1EEJA

Crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1eejA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eejA02
2AV4A 2IMEA 4H86A 4KAEA 4MZWA 3LORA 2GT5A 1S3CA 4NWYA 1KBNA 3QDNA 1SD9A 1K3OA 3RBTA 3US3A 1YQ1A 1T3BA 3FK8A 4JZQA 4ML6A 2JSZA 5KN2A 1GSSA 2HYXA 3HHVA 3SBCA 2MMNA 2KHPA 2O85A 1PA3A 3VWXA 5IMVA 1I9DA 4MLYA 2B7JA 1GRXA 1I5GA 3IA1A 3LJRA 4KA0A 5DVBA 2HZEA 4DSSA 3M9JA 4IP1A 3KMNA 2IFQB 2H0GA 2B5EA 3KTLA 2HFDA 1WP0A 3AY8A 2OE3A 4EXJA 2FY6A 5A4UA 5IMZA 3CXGA 2C8UA 3TJJA 3F4SA 1TOFA 4JRRA 4V2MA 3L0HA 18GSA 2CVDA 2X8CA 4YQUA 3DYRA 3LFLA 3QAWA 4GSTA 1WRYA 2BTOT 4IKHA 3IE3A 3UVHA 4L5LA 2VLVA 4KUNA 3F8UA 4TKYA 4TOPA 4OO4A 5DCHA 2C1YA 4KGIA 3CSJA 1U6TA 2MZCA 1CQHA 2ZUPA 2B5XA 2OKAA 1BX9A 2VL2C 4TR0A 1ERUA 2L5OA 1DSBA 4KW6A 4N30A 1USBA 3FW2A 3H79A 3G7JA 4WF4A 5ECPB 4K7OA 1XVWA 3DMLA 5HFKA 3WGDA 5DAKA 1XOAA 3ZRDA 3EMPA 2OBKA 1QQ2A 1UVZA 2OE0A 2PERA 4G2EA 1TRSA 3LQ7A 1XWKA 1V57A 1JZDA 2JZRA 4F9ZA 1FHEA 1EGOA 4XS4A 6GSXA 1NHOA 4N0ZA 4MJBA 1PQNA 3E3EA 5ECSA 3CRUA 3GSSA 2DJ1A 1T7PB 20GSA 3EC3A 4EC0A 3FR9A 4P3YB 1FVJA 3O76A 3SWLA 2GSSA 1WIKA 3GHAA 1X5DA 5D9TA 3FZAA 5F05A 5IPGA 3KZQA 5E4WA 3DGQA 1ZZYA 1B4PA 1A24A 4OFMA 2VLTA 4XRDA 4KCAA 4TXVA 3P90A 4MDCA 3ZFLA 2FA4A 1S3AA 2C4JA 1GTBA 4Q5NA 5C04A 5HFIA 3RHBA 2FWHA 4XS1A 1G7OA 2ON5A 1J0FA 2HRNA 5ABRA 3IK7A 4BVYA 4ML1A 2OACA 1M2AA 4N11A 2CA8A 1A23A 3TOTA 3PGTA 1DUGA 2H1AA 2CZ2A 3V1WA 3EINA 2O87A 4ZL7A 5IO0A 2I4AA 1QFNA 3QR6A 2HLSA 6GSVA 3ERGA 3FR6A 3ZL5A 3TJKA 1GSYA 1XWGA 3KP8A 3BOAA 2DSAA 5ECRB 4MH2A 4I6XA 2GS3A 3M1GA 2P5RA 4BVXA 1GL8A 2YV7A 2B5YA 2C0FA 4BWSA 1TDIA 3TKRA 4YQVA 5D73A 3TKQA 2L57A 2GZYA 2M46A 4ZL8A 1EOHA 6GSYA 2H30A 3GYKA 1TXXA 2F9SA 3ZFBA 1V2AA 4POBA 1UC7A 5KEJA 2RUFA 3C1SA 3HA9A 2EIOA 2NTOA 1E6BA 2LEGA 3ISOA 1XWAA 2JACA 3E9JB 4IQ1A 1HD2A 2X8GA 2VOCA 1MD3A 2H1GA 2L4QA 1X0RA 3DXBA 3UMAA 1TK0B 4ECBA 2GQKA 1XPVA 2D2ZA 4MMMA 4N0VA 1XCCA 3ME7A 1YEPA 5AN1A 4GQFA 5H5QA 4I97A 4POKA 3GN3A 2KUCA 3EURA 4IN0A 4E8EA 2C0EA 2LJRA 2WCIA 4LL4B 2G2QA 3GV1A 6GSSA 3WT2A 2ZNMA 1DBYA 3FHKA 5ECHB 5J4UA 2P0GA 1R7HA 4NMUA 2L6DA 4XS6A 1GNWA 2VD0A 5DALA 2DMLA 2PGTA 5D9WA 9GSSA 5J41A 4NV2A 7GSSA 1SJZA 1PD21 1Y25A 5HR0A 4LMWA 2CX3A 2XBIA 14GSA 4G9HA 5HR1A 4PQIA 3ZVJA 4WR5A 1M2DA 1V58A 4AJ8A 4QQ7A 2I9HA 1T8EB 3CBUA 3GRXA 5FWGA 3VFIA 4QL9A 2YN1A 4IJIA 3HJPA 5INYA 1A2MA 3WGEA 2M80A 4ID0A 4RI7A 1O7UA 1YDKA 5DCGA 3LYPA 1G6WA 1IYIA 3U5RE 1DE2A 2HRFA 2E0QA 4O5RA 3IAS2 2VL3A 1BEDA 2GSQA 5F8BA 2WULA 4PX1A 8GSSA 5DBQA 1EEJA 2DJ3A 1Z3EA 3GFKA 2JZTA 2CVKA 4GXZA 4JBBA 1U3AA 1A2JA 1XOBA 1GSFA 1GULA 1ZGNA 1TRWA 1MDJA 3ZTLA 1O85A 4PQ1A 4G19A 2H19A 3HDCA 2WDUA 5ECIB 4IGJA 1A0FA 3L9UA 3R2QA 2OADA 2IWTA 1DE1A 5ID2B 2VIMA 2YWMA 2FWGA 1GUKA 3TKPA 1F6MC 4OCEA 2J9HA 2X8HA 3G7YA 2HSYA 4WETA 1A8LA 1KEBA 2AAWA 4RQXA 1SYXA 3H4KA 3Q74A 5CREA 5KN3A 1ZYEA 4ZB9A 4F03A 2QKEA 1Y6EA 2YV9A 1KNGA 4WR4A 1W89A 3C7MA 2PN8A 2O7KA 4MK3A 3UAPA 4GLTA 2IMDA 2FWFA 5JWQB 1PL1A 3GH6A 1EZKA 5CO3A 1F2EA 4MF6A 2VCXA 5LD0A 5ID2A 2H72A 1SK1A 3BCKA 3GL3A 1MDIA 2CQ9A 3GH9A 2YANA 1ST9A 3GKKA 2PMTA 1EV4A 2F8AA 1TK5B 1FW1A 5D93A 3L9SA 5ECLB 3TGZA 4ACSA 5JWOB 4GCIA 1XWCA 2KP2A 3HKRA 2LSTA 3UBKA 3KXOA 3MAKA 1PKZA 3IHQA 1M2BA 3ZZXA 1HNCA 4EKZA 2OBIA 4I5QA 3EU4A 3Q19A 1EV9A 2FUG2 1Z7RA 5CRDA 1SJIA 3UJ1A 4DSSB 4IQAA 1KTEA 1PRXA 1SL2B 1XW5A 4HI7A 4XCSA 2FHEA 3KP9A 1JLVA 3EVIA 1LJRA 3UBLA 3QD9A 3FRCA 5B6NA 4PXOA 5J9BA 2FD3A 3ME8A 2XPEA 2PVOC 2LKUA 2A2SA 2L5LA 4V2NA 1O73A 5G30A 3NZNA 4IHUA 1Z9HA 3KJYA 3ZYWA 1J9BA 1WPIA 4LLRA 1XVQA 1K0OA 3IXRA 1YF0A 4I2TA 3A5WA 5AGYA 4BWQA 1T1VA 1TRVA 2B1LA 2DIYA 4MZBA 4POLA 2PVQA 1GLQA 5DAKB 1SD8A 2LQQA 4V1Ag 2AHEA 3J7Yb 1SK0A 2LJAA 5GSSA 1ML6A 3PH9A 2LTKA 2V2GA 1B4QA 4V1Ap 4L0UA 4K8MA 3IC4A 5LNKe 2JZSA 3WD6A 2GTUA 4XS4B 2JU5A 1WOUA 2C3NA 1K0CA 2H8LA 2K6VA 2J23A 3ZMKA 4TN8A 2I1UA 4IJ3A 2DJ0A 1O8WA 3GNJA 1HYUA 2VO4A 1NW2A 4TVEA 2WS2A 3ERFA 1OKDA 2A2RA 5IOWA 4DSQA 2O8VB 3K8NA 3IK9A 3HCZA 2R3XA 4NV5A 2K9FA 2IY2A 5D8IA 4WBRD 4FH8A 1HNBA 3EE2A 5G2ZA 4HJMA 3UVTA 3DWVA 3U6VA 3VI5A 2HXKA 4KNDA 3VI7A 3DIEA 3C73A 4MP4A 3IDVA 5EPFA 1O81A 4K0NA 3VWVA 3LSZA 2IPAA 4JR6A 1SKRB 3NIVA 3N9JA 4OD7A 4BL7A 2X99A 4MF7A 4GF0A 3HXSA 4Q5QA 5A4VA 3TCOA 2FWEA 1QK8A 2PPTA 2DIZA 4AGSA 3DVWA 4HUAA 2RM6A 1GNEA 1WWJA 1NM3A 1T4ZA 3QFBC 4GRFA 2CZ3A 2HI7A 5IMFA 2JADA 2H71A 2GDRA 4MJAA 2BMXA 1XW6A 4WEYA 2NBSA 2EC4A 2LRNA 4ILFA 1GP1A 2FLSA 3KD0A 4TXOA 3BBYA 4TR4A 3ZIJA 4NPBA 3L4NA 2DJKA 3KM6A 2TRXA 4X1UA 2YP6A 3TRPA 4JR4A 1OAZA 3KCMA 4FYBA 2ZCTA 1GWCA 2C3TA 3APQA 2YZHA 4JU5A 1G7EA 1YY7A 3Q18A 3QOUA 17GSA 3P7XA 2DJ2A 1AC1A 2XPDA 1PX7A 4IP6A 4NHZA 2B3SA 3GKXA 3UOMA 2XC2A 1YKCA 1AQVA 2H73A 2O89A 2N5FA 2AB6A 2ALBA 2VCZA 4FYUA 3RAZA 1YF1A 1G0TA 3G7IA 3F63A 4EUYA 4KCEA 4XHMA 2HSHA 1Z6NA 4EVMA 3GX0A 3I69A 5DALB 4F2IA 1K0NA 2CT6A 5EY6A 4WF5A 4CW9A 1THOA 4TRXA 1TP9A 1X9WB 3C1RA 4GTUA 5ELAA 2H1DA 2CVBA 3FEUA 1M9AA 5G1LA 3VWUA 1TTZA 5CAXA 3I43A 4OCFA 4OFNA 5GAND 1TU7A 1F3BA 2CX4A 3J7Yk 1XIYA 2RIIA 1VF2A 1K0MA 5B6MA 4NAXA 1E2YA 5EL8A 1ERWA 4K1FA 22GSA 4J56E 2OA7A 5GSTA 3ZIVA 5CP1A 3PR8A 4D73A 2VAFA 3MNGA 2H6ZA 2H01A 4KDUA 1HNAA 4LMVA 3TJFA 1F3AA 2WZ9A 5CRHA 3O6TA 1A2LA 4MABA 1SL1B 2HNLA 3HZ4A 4K9ZA 3PINA 1QGVA 4ZXGA 1O8XA 1ABAA 1N2AA 2WFCA 4Z7XA 2IYJA 1PSQA 3DD3A 2LRCA 4PQHA 5B8AA 4IELA 2WGRA 3C8EA 5JWRB 4MCUA 5A4WA 3OR5A 2C80A 1LBKA 2LJKA 4XTSA 2GZZA 2MBTA 4YAVA 3DEXA 2NDOA 2TRCP 3ZLPA 4EDYA 6GSTA 1AQXA 4GWRA 3HVVA 1H4OA 4LA1A 3WT1A 1ZOFA 3BCIA 2VM2A 2DBCA 1AAZA 2DC5A 2VCVA 4F0BA 2KLXA 1OE7A 1X9MB 3F9UA 1VRSD 4JE1A 1MEKA 1ZCPA 3N5OA 1AUCA 1V98A 5DQYA 1FAAA 1OC3A 4MJCA 1S3DA 2B7KA 2V6KA 4ZBBA 1H75A 4AF2A 2LV3A 1FVKA 13GSA 4MJEA 1V40A 2XBQA 3HJOA 2QGVA 4MH3A 4ZILA 2WB9A 4MPFA 3GTUB 3Q6OA 3KMOA 2IIYA 2R37A 3ERWA 3GA4A 2FGXA 3O3TA 3UARA 2V6OA 4HZ4A 2YJHA 4L0WA 1VF4A 3RHCA 2P5QA 2IMKA 2L59A 3ZVJD 4HJ2A 2K8SA 2YZUA 2LNSA 1GSDA 2HZFA 1RQMA 1HQOA 3HZ8A 4IVFA 1EWXA 2N5AA 4ZB8A 3VPTA 3KGKA 2LUSA 2B1KA 5DDLA 3WGXA 3EMXA 3KIJA 3TOUA 1XXUA 5EVOA 2E2GA 3FY7A 2AJQB 1B9YC 2R5GA 3GTUA 4NXIA 3APSA 1VF3A 1TU8A 1AIUA 2H66A 4ULXA 1SU9A 2EIQA 1YJ6A 4IBPA 3KTBA 1U3IA 3EWLA 1TW9A 3CTGA 2F3MA 1FB0A 1BYEA 1B9XC 1K0AA 1JZWA 4K2DA 3P2AA 2BJXA 3F6DA 3QMXA 3CMIA 4GSNA 3FZ4A 3F4RA 1OKTA 2OE1A 4CHSA 1SENA 2XHFA 1R4WA 5IM9A 3QCPA 2REMA 4WXTA 1ON4A 3UEMA 2R2JA 2RM5A 2ON7A 4X0XA 5F0GA 3IAM2 5ECKB 3TKSC 5CRWA 1SJ6A 3LWAA 3QFAC 2YPMA 4K6XA 4PGTA 3CSIA 3GKNA 1C72A 1RW1A 2X64A 4NHWA 1Z6MA 2P31A 3HYPA 4EF0A 2G0FA 4EE0A 4PNFA 2MYGA 5ELGA 2N5BA 2LNTA 4KSOA 4ZBDA 3LYKA 4ECJA 4BA7A 4ISDA 2V1MA 3D4MA 5ECQB 4I2UA 1ZL9A 5D9XA 4DVCA 5G5FA 2H0HA 2IN3A 3E0UA 4AJ7A 12GSA 3S9FA 4MF5A 1EP7A 3A2XA 1FO5A 3HY2A 3RDWA 3JCML 3IRAA 3HJMA 3UL3A 3KH9A 1M7TA 2H0IA 3TUEA 3HVXA 5IPHA 3MSZA 1WE0A 1ERVA 3I9V2 4TR1A 4I8BA 1R26A 1BAYA 2B6MA 3VLNA 5CYYA 3IOSA 2E2MA 3EYTA 3H8QA 4IW9A 4LL1B 2YOIA 1OC9A 4POMA 2K8VA 1X5EA 3KH7A 3LXTA 6GSUA 2A4VA 4YH2A 2RLIA 4WKWA 10GSA 1TRUA 5HQPA 3IR4A 1SL0B 2GQMA 4HS1A 2PBJA 3DKSA 2VCTA 1LU4A 4ZL9A 5C00A 2CAQA 3M3MA 4PURA 1GSUA 2IMFA 5IOXA 3A2WA 3M0FA 4RQRA 4KE3A 2GZPA 3TKSA 5IQYA 5FHIA 3D4TA 2LRTA 4PNGA 1K0DA 3MWHA 3GSTA 5HR2A 5IO2A 2PWJA 1TK8B 1QXHA 3GURA 3BJ5A 1K0BA 2L6CA 5IMAA 4RUVA 1PX6A 4OFTA 5E59A 4J2FA 2MBSA 2I81A 1ZYQB 3W8SA 1F9MA 2F8FA 1WJKA 2IFQA 2VD1A 4JEDA 5J9CA 2JSYA 3F6FA 3W6GA 1XZOA 2YWNA 2HE3A 3TB2A 2K18A 4HEA2 2V32A 3CYNA 16GSA 3L9VA 1YZXA 4TXOB 2YNXA 5H5SA 4TR3A 3QAGA 1EP8A 1TKDB 4PUFC 4TW5A 3UIWA 1VGLA 3HVSA 5ENUA 1U87A 3D0ZA 1OYJA 2H74A 3D6IA 1B8XA 3LGCA 5A5KA 2H75A 4Q5FA 4ECIA 2AYTA 4G10A 1J08A 3H93A 3A2VA 2H6XA 5L71A 1TJDA 4KDYA 2IJYA 2VCQA 3NOFA 4K0GA 2AUVA 2C0DA 1FG4A 2H1BA 2YWIA 3WYWA 2GSTA 11GSA 1MDKA 2E7PA 2I3YA 1EGRA 4GQCA 1SK2A 4QL7A 1GH2A 4L5OA 1BQ7A 4F82A 2VL2A 3VWWA 19GSA 4E8HA 5JCWA 4CDOA 1JFUA 1FOVA 1JZOA 2GVPA 2QSIA 3DVXA 3QAVA 3VPQA 4DEJA 4FYCA 1ACVA 5G31A 3IBHA 4HU7A 4ECCA 3D22A 2MMAA 