A;  2O87 A;  3L9V A;  5ECR B;  2K6V A;  4ZBB A;  1K0A A;  1X9W B;  2ON5 A;  4GQC A;  3O6T A;  1O81 A;  5G30 A;  1SD9 A;  5CAX A;  1J0F A;  1EOH A;  3LW9 A;  5CRG A;  3M8N A;  2AB6 A;  1MTC A;  3EWL A;  5IO0 A;  1FOH A;  2C0E A;  2HI7 A;  4V2N A;  2WB9 A;  3TKR A;  1TKD B;  3TKP A;  5D9T A;  11GS A;  2PN8 A;  3QR6 A;  4AGS A;  1VF2 A;  3GH9 A;  3WT2 A;  4BA7 A;  4WR5 A;  4WBR D;  4OFT A;  3TKQ A;  2E2G A;  4XIH A;  3M9K A;  4NHZ A;  2AYT A;  5GAP D;  4MK3 A;  3HXS A;  2H6Y A;  2UZ8 A;  5ECL B;  3LXT A;  3GHA A;  3GL3 A;  4F0C A;  7GSS A;  4FQU A;  2GDR A;  4XS1 A;  3VWX A;  2X8C A;  3IHG A;  3QFB C;  2X4A A;  3ERW A;  5JWO B;  1I5G A;  3GSS A;  5AIV A;  4OD7 A;  1YF1 A;  4Z2T A;  2CV4 A;  2GZY A;  1GUL A;  1Q4J A;  4LMW A;  1GWC A;  3ZYW A;  4PQH A;  4HZ4 A;  1F37 A;  4KE3 A;  1NW2 A;  3M3M A;  5F0G A;  2LJA A;  4BVX A;  2H8L A;  4WEY A;  4HI7 A;  1TXX A;  3ISO A;  2LQQ A;  1B4Q A;  2HNL A;  2FWG A;  1BYE A;  1DBY A;  3EU4 A;  4Z2R A;  2YWI A;  4PX1 A;  4GF0 A;  5IMV A;  3EUR A;  4ECI A;  2AAW A;  2MBT A;  6GSU A;  3QCP A;  5AGY A;  1A2L A;  4IEL A;  1V57 A;  3TGZ A;  4E8H A;  4L5L A;  5G1K A;  1AAZ A;  5G5E A;  2H1A A;  2DKI A;  1J08 A;  3D4T A;  3VFI A;  2NDO A;  1XIY A;  5DAK A;  4ZB6 A;  3UOM A;  2GSR A;  1JZO A;  4FYU A;  1WRY A;  4J56 E;  4JR4 A;  1JLW A;  2VCQ A;  2G0F A;  2VM1 A;  4HQZ A;  4ISD A;  1GH2 A;  1WWJ A;  2PUK C;  3G9B A;  3GV1 A;  4K2D A;  5JWR B;  4PNF A;  1EP7 A;  2H19 A;  3HJM A;  4AF2 A;  2R0C A;  1AQW A;  2QKE A;  5HR3 A;  2CT6 A;  4YQV A;  3AY8 A;  3DVX A;  3FYG A;  2TRX A;  1TK8 B;  1F3A A;  3I6A A;  1GSY A;  5J9B A;  3IR4 A;  1FB6 A;  5JCG A;  3ZMK A;  2VL9 A;  1TW9 A;  1TK0 B;  2R4V A;  9GSS A;  1F2E A;  3H93 A;  3VWW A;  2AUV A;  5J41 A;  1U3I A;  3F4T A;  2L57 A;  5GAN D;  2LEG A;  1A23 A;  4MH2 A;  1ERU A;  2HE3 A;  1EV4 A;  4AJ8 A;  2F8F A;  1K3Y A;  5H5S A;  4KDX A;  1XWK A;  4DSR A;  4HEA 2;  1YKC A;  4MJE A;  5J5N A;  2DBC A;  3KP8 A;  3KMO A;  4MF5 A;  5DJM A;  4X0X A;  1FHE A;  2ZNM A;  4NWY A;  4ECB A;  2DJ2 A;  3IOS A;  4FO5 A;  2C0F A;  2KP2 A;  2IME A;  4XRA A;  3CSJ A;  1S3C A;  2C3N A;  2OAC A;  3A2V A;  2X49 A;  2GSS A;  6GSY A;  1M7T A;  1O6J A;  2V6K A;  4ZL7 A;  3KCM A;  3A5W A;  2VL2 A;  2PPT A;  3HVX A;  3ZRD A;  5ECK B;  3SBC A;  2H1B A;  3RDW A;  1GNW A;  1QFN A;  4F03 A;  2DIY A;  4HJ2 A;  3ERF A;  2RUE A;  1GSU A;  3KMN A;  4GQF A;  1LU4 A;  4CY6 A;  5IPH A;  2FHE A;  3O3T A;  4EF0 A;  2PMT A;  3ME7 A;  4GSS A;  2FA4 A;  3Q6O A;  3FEU A;  2REM A;  2L59 A;  1V40 A;  2FWF A;  4IKH A;  4KX4 A;  1ON4 A;  4G0K A;  1WMJ A;  2VCW A;  2VOC A;  4TXO A;  3R2Q A;  3GKN A;  6GSX A;  4NV2 A;  3RPP A;  3ERG A;  4HUA A;  4K6X A;  5KN1 A;  3ZL5 A;  2AJQ B;  3ZVJ D;  1KEB A;  2PU9 C;  3C73 A;  2K8V A;  1BX9 A;  1KNG A;  1T4Z A;  3EIN A;  2WJU A;  1TI3 A;  3TKS C;  1T8E B;  3CSI A;  4DSS B;  1ZYP A;  4MPF A;  2GS3 A;  5ECP B;  2CX3 A;  3CXG A;  1X0R A;  4LL4 B;  3I9V 2;  1QQ2 A;  1SJ6 A;  1GSD A;  4PQ1 A;  4WF5 A;  1OC8 A;  3LJR A;  3Q19 A;  2H71 A;  4X4J A;  1BJX A;  1A0F A;  4ZXG A;  3N5O A;  1SK1 A;  2VO4 A;  3GKM A;  1WPI A;  2CVD A;  4JBB A;  2KHP A;  5ECN B;  5JCW A;  1AC1 A;  3CMI A;  4TXO B;  4G0I A;  3DD3 A;  4OMV A;  4PUR A;  3ZLP A;  4MAB A;  2IY2 A;  1IYI A;  5F8B A;  1THX A;  5JCU A;  2H01 A;  5HR0 A;  5HR2 A;  1FW1 A;  4Q5F A;  2I9H A;  14GS A;  3FK8 A;  2YPM A;  2CAI A;  4O5Q A;  5IMZ A;  3VPT A;  2BTO T;  4GCI A;  2Z9S A;  4KW6 A;  1RW1 A;  3UL3 A;  1VF3 A;  5E4W A;  4HQS A;  5ENU A;  4K1F A;  4IQ1 A;  1OAZ A;  4EL1 A;  1ZYE A;  5A4W A;  4F9Z A;  12GS A;  5CRW A;  3KTB A;  4WF4 A;  6GSW A;  2CQ9 A;  3JCM L;  3IC4 A;  4ILF A;  4D73 A;  3KZQ A;  4CDO A;  4I5Q A;  2H0H A;  2GT6 A;  5J9C A;  3IAM 2;  1H4O A;  5D93 A;  1R7H A;  3ZIV A;  4EO3 A;  3G7J A;  3GA4 A;  1ACV A;  3MSZ A;  1AQX A;  2YJ7 A;  2K18 A;  2X8H A;  4POM A;  2GQK A;  3LQ7 A;  1V2A A;  3I69 A;  5LD0 A;  1V9W A;  3UAP A;  2RLI A;  3LWA