4KX4A 1Q4JA 1G6YA 2H6YA 3H1NA 1OC8A 2LQOA 1AXDA 4V2LA 2PU9C 2LS5A 4AJ6A 5D96A 4DSRA 4MA9A 5D9VA 2OJLA 1M0UA 4N10A 2DJJA 2VL9A 5B7CA 2CAIA 4D73B 3QPMA 1T00A 4HDEA 2GLRA 5DJLA 1Z5YE 3D21A 5KN1A 5AIXA 1JZRA 1NHYA 1W4VA 5KN0A 5J3RA 4GSSA 3C71A 4FO5A 1M99A 3TDGA 1URMA 1PGTA 2MMOA 2FCHA 2VCWA 1GTIA 3GMFA 4WBJA 4BPYA 2ES7A 1MD4A 1PKWA 4XRAA 3TRXA 2YCDA 5HR3A 1AW9A 2IMIA 2Z9SA 1ILOA 1O6JA 2NPBA 2KP1A 1ERTA 1SYRA 3FYGA 2V41A 3CTFA 1T4YA 1M9BA 2EIRA 3GL5A 3GIXA 3ZMLA 3HD5A 2VLUA 3TJGA 5AISA 3ZITA 4KB3A 1IYHA 1X9SB 1RK4A 1JLWA 5CNWA 4IS0A 4RI6A 5IIZA 1GSQA 5H5RA 5F06A 1CQGA 4O32A 3BD2A 2KOKA 4EO3A 1MTCA 1QUWA 5F07A 3LG6A 3VURA 1K3LA 1PL2A 1WMJA 5ECNB 1GSEA 2GT6A 4KDXA 1SKWB 3L78A 4X43A 2RUEA 4ZB6A 1TI3A 4KH7A 2M72A 3GX8A 3LXZA 1B48A 1R5AA 4L8EA 4HQZA 5GZZB 4XIHA 3FZ9A 1AQWA 3F3QA 3ZREA 2H76A 5J5NA 3F3RA 5LCZA 2FNOA 1XWBA 4KSMA 2DMMA 2R4VA 5ECMB 1XFLA 5CRGA 2CV4A 3P8WA 4ZBAA 1N8JA 3IV4A 5DJMA 1U88A 3TJBA 3W8JA 1EEMA 3VK9A 3F0IA 4OWYA 3TKSE 2GQLA 2H70A 1PN9A 1SKSB 3I6AA 1A0RP 1GTUA 1YEXA 3GUSA 3F4TA 1GUMA 1YKAA 3DRNA 5FT3A 5IMDA 2IL3A 5JCGA 4MZCA 5HFGA 3RPPA 4HZ2A 4YAPA 2VM1A 1V9WA 1XBSA 4HQSA 4O7HA 6GSWA 1VF1A 2NVLA 2PUKC 2YJ7A 2TIRA 4EL1A 4EDZA 4O92A 1PMTA 1R5PA 2C0GA 2WRTA 4HOJA 5ECOB 3LEFA 2GGTA 1Z7PA 3MDKA 4YQMA 1QMVA 2DLXA 3CRTA 1GTAA 3FKFA 5COHA 2L4CA 3APOA 1OE8A 1UN2A 4MPGA 3FZ5A 1A8YA 4F0CA 1XW9A 5G5EA 3FR3A 1BJXA 3G9BA 3D5JA 5JCUA 2GSRA 1THXA 1Q98A 1GUHA 3M8NA 1UA5A 4J57E 1K3YA 3RPNA 1NSWA 2F51A 2YWOA 4OMVA 5B8BA 1BG5A 3A3TA 4K7IA 3GKMA 3M9KA 1OVNA 1EOGA 4FIWA 3EU3A 3ED3A 1FB6A 1GLPA 5GAPD 5IMCA 3IPZA 2JL4A 5G1KA 4K7NA 2QC7A 4PUAA 5AIVA 3TRQA 1JHBA 1X5CA 1F37A 2VUPA 4Q5RA 4OO5A 2R6KA 4HU9A 1ZMAA 5DQSA 2HT9A 2MMZA 4ZIJA 1TI1A 2FA8A 4TR1B 3KEBA 2HZEB 2C3QA 3CSHA 2WJUA 1OC9B
chains in the Genus database with same CATH superfamily
2AV4A 2IMEA 1US1A 4H86A 5KP1A 1I2EA 4KAEA 4MZWA 3LORA 2M7OA 2GT5A 3EJVA 4ORLA 2GEYA 1UCJA 2XFTA 1I0XA 1S3CA 4NWYA 1KBNA 1VQK3 3QDNA 1SD9A 4K5SA 1RCLA 1K3OA 3RBTA 3US3A 1YQ1A 1T3BA 2IMJA 3UL5A 3FK8A 1ZYNA 2JSZA 4JZQA 4ML6A 5KN2A 4J8TA 1GSSA 2HYXA 5AIFA 3HHVA 3SBCA 2MMNA 2KHPA 2O85A 1PA3A 3VWXA 5IMVA 1A2PA 1I9DA 4MLYA 2B7JA 1GRXA 1I5GA 3IA1A 3G4S3 1RN4A 3LJRA 1BGSA 3FKAA 4KA0A 5DVBA 3EBYA 2HZEA 4DSSA 3M9JA 4IP1A 3KMNA 4N6LA 2IFQB 2H0GA 2B5EA 2GBXB 3F40A 3KTLA 3DUKA 2HFDA 1WP0A 3AY8A 2OE3A 4EXJA 3SX1A 3BIRA 2FY6A 5IMZA 5A4UA 3CXGA 2C8UA 3TJJA 3G6E3 3F4SA 1TOFA 4JRRA 4V2MA 3L0HA 18GSA 2CVDA 2X8CA 4YQUA 3DYRA 3LFLA 3QAWA 4GSTA 1VQO3 1WRYA 2BTOT 4IKHA 2Q07A 3IE3A 3UVHA 4L5LA 2VLVA 4KUNA 3AHWA 3F8UA 4TKYA 4HM4B 4TOPA 4OO4A 1LOYA 5DCHA 3WDGB 2C1YA 3DH2A 3T8UA 3G16A 4KGIA 1VQP3 3EB8A 3CSJA 3SVAA 4EW5A 1YJN3 1U6TA 1M904 2MZCA 3D3LA 3MYDA 1CQHA 3F7XA 3WA3A 2ZUPA 2B5XA 2OKAA 1BX9A 1BSCA 3SXXA 2VL2C 4TR0A 1DMQA 1ERUA 1W6CA 4XBTA 2L5OA 1DSBA 4KW6A 1JRQA 1BOXA 4N30A 3EBTA 1USBA 1DMNA 1MWSA 3FW2A 3H79A 2XEPA 3G7JA 4WF4A 3AHSA 5ECPB 4K7OA 1XVWA 3DMLA 5HFKA 3WGDA 5DAKA 1XOAA 5IENA 3ZRDA 2GXFA 3EMPA 2OBKA 3V92A 2O3OA 1QQ2A 1UVZA 1UI7A 2OE0A 1FGRA 3MG3A 2PERA 4G2EA 1TRSA 4PEJA 3LQ7A 1W00A 1XWKA 1MWRA 2QA43 1QVG2 3FF0A 1V57A 1JZDA 5AI1A 2JZRA 1FHEA 3Q2PA 4F9ZA 1EGOA 4XS4A 4WFOA 2ML5A 6GSXA 3CCS3 1NHOA 3J7Yd 4DKIA 4FMBA 1IQYA 3FCSB 4N0ZA 4MJBA 1PQNA 3E3EA 5ECSA 3CRUA 3GSSA 5IERA 2DJ1A 4KFDA 1T7PB 20GSA 3EC3A 4EC0A 3FR9A 4P3YB 1FVJA 4IPBA 3O76A 3SWLA 2GSSA 7RNTA 2CH9A 1WIKA 3CCV3 3GAXA 3GHAA 4BU4A 1X5DA 2IA7A 5G2GA 5D9TA 2P09A 3FZAA 5F05A 5IPGA 3KZQA 5E4WA 3DGQA 3CU3A 3FGYA 2KCDA 3CCL3 1ZZYA 1B4PA 1A24A 1FGOA 1BANA 1BNJA 4OFMA 1UW1A 2VLTA 1A2VA 4XRDA 2W9PA 4EIPA 4KCAA 1G02A 4TXVA 3P90A 4NREA 2YFLB 4MDCA 3ZFLA 4PTSA 2FA4A 1S3AA 2C4JA 1GTBA 4Q5NA 3SYUA 5C04A 5HFIA 3RHBA 1LXEA 2FWHA 4K1UA 4XS1A 1G7OA 2ON5A 1J0FA 1ZS7A 2HRNA 1A2KA 5ABRA 3IK7A 5IG5A 4BVYA 4ML1A 1OHPA 3CCU3 1M2AA 2OACA 4N11A 2CA8A 1A23A 1RRLA 3TOTA 3OW22 3PGTA 1DUGA 3PPUA 2H1AA 2BIRA 1GS3A 5LC6A 1WMNA 2MF7A 3DGLA 2CZ2A 4K5RA 3X42A 3V1WA 3EINA 2O87A 4ZL7A 5IO0A 2I4AA 3EQQB 1S723 1QFNA 1PU4A 1GMQA 3QR6A 1DETA 2HLSA 4MNNA 6GSVA 3ERGA 3FR6A 1YGWA 1OUNA 3ZL5A 3S5CA 3TJKA 2STDA 1GSYA 1XWGA 1Q824 3KP8A 3BOAA 5IG0A 2DSAA 4HJLB 5ECRB 1AQZA 1NB3I 1K28A 4MH2A 1SIIA 3AGNA 4I6XA 2GS3A 3M1GA 2DKIA 2P5RA 4BVXA 1GL8A 3LH4A 2YV7A 1W02A 1O7GB 2B5YA 2C0FA 4BWSA 3NBRA 5AIIA 1TDIA 3T8NA 3TKRA 2ZA4A 4YQVA 5D73A 5KOXA 5ELUA 1KQS2 3TKQA 4O8SA 5IW9A 2L57A 2GZYA 2M46A 4ZL8A 1TRPA 1EOHA 6GSYA 1IVWA 1BSAA 5A0OB 2H30A 3GYKA 2R4IA 1TXXA 2CFLA 2XR8B 2F9SA 1D6YA 3LT9A 4FMDA 1N5HA 3ZFBA 2XSHB 1G96A 4H61A 1V2AA 1UC7A 4POBA 5KEJA 2RUFA 1KWIA 4LEHA 3C1SA 3WOFB 3N8BA 3HA9A 3N9HA 5BIRA 2EIOA 2NTOA 1E6BA 3B4PA 2LEGA 4KFEA 3ISOA 1XWAA 2KF4A 1HKXA 5IEOA 4GHOA 2JACA 3E9JB 4IQ1A 1HD2A 2X8GA 1WTHA 2VOCA 1LOXA 1MD3A 2H1GA 2L4QA 1BU4A 3BNEA 1X0RA 3FF2A 4FCJA 3MWZA 2P38A 3DXBA 3UMAA 1TK0B 4HKVB 4ECBA 2GQKA 3N54B 1XPVA 2D2ZA 4MMMA 4N0VA 1XCCA 3ME7A 3GWRA 1YEPA 5D81A 5AN1A 4GQFA 4ICYA 5H5QA 4I97A 3BLZA 4POKA 1X1UA 3GN3A 2OQEC 2KUCA 3EURA 4N6NB 4IN0A 2Z7AA 3ROBA 4E8EA 2CG0A 1D6UA 4BL3A 4CCVA 2C0EA 1V74A 2LJRA 2WCIA 4LL4B 1BSBA 2G2QA 3GV1A 6GSSA 5JBSA 3WT2A 2ZNMA 1DBYA 3FHKA 2P0XA 5ECHB 1TTOA 1M3JA 3S67A 5J4UA 2P0GA 2L4VA 1VQQA 1R7HA 4X2OA 4NMUA 2L6DA 4XS6A 1IVVA 1GNWA 2VD0A 5DALA 2DMLA 2PGTA 3EHCA 3WOEB 2CK3H 4BIRA 5D9WA 4NV2A 9GSSA 5J41A 7GSSA 4HM6B 3WMDA 1SJZA 1PD21 1Y25A 5HR0A 3PYJA 4LMWA 3LYGA 4R4KA 4WP5A 2CX3A 1BRKA 2XBIA 4ZM8A 14GSA 3H3HA 5M18A 4G9HA 2OTJ3 5HR1A 4PQIA 3ZVJA 1UDII 4WR5A 1M2DA 1K734 1V58A 1KD14 4AJ8A 4QQ7A 3DGOA 2I9HA 1BRGA 1T8EB 3CBUA 3GRXA 5BXQA 4HM5B 5FWGA 3VFIA 4QL9A 2YN1A 5EVHA 1Q814 4IJIA 4AEQA 3HJPA 5INYA 1A2MA 3WGEA 1XG8A 2C11A 2M80A 4ID0A 4RI7A 1O7UA 2GBWB 1YIT3 1YDKA 5DCGA 3LYPA 1G6WA 1IYIA 3U5RE 1VQ73 1DE2A 2CFKA 3HIIA 2HRFA 2E0QA 4O5RA 3IAS2 2VL3A 1BEDA 1NB5I 2GSQA 1QJGA 5F8BA 2WULA 3NV0B 4PX1A 1I3FA 3CQFA 8GSSA 3CC23 5DBQA 3NUVA 1SIHA 1OCVA 2QEX3 1EEJA 1E97A 4J5GA 2XSOB 2DJ3A 1Z3EA 3GFKA 2JZTA 1E3VA 1CYVA 1NWWA 2CVKA 4GXZA 4JBBA 3V99A 2XF3A 1U3AA 3A5EA 1A2JA 1XOBA 1GSFA 1OGZA 1GULA 1BSDA 1TRWA 1ZGNA 1MDJA 3ZTLA 1N9EA 1O85A 2R41A 3JUPA 1RHLA 3D79A 1EA2A 5DRVA 4PQ1A 4G19A 2H19A 3HDCA 2WDUA 5ECIB 4GB5A 4IGJA 1A0FA 4U13A 3L9UA 3R2QA 3CXC2 3VF1A 2OADA 2IWTA 2GSPA 2F56A 5ID2B 1DE1A 2VIMA 2YWMA 2FWGA 1SQWA 1GUKA 3TKPA 1F6MC 4OCEA 2LYXA 2J9HA 2X8HA 2LQVA 3G7YA 3CCJ3 2HSYA 4HBRA 4WETA 2W04A 2XGNA 1A8LA 2E2UA 2CFDA 1KEBA 2AAWA 4RQXA 3NM7A 4MEIA 1SYXA 1W7CA 4FCMA 3H4KA 1Q7Y4 3Q74A 5CREA 5KN3A 2Y74A 1B2UA 1ZYEA 4ZB9A 1JBRA 4F03A 2QKEA 1Y6EA 2YV9A 1KNGA 4WR4A 1W89A 1VQ63 3C7MA 2PN8A 3BNDA 2O7KA 5BU4A 4MK3A 3UAPA 3OXAA 1L5GB 4GLTA 2IMDA 4AKYA 2FWFA 4HM0B 1EKMA 1MWTA 5JWQB 1W01A 1PL1A 1OHSA 3GH6A 1EZKA 5CO3A 3IMAB 1F2EA 4MF6A 2VCXA 1DVDA 3KSED 5LD0A 1DYUA 5ID2A 2WGQA 2H72A 1SK1A 3BCKA 3GL3A 1MDIA 3CCQ3 2CQ9A 3GH9A 1B2ZA 3LT8A 1NJI4 2YANA 1B21A 4USSA 1ST9A 3GKKA 3SEDA 2PMTA 6STDA 1EV4A 2F8AA 1TK5B 1FW1A 5D93A 3L9SA 5ECLB 3TGZA 4ACSA 5JWOB 4GCIA 1XWCA 2KP2A 2KF5A 1IU7A 2LSTA 3HKRA 3UBKA 3KXOA 3MAKA 3GSPA 1PKZA 2O9UX 3IHQA 1M2BA 3ZZXA 1HNCA 4EKZA 2OBIA 3JUQA 2X49A 4I5QA 3EU4A 1O7HB 3Q19A 1EV9A 2FUG2 1Z7RA 3X3XA 5CRDA 1RGLA 1SJIA 1GD4A 3UJ1A 4DSSB 4IQAA 1KTEA 1PRXA 1SL2B 1XW5A 1FUSA 1RNTA 4HI7A 4XCSA 3G0KA 2FHEA 3KP9A 1JLVA 2C10A 3B8LA 3EVIA 1LJRA 3UBLA 3QD9A 4EV2A 3FRCA 1ZO2A 3LZAA 5B6NA 4PXOA 5J9BA 3PCSA 3GZRA 3WR2A 2FD3A 3ME8A 2XPEA 2PVOC 3GZYB 2LKUA 2A2SA 1O7PB 2L5LA 1BNEA 1QVF2 4V2NA 3IPTA 1IK3A 1O73A 5G30A 3NZNA 4IHUA 1Z9HA 3KJYA 3ZYWA 1J9BA 1JB4A 5KOWA 1QAKA 1WPIA 4LLRA 2HMKB 1XVQA 1K0OA 3IJEB 4NHFA 3IXRA 4XDVA 1YF0A 3LW9A 4I2TA 3A5WA 5AGYA 4BWQA 1T1VA 1TRVA 2B1LA 2DIYA 4HM7B 4MZBA 4POLA 2WOHA 1BRJA 2PVQA 1GLQA 5DAKB 1SD8A 5CK6A 2LQQA 4V1Ag 1A67A 3DY5A 2CWTA 4OUQA 2AHEA 1ZX2A 1K8A4 1BRHA 4O2HA 3J7Yb 1HU9A 1OGXA 1SK0A 2LJAA 5GSSA 1ML6A 3PH9A 2LTKA 2V2GA 1B4QA 4Q53A 4V1Ap 4OK0A 4L0UA 4K8MA 4N6MA 3IC4A 9RNTA 5LNKe 2JZSA 1T2IA 3WD6A 2GTUA 1R4YA 2JU5A 4XS4B 1F8NA 1WOUA 2C3NA 1K0CA 1JB5A 1QALA 1RJOA 2H8LA 2K6VA 2J23A 3ZMKA 4TN8A 1IVUA 4O5UA 5M1AA 2JQ5A 2I1UA 1X1YA 4IJ3A 2DJ0A 1O8WA 3GNJA 4CPKA 1HYUA 1N8QA 3ER7A 3D4AA 1FGMA 1CEWI 1O7WB 1RGKA 2K54A 4GL6A 1Q42A 2VO4A 3CNMA 3I563 3ALAA 4BL7B 3CNXA 1NW2A 4TVEA 2CHCA 5IG3A 2WS2A 2V1LA 3ERFA 1OKDA 3MSOA 1GOVA 2A2RA 3HI7A 5IOWA 2CFWA 4WHAA 3JUMA 1LQGC 4DSQA 3D5IA 1DVCA 3OX9A 2O8VB 3K8NA 1GY7A 2SARA 1Q40A 3IK9A 2UX0A 1BSEA 4FCZA 3HCZA 2R3XA 3NBBA 1TIJA 4NV5A 1GY6A 2K9FA 2IY2A 5D8IA 4WBRD 4FH8A 1FUTA 1HNBA 3Q1CA 3EE2A 2CX0A 2HMMB 5G2ZA 3CPW2 2UGIA 4BVYB 2IUKA 4HJMA 3UVTA 3DM8A 1N9JA 1EUIC 3DWVA 1YNVX 3U6VA 4OVMA 3VI5A 1YJ93 2HXKA 4KNDA 3PGBA 1X1WA 3VI7A 3DIEA 1C54A 4JF8A 3C73A 3JUOA 4MP4A 3IDVA 2HMLB 5EPFA 1RN1A 1O81A 4K0NA 3VWVA 2MC8A 3LSZA 4JRFA 3CC43 2IPAA 4JR6A 3NQYA 1WMPA 1SKRB 3NIVA 2X4AA 3N9JA 4OD7A 2CX1A 4BL7A 2X99A 4MF7A 4GF0A 1MGRA 3HXSA 4YKFA 1B27A 4Q5QA 5A4VA 2BHMA 1YJW3 3TCOA 1OHOA 2FWEA 3CME3 1QK8A 2KF3A 2PPTA 2DIZA 4AGSA 3DVWA 2PNCA 4HUAA 2RM6A 2OOVC 1GNEA 1WWJA 4BVXB 1GOYA 1NM3A 2L1SA 1FYSA 1UCIA 3STDA 1T4ZA 3QFBC 4GRFA 2CZ3A 3QRDA 4HM2B 2HI7A 4HSCX 5IMFA 2JADA 1BAOA 2H71A 2GDRA 1RGEA 4X4JA 1M3IA 4MJAA 2BMXA 1XW6A 3KN4A 2NBSA 4WEYA 2EC4A 2GEXA 1Q9EA 2LRNA 2BMOB 1YI23 1NO3A 4ILFA 1GP1A 2FLSA 3KD0A 4TXOA 3BBYA 3HIGA 4G0KA 4TR4A 3FSDA 3ZIJA 1UGIA 4NPBA 1LOWA 3L4NA 2DJKA 4BTWA 3EN1B 3KM6A 2TRXA 3V98A 2YP6A 4X1UA 3TRPA 4HOHA 4JR4A 1OAZA 3KCMA 1W2ZA 2F86B 4FYBA 2F98A 1N8R4 2ZCTA 1GYBA 1GWCA 1ASKA 3X40A 1MWUA 2C3TA 1J2BA 1JBSA 3APQA 2YZHA 4JU5A 2Z76A 1G7EA 1JN5B 3D9RA 1YVBI 1YY7A 4G0IA 3Q18A 1VQ83 5DREA 3QOUA 17GSA 3P7XA 3Q90A 1JJ22 3EPTA 2DJ2A 1AC1A 1IT8A 3A76A 2XPDA 1PX7A 4IP6A 4NHZA 3NXJA 2B3SA 1MOLA 3LTBA 4RBNA 1W6GA 2F4YA 1B2MA 3GKXA 1UGHI 3UOMA 4HM8B 2XC2A 1YKCA 1AQVA 1ULIB 2H73A 2BO9B 2O89A 3KZTA 3CMA3 2N5FA 1BIRA 2AB6A 5IG4A 2ALBA 2VCZA 2ZDJA 4FYUA 3RAZA 1YF1A 1G0TA 5HOHA 3G7IA 3F63A 3X3ZA 3HOHA 4EUYA 4KCEA 4XHMA 4CDLA 2HSHA 1Z6NA 4N6V0 2HMNB 1K9M4 2W0QA 4EVMA 1T5YA 3GX0A 2OOVA 3I69A 5DALB 4BL2A 2BU4A 1PFPA 4F2IA 5HGRA 1JV2B 3HVNA 1K0NA 1JN5A 2CT6A 4XM4A 5EY6A 4WF5A 3DGNA 2HMJB 3ZFZA 4LZIA 5BVBA 4CW9A 1THOA 4TRXA 2RGQA 1QMAA 1TP9A 1X9WB 3C1RA 4GTUA 5ELAA 2H1DA 2CVBA 3FEUA 1M9AA 1ZGXA 5G1LA 4EV5A 3VWUA 1TTZA 5CAXA 4QWTA 2OWPA 3I43A 4OCFA 4OFNA 5GAND 3MG2A 1TU7A 5RNTA 1NU3A 1F3BA 2CX4A 3J7Yk 3K7CA 3PS8A 1XIYA 2RIIA 1VF2A 1K0MA 1BNRA 5BRTA 4EIQA 5B6MA 4NAXA 1E2YA 5EL8A 4X2HA 1ERWA 4K1FA 22GSA 1LOVA 4J56E 2OA7A 3CCM3 5GSTA 3ZIVA 5CP1A 3PR8A 4FQUA 4D73A 2VAFA 3MNGA 3EF8A 2H6ZA 2H01A 4KDUA 1HNAA 3LTCA 1ISKA 4LMVA 3TJFA 1F3AA 2WZ9A 5CRHA 3O6TA 1A2LA 4MABA 1SL1B 3LTDA 4HM1B 2HNLA 3HZ4A 4K9ZA 3PINA 1VQM3 1QGVA 4ZXGA 2E2VA 1O8XA 1ABAA 1N2AA 3F14A 2WFCA 1CH0A 4HZ9B 2IYJA 4Z7XA 3K0ZA 3LXUX 1PSQA 3DD3A 1DMMA 2LRCA 3FLJA 4PQHA 5B8AA 2YFJB 4IELA 2WGRA 3C8EA 5JWRB 3MIXA 4MCUA 1BVIA 5A4WA 3OR5A 2C80A 1LBKA 2RBIA 2LJKA 4XTSA 1UCKA 2GZZA 2MBTA 4YAVA 3DEXA 2NDOA 2TRCP 3ZLPA 4EDYA 1I8VA 6GSTA 1ROAA 1AQXA 3I553 2R0CA 4CY6A 1FW7A 4GWRA 3HVVA 1H4OA 2CIUA 2Z6BA 2HOHA 4LA1A 1SARA 3WT1A 1ZOFA 3BCIA 2VM2A 2DBCA 1AAZA 2DC5A 2VCVA 4F0BA 3DZLA 2KLXA 1S3RA 1JBTA 1OE7A 1X9MB 3F9UA 1VRSD 4JE1A 1MEKA 1Q7HA 5BMUA 1WMOA 5AEWB 1BNGA 1ZCPA 2W03A 3N5OA 1AUCA 4EXRA 1V98A 3T0UA 1ZYPA 5DQYA 1FAAA 4K1VA 1OC3A 1AVLA 4MJCA 1S3DA 4XB5A 2B7KA 2V6KA 3UL6A 1H75A 4ZBBA 4AF2A 2LV3A 1FVKA 1I0VA 13GSA 4MJEA 1V40A 2XBQA 3HJOA 1M1K4 2R0PA 2QGVA 4MH3A 1VQ43 4ZILA 3EC9A 3R3EA 2WB9A 4MPFA 3GTUB 1N5PA 3Q6OA 3U1WA 3KMOA 2Z77A 2IIYA 2R37A 5KP4A 3LMLA 4H3UA 3ERWA 3GA4A 2FGXA 3O3TA 3UARA 3LTAA 3FG4A 2OCTA 2V6OA 4HZ4A 1E3RA 4RNTA 2YJHA 4L0WA 1VF4A 4FR9A 3RHCA 1OACA 2P5QA 1S5AA 1IVXA 2JDIH 2IMKA 2L59A 3ZVJD 2KRTA 4HJ2A 2K8SA 2YZUA 2LNSA 3KE7A 1GSDA 4EBGA 2HZFA 3B7CA 1RQMA 2C4BA 1NDOB 2DKHA 1HQOA 3HZ8A 4IVFA 1EWXA 3WHOA 1EQKA 2N5AA 4ZB8A 3VPTA 2INXA 5IEPA 3KGKA 2LUSA 1DE3A 1I2GA 1LRAA 2B1KA 4Z2UA 3Q3FA 5DDLA 3WGXA 3EMXA 3KIJA 3TOUA 1XXUA 5EVOA 2E2GA 3FY7A 2AJQB 3AMOA 1B9YC 2R5GA 1YIJ3 3GTUA 2YX9A 4NXIA 3APSA 1VF3A 1TU8A 5AEUB 1RNBA 1AIUA 2H66A 4ULXA 2WGOA 3OV4A 1SU9A 2EIQA 1YJ6A 4IBPA 3KTBA 4STDA 1WQLB 1U3IA 3EWLA 1BRSA 3KKGA 4R9LA 1TW9A 3CTGA 4Z2RA 2F3MA 1FB0A 1BYEA 1B9XC 3CD63 1K0AA 3E99A 1JZWA 4K2DA 2CG1A 3O8YA 4MMYB 3P2AA 2BJXA 4AKZA 3F6DA 3QMXA 3CMIA 3FMWA 3CCR3 5ELJA 4GSNA 1U5OA 3F4RA 3FZ4A 1OKTA 1B3SA 4LYLB 2OE1A 4CHSA 1RGHA 1SENA 2XHFA 1R4WA 5IM9A 1UUVB 3QCPA 2REMA 4WXTA 1ON4A 3FG3A 1RRHA 3F8HA 3UEMA 3S27A 2R2JA 5CLKA 3MYTA 3K9MC 2RM5A 2KF6A 2ON7A 1TRQA 3BB9A 3DGMA 1IYYA 4X0XA 1M1XB 5F0GA 3IAM2 5ECKB 5D83A 3TKSC 1MGWA 1JB2A 5CRWA 1SJ6A 3LWAA 3QFAC 2YPMA 4K6XA 4PGTA 3CSIA 3GKNA 2SBLA 2OTL3 4O5QA 1C72A 1FA3A 1RW1A 2X64A 2W56A 1VQL3 4NHWA 1Z6MA 2P31A 3HYPA 4EF0A 2G0FA 4EE0A 4PNFA 2MYGA 2XH9A 5ELGA 2N5BA 2LNTA 4KSOA 4ZBDA 3LYKA 4ECJA 4BA7A 4ISDA 4FMCA 1LQMB 2V1MA 3D4MA 3QK9A 5ECQB 2ZL8A 5I97A 1B20A 3NQZA 1YGEA 4BTXA 4I2UA 1ZL9A 5D9XA 4DVCA 2WO0A 5G5FA 5CF1A 5STDA 2H0HA 3HZPA 2IN3A 3E0UA 3UJMA 6RNTA 4AJ7A 12GSA 3S9FA 4MF5A 3ECFA 1EP7A 3A2XA 1FO5A 3HY2A 3RDWA 1RGAA 3JCML 3IRAA 3HJMA 5M19A 3UL3A 3KH9A 2FNQA 1M7TA 1ROVA 3KCHA 2H0IA 3TUEA 1OF5A 3HVXA 1TFOA 1GMPA 1AV4A 3URPA 5IPHA 3MSZA 1GOUA 1WE0A 1Q40B 1ERVA 4KFFA 1TP6A 2RCDA 5JPPA 4R9KA 2QIYA 2CFGA 3I9V2 4TR1A 4I8BA 1R26A 1BAYA 2B6MA 3VLNA 2PZVA 2ML6A 5CYYA 3IOSA 3MG1A 4XDWA 1RGGA 1AY7A 3G713 2E2MA 3EYTA 3H8QA 2RSXA 1TU5A 4IW9A 4LL1B 2YOIA 1OC9A 4POMA 3EE1A 2K8VA 4N6UA 1X5EA 3KH7A 3LXTA 2A4VA 6GSUA 4YH2A 2RLIA 4WKWA 10GSA 1TRUA 5HQPA 5AIGA 3IR4A 1SL0B 2GQMA 4HS1A 2PBJA 3DKSA 1SPUA 2VCTA 1LU4A 2BMRB 5KP3A 1Q864 5C00A 1RKYA 2CAQA 3M3MA 4PURA 4ZL9A 1GSUA 1JNQA 2IMFA 1IDPA 5IOXA 3HX8A 3NBJA 2HRKA 3A2WA 2FGTA 3M0FA 4RQRA 4KE3A 2GZPA 3TKSA 1M9GA 5IQYA 4K61A 5FHIA 3D4TA 2LRTA 4PNGA 1K0DA 3UNLA 1X1XA 3F8XA 1FUWA 2CWVA 3MWHA 4KF9A 3GSTA 5HR2A 4CJNA 1IQXA 1B2SA 1BRNL 2PWJA 5IO2A 1QXHA 3GURA 1TK8B 2HMOB 3BJ5A 4KVHA 1K0BA 2L6CA 5IMAA 1UI8A 1PX6A 4J9AA 4OFTA 4RUVA 5E59A 4J2FA 2MBSA 2XGLA 3HK4A 2I81A 1ZYQB 3W8SA 3S29A 3CC73 2F99A 2B24B 1F9MA 4XBYA 3ZG5A 2F8FA 1WJKA 2IFQA 2VD1A 4JEDA 5J9CA 1FOHA 2JSYA 3F6FA 3W6GA 1XZOA 2YWNA 3X3YA 2HE3A 1I3IA 3TB2A 2K18A 4R80A 1RSNA 2V32A 4HEA2 3CYNA 16GSA 3L9VA 1YZXA 4TXOB 8CHOA 2YNXA 5H5SA 4TR3A 3QAGA 2I9WA 2Y73A 1EP8A 1TKDB 1B2XA 3GRDA 4PUFC 4TW5A 3IHGA 1RGCA 3UIWA 1VGLA 1GSPA 5TGNA 3HVSA 5ENUA 1U87A 6GSPA 1OYJA 2H74A 3D0ZA 1B8XA 3D6IA 3LGCA 5A5KA 2H75A 3WODG 4Q5FA 3NHXA 4ECIA 1FGQA 2AYTA 4G10A 1J08A 3H93A 3A2VA 1VZZA 2H6XA 4KZ1A 5L71A 5LC7A 1RDSA 1TJDA 2QGUA 4KDYA 2B1XB 3F7SA 3EX9A 2IJYA 1LNHA 2VCQA 3NOFA 1R4CA 4K0GA 4I4KA 5IF6A 2AUVA 2C0DA 1I70A 4N3VA 1C7HA 2BMQB 4WYKB 8RNTA 1FG4A 2XFSA 3LOYA 5CF2A 2H1BA 2YWIA 3WYWA 3CPOA 2GSTA 11GSA 1MDKA 2P05A 2E7PA 1LNIA 2I3YA 1EGRA 4WWUC 2D42A 4GQCA 1SK2A 1GH2A 4QL7A 4L5OA 1UUWB 1BQ7A 2GU3A 4MMZB 4F82A 4BIKA 2AAEA 2VL2A 3PXMA 3VWWA 19GSA 4E8HA 5JCWA 4CDOA 1JFUA 1FOVA 3K5TA 1JZOA 2GVPA 2QSIA 3SLUA 3DVXA 3QAVA 2UUGC 3VPQA 4DEJA 4FYCA 1ACVA 5G31A 3IBHA 3I0YA 4HU7A 1PN0A 4HVNA 4ECCA 3D22A 2MMAA 4KX4A 3RGAA 1Q4JA 1G6YA 4YKGA 3PCRA 2H6YA 3H1NA 1VQ93 2F5WA 3UB1A 1OC8A 1RGFA 2LQOA 3JUNA 1AXDA 4V2LA 3FG1A 4L8PA 2PU9C 2LS5A 4AJ6A 3GZBA 5D96A 1TFKA 3KSPA 3RNTA 1BUQA 2F5MA 4WYKA 4DSRA 4MA9A 5D9VA 2OJLA 1M0UA 2HRAA 4N10A 2DJJA 2VL9A 5B7CA 1JKGB 2CAIA 4D73B 3QPMA 3A5IA 1STDA 2CKFB 1T00A 2KAAA 4RZMA 3S28A 4HDEA 2BT3A 2GLRA 5DJLA 1Z5YE 3D21A 3BNCA 5KN1A 5AIXA 1JZRA 1NHYA 3GZXB 1W4VA 5D82A 1Y4KA 3G8ZA 2HSMA 1BRIA 1LVNA 5KN0A 3X41A 5J3RA 4GSSA 3H51A 3C71A 4FO5A 3TDGA 1M99A 1URMA 1PGTA 4KT3B 2MMOA 3NX0A 2FCHA 2VCWA 2W6JH 1GTIA 3GMFA 4WBJA 2RNTA 4HYZA 2W9QA 4BPYA 2ES7A 1MD4A 1A90A 2QA1A 1YVSA 1PKWA 4XRAA 3TRXA 2YCDA 5HR3A 1FGTA 1AW9A 5AIHA 2IMIA 2Z9SA 1ULJB 1ILOA 1O6JA 1GY5A 1EG9B 5GSPA 2K0MA 1D6ZA 2AADA 2NPBA 2KP1A 1ERTA 1SYRA 1JKGA 3FYGA 2V41A 2D1WA 3CTFA 1CYUA 1M9BA 1T4YA 2EIRA 3GIXA 