A;  4RQX A;  3HD5 A;  1X5E A;  4N11 A;  5H5Q A;  4KCE A;  1UVZ A;  1B8X A;  2OE1 A;  1YJ6 A;  2M46 A;  4GXZ A;  3PH9 A;  3US3 A;  2IMD A;  1JZW A;  4JR6 A;  1G7E A;  3NOF A;  1AUC A;  4HDE A;  1XFL A;  3EPT A;  3BJ5 A;  1IYH A;  2NBS A;  3F4S A;  4CY8 A;  3FHK A;  2IMF A;  1NHO A;  3U5R E;  4ICY A;  2GSQ A;  4I97 A;  3R3E A;  2YV7 A;  4NPB A;  3TOU A;  1GLP A;  2QA2 A;  1FVJ A;  4NMU A;  4OCE A;  3LXZ A;  2NPB A;  2WCI A;  3KGK A;  4WKW A;  5IMA A;  2R37 A;  4KUN A;  5CRE A;  1EGO A;  4MDC A;  3H8Q A;  1XVQ A;  1SKS B;  3D21 A;  2WUL A;  2YWM A;  2C8U A;  1GUH A;  4BWS A;  1EOG A;  3BCI A;  1DE1 A;  2DML A;  2C1Y A;  3TKS A;  4EXJ A;  3K8N A;  2R5G A;  1SYR A;  2YJH A;  5ECM B;  3TRQ A;  4JE1 A;  4NV5 A;  3GTU B;  3BD2 A;  3LGC A;  4TR1 A;  4TW5 A;  2OJL A;  4BVX B;  2V41 A;  4NXI A;  2BMX A;  20GS A;  2DMM A;  2IMI A;  5EL8 A;  4YQU A;  1OE7 A;  1EP8 A;  4YAP A;  4K7I A;  3W8S A;  2F51 A;  5G5F A;  2JU5 A;  3IK7 A;  1NSW A;  4K2X A;  3H79 A;  4XS4 A;  4RUV A;  2HSH A;  1FG4 A;  2YAN A;  1YF0 A;  3M9J A;  4YKG A;  2A2P A;  5IMC A;  3OR5 A;  4Z2U A;  3CBU A;  1W4V A;  3J7Y b;  1LJR A;  2XPE A;  3KIJ A;  2A2S A;  3KTL A;  5IO2 A;  1U88 A;  4KCA A;  4TN8 A;  1S3D A;  5IIZ A;  2GST A;  2V2G A;  3TJB A;  4KSO A;  4OFM A;  3IPZ A;  4DEJ A;  1SK0 A;  2MMA A;  1B4P A;  4QQ7 A;  2GVP A;  2CZ3 A;  3KEB A;  1QMV A;  3EC3 A;  4MLY A;  4DSS A;  3D5J A;  1TRW A;  4HZ2 A;  1Z7P A;  1M9A A;  2HZF A;  2JAC A;  4IJ3 A;  1M2D A;  2E7P A;  1ZMA A;  4CW9 A;  2F8A A;  5DQY A;  2N5F A;  2R0P A;  3F0I A;  3WT1 A;  4ECC A;  4KAE A;  4OO5 A;  3TUE A;  1G6W A;  4OO4 A;  2B5E A;  1USB A;  5ECI B;  3GRX A;  1ZCP A;  4P3Y B;  3GFK A;  3IC8 A;  2PBJ A;  3ZVJ A;  4V2M A;  2VCV A;  2JSZ A;  2EC4 A;  3MIX A;  1PA3 A;  3E3E A;  5E59 A;  4KND A;  2H74 A;  1PSQ A;  1F3B A;  3TKS E;  3WGX A;  1PGT A;  5DJL A;  4EIP A;  2YOI A;  4JED A;  4G10 A;  3F3R A;  4LA1 A;  2H73 A;  3IK9 A;  3RBT A;  2OA7 A;  1F6M C;  1XWB A;  2PGT A;  2YCD A;  4GRF A;  5DBQ A;  3IXR A;  4K0G A;  5IMF A;  2PVQ A;  1GUK A;  1YQ1 A;  4XHM A;  1U87 A;  1OKD A;  3A3T A;  4IP1 A;  4G0L A;  1UN2 A;  1A2J A;  4MF6 A;  1XWA A;  3F3Q A;  4MF7 A;  3IAS 2;  3MAK A;  3RHC A;  5KOW A;  4POL A;  4RI6 A;  4ZL8 A;  3TJJ A;  3IHQ A;  3VI7 A;  4ACS A;  1GLQ A;  4TVE A;  2F9S A;  2VAF A;  1MEK A;  1T00 A;  2B7K A;  5F06 A;  1NHY A;  4BVY B;  4IP6 A;  1PD2 1;  5AN1 A;  4F0B A;  2HRN A;  2L4Q A;  3EMP A;  1SJZ A;  1DSB A;  3VI5 A;  1G7O A;  2C3Q A;  3N9J A;  4X43 A;  4ZIL A;  2KLX A;  4LL1 B;  3RAZ A;  5HR1 A;  3L9U A;  4X1U A;  3PR8 A;  4ZB8 A;  5LNK e;  5DAK B;  2LRC A;  2QC7 A;  1ILO A;  2MBS A;  2IL3 A;  2A2R A;  1CQH A;  2CZ2 A;  1SJI A;  4L8E A;  4MZW A;  4PNG A;  4Q5R A;  2F3M A;  2FNO A;  3D22 A;  1GTA A;  2H75 A;  2H1D A;  2B1L A;  3FRC A;  3QD9 A;  2VLV A;  2LKU A;  4MJA A;  4D73 B;  4XS6 A;  3RHB A;  8GSS A;  4KH7 A;  1CQG A;  5EPF A;  2B6M A;  1XBS A;  5KN0 A;  4ZBD A;  2XBQ A;  2CVK A;  1X9M B;  5CNW A;  1OC9 A;  2GTU A;  3FMW A;  2DJ3 A;  1YY7 A;  1K3O A;  1PQN A;  5F07 A;  3GUS A;  4L0W A;  5B8B A;  2OBK A;  3TJK A;  5IMD A;  2IFQ A;  3D6I A;  4PTS A;  4QL7 A;  1OE8 A;  2LJK A;  2FGX A;  2VL3 A;  3KP9 A;  4NHW A;  4OCF A;  3HZ8 A;  2YZU A;  2C0G A;  4PGT A;  1THO A;  1K0M A;  4POK A;  2DIZ A;  2HT9 A;  3CRT A;  2I3Y A;  2R3X A;  3FR3 A;  1GSF A;  1O8X A;  1Z6M A;  5KN2 A;  3P2A A;  3LSZ A;  1UC7 A;  2WZ9 A;  1XCC A;  4FYC A;  3C7M A;  3KM6 A;  5KOX A;  4L5O A;  1YEP A;  3S9F A;  4CHS A;  3VWV A;  2H1G A;  1YEX A;  5A5K A;  2V6O A;  1OVN A;  3E0U A;  2DJ0 A;  1ZOF A;  1TTZ A;  5GZZ B;  1GRX A;  4V1A g;  4ID0 A;  1K0C A;  4Q5N A;  2O7K A;  4EE0 A;  3HCZ A;  1R4W A;  4RI7 A;  2LQO A;  1M2B A;  4BL7 B;  2J9H A;  1Z7R A;  1N8J A;  3PPU A;  1SL0 B;  5IOX A;  2LTK A;  4K8M A;  1JZR A;  3QOU A;  3CTF A;  1GSE A;  2DSA A;  3GYK A;  3TDG A;  4F2I A;  2EIQ A;  1GNE A;  1HYU A;  3NZN A;  2LRN A;  1I9D A;  1JHB A;  2YP6 A;  1SEN