1RN7A 3GL5A 1TUHA 3ZMLA 3HD5A 2VLUA 3TJGA 2GU1A 5FW5A 5AISA 3ZITA 2J8XB 2P0MA 4KB3A 1W4NA 1GD3A 1QAFA 1U8CB 1OH0A 1IYHA 3L0RA 1X9SB 3FH1A 1RK4A 1JLWA 5CNWA 4IS0A 4RI6A 5IIZA 1GSQA 5H5RA 3D5GA 5F06A 3OWSA 1CQGA 3ZG0A 4O32A 3BD2A 2KOKA 4EO3A 1MTCA 1QUWA 3KFQC 3K63A 5F07A 3LG6A 3KIIA 3VURA 1K3LA 1AR0A 1PL2A 1WMJA 5ECNB 1GSEA 2GT6A 4KDXA 2A2PA 1SKWB 3L78A 3BU4A 2W2CA 4X43A 4Z2TA 2RUEA 1O7MB 4ZB6A 1TI3A 4KH7A 3DMCA 2M72A 1FZUA 1SJWA 2BNGA 3GX8A 3LXZA 1B48A 1R5AA 3M8CA 4L8EA 2K3DA 4HQZA 5GZZB 4XIHA 4MMXB 3FZ9A 1AQWA 2FXTA 3F3QA 3ZREA 2H76A 5J5NA 3F3RA 5LCZA 2FNOA 3OWUA 2A15A 4G0LA 1XWBA 5JPUA 2DMMA 4KSMA 2R4VA 5ECMB 4LGQA 1OPYA 1XFLA 5CRGA 2CV4A 2UZ8A 3P8WA 4ZBAA 3VGNA 5EQLA 1NNVA 1N8JA 3IV4A 5DJMA 3F9SA 1U88A 3TJBA 4N6OB 3W8JA 1UUGB 3VSYA 1EEMA 3VK9A 7GSPA 4RNZA 4TX4A 3F0IA 1VQ53 4OWYA 4BTYA 3AMOB 3TKSE 2GQLA 2QA2A 3FZWA 3U97A 2H70A 1PN9A 1SKSB 4N6TA 3SOAA 3I6AA 1A0RP 1GTUA 1YEXA 1KC84 1T2HA 3GUSA 3F4TA 5EEOA 1GUMA 1YKAA 3DRNA 2WOFA 5FT3A 5IMDA 4RNYA 2IL3A 5JCGA 4XBXA 2RFRA 1GMRA 4L8OA 4MZCA 5HFGA 3RPPA 2CWUA 3RGRA 1IV7A 2IUJA 4HZ2A 2OQEA 4YAPA 1STFI 1PYLA 2CC3A 2VM1A 1W5ZA 2YFIB 1V9WA 1XBSA 4HQSA 4O7HA 1UCLA 1IT7A 6GSWA 5AYSC 1VF1A 2NVLA 2PUKC 4IT7A 2YJ7A 2TIRA 4EL1A 1RMSA 4EDZA 7STDA 4O92A 3MKIA 3PZWA 1PMTA 1K41A 1R5PA 4HM3B 2C0GA 5AYRB 2E2TA 2WRTA 4HOJA 3NM2A 3JVCA 1IV9A 5ECOB 1BNFA 3LEFA 1BNIA 2GGTA 1Z7PA 3NV0A 3MDKA 3OWYA 4YQMA 4O3VA 1QMVA 2DLXA 3CRTA 1VQN3 1GTAA 3FKFA 5COHA 2L4CA 3APOA 1OE8A 1UN2A 3MHEA 4MPGA 1BNSA 3FZ5A 1A8YA 4F0CA 1XW9A 5G5EA 4GSPA 3CCE3 3FR3A 3AGOA 4LMIA 1BJXA 3G9BA 3DXOA 3D5JA 5JCUA 2GSRA 1RCKA 1THXA 1Q98A 1Z1SA 1GUHA 3M8NA 1UA5A 2ZHXB 4J57E 1PFOA 2W56B 1K3YA 4EC6A 3RPNA 4R1KA 1NSWA 4L7KA 2F51A 1IQ8A 2YWOA 4OMVA 5B8BA 3RDEA 1BG5A 3A3TA 4K7IA 3GKMA 3M9KA 3EN8A 4FMAA 4K2XA 3B4OA 1OVNA 2XRXB 1BUJA 1EOGA 3WA2X 3MPHA 1RLSA 4FIWA 1AVKA 3EU3A 1RTUA 3ED3A 1FB6A 1GLPA 4MJDA 5GAPD 5IMCA 1WNHA 4G1MB 3IPZA 2JL4A 2KXGA 5G1KA 2CW9A 2A4HA 4K7NA 2QC7A 4PUAA 5AIVA 3TRQA 1JHBA 4IIAA 1X5CA 4HAAA 4K90B 1KSIA 5CXOA 1F37A 4J5KA 2R0GA 3SOYA 2VUPA 4Q5RA 4OO5A 4CY8A 1CQSA 5FGOA 1W2B2 2R6KA 1OF5B 4EYCA 4HU9A 1ZMAA 5DQSA 2HT9A 1HYFA 2MMZA 4ZIJA 4LSOA 4A5PA 4HZBB 1TI1A 1HZ1A 1W6YA 3BNBA 1YHQ3 2FA8A 1I2FA 4TR1B 1PY3A 3KEBA 2HZEB 3IC8A 2C3QA 3CSHA 1O7NB 1MNLA 4O02B 2WJUA 1OC9B 3DGYA
chains in the Genus database with same CATH topology
2AV4A 2IMEA 4H86A 4KAEA 4MZWA 3LORA 2GT5A 1S3CA 4NWYA 1KBNA 3QDNA 1SD9A 4K5SA 1K3OA 3RBTA 3US3A 1YQ1A 1T3BA 3FK8A 4JZQA 4ML6A 1ZYNA 2JSZA 5KN2A 1GSSA 2HYXA 3HHVA 3SBCA 2MMNA 2KHPA 2O85A 1PA3A 3VWXA 5IMVA 1I9DA 4MLYA 2B7JA 1GRXA 1I5GA 3IA1A 3LJRA 4KA0A 5DVBA 2HZEA 4DSSA 3M9JA 4IP1A 3KMNA 2IFQB 2H0GA 2B5EA 3KTLA 2HFDA 1WP0A 3AY8A 2OE3A 4EXJA 2FY6A 5A4UA 5IMZA 3CXGA 2C8UA 3TJJA 3F4SA 1TOFA 4JRRA 4V2MA 3L0HA 18GSA 2CVDA 2X8CA 4YQUA 3DYRA 3LFLA 3QAWA 4GSTA 1WRYA 2BTOT 4IKHA 3IE3A 3UVHA 4L5LA 2VLVA 4KUNA 3F8UA 4TKYA 4TOPA 4OO4A 5DCHA 2C1YA 4KGIA 3CSJA 1U6TA 2MZCA 3MYDA 1CQHA 2ZUPA 2B5XA 2OKAA 1BX9A 2VL2C 4TR0A 1ERUA 2L5OA 1DSBA 4KW6A 4N30A 1USBA 3FW2A 3H79A 3G7JA 4WF4A 5ECPB 4K7OA 1XVWA 3DMLA 5HFKA 3WGDA 5DAKA 1XOAA 3ZRDA 3EMPA 2OBKA 1QQ2A 1UVZA 2OE0A 2PERA 4G2EA 1TRSA 3LQ7A 1XWKA 1V57A 1JZDA 2JZRA 4F9ZA 1FHEA 1EGOA 4XS4A 6GSXA 1NHOA 4N0ZA 4MJBA 1PQNA 3E3EA 5ECSA 3CRUA 3GSSA 2DJ1A 1T7PB 20GSA 3EC3A 4EC0A 3FR9A 4P3YB 1FVJA 3O76A 3SWLA 2GSSA 1WIKA 3GHAA 1X5DA 5D9TA 3FZAA 5F05A 5IPGA 3KZQA 5E4WA 3DGQA 1ZZYA 1B4PA 1A24A 4OFMA 2VLTA 4XRDA 4EIPA 4KCAA 4TXVA 3P90A 4MDCA 3ZFLA 4PTSA 2FA4A 1S3AA 2C4JA 1GTBA 4Q5NA 5C04A 5HFIA 3RHBA 2FWHA 4XS1A 1G7OA 2ON5A 1J0FA 2HRNA 5ABRA 3IK7A 4BVYA 4ML1A 2OACA 1M2AA 4N11A 2CA8A 1A23A 3TOTA 3PGTA 1DUGA 3PPUA 2H1AA 2CZ2A 4K5RA 3V1WA 3EINA 2O87A 4ZL7A 5IO0A 2I4AA 1QFNA 3QR6A 2HLSA 4MNNA 6GSVA 3ERGA 3FR6A 3ZL5A 3TJKA 1GSYA 1XWGA 3KP8A 3BOAA 2DSAA 5ECRB 4MH2A 4I6XA 2GS3A 3M1GA 2DKIA 2P5RA 4BVXA 1GL8A 2YV7A 2B5YA 2C0FA 4BWSA 1TDIA 3TKRA 4YQVA 5D73A 5KOXA 3TKQA 2L57A 2GZYA 2M46A 4ZL8A 1EOHA 6GSYA 2H30A 3GYKA 1TXXA 2F9SA 3ZFBA 1V2AA 4POBA 1UC7A 5KEJA 2RUFA 3C1SA 3HA9A 2EIOA 2NTOA 1E6BA 2LEGA 3ISOA 1XWAA 2JACA 3E9JB 4IQ1A 1HD2A 2X8GA 2VOCA 1MD3A 2H1GA 2L4QA 1X0RA 3DXBA 3UMAA 1TK0B 4ECBA 2GQKA 1XPVA 2D2ZA 4MMMA 4N0VA 1XCCA 3ME7A 1YEPA 5AN1A 4GQFA 4ICYA 5H5QA 4I97A 4POKA 3GN3A 2KUCA 3EURA 4IN0A 4E8EA 2C0EA 2LJRA 2WCIA 4LL4B 2G2QA 3GV1A 6GSSA 3WT2A 2ZNMA 1DBYA 3FHKA 5ECHB 5J4UA 2P0GA 1R7HA 4NMUA 2L6DA 4XS6A 1GNWA 2VD0A 5DALA 2DMLA 2PGTA 5D9WA 9GSSA 5J41A 4NV2A 7GSSA 1SJZA 1PD21 1Y25A 5HR0A 4LMWA 2CX3A 2XBIA 14GSA 4G9HA 5HR1A 4PQIA 3ZVJA 4WR5A 1M2DA 1V58A 4AJ8A 4QQ7A 2I9HA 1T8EB 3CBUA 3GRXA 5FWGA 3VFIA 4QL9A 2YN1A 4IJIA 3HJPA 5INYA 1A2MA 3WGEA 2M80A 4ID0A 4RI7A 1O7UA 1YDKA 5DCGA 3LYPA 1G6WA 1IYIA 3U5RE 1DE2A 2HRFA 2E0QA 4O5RA 3IAS2 2VL3A 1BEDA 2GSQA 5F8BA 2WULA 4PX1A 8GSSA 5DBQA 1EEJA 2DJ3A 1Z3EA 3GFKA 2JZTA 2CVKA 4GXZA 4JBBA 1U3AA 1A2JA 1XOBA 1GSFA 1GULA 1ZGNA 1TRWA 1MDJA 3ZTLA 1O85A 4PQ1A 4G19A 2H19A 3HDCA 2WDUA 5ECIB 4IGJA 1A0FA 3L9UA 3R2QA 2OADA 2IWTA 1DE1A 5ID2B 2VIMA 2YWMA 2FWGA 1GUKA 3TKPA 1F6MC 4OCEA 2J9HA 2X8HA 3G7YA 2HSYA 4WETA 1A8LA 1KEBA 2AAWA 4RQXA 1SYXA 3H4KA 3Q74A 5CREA 5KN3A 1ZYEA 4ZB9A 4F03A 2QKEA 1Y6EA 2YV9A 1KNGA 4WR4A 1W89A 3C7MA 2PN8A 2O7KA 4MK3A 3UAPA 4GLTA 2IMDA 2FWFA 5JWQB 1PL1A 3GH6A 1EZKA 5CO3A 1F2EA 4MF6A 2VCXA 5LD0A 5ID2A 2H72A 1SK1A 3BCKA 3GL3A 1MDIA 2CQ9A 3GH9A 2YANA 4USSA 1ST9A 3GKKA 2PMTA 1EV4A 2F8AA 1TK5B 1FW1A 5D93A 3L9SA 5ECLB 3TGZA 4ACSA 5JWOB 4GCIA 1XWCA 2KP2A 3HKRA 2LSTA 3UBKA 3KXOA 3MAKA 1PKZA 3IHQA 1M2BA 3ZZXA 1HNCA 4EKZA 2OBIA 2X49A 4I5QA 3EU4A 3Q19A 1EV9A 2FUG2 1Z7RA 5CRDA 1SJIA 3UJ1A 4DSSB 4IQAA 1KTEA 1PRXA 1SL2B 1XW5A 4HI7A 4XCSA 2FHEA 3KP9A 1JLVA 3EVIA 1LJRA 3UBLA 3QD9A 3FRCA 5B6NA 4PXOA 5J9BA 2FD3A 3ME8A 2XPEA 2PVOC 2LKUA 2A2SA 2L5LA 4V2NA 1O73A 5G30A 3NZNA 4IHUA 1Z9HA 3KJYA 3ZYWA 1J9BA 5KOWA 1WPIA 4LLRA 1XVQA 1K0OA 3IXRA 1YF0A 3LW9A 4I2TA 3A5WA 5AGYA 4BWQA 1T1VA 1TRVA 2B1LA 2DIYA 4MZBA 4POLA 2PVQA 1GLQA 5DAKB 1SD8A 2LQQA 4V1Ag 2AHEA 3J7Yb 1SK0A 2LJAA 5GSSA 1ML6A 3PH9A 2LTKA 2V2GA 1B4QA 4V1Ap 4L0UA 4K8MA 3IC4A 5LNKe 2JZSA 3WD6A 2GTUA 4XS4B 2JU5A 1WOUA 2C3NA 1K0CA 2H8LA 2K6VA 2J23A 3ZMKA 4TN8A 4O5UA 2I1UA 4IJ3A 2DJ0A 1O8WA 3GNJA 1HYUA 2VO4A 4BL7B 1NW2A 4TVEA 2WS2A 3ERFA 1OKDA 2A2RA 5IOWA 4DSQA 2O8VB 3K8NA 3IK9A 3HCZA 2R3XA 4NV5A 2K9FA 2IY2A 5D8IA 4WBRD 4FH8A 1HNBA 3EE2A 5G2ZA 4BVYB 4HJMA 3UVTA 3DWVA 3U6VA 3VI5A 2HXKA 4KNDA 3VI7A 3DIEA 3C73A 4MP4A 3IDVA 5EPFA 1O81A 4K0NA 3VWVA 3LSZA 2IPAA 4JR6A 1SKRB 3NIVA 2X4AA 3N9JA 4OD7A 4BL7A 2X99A 4MF7A 4GF0A 3HXSA 4YKFA 4Q5QA 5A4VA 3TCOA 2FWEA 1QK8A 2PPTA 2DIZA 4AGSA 3DVWA 4HUAA 2RM6A 1GNEA 1WWJA 4BVXB 1NM3A 1T4ZA 3QFBC 4GRFA 2CZ3A 2HI7A 5IMFA 2JADA 2H71A 2GDRA 4X4JA 4MJAA 2BMXA 1XW6A 4WEYA 2NBSA 2EC4A 2LRNA 4ILFA 1GP1A 2FLSA 3KD0A 4TXOA 3BBYA 4G0KA 4TR4A 3ZIJA 4NPBA 3L4NA 2DJKA 3KM6A 2TRXA 4X1UA 2YP6A 3TRPA 4JR4A 1OAZA 3KCMA 4FYBA 2ZCTA 1GWCA 2C3TA 3APQA 2YZHA 4JU5A 1G7EA 1YY7A 4G0IA 3Q18A 3QOUA 17GSA 3P7XA 3EPTA 2DJ2A 1AC1A 2XPDA 1PX7A 4IP6A 4NHZA 2B3SA 3GKXA 3UOMA 2XC2A 1YKCA 1AQVA 2H73A 2O89A 2N5FA 2AB6A 2ALBA 2VCZA 4FYUA 3RAZA 1YF1A 1G0TA 3G7IA 3F63A 4EUYA 4KCEA 4XHMA 2HSHA 1Z6NA 4EVMA 3GX0A 3I69A 5DALB 4F2IA 1K0NA 2CT6A 5EY6A 4WF5A 4CW9A 1THOA 4TRXA 1TP9A 1X9WB 3C1RA 4GTUA 5ELAA 2H1DA 2CVBA 3FEUA 1M9AA 5G1LA 3VWUA 1TTZA 5CAXA 3I43A 4OCFA 4OFNA 5GAND 1TU7A 1F3BA 2CX4A 3J7Yk 1XIYA 2RIIA 1VF2A 1K0MA 5BRTA 4EIQA 5B6MA 4NAXA 1E2YA 5EL8A 1ERWA 4K1FA 22GSA 4J56E 2OA7A 5GSTA 3ZIVA 5CP1A 3PR8A 4FQUA 4D73A 2VAFA 3MNGA 2H6ZA 2H01A 4KDUA 1HNAA 4LMVA 3TJFA 1F3AA 2WZ9A 5CRHA 3O6TA 1A2LA 4MABA 1SL1B 2HNLA 3HZ4A 4K9ZA 3PINA 1QGVA 4ZXGA 1O8XA 1ABAA 1N2AA 2WFCA 4Z7XA 2IYJA 1PSQA 3DD3A 2LRCA 4PQHA 5B8AA 4IELA 2WGRA 3C8EA 5JWRB 3MIXA 4MCUA 5A4WA 3OR5A 2C80A 1LBKA 2LJKA 4XTSA 2GZZA 2MBTA 4YAVA 3DEXA 2NDOA 2TRCP 3ZLPA 4EDYA 6GSTA 1AQXA 2R0CA 4CY6A 4GWRA 3HVVA 1H4OA 4LA1A 3WT1A 1ZOFA 3BCIA 2VM2A 2DBCA 1AAZA 2DC5A 2VCVA 4F0BA 2KLXA 1OE7A 1X9MB 3F9UA 1VRSD 4JE1A 1MEKA 5BMUA 1ZCPA 3N5OA 1AUCA 1V98A 1ZYPA 5DQYA 1FAAA 1OC3A 4MJCA 1S3DA 2B7KA 2V6KA 4ZBBA 1H75A 4AF2A 2LV3A 1FVKA 13GSA 4MJEA 1V40A 2XBQA 3HJOA 2R0PA 2QGVA 4MH3A 4ZILA 3R3EA 2WB9A 4MPFA 3GTUB 3Q6OA 3KMOA 2IIYA 2R37A 3ERWA 3GA4A 2FGXA 3O3TA 3UARA 2V6OA 4HZ4A 2YJHA 4L0WA 1VF4A 3RHCA 2P5QA 2IMKA 2L59A 3ZVJD 4HJ2A 2K8SA 2YZUA 2LNSA 1GSDA 2HZFA 1RQMA 2DKHA 1HQOA 3HZ8A 4IVFA 1EWXA 2N5AA 4ZB8A 3VPTA 3KGKA 2LUSA 2B1KA 4Z2UA 5DDLA 3WGXA 3EMXA 3KIJA 3TOUA 1XXUA 5EVOA 2E2GA 3FY7A 2AJQB 1B9YC 2R5GA 3GTUA 4NXIA 3APSA 1VF3A 1TU8A 1AIUA 2H66A 4ULXA 1SU9A 2EIQA 1YJ6A 4IBPA 3KTBA 1U3IA 3EWLA 1TW9A 3CTGA 4Z2RA 2F3MA 1FB0A 1BYEA 1B9XC 1K0AA 1JZWA 4K2DA 3P2AA 2BJXA 3F6DA 3QMXA 3CMIA 3FMWA 4GSNA 3FZ4A 3F4RA 1OKTA 2OE1A 4CHSA 1SENA 2XHFA 1R4WA 5IM9A 3QCPA 2REMA 4WXTA 1ON4A 3UEMA 2R2JA 2RM5A 2ON7A 4X0XA 5F0GA 3IAM2 5ECKB 3TKSC 5CRWA 1SJ6A 3LWAA 3QFAC 2YPMA 4K6XA 4PGTA 3CSIA 3GKNA 4O5QA 1C72A 1RW1A 2X64A 4NHWA 1Z6MA 2P31A 3HYPA 4EF0A 2G0FA 4EE0A 4PNFA 2MYGA 5ELGA 2N5BA 2LNTA 4KSOA 4ZBDA 3LYKA 4ECJA 4BA7A 4ISDA 2V1MA 3D4MA 5ECQB 4I2UA 1ZL9A 5D9XA 4DVCA 5G5FA 2H0HA 2IN3A 3E0UA 4AJ7A 12GSA 3S9FA 4MF5A 1EP7A 3A2XA 1FO5A 3HY2A 3RDWA 3JCML 3IRAA 3HJMA 3UL3A 3KH9A 1M7TA 2H0IA 3TUEA 3HVXA 5IPHA 3MSZA 1WE0A 1ERVA 3I9V2 4TR1A 4I8BA 1R26A 1BAYA 2B6MA 3VLNA 5CYYA 3IOSA 2E2MA 3EYTA 3H8QA 4IW9A 4LL1B 2YOIA 1OC9A 4POMA 2K8VA 1X5EA 3KH7A 3LXTA 6GSUA 2A4VA 4YH2A 2RLIA 4WKWA 10GSA 1TRUA 5HQPA 3IR4A 1SL0B 2GQMA 4HS1A 2PBJA 3DKSA 2VCTA 1LU4A 4ZL9A 5C00A 2CAQA 3M3MA 4PURA 1GSUA 2IMFA 5IOXA 2HRKA 3A2WA 3M0FA 4RQRA 4KE3A 2GZPA 3TKSA 5IQYA 5FHIA 3D4TA 2LRTA 4PNGA 1K0DA 3MWHA 4KF9A 3GSTA 5HR2A 5IO2A 2PWJA 1TK8B 1QXHA 3GURA 3BJ5A 1K0BA 2L6CA 5IMAA 4RUVA 1PX6A 4OFTA 5E59A 4J2FA 2MBSA 2I81A 1ZYQB 3W8SA 1F9MA 2F8FA 1WJKA 2IFQA 2VD1A 4JEDA 5J9CA 1FOHA 2JSYA 3F6FA 3W6GA 1XZOA 2YWNA 2HE3A 3TB2A 2K18A 4HEA2 2V32A 3CYNA 16GSA 3L9VA 1YZXA 4TXOB 2YNXA 5H5SA 4TR3A 3QAGA 1EP8A 1TKDB 4PUFC 4TW5A 3IHGA 3UIWA 1VGLA 3HVSA 5ENUA 1U87A 3D0ZA 1OYJA 2H74A 3D6IA 1B8XA 3LGCA 5A5KA 2H75A 4Q5FA 4ECIA 2AYTA 4G10A 1J08A 3H93A 3A2VA 2H6XA 5L71A 1TJDA 4KDYA 2IJYA 2VCQA 3NOFA 4K0GA 2AUVA 2C0DA 1FG4A 2H1BA 2YWIA 3WYWA 2GSTA 11GSA 1MDKA 2E7PA 2I3YA 1EGRA 4GQCA 1SK2A 4QL7A 1GH2A 4L5OA 1BQ7A 4F82A 2VL2A 3VWWA 19GSA 4E8HA 5JCWA 4CDOA 1JFUA 1FOVA 1JZOA 2GVPA 2QSIA 3DVXA 3QAVA 3VPQA 4DEJA 4FYCA 1ACVA 5G31A 3IBHA 4HU7A 1PN0A 4ECCA 3D22A 2MMAA 4KX4A 1Q4JA 1G6YA 4YKGA 2H6YA 3H1NA 1OC8A 2LQOA 1AXDA 4V2LA 2PU9C 2LS5A 4AJ6A 5D96A 4DSRA 4MA9A 5D9VA 2OJLA 1M0UA 2HRAA 4N10A 2DJJA 2VL9A 5B7CA 2CAIA 4D73B 3QPMA 3A5IA 1T00A 4HDEA 2GLRA 5DJLA 1Z5YE 3D21A 5KN1A 5AIXA 1JZRA 1NHYA 1W4VA 2HSMA 5KN0A 5J3RA 4GSSA 3C71A 4FO5A 1M99A 3TDGA 1URMA 1PGTA 2MMOA 2FCHA 2VCWA 1GTIA 3GMFA 4WBJA 4BPYA 2ES7A 1MD4A 2QA1A 1PKWA 4XRAA 3TRXA 2YCDA 5HR3A 1AW9A 2IMIA 2Z9SA 1ILOA 1O6JA 2NPBA 2KP1A 1ERTA 1SYRA 3FYGA 2V41A 3CTFA 1T4YA 1M9BA 2EIRA 3GL5A 3GIXA 3ZMLA 3HD5A 2VLUA 3TJGA 5AISA 3ZITA 4KB3A 1IYHA 1X9SB 1RK4A 1JLWA 5CNWA 4IS0A 4RI6A 5IIZA 1GSQA 5H5RA 5F06A 1CQGA 4O32A 3BD2A 2KOKA 4EO3A 1MTCA 1QUWA 5F07A 3LG6A 3VURA 1K3LA 1PL2A 1WMJA 5ECNB 1GSEA 2GT6A 4KDXA 2A2PA 1SKWB 3L78A 4X43A 4Z2TA 2RUEA 4ZB6A 1TI3A 4KH7A 2M72A 3GX8A 3LXZA 1B48A 1R5AA 4L8EA 4HQZA 5GZZB 4XIHA 3FZ9A 1AQWA 3F3QA 3ZREA 2H76A 5J5NA 3F3RA 5LCZA 2FNOA 4G0LA 1XWBA 4KSMA 2DMMA 2R4VA 5ECMB 1XFLA 5CRGA 2CV4A 2UZ8A 3P8WA 4ZBAA 1N8JA 3IV4A 5DJMA 1U88A 3TJBA 3W8JA 1EEMA 3VK9A 3F0IA 4OWYA 3TKSE 2GQLA 2QA2A 2H70A 1PN9A 1SKSB 3I6AA 1A0RP 1GTUA 1YEXA 3GUSA 3F4TA 1GUMA 1YKAA 3DRNA 5FT3A 5IMDA 2IL3A 5JCGA 4MZCA 5HFGA 3RPPA 4HZ2A 4YAPA 2VM1A 1V9WA 1XBSA 4HQSA 4O7HA 6GSWA 1VF1A 2NVLA 2PUKC 2YJ7A 2TIRA 4EL1A 4EDZA 4O92A 1PMTA 1R5PA 2C0GA 2WRTA 4HOJA 5ECOB 3LEFA 2GGTA 1Z7PA 3MDKA 4YQMA 1QMVA 2DLXA 3CRTA 1GTAA 3FKFA 5COHA 2L4CA 3APOA 1OE8A 1UN2A 4MPGA 3FZ5A 1A8YA 4F0CA 1XW9A 5G5EA 3FR3A 1BJXA 3G9BA 3D5JA 5JCUA 2GSRA 1THXA 1Q98A 1GUHA 3M8NA 1UA5A 4J57E 1K3YA 3RPNA 1NSWA 2F51A 2YWOA 4OMVA 5B8BA 1BG5A 3A3TA 4K7IA 3GKMA 3M9KA 4K2XA 1OVNA 1EOGA 4FIWA 3EU3A 3ED3A 1FB6A 1GLPA 5GAPD 5IMCA 3IPZA 2JL4A 2A4HA 5G1KA 4K7NA 2QC7A 4PUAA 5AIVA 3TRQA 1JHBA 1X5CA 1F37A 2R0GA 2VUPA 4Q5RA 4OO5A 4CY8A 2R6KA 4HU9A 1ZMAA 5DQSA 2HT9A 2MMZA 4ZIJA 4A5PA 1TI1A 2FA8A 4TR1B 3KEBA 2HZEB 3IC8A 2C3QA 3CSHA 2WJUA 1OC9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AV4 A;  2IME A;  4H86 A;  4KAE A;  4MZW A;  3LOR A;  2GT5 A;  1S3C A;  4NWY A;  1KBN A;  3QDN A;  1SD9 A;  1K3O A;  3RBT A;  3US3 A;  1YQ1 A;  1T3B A;  3FK8 A;  4JZQ A;  4ML6 A;  2JSZ A;  5KN2 A;  1GSS A;  2HYX A;  3HHV A;  3SBC A;  2MMN A;  2KHP A;  2O85 A;  1PA3 A;  3VWX A;  5IMV A;  1I9D A;  4MLY A;  2B7J A;  1GRX A;  1I5G A;  3IA1 A;  3LJR A;  4KA0 A;  5DVB A;  2HZE A;  4DSS A;  3M9J A;  4IP1 A;  3KMN A;  2IFQ B;  2H0G A;  2B5E A;  3KTL A;  2HFD A;  1WP0 A;  3AY8 A;  2OE3 A;  4EXJ A;  2FY6 A;  5A4U A;  5IMZ A;  3CXG A;  2C8U A;  3TJJ A;  3F4S A;  1TOF A;  4JRR A;  4V2M A;  3L0H A;  18GS A;  2CVD A;  2X8C A;  4YQU A;  3DYR A;  3LFL A;  3QAW A;  4GST A;  1WRY A;  2BTO T;  4IKH A;  3IE3 A;  3UVH A;  4L5L A;  2VLV A;  4KUN A;  3F8U A;  4TKY A;  4TOP A;  4OO4 A;  5DCH A;  2C1Y A;  4KGI A;  3CSJ A;  1U6T A;  2MZC A;  1CQH A;  2ZUP A;  2B5X A;  2OKA A;  1BX9 A;  2VL2 C;  4TR0 A;  1ERU A;  2L5O A;  1DSB A;  4KW6 A;  4N30 A;  1USB A;  3FW2 A;  3H79 A;  3G7J A;  4WF4 A;  5ECP B;  4K7O A;  1XVW A;  3DML A;  5HFK A;  3WGD A;  5DAK A;  1XOA A;  3ZRD A;  3EMP A;  2OBK A;  1QQ2 A;  1UVZ A;  2OE0 A;  2PER A;  4G2E A;  1TRS A;  3LQ7 A;  1XWK A;  1V57 A;  1JZD A;  2JZR A;  4F9Z A;  1FHE A;  1EGO A;  4XS4 A;  6GSX A;  1NHO A;  4N0Z A;  4MJB A;  1PQN A;  3E3E A;  5ECS A;  3CRU A;  3GSS A;  2DJ1 A;  1T7P B;  20GS A;  3EC3 A;  4EC0 A;  3FR9 A;  4P3Y B;  1FVJ A;  3O76 A;  3SWL A;  2GSS A;  1WIK A;  3GHA A;  1X5D A;  5D9T A;  3FZA A;  5F05 A;  5IPG A;  3KZQ A;  5E4W A;  3DGQ A;  1ZZY A;  1B4P A;  1A24 A;  4OFM A;  2VLT A;  4XRD A;  4KCA A;  4TXV A;  3P90 A;  4MDC A;  3ZFL A;  2FA4 A;  1S3A A;  2C4J A;  1GTB A;  4Q5N A;  5C04 A;  5HFI A;  3RHB A;  2FWH A;  4XS1 A;  1G7O A;  2ON5 A;  1J0F A;  2HRN A;  5ABR A;  3IK7 A;  4BVY A;  4ML1 A;  2OAC A;  1M2A A;  4N11 A;  2CA8 A;  1A23 A;  3TOT A;  3PGT A;  1DUG A;  2H1A A;  2CZ2 A;  3V1W A;  3EIN A;  2O87 A;  4ZL7 A;  5IO0 A;  2I4A A;  1QFN A;  3QR6 A;  2HLS A;  6GSV A;  3ERG A;  3FR6 A;  3ZL5 A;  3TJK A;  1GSY A;  1XWG A;  3KP8 A;  3BOA A;  2DSA A;  5ECR B;  4MH2 A;  4I6X A;  2GS3 A;  3M1G A;  2P5R A;  4BVX A;  1GL8 A;  2YV7 A;  2B5Y A;  2C0F A;  4BWS A;  1TDI A;  3TKR A;  4YQV A;  5D73 A;  3TKQ A;  2L57 A;  2GZY A;  2M46 A;  4ZL8 A;  1EOH A;  6GSY A;  2H30 A;  3GYK A;  1TXX A;  2F9S A;  3ZFB A;  1V2A A;  4POB A;  1UC7 A;  5KEJ A;  2RUF A;  3C1S A;  3HA9 A;  2EIO A;  2NTO A;  1E6B A;  2LEG A;  3ISO A;  1XWA A;  2JAC A;  3E9J B;  4IQ1 A;  1HD2 A;  2X8G A;  2VOC A;  1MD3 A;  2H1G A;  2L4Q A;  1X0R A;  3DXB A;  3UMA A;  1TK0 B;  4ECB A;  2GQK A;  1XPV A;  2D2Z A;  4MMM A;  4N0V A;  1XCC A;  3ME7 A;  1YEP A;  5AN1 A;  4GQF A;  5H5Q A;  4I97 A;  4POK A;  3GN3 A;  2KUC A;  3EUR A;  4IN0 A;  4E8E A;  2C0E A;  2LJR A;  2WCI A;  4LL4 B;  2G2Q A;  3GV1 A;  6GSS A;  3WT2 A;  2ZNM A;  1DBY A;  3FHK A;  5ECH B;  5J4U A;  2P0G A;  1R7H A;  4NMU A;  2L6D A;  4XS6 A;  1GNW A;  2VD0 A;  5DAL A;  2DML A;  2PGT A;  5D9W A;  9GSS A;  5J41 A;  4NV2 A;  7GSS A;  1SJZ A;  1PD2 1;  1Y25 A;  5HR0 A;  4LMW A;  2CX3 A;  2XBI A;  14GS A;  4G9H A;  5HR1 A;  4PQI A;  3ZVJ A;  4WR5 A;  1M2D A;  1V58 A;  4AJ8 A;  4QQ7 A;  2I9H A;  1T8E B;  3CBU A;  3GRX A;  5FWG A;  3VFI A;  4QL9 A;  2YN1 A;  4IJI A;  3HJP A;  5INY A;  1A2M A;  3WGE A;  2M80 A;  4ID0 A;  4RI7 A;  1O7U A;  1YDK A;  5DCG A;  