A;  2FUG 2;  1ZL9 A;  3ZFB A;  4WBJ A;  1ZZY A;  5J4U A;  2FY6 A;  3UBK A;  2WS2 A;  2MZC A;  5H5R A;  2VD1 A;  2N5B A;  1SU9 A;  5IM9 A;  3QAV A;  4BWQ A;  3J7Y k;  5B6M A;  1PRX A;  3EU3 A;  5ABR A;  4KDU A;  4ULX A;  5GSS A;  1R5A A;  1HNC A;  4TR1 B;  3GX0 A;  3HY2 A;  2O89 A;  1O7U A;  4IJI A;  3DXB A;  4FIW A;  2HRA A;  2B5Y A;  2ALB A;  2X64 A;  3MNG A;  3GIX A;  1UA5 A;  1VRS D;  4JU5 A;  3F4R A;  2TRC P;  3GH6 A;  3W8J A;  1BAY A;  3EMX A;  2H30 A;  1VF4 A;  5L71 A;  2FWE A;  3ED3 A;  2LNS A;  4ZL9 A;  3MWH A;  1HNB A;  1XXU A;  3DKS A;  2B3S A;  5A4V A;  3TJG A;  1AW9 A;  5ELG A;  1AXD A;  3HZ4 A;  1HD2 A;  4J2F A;  1T4Y A;  1OYJ A;  5FWG A;  3DYR A;  4N0V A;  3L0H A;  2QA1 A;  1OC3 A;  2CAQ A;  2GZP A;  3KD0 A;  2WGR A;  1GTU A;  5D73 A;  3BCK A;  1R5P A;  13GS A;  1MDK A;  3LFL A;  4RQR A;  1TOF A;  2H70 A;  2DJJ A;  2LV3 A;  1ZYN A;  3CSH A;  3HHV A;  5J3R A;  5DCH A;  5LCZ A;  2H6Z A;  1Y25 A;  1TRV A;  1Z3E A;  4V1A p;  2PER A;  1S3A A;  1TK5 B;  5IOW A;  4YH2 A;  3GUR A;  5AIX A;  2HYX A;  5B8A A;  5CP1 A;  2RM5 A;  4TOP A;  1T3B A;  2IWT A;  2C80 A;  4GWR A;  2A4V A;  1PKW A;  3IDV A;  2LS5 A;  2HSY A;  2YZH A;  2K9F A;  4EKZ A;  4GSN A;  1O8W A;  2HSM A;  1TRU A;  2HZE B;  3GMF A;  3IE3 A;  3G7I A;  2VIM A;  3ME8 A;  3G7Y A;  1WP0 A;  3TOT A;  2M72 A;  4I2T A;  4E8E A;  2P5R A;  2O8V B;  1TRS A;  3GST A;  1XWC A;  3HVV A;  4ZB9 A;  4BPY A;  4K7O A;  3CYN A;  3CRU A;  4MZC A;  1QUW A;  2A4H A;  3VWU A;  4XCS A;  2DJK A;  4IQA A;  3ZML A;  4HJM A;  3F9U A;  2IN3 A;  2J23 A;  4N0Z A;  3DML A;  1MDI A;  1MD4 A;  3ZIT A;  2JZT A;  4KSM A;  3UVT A;  2I4A A;  2K8S A;  3IA1 A;  3HJP A;  3BBY A;  2HZE A;  5ECQ B;  2L5O A;  5D9V A;  2GLR A;  4K7N A;  4EIQ A;  1N2A A;  4H86 A;  4MMM A;  2JSY A;  3VK9 A;  2R6K A;  3Q18 A;  4BL7 A;  2AHE A;  2I1U A;  2RM6 A;  1FAA A;  4N30 A;  2MMN A;  4WXT A;  3UMA A;  3LG6 A;  4WET A;  3H4K A;  1R26 A;  1PN0 A;  2GT5 A;  4MA9 A;  2ON7 