3LYP A;  1G6W A;  1IYI A;  3U5R E;  1DE2 A;  2HRF A;  2E0Q A;  4O5R A;  3IAS 2;  2VL3 A;  1BED A;  2GSQ A;  5F8B A;  2WUL A;  4PX1 A;  8GSS A;  5DBQ A;  1EEJ A;  2DJ3 A;  1Z3E A;  3GFK A;  2JZT A;  2CVK A;  4GXZ A;  4JBB A;  1U3A A;  1A2J A;  1XOB A;  1GSF A;  1GUL A;  1ZGN A;  1TRW A;  1MDJ A;  3ZTL A;  1O85 A;  4PQ1 A;  4G19 A;  2H19 A;  3HDC A;  2WDU A;  5ECI B;  4IGJ A;  1A0F A;  3L9U A;  3R2Q A;  2OAD A;  2IWT A;  1DE1 A;  5ID2 B;  2VIM A;  2YWM A;  2FWG A;  1GUK A;  3TKP A;  1F6M C;  4OCE A;  2J9H A;  2X8H A;  3G7Y A;  2HSY A;  4WET A;  1A8L A;  1KEB A;  2AAW A;  4RQX A;  1SYX A;  3H4K A;  3Q74 A;  5CRE A;  5KN3 A;  1ZYE A;  4ZB9 A;  4F03 A;  2QKE A;  1Y6E A;  2YV9 A;  1KNG A;  4WR4 A;  1W89 A;  3C7M A;  2PN8 A;  2O7K A;  4MK3 A;  3UAP A;  4GLT A;  2IMD A;  2FWF A;  5JWQ B;  1PL1 A;  3GH6 A;  1EZK A;  5CO3 A;  1F2E A;  4MF6 A;  2VCX A;  5LD0 A;  5ID2 A;  2H72 A;  1SK1 A;  3BCK A;  3GL3 A;  1MDI A;  2CQ9 A;  3GH9 A;  2YAN A;  1ST9 A;  3GKK A;  2PMT A;  1EV4 A;  2F8A A;  1TK5 B;  1FW1 A;  5D93 A;  3L9S A;  5ECL B;  3TGZ A;  4ACS A;  5JWO B;  4GCI A;  1XWC A;  2KP2 A;  3HKR A;  2LST A;  3UBK A;  3KXO A;  3MAK A;  1PKZ A;  3IHQ A;  1M2B A;  3ZZX A;  1HNC A;  4EKZ A;  2OBI A;  4I5Q A;  3EU4 A;  3Q19 A;  1EV9 A;  2FUG 2;  1Z7R A;  5CRD A;  1SJI A;  3UJ1 A;  4DSS B;  4IQA A;  1KTE A;  1PRX A;  1SL2 B;  1XW5 A;  4HI7 A;  4XCS A;  2FHE A;  3KP9 A;  1JLV A;  3EVI A;  1LJR A;  3UBL A;  3QD9 A;  3FRC A;  5B6N A;  4PXO A;  5J9B A;  2FD3 A;  3ME8 A;  2XPE A;  2PVO C;  2LKU A;  2A2S A;  2L5L A;  4V2N A;  1O73 A;  5G30 A;  3NZN A;  4IHU A;  1Z9H A;  3KJY A;  3ZYW A;  1J9B A;  1WPI A;  4LLR A;  1XVQ A;  1K0O A;  3IXR A;  1YF0 A;  4I2T A;  3A5W A;  5AGY A;  4BWQ A;  1T1V A;  1TRV A;  2B1L A;  2DIY A;  4MZB A;  4POL A;  2PVQ A;  1GLQ A;  5DAK B;  1SD8 A;  2LQQ A;  4V1A g;  2AHE A;  3J7Y b;  1SK0 A;  2LJA A;  5GSS A;  1ML6 A;  3PH9 A;  2LTK A;  2V2G A;  1B4Q A;  4V1A p;  4L0U A;  4K8M A;  3IC4 A;  5LNK e;  2JZS A;  3WD6 A;  2GTU A;  4XS4 B;  2JU5 A;  1WOU A;  2C3N A;  1K0C A;  2H8L A;  2K6V A;  2J23 A;  3ZMK A;  4TN8 A;  2I1U A;  4IJ3 A;  2DJ0 A;  1O8W A;  3GNJ A;  1HYU A;  2VO4 A;  1NW2 A;  4TVE A;  2WS2 A;  3ERF A;  1OKD A;  2A2R A;  5IOW A;  4DSQ A;  2O8V B;  3K8N A;  3IK9 A;  3HCZ A;  2R3X A;  4NV5 A;  2K9F A;  2IY2 A;  5D8I A;  4WBR D;  4FH8 A;  1HNB A;  3EE2 A;  5G2Z A;  4HJM A;  3UVT A;  3DWV A;  3U6V A;  3VI5 A;  2HXK A;  4KND A;  3VI7 A;  3DIE A;  3C73 A;  4MP4 A;  3IDV A;  5EPF A;  1O81 A;  4K0N A;  3VWV A;  3LSZ A;  2IPA A;  4JR6 A;  1SKR B;  3NIV A;  3N9J A;  4OD7 A;  4BL7 A;  2X99 A;  4MF7 A;  4GF0 A;  3HXS A;  4Q5Q A;  5A4V A;  3TCO A;  2FWE A;  1QK8 A;  2PPT A;  2DIZ A;  4AGS A;  3DVW A;  4HUA A;  2RM6 A;  1GNE A;  1WWJ A;  1NM3 A;  1T4Z A;  3QFB C;  4GRF A;  2CZ3 A;  2HI7 A;  5IMF A;  2JAD A;  2H71 A;  2GDR A;  4MJA A;  2BMX A;  1XW6 A;  4WEY A;  2NBS A;  2EC4 A;  2LRN A;  4ILF A;  1GP1 A;  2FLS A;  3KD0 A;  4TXO A;  3BBY A;  4TR4 A;  3ZIJ A;  4NPB A;  3L4N A;  2DJK A;  3KM6 A;  2TRX A;  4X1U A;  2YP6 A;  3TRP A;  4JR4 A;  1OAZ A;  3KCM A;  4FYB A;  2ZCT A;  1GWC A;  2C3T A;  3APQ A;  2YZH A;  4JU5 A;  1G7E A;  1YY7 A;  3Q18 A;  3QOU A;  17GS A;  3P7X A;  2DJ2 A;  1AC1 A;  2XPD A;  1PX7 A;  4IP6 A;  4NHZ A;  2B3S A;  3GKX A;  3UOM A;  2XC2 A;  1YKC A;  1AQV A;  2H73 A;  2O89 A;  2N5F A;  2AB6 A;  2ALB A;  2VCZ A;  4FYU A;  3RAZ A;  1YF1 A;  1G0T A;  3G7I A;  3F63 A;  4EUY A;  4KCE A;  4XHM A;  2HSH A;  1Z6N A;  4EVM A;  3GX0 A;  3I69 A;  5DAL B;  4F2I A;  1K0N A;  2CT6 A;  5EY6 A;  4WF5 A;  4CW9 A;  1THO A;  4TRX A;  1TP9 A;  1X9W B;  3C1R A;  4GTU A;  5ELA A;  2H1D A;  2CVB A;  3FEU A;  1M9A A;  5G1L A;  3VWU A;  1TTZ A;  5CAX A;  3I43 A;  4OCF A;  4OFN A;  5GAN D;  1TU7 A;  1F3B A;  2CX4 A;  3J7Y k;  1XIY A;  2RII A;  1VF2 A;  1K0M A;  5B6M A;  4NAX A;  1E2Y A;  5EL8 A;  1ERW A;  4K1F A;  22GS A;  4J56 E;  2OA7 A;  5GST A;  3ZIV A;  5CP1 A;  3PR8 A;  4D73 A;  2VAF A;  3MNG A;  2H6Z A;  2H01 A;  4KDU A;  1HNA A;  4LMV A;  3TJF A;  1F3A A;  2WZ9 A;  5CRH A;  3O6T A;  1A2L A;  4MAB A;  1SL1 B;  2HNL A;  3HZ4 A;  4K9Z A;  3PIN A;  1QGV A;  4ZXG A;  1O8X A;  1ABA A;  1N2A A;  2WFC A;  4Z7X A;  2IYJ A;  1PSQ A;  3DD3 A;  2LRC A;  4PQH A;  5B8A A;  4IEL A;  2WGR A;  3C8E A;  5JWR B;  4MCU A;  5A4W A;  3OR5 A;  2C80 A;  1LBK A;  2LJK A;  4XTS A;  2GZZ A;  2MBT A;  4YAV A;  3DEX A;  2NDO A;  2TRC P;  3ZLP A;  4EDY A;  6GST A;  1AQX A;  4GWR A;  3HVV A;  1H4O A;  4LA1 A;  3WT1 A;  1ZOF A;  3BCI A;  2VM2 A;  2DBC A;  1AAZ A;  2DC5 A;  2VCV A;  4F0B A;  2KLX A;  1OE7 A;  1X9M B;  3F9U A;  1VRS D;  4JE1 A;  1MEK A;  1ZCP A;  3N5O A;  1AUC A;  1V98 A;  5DQY A;  1FAA A;  1OC3 A;  4MJC A;  1S3D A;  2B7K A;  2V6K A;  4ZBB A;  1H75 A;  4AF2 A;  2LV3 A;  1FVK A;  13GS A;  4MJE A;  1V40 A;  2XBQ A;  3HJO A;  2QGV A;  4MH3 A;  4ZIL A;  2WB9 A;  4MPF A;  3GTU B;  3Q6O A;  3KMO A;  2IIY A;  2R37 A;  3ERW A;  3GA4 A;  2FGX A;  3O3T A;  3UAR A;  2V6O A;  4HZ4 A;  2YJH A;  4L0W A;  1VF4 A;  3RHC A;  2P5Q A;  2IMK A;  2L59 A;  3ZVJ D;  4HJ2 A;  2K8S A;  2YZU A;  2LNS A;  1GSD A;  2HZF A;  1RQM A;  1HQO A;  3HZ8 A;  4IVF A;  1EWX A;  2N5A A;  4ZB8 A;  3VPT A;  3KGK A;  2LUS A;  2B1K A;  5DDL A;  3WGX A;  3EMX A;  3KIJ A;  3TOU A;  1XXU A;  5EVO A;  2E2G A;  3FY7 A;  2AJQ B;  1B9Y C;  2R5G A;  3GTU A;  4NXI A;  3APS A;  1VF3 A;  1TU8 A;  1AIU A;  2H66 A;  4ULX A;  1SU9 A;  2EIQ A;  1YJ6 A;  4IBP A;  3KTB A;  1U3I A;  3EWL A;  1TW9 A;  3CTG A;  2F3M A;  1FB0 A;  1BYE A;  1B9X C;  1K0A A;  1JZW A;  4K2D A;  3P2A A;  2BJX A;  3F6D A;  3QMX A;  3CMI A;  4GSN A;  3FZ4 A;  3F4R A;  1OKT A;  2OE1 A;  4CHS A;  1SEN A;  2XHF A;  1R4W A;  5IM9 A;  3QCP A;  2REM A;  4WXT A;  1ON4 A;  3UEM A;  2R2J A;  2RM5 A;  2ON7 A;  4X0X A;  5F0G A;  3IAM 2;  5ECK B;  3TKS C;  5CRW A;  1SJ6 A;  3LWA A;  3QFA C;  2YPM A;  4K6X A;  4PGT A;  3CSI A;  3GKN A;  1C72 A;  1RW1 A;  2X64 A;  4NHW A;  1Z6M A;  2P31 A;  3HYP A;  4EF0 A;  2G0F A;  4EE0 A;  4PNF A;  2MYG A;  5ELG A;  2N5B A;  2LNT A;  4KSO A;  4ZBD A;  3LYK A;  4ECJ A;  4BA7 A;  4ISD A;  2V1M A;  3D4M A;  5ECQ B;  4I2U A;  1ZL9 A;  5D9X A;  4DVC A;  5G5F A;  2H0H A;  2IN3 A;  3E0U A;  4AJ7 A;  12GS A;  3S9F A;  4MF5 A;  1EP7 A;  3A2X A;  1FO5 A;  3HY2 A;  3RDW A;  3JCM L;  3IRA A;  3HJM A;  3UL3 A;  3KH9 A;  1M7T A;  2H0I A;  3TUE A;  3HVX A;  5IPH A;  3MSZ A;  1WE0 A;  1ERV A;  3I9V 2;  4TR1 A;  4I8B A;  1R26 A;  1BAY A;  2B6M A;  3VLN A;  5CYY A;  3IOS A;  2E2M A;  3EYT A;  3H8Q A;  4IW9 A;  4LL1 B;  2YOI A;  1OC9 A;  4POM A;  2K8V A;  1X5E A;  3KH7 A;  3LXT A;  6GSU A;  2A4V A;  4YH2 A;  2RLI A;  4WKW A;  10GS A;  1TRU A;  5HQP A;  3IR4 A;  1SL0 B;  2GQM A;  4HS1 A;  2PBJ A;  3DKS A;  2VCT A;  1LU4 A;  4ZL9 A;  5C00 A;  2CAQ A;  3M3M A;  4PUR A;  1GSU A;  2IMF A;  5IOX A;  3A2W A;  3M0F A;  4RQR A;  4KE3 A;  2GZP A;  3TKS A;  5IQY A;  5FHI A;  3D4T A;  2LRT A;  4PNG A;  1K0D A;  3MWH A;  3GST A;  5HR2 A;  5IO2 A;  2PWJ A;  1TK8 B;  1QXH A;  3GUR A;  3BJ5 A;  1K0B A;  2L6C A;  5IMA A;  4RUV A;  1PX6 A;  4OFT A;  5E59 A;  4J2F A;  2MBS A;  2I81 A;  1ZYQ B;  3W8S A;  1F9M A;  2F8F A;  1WJK A;  2IFQ A;  2VD1 A;  4JED A;  5J9C A;  2JSY A;  3F6F A;  3W6G A;  1XZO A;  2YWN A;  2HE3 A;  3TB2 A;  2K18 A;  4HEA 2;  2V32 A;  3CYN A;  16GS A;  3L9V A;  1YZX A;  4TXO B;  2YNX A;  5H5S A;  4TR3 A;  3QAG A;  1EP8 A;  1TKD B;  4PUF C;  4TW5 A;  3UIW A;  1VGL A;  3HVS A;  5ENU A;  1U87 A;  3D0Z A;  1OYJ A;  2H74 A;  3D6I A;  1B8X A;  3LGC A;  5A5K A;  2H75 A;  4Q5F A;  4ECI A;  2AYT A;  4G10 A;  1J08 A;  3H93 A;  3A2V A;  2H6X A;  5L71 A;  1TJD A;  4KDY A;  2IJY A;  2VCQ A;  3NOF A;  4K0G A;  2AUV A;  2C0D A;  1FG4 A;  2H1B A;  2YWI A;  3WYW A;  2GST A;  