A;  4AJ6 A;  2B7J A;  4K0N A;  1T7P B;  1ZYQ B;  2GZZ A;  2P31 A;  1V58 A;  2L4C A;  5HFI A;  2VCX A;  5ECO B;  4FYB A;  2OBI A;  3FW2 A;  2CA8 A;  5B7C A;  1KTE A;  5D9X A;  1PMT A;  4IVF A;  3M1G A;  2H0I A;  1H75 A;  3L78 A;  3DGQ A;  4ZIJ A;  1WE0 A;  2VUP A;  5COH A;  4MH3 A;  5F05 A;  4KDY A;  2MMO A;  4XTS A;  4EUY A;  5ELA A;  4GTU A;  1LBK A;  1Q98 A;  2IYJ A;  5KEJ A;  1ZGN A;  2OE3 A;  1U3A A;  5IQY A;  4AJ7 A;  2EIO A;  4O92 A;  1TDI A;  4ECJ A;  4EVM A;  1TJD A;  1GTI A;  2FLS A;  2LUS A;  5KN3 A;  3GKK A;  2RII A;  4GST A;  1HNA A;  2WRT A;  1X9S B;  1Z5Y E;  2RUF A;  5ECH B;  5C04 A;  2LNT A;  4TR0 A;  1J9B A;  3FY7 A;  1ML6 A;  3GL5 A;  1EWX A;  5CRH A;  18GS A;  1V98 A;  3DVW A;  1FB0 A;  4YAV A;  3Q74 A;  19GS A;  5AIS A;  3HA9 A;  3F8U A;  1ERW A;  1XOB A;  1X5D A;  4HOJ A;  3LYK A;  2JL4 A;  4I8B A;  3FZ5 A;  3WGE A;  2V32 A;  2O85 A;  1EZK A;  3UJ1 A;  1MD3 A;  4V2L A;  3ZTL A;  4O32 A;  1O73 A;  5DVB A;  4TR3 A;  3ZRE A;  4EDZ A;  4PQI A;  3KJY A;  2GGT A;  3VPQ A;  3C1S A;  2VCZ A;  5FT3 A;  3DIE A;  3D0Z A;  4HU7 A;  5ID2 A;  4Z7X A;  1XPV A;  4IGJ A;  1M2A A;  1NM3 A;  1Z6N A;  2NVL A;  1HQO A;  1Z9H A;  1E6B A;  4O5U A;  2YN1 A;  3SWL A;  1BQ7 A;  4KGI A;  3WD6 A;  3GX8 A;  4QL9 A;  1GP1 A;  4K5R A;  2D2Z A;  1ABA A;  2I81 A;  2L6C A;  1SK2 A;  3A2X A;  5ID2 B;  1SD8 A;  4KA0 A;  2HXK A;  1PL1 A;  1K0D A;  2LRT A;  3TB2 A;  1OC9 B;  1URM A;  2VL2 C;  2ZUP A;  2C4J A;  2LST A;  3UIW A;  1M0U A;  2HRF A;  1GUM A;  2JZS A;  3DRN A;  3FR9 A;  3HYP A;  2LJR A;  4XRD A;  1XW6 A;  4WR4 A;  4OFN A;  3D4M A;  4F82 A;  1FVK A;  2N5A A;  2DJ1 A;  3TJF A;  2L6D A;  1PKZ A;  1SL2 B;  4ML1 A;  2X8G A;  5IPG A;  2OAD A;  5B6N A;  1U6T A;  2KOK A;  1SL1 B;  2HFD A;  3C8E A;  16GS A;  1K0O A;  2QSI A;  3QDN A;  5D8I A;  1E2Y A;  4DVC A;  3A2W A;  4USS A;  3EYT A;  1QK8 A;  4DSQ A;  1VF1 A;  3IRA A;  3KH7 A;  2IJY A;  4N10 A;  4OWY A;  4LLR A;  2IFQ B;  1BED A;  5G1L