11GS A;  1MDK A;  2E7P A;  2I3Y A;  1EGR A;  4GQC A;  1SK2 A;  4QL7 A;  1GH2 A;  4L5O A;  1BQ7 A;  4F82 A;  2VL2 A;  3VWW A;  19GS A;  4E8H A;  5JCW A;  4CDO A;  1JFU A;  1FOV A;  1JZO A;  2GVP A;  2QSI A;  3DVX A;  3QAV A;  3VPQ A;  4DEJ A;  4FYC A;  1ACV A;  5G31 A;  3IBH A;  4HU7 A;  4ECC A;  3D22 A;  2MMA A;  4KX4 A;  1Q4J A;  1G6Y A;  2H6Y A;  3H1N A;  1OC8 A;  2LQO A;  1AXD A;  4V2L A;  2PU9 C;  2LS5 A;  4AJ6 A;  5D96 A;  4DSR A;  4MA9 A;  5D9V A;  2OJL A;  1M0U A;  4N10 A;  2DJJ A;  2VL9 A;  5B7C A;  2CAI A;  4D73 B;  3QPM A;  1T00 A;  4HDE A;  2GLR A;  5DJL A;  1Z5Y E;  3D21 A;  5KN1 A;  5AIX A;  1JZR A;  1NHY A;  1W4V A;  5KN0 A;  5J3R A;  4GSS A;  3C71 A;  4FO5 A;  1M99 A;  3TDG A;  1URM A;  1PGT A;  2MMO A;  2FCH A;  2VCW A;  1GTI A;  3GMF A;  4WBJ A;  4BPY A;  2ES7 A;  1MD4 A;  1PKW A;  4XRA A;  3TRX A;  2YCD A;  5HR3 A;  1AW9 A;  2IMI A;  2Z9S A;  1ILO A;  1O6J A;  2NPB A;  2KP1 A;  1ERT A;  1SYR A;  3FYG A;  2V41 A;  3CTF A;  1T4Y A;  1M9B A;  2EIR A;  3GL5 A;  3GIX A;  3ZML A;  3HD5 A;  2VLU A;  3TJG A;  5AIS A;  3ZIT A;  4KB3 A;  1IYH A;  1X9S B;  1RK4 A;  1JLW A;  5CNW A;  4IS0 A;  4RI6 A;  5IIZ A;  1GSQ A;  5H5R A;  5F06 A;  1CQG A;  4O32 A;  3BD2 A;  2KOK A;  4EO3 A;  1MTC A;  1QUW A;  5F07 A;  3LG6 A;  3VUR A;  1K3L A;  1PL2 A;  1WMJ A;  5ECN B;  1GSE A;  2GT6 A;  4KDX A;  1SKW B;  3L78 A;  4X43 A;  2RUE A;  4ZB6 A;  1TI3 A;  4KH7 A;  2M72 A;  3GX8 A;  3LXZ A;  1B48 A;  1R5A A;  4L8E A;  4HQZ A;  5GZZ B;  4XIH A;  3FZ9 A;  1AQW A;  3F3Q A;  3ZRE A;  2H76 A;  5J5N A;  3F3R A;  5LCZ A;  2FNO A;  1XWB A;  4KSM A;  2DMM A;  2R4V A;  5ECM B;  1XFL A;  5CRG A;  2CV4 A;  3P8W A;  4ZBA A;  1N8J A;  3IV4 A;  5DJM A;  1U88 A;  3TJB A;  3W8J A;  1EEM A;  3VK9 A;  3F0I A;  4OWY A;  3TKS E;  2GQL A;  2H70 A;  1PN9 A;  1SKS B;  3I6A A;  1A0R P;  1GTU A;  1YEX A;  3GUS A;  3F4T A;  1GUM A;  1YKA A;  3DRN A;  5FT3 A;  5IMD A;  2IL3 A;  5JCG A;  4MZC A;  5HFG A;  3RPP A;  4HZ2 A;  4YAP A;  2VM1 A;  1V9W A;  1XBS A;  4HQS A;  4O7H A;  6GSW A;  1VF1 A;  2NVL A;  2PUK C;  2YJ7 A;  2TIR A;  4EL1 A;  4EDZ A;  4O92 A;  1PMT A;  1R5P A;  2C0G A;  2WRT A;  4HOJ A;  5ECO B;  3LEF A;  2GGT A;  1Z7P A;  3MDK A;  4YQM A;  1QMV A;  2DLX A;  3CRT A;  1GTA A;  3FKF A;  5COH A;  2L4C A;  3APO A;  1OE8 A;  1UN2 A;  4MPG A;  3FZ5 A;  1A8Y A;  4F0C A;  1XW9 A;  5G5E A;  3FR3 A;  1BJX A;  3G9B A;  3D5J A;  5JCU A;  2GSR A;  1THX A;  1Q98 A;  1GUH A;  3M8N A;  1UA5 A;  4J57 E;  1K3Y A;  3RPN A;  1NSW A;  2F51 A;  2YWO A;  4OMV A;  5B8B A;  1BG5 A;  3A3T A;  4K7I A;  3GKM A;  3M9K A;  1OVN A;  1EOG A;  4FIW A;  3EU3 A;  3ED3 A;  1FB6 A;  1GLP A;  5GAP D;  5IMC A;  3IPZ A;  2JL4 A;  5G1K A;  4K7N A;  2QC7 A;  4PUA A;  5AIV A;  3TRQ A;  1JHB A;  1X5C A;  1F37 A;  2VUP A;  4Q5R A;  4OO5 A;  2R6K A;  4HU9 A;  1ZMA A;  5DQS A;  2HT9 A;  2MMZ A;  4ZIJ A;  1TI1 A;  2FA8 A;  4TR1 B;  3KEB A;  2HZE B;  2C3Q A;  3CSH A;  2WJU A;  1OC9 B; 
#chains in the Genus database with same CATH topology
 2AV4 A;  2IME A;  1US1 A;  4H86 A;  5KP1 A;  1I2E A;  4KAE A;  4MZW A;  3LOR A;  2M7O A;  2GT5 A;  3EJV A;  4ORL A;  2GEY A;  1UCJ A;  2XFT A;  1I0X A;  1S3C A;  4NWY A;  1KBN A;  1VQK 3;  3QDN A;  1SD9 A;  4K5S A;  1RCL A;  1K3O A;  3RBT A;  3US3 A;  1YQ1 A;  1T3B A;  2IMJ A;  3UL5 A;  3FK8 A;  1ZYN A;  2JSZ A;  4JZQ A;  4ML6 A;  5KN2 A;  4J8T A;  1GSS A;  2HYX A;  5AIF A;  3HHV A;  3SBC A;  2MMN A;  2KHP A;  2O85 A;  1PA3 A;  3VWX A;  5IMV A;  1A2P A;  1I9D A;  4MLY A;  2B7J A;  1GRX A;  1I5G A;  3IA1 A;  3G4S 3;  1RN4 A;  3LJR A;  1BGS A;  3FKA A;  4KA0 A;  5DVB A;  3EBY A;  2HZE A;  4DSS A;  3M9J A;  4IP1 A;  3KMN A;  4N6L A;  2IFQ B;  2H0G A;  2B5E A;  2GBX B;  3F40 A;  3KTL A;  3DUK A;  2HFD A;  1WP0 A;  3AY8 A;  2OE3 A;  4EXJ A;  3SX1 A;  3BIR A;  2FY6 A;  5IMZ A;  5A4U A;  3CXG A;  2C8U A;  3TJJ A;  3G6E 3;  3F4S A;  1TOF A;  4JRR A;  4V2M A;  3L0H A;  18GS A;  2CVD A;  2X8C A;  4YQU A;  3DYR A;  3LFL A;  3QAW A;  4GST A;  1VQO 3;  1WRY A;  2BTO T;  4IKH A;  2Q07 A;  3IE3 A;  3UVH A;  4L5L A;  2VLV A;  4KUN A;  3AHW A;  3F8U A;  4TKY A;  4HM4 B;  4TOP A;  4OO4 A;  1LOY A;  5DCH A;  3WDG B;  2C1Y A;  3DH2 A;  3T8U A;  3G16 A;  4KGI A;  1VQP 3;  3EB8 A;  3CSJ A;  3SVA A;  4EW5 A;  1YJN 3;  1U6T A;  1M90 4;  2MZC A;  3D3L A;  3MYD A;  1CQH A;  3F7X A;  3WA3 A;  2ZUP A;  2B5X A;  2OKA A;  1BX9 A;  1BSC A;  3SXX A;  2VL2 C;  4TR0 A;  1DMQ A;  1ERU A;  1W6C A;  4XBT A;  2L5O A;  1DSB A;  4KW6 A;  1JRQ A;  1BOX A;  4N30 A;  3EBT A;  1USB A;  1DMN A;  1MWS A;  3FW2 A;  3H79 A;  2XEP A;  3G7J A;  4WF4 A;  3AHS A;  5ECP B;  4K7O A;  1XVW A;  3DML A;  5HFK A;  3WGD A;  5DAK A;  1XOA A;  5IEN A;  3ZRD A;  2GXF A;  3EMP A;  2OBK A;  3V92 A;  2O3O A;  1QQ2 A;  1UVZ A;  1UI7 A;  2OE0 A;  1FGR A;  3MG3 A;  2PER A;  4G2E A;  1TRS A;  4PEJ A;  3LQ7 A;  1W00 A;  1XWK A;  1MWR A;  2QA4 3;  1QVG 2;  3FF0 A;  1V57 A;  1JZD A;  5AI1 A;  2JZR A;  1FHE A;  3Q2P A;  4F9Z A;  1EGO A;  4XS4 A;  4WFO A;  2ML5 A;  6GSX A;  3CCS 3;  1NHO A;  3J7Y d;  4DKI A;  4FMB A;  1IQY A;  3FCS B;  4N0Z A;  4MJB A;  1PQN A;  3E3E A;  5ECS A;  3CRU A;  3GSS A;  5IER A;  2DJ1 A;  4KFD A;  1T7P B;  20GS A;  3EC3 A;  4EC0 A;  3FR9 A;  4P3Y B;  1FVJ A;  4IPB A;  3O76 A;  3SWL A;  2GSS A;  7RNT A;  2CH9 A;  1WIK A;  3CCV 3;  3GAX A;  3GHA A;  4BU4 A;  1X5D A;  2IA7 A;  5G2G A;  5D9T A;  2P09 A;  3FZA A;  5F05 A;  5IPG A;  3KZQ A;  5E4W A;  3DGQ A;  3CU3 A;  3FGY A;  2KCD A;  3CCL 3;  1ZZY A;  1B4P A;  1A24 A;  1FGO A;  1BAN A;  1BNJ A;  4OFM A;  1UW1 A;  2VLT A;  1A2V A;  4XRD A;  2W9P A;  4EIP A;  4KCA A;  1G02 A;  4TXV A;  3P90 A;  4NRE A;  2YFL B;  4MDC A;  3ZFL A;  4PTS A;  2FA4 A;  1S3A A;  2C4J A;  1GTB A;  4Q5N A;  3SYU A;  5C04 A;  5HFI A;  3RHB A;  1LXE A;  2FWH A;  4K1U A;  4XS1 A;  1G7O A;  2ON5 A;  1J0F A;  1ZS7 A;  2HRN A;  1A2K A;  5ABR A;  3IK7 A;  5IG5 A;  4BVY A;  4ML1 A;  1OHP A;  3CCU 3;  1M2A A;  2OAC A;  4N11 A;  2CA8 A;  1A23 A;  1RRL A;  3TOT A;  3OW2 2;  3PGT A;  1DUG A;  3PPU A;  2H1A A;  2BIR A;  1GS3 A;  5LC6 A;  1WMN A;  2MF7 A;  3DGL A;  2CZ2 A;  4K5R A;  3X42 A;  3V1W A;  3EIN A;  2O87 A;  4ZL7 A;  5IO0 A;  2I4A A;  3EQQ B;  1S72 3;  1QFN A;  1PU4 A;  1GMQ A;  3QR6 A;  1DET A;  2HLS A;  4MNN A;  6GSV A;  3ERG A;  3FR6 A;  1YGW A;  1OUN A;  3ZL5 A;  3S5C A;  3TJK A;  2STD A;  1GSY A;  1XWG A;  1Q82 4;  3KP8 A;  3BOA A;  5IG0 A;  2DSA A;  4HJL B;  5ECR B;  1AQZ A;  1NB3 I;  1K28 A;  4MH2 A;  1SII A;  3AGN A;  4I6X A;  2GS3 A;  3M1G A;  2DKI A;  2P5R A;  4BVX A;  1GL8 A;  3LH4 A;  2YV7 A;  1W02 A;  1O7G B;  2B5Y A;  2C0F A;  4BWS A;  3NBR A;  5AII A;  1TDI A;  3T8N A;  3TKR A;  2ZA4 A;  4YQV A;  5D73 A;  5KOX A;  5ELU A;  1KQS 2;  3TKQ A;  4O8S A;  5IW9 A;  2L57 A;  2GZY A;  2M46 A;  4ZL8 A;  1TRP A;  1EOH A;  6GSY A;  1IVW A;  1BSA A;  5A0O B;  2H30 A;  3GYK A;  2R4I A;  1TXX A;  2CFL A;  2XR8 B;  2F9S A;  1D6Y A;  3LT9 A;  4FMD A;  1N5H A;  3ZFB A;  2XSH B;  1G96 A;  4H61 A;  1V2A A;  1UC7 A;  4POB A;  5KEJ A;  2RUF A;  1KWI A;  4LEH A;  3C1S A;  3WOF B;  3N8B A;  3HA9 A;  3N9H A;  5BIR A;  2EIO A;  2NTO A;  1E6B A;  3B4P A;  2LEG A;  4KFE A;  3ISO A;  1XWA A;  2KF4 A;  1HKX A;  5IEO A;  4GHO A;  2JAC A;  3E9J B;  4IQ1 A;  1HD2 A;  2X8G A;  1WTH A;  2VOC A;  1LOX A;  1MD3 A;  2H1G A;  2L4Q A;  1BU4 A;  3BNE A;  1X0R A;  3FF2 A;  4FCJ A;  3MWZ A;  2P38 A;  3DXB A;  3UMA A;  1TK0 B;  4HKV B;  4ECB A;  2GQK A;  3N54 B;  1XPV A;  2D2Z A;  4MMM A;  4N0V A;  1XCC A;  3ME7 A;  3GWR A;  1YEP A;  5D81 A;  5AN1 A;  4GQF A;  4ICY A;  5H5Q A;  4I97 A;  3BLZ A;  4POK A;  1X1U A;  3GN3 A;  2OQE C;  2KUC A;  3EUR A;  4N6N B;  4IN0 A;  2Z7A A;  3ROB A;  4E8E A;  2CG0 A;  1D6U A;  4BL3 A;  4CCV A;  2C0E A;  1V74 A;  2LJR