A;  2C0D A;  1TP9 A;  3C71 A;  4MJB A;  5GST A;  5JWQ B;  2YNX A;  1YDK A;  3HDC A;  3IV4 A;  1JZD A;  5G31 A;  1K3L A;  2H66 A;  3KH9 A;  1XZO A;  5DQS A;  2OE0 A;  3F6D A;  5FHI A;  4G9H A;  3QFA C;  5CO3 A;  1XOA A;  5CRD A;  3F6F A;  2TIR A;  2KP1 A;  2XHF A;  3U6V A;  4BVY A;  4IW9 A;  1M9B A;  3H1N A;  2H0G A;  2VLU A;  3PIN A;  2IIY A;  2E0Q A;  2KUC A;  3HVS A;  1EGR A;  2P5Q A;  2BJX A;  3APS A;  1TU7 A;  4YQM A;  3P90 A;  1A2M A;  3GNJ A;  2QGV A;  3ZZX A;  5G2Z A;  3CTG A;  1GTB A;  2V1M A;  2H76 A;  2NTO A;  5DCG A;  4IHU A;  1EEM A;  2XC2 A;  4MP4 A;  2R2J A;  4HU9 A;  4TR4 A;  1PN9 A;  1K0N A;  4TRX A;  3FZ4 A;  3ZFL A;  2G2Q A;  1K0B A;  2OKA A;  2HRK A;  1GSS A;  2GQM A;  3GN3 A;  3VLN A;  1TI1 A;  4KF9 A;  2MYG A;  1GL8 A;  1PL2 A;  1XVW A;  2R0G A;  3I43 A;  2IPA A;  3FKF A;  5DAL B;  4EC0 A;  3EVI A;  5CYY A;  4ZBA A;  1F9M A;  1TU8 A;  4I6X A;  2ES7 A;  5A4U A;  1RQM A;  3FZA A;  1YKA A;  10GS A;  2MMZ A;  3QAW A;  2B1K A;  2DLX A;  1AQV A;  4I2U A;  3WYW A;  1SYX A;  3P8W A;  2JAD A;  5D9W A;  1WJK A;  4EDY A;  4PXO A;  4FH8 A;  1XW5 A;  3QPM A;  2X99 A;  2E2M A;  17GS A;  3C1R A;  1A8Y A;  1X5C A;  5EY6 A;  1VGL A;  5HFG A;  4IN0 A;  4MPG A;  1WIK A;  3LOR A;  1T1V A;  3F63 A;  1A8L A;  3TRP A;  3E9J B;  2ZCT A;  1PX7 A;  1Y6E A;  4YKF A;  3O76 A;  4PUF C;  3ZIJ A;  1A0R P;  1XWG A;  3HJO A;  1FO5 A;  3UBL A;  2YV9 A;  1PX6 A;  3UVH A;  4O7H A;  1DUG A;  1QXH A;  5DAL A;  4L0U A;  5BRT A;  4Q5Q A;  1ST9 A;  3TRX A;  2YWO A;  1GSQ A;  3APO A;  3EE2 A;  1DE2 A;  1C72 A;  4ML6 A;  1G0T A;  2VLT A;  2WDU A;  3W6G A;  3UEM A;  1YZX A;  1EEJ A;  2C3T A;  2VD0 A;  4K5S A;  2EIR A;  2H72 A;  2PWJ A;  2FCH A;  2DC5 A;  3MYD A;  3BOA A;  3M0F A;  6GST A;  5EVO A;  2XBI A;  3IBH A;  4GLT A;  2VCT A;  5BMU A;  1G6Y A;  3HKR A;  3A5I A;  3L4N A;  1WOU A;  5HQP A;  4LMV A;  1SKR B;  2AV4 A;  4IBP A;  2CX4 A;  2YWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...