A;  2WCI A;  4LL4 B;  1BSB A;  2G2Q A;  3GV1 A;  6GSS A;  5JBS A;  3WT2 A;  2ZNM A;  1DBY A;  3FHK A;  2P0X A;  5ECH B;  1TTO A;  1M3J A;  3S67 A;  5J4U A;  2P0G A;  2L4V A;  1VQQ A;  1R7H A;  4X2O A;  4NMU A;  2L6D A;  4XS6 A;  1IVV A;  1GNW A;  2VD0 A;  5DAL A;  2DML A;  2PGT A;  3EHC A;  3WOE B;  2CK3 H;  4BIR A;  5D9W A;  4NV2 A;  9GSS A;  5J41 A;  7GSS A;  4HM6 B;  3WMD A;  1SJZ A;  1PD2 1;  1Y25 A;  5HR0 A;  3PYJ A;  4LMW A;  3LYG A;  4R4K A;  4WP5 A;  2CX3 A;  1BRK A;  2XBI A;  4ZM8 A;  14GS A;  3H3H A;  5M18 A;  4G9H A;  2OTJ 3;  5HR1 A;  4PQI A;  3ZVJ A;  1UDI I;  4WR5 A;  1M2D A;  1K73 4;  1V58 A;  1KD1 4;  4AJ8 A;  4QQ7 A;  3DGO A;  2I9H A;  1BRG A;  1T8E B;  3CBU A;  3GRX A;  5BXQ A;  4HM5 B;  5FWG A;  3VFI A;  4QL9 A;  2YN1 A;  5EVH A;  1Q81 4;  4IJI A;  4AEQ A;  3HJP A;  5INY A;  1A2M A;  3WGE A;  1XG8 A;  2C11 A;  2M80 A;  4ID0 A;  4RI7 A;  1O7U A;  2GBW B;  1YIT 3;  1YDK A;  5DCG A;  3LYP A;  1G6W A;  1IYI A;  3U5R E;  1VQ7 3;  1DE2 A;  2CFK A;  3HII A;  2HRF A;  2E0Q A;  4O5R A;  3IAS 2;  2VL3 A;  1BED A;  1NB5 I;  2GSQ A;  1QJG A;  5F8B A;  2WUL A;  3NV0 B;  4PX1 A;  1I3F A;  3CQF A;  8GSS A;  3CC2 3;  5DBQ A;  3NUV A;  1SIH A;  1OCV A;  2QEX 3;  1EEJ A;  1E97 A;  4J5G A;  2XSO B;  2DJ3 A;  1Z3E A;  3GFK A;  2JZT A;  1E3V A;  1CYV A;  1NWW A;  2CVK A;  4GXZ A;  4JBB A;  3V99 A;  2XF3 A;  1U3A A;  3A5E A;  1A2J A;  1XOB A;  1GSF A;  1OGZ A;  1GUL A;  1BSD A;  1TRW A;  1ZGN A;  1MDJ A;  3ZTL A;  1N9E A;  1O85 A;  2R41 A;  3JUP A;  1RHL A;  3D79 A;  1EA2 A;  5DRV A;  4PQ1 A;  4G19 A;  2H19 A;  3HDC A;  2WDU A;  5ECI B;  4GB5 A;  4IGJ A;  1A0F A;  4U13 A;  3L9U A;  3R2Q A;  3CXC 2;  3VF1 A;  2OAD A;  2IWT A;  2GSP A;  2F56 A;  5ID2 B;  1DE1 A;  2VIM A;  2YWM A;  2FWG A;  1SQW A;  1GUK A;  3TKP A;  1F6M C;  4OCE A;  2LYX A;  2J9H A;  2X8H A;  2LQV A;  3G7Y A;  3CCJ 3;  2HSY A;  4HBR A;  4WET A;  2W04 A;  2XGN A;  1A8L A;  2E2U A;  2CFD A;  1KEB A;  2AAW A;  4RQX A;  3NM7 A;  4MEI A;  1SYX A;  1W7C A;  4FCM A;  3H4K A;  1Q7Y 4;  3Q74 A;  5CRE A;  5KN3 A;  2Y74 A;  1B2U A;  1ZYE A;  4ZB9 A;  1JBR A;  4F03 A;  2QKE A;  1Y6E A;  2YV9 A;  1KNG A;  4WR4 A;  1W89 A;  1VQ6 3;  3C7M A;  2PN8 A;  3BND A;  2O7K A;  5BU4 A;  4MK3 A;  3UAP A;  3OXA A;  1L5G B;  4GLT A;  2IMD A;  4AKY A;  2FWF A;  4HM0 B;  1EKM A;  1MWT A;  5JWQ B;  1W01 A;  1PL1 A;  1OHS A;  3GH6 A;  1EZK A;  5CO3 A;  3IMA B;  1F2E A;  4MF6 A;  2VCX A;  1DVD A;  3KSE D;  5LD0 A;  1DYU A;  5ID2 A;  2WGQ A;  2H72 A;  1SK1 A;  3BCK A;  3GL3 A;  1MDI A;  3CCQ 3;  2CQ9 A;  3GH9 A;  1B2Z A;  3LT8 A;  1NJI 4;  2YAN A;  1B21 A;  4USS A;  1ST9 A;  3GKK A;  3SED A;  2PMT A;  6STD A;  1EV4 A;  2F8A A;  1TK5 B;  1FW1 A;  5D93 A;  3L9S A;  5ECL B;  3TGZ A;  4ACS A;  5JWO B;  4GCI A;  1XWC A;  2KP2 A;  2KF5 A;  1IU7 A;  2LST A;  3HKR A;  3UBK A;  3KXO A;  3MAK A;  3GSP A;  1PKZ A;  2O9U X;  3IHQ A;  1M2B A;  3ZZX A;  1HNC A;  4EKZ A;  2OBI A;  3JUQ A;  2X49 A;  4I5Q A;  3EU4 A;  1O7H B;  3Q19 A;  1EV9 A;  2FUG 2;  1Z7R A;  3X3X A;  5CRD A;  1RGL A;  1SJI A;  1GD4 A;  3UJ1 A;  4DSS B;  4IQA A;  1KTE A;  1PRX A;  1SL2 B;  1XW5 A;  1FUS A;  1RNT A;  4HI7 A;  4XCS A;  3G0K A;  2FHE A;  3KP9 A;  1JLV A;  2C10 A;  3B8L A;  3EVI A;  1LJR A;  3UBL A;  3QD9 A;  4EV2 A;  3FRC A;  1ZO2 A;  3LZA A;  5B6N A;  4PXO A;  5J9B A;  3PCS A;  3GZR A;  3WR2 A;  2FD3 A;  3ME8 A;  2XPE A;  2PVO C;  3GZY B;  2LKU A;  2A2S A;  1O7P B;  2L5L A;  1BNE A;  1QVF 2;  4V2N A;  3IPT A;  1IK3 A;  1O73 A;  5G30 A;  3NZN A;  4IHU A;  1Z9H A;  3KJY A;  3ZYW A;  1J9B A;  1JB4 A;  5KOW A;  1QAK A;  1WPI A;  4LLR A;  2HMK B;  1XVQ A;  1K0O A;  3IJE B;  4NHF A;  3IXR A;  4XDV A;  1YF0 A;  3LW9 A;  4I2T A;  3A5W A;  5AGY A;  4BWQ A;  1T1V A;  1TRV A;  2B1L A;  2DIY A;  4HM7 B;  4MZB A;  4POL A;  2WOH A;  1BRJ A;  2PVQ A;  1GLQ A;  5DAK B;  1SD8 A;  5CK6 A;  2LQQ A;  4V1A g;  1A67 A;  3DY5 A;  2CWT A;  4OUQ A;  2AHE A;  1ZX2 A;  1K8A 4;  1BRH A;  4O2H A;  3J7Y b;  1HU9 A;  1OGX A;  1SK0 A;  2LJA A;  5GSS A;  1ML6 A;  3PH9 A;  2LTK A;  2V2G A;  1B4Q A;  4Q53 A;  4V1A p;  4OK0 A;  4L0U A;  4K8M A;  4N6M A;  3IC4 A;  9RNT A;  5LNK e;  2JZS A;  1T2I A;  3WD6 A;  2GTU A;  1R4Y A;  2JU5 A;  4XS4 B;  1F8N A;  1WOU A;  2C3N A;  1K0C A;  1JB5 A;  1QAL A;  1RJO A;  2H8L A;  2K6V A;  2J23 A;  3ZMK A;  4TN8 A;  1IVU A;  4O5U A;  5M1A A;  2JQ5 A;  2I1U A;  1X1Y A;  4IJ3 A;  2DJ0 A;  1O8W A;  3GNJ A;  4CPK A;  1HYU A;  1N8Q A;  3ER7 A;  3D4A A;  1FGM A;  1CEW I;  1O7W B;  1RGK A;  2K54 A;  4GL6 A;  1Q42 A;  2VO4 A;  3CNM A;  3I56 3;  3ALA A;  4BL7 B;  3CNX A;  1NW2 A;  4TVE A;  2CHC A;  5IG3 A;  2WS2 A;  2V1L A;  3ERF A;  1OKD A;  3MSO A;  1GOV A;  2A2R A;  3HI7 A;  5IOW A;  2CFW A;  4WHA A;  3JUM A;  1LQG C;  4DSQ A;  3D5I A;  1DVC A;  3OX9 A;  2O8V B;  3K8N A;  1GY7 A;  2SAR A;  1Q40 A;  3IK9 A;  2UX0 A;  1BSE A;  4FCZ A;  3HCZ A;  2R3X A;  3NBB A;  1TIJ A;  4NV5 A;  1GY6 A;  2K9F A;  2IY2 A;  5D8I A;  4WBR D;  4FH8 A;  1FUT A;  1HNB A;  3Q1C A;  3EE2 A;  2CX0 A;  2HMM B;  5G2Z A;  3CPW 2;  2UGI A;  4BVY B;  2IUK A;  4HJM A;  3UVT A;  3DM8 A;  1N9J A;  1EUI C;  3DWV A;  1YNV X;  3U6V A;  4OVM A;  3VI5 A;  1YJ9 3;  2HXK A;  4KND A;  3PGB A;  1X1W A;  3VI7 A;  3DIE A;  1C54 A;  4JF8 A;  3C73 A;  3JUO A;  4MP4 A;  3IDV A;  2HML B;  5EPF A;  1RN1 A;  1O81 A;  4K0N A;  3VWV A;  2MC8 A;  3LSZ A;  4JRF A;  3CC4 3;  2IPA A;  4JR6 A;  3NQY A;  1WMP A;  1SKR B;  3NIV A;  2X4A A;  3N9J A;  4OD7 A;  2CX1 A;  4BL7 A;  2X99 A;  4MF7 A;  4GF0 A;  1MGR A;  3HXS A;  4YKF A;  1B27 A;  4Q5Q A;  5A4V A;  2BHM A;  1YJW 3;  3TCO A;  1OHO A;  2FWE A;  3CME 3;  1QK8 A;  2KF3 A;  2PPT A;  2DIZ A;  4AGS A;  3DVW A;  2PNC A;  4HUA A;  2RM6 A;  2OOV C;  1GNE A;  1WWJ A;  4BVX B;  1GOY A;  1NM3 A;  2L1S A;  1FYS A;  1UCI A;  3STD A;  1T4Z A;  3QFB C;  4GRF A;  2CZ3 A;  3QRD A;  4HM2 B;  2HI7 A;  4HSC X;  5IMF A;  2JAD A;  1BAO A;  2H71 A;  2GDR A;  1RGE A;  4X4J A;  1M3I A;  4MJA A;  2BMX A;  1XW6 A;  3KN4 A;  2NBS A;  4WEY A;  2EC4 A;  2GEX A;  1Q9E A;  2LRN A;  2BMO B;  1YI2 3;  1NO3 A;  4ILF A;  1GP1 A;  2FLS A;  3KD0 A;  4TXO A;  3BBY A;  3HIG A;  4G0K A;  4TR4 A;  3FSD A;  3ZIJ A;  1UGI A;  4NPB A;  1LOW A;  3L4N A;  2DJK A;  4BTW A;  3EN1 B;  3KM6 A;  2TRX A;  3V98 A;  2YP6 A;  4X1U A;  3TRP A;  4HOH A;  4JR4 A;  1OAZ A;  3KCM A;  1W2Z A;  2F86 B;  4FYB A;  2F98 A;  1N8R 4;  2ZCT A;  1GYB A;  1GWC A;  1ASK A;  3X40 A;  1MWU A;  2C3T A;  1J2B A;  1JBS A;  3APQ A;  2YZH A;  4JU5 A;  2Z76 A;  1G7E A;  1JN5 B;  3D9R A;  1YVB I;  1YY7 A;  4G0I A;  3Q18 A;  1VQ8 3;  5DRE A;  3QOU A;  17GS A;  3P7X A;  3Q90 A;  1JJ2 2;  3EPT A;  2DJ2 A;  1AC1 A;  1IT8 A;  3A76 A;  2XPD A;  1PX7 A;  4IP6 A;  4NHZ A;  3NXJ A;  2B3S A;  1MOL A;  3LTB A;  4RBN A;  1W6G A;  2F4Y A;  1B2M A;  3GKX A;  1UGH I;  3UOM A;  4HM8 B;  2XC2 A;  1YKC A;  1AQV A;  1ULI B;  2H73 A;  2BO9 B;  2O89 A;  3KZT A;  3CMA 3;  2N5F A;  1BIR A;  2AB6 A;  5IG4 A;  2ALB A;  2VCZ A;  2ZDJ A;  4FYU A;  3RAZ A;  1YF1 A;  1G0T A;  5HOH A;  3G7I A;  3F63 A;  3X3Z A;  3HOH A;  4EUY A;  4KCE A;  4XHM A;  4CDL A;  2HSH A;  1Z6N A;  4N6V 0;  2HMN B;  1K9M 4;  2W0Q A;  4EVM A;  1T5Y A;  3GX0 A;  2OOV A;  3I69 A;  5DAL B;  4BL2 A;  2BU4 A;  1PFP A;  4F2I A;  5HGR A;  1JV2 B;  3HVN A;  1K0N A;  1JN5 A;  2CT6 A;  4XM4 A;  5EY6 A;  4WF5 A;  3DGN A;  2HMJ B;  3ZFZ A;  4LZI A;  5BVB A;  4CW9 A;  1THO A;  4TRX A;  2RGQ A;  1QMA A;  1TP9 A;  1X9W B;  3C1R A;  4GTU A;  5ELA A;  2H1D A;  2CVB A;  3FEU A;  1M9A A;  1ZGX A;  5G1L A;  4EV5 A;  3VWU A;  1TTZ A;  5CAX A;  4QWT A;  2OWP A;  3I43 A;  4OCF A;  4OFN A;  5GAN D;  3MG2 A;  1TU7 A;  5RNT A;  1NU3 A;  1F3B A;  2CX4 A;  3J7Y k;  3K7C A;  3PS8 A;  1XIY A;  2RII A;  1VF2 A;  1K0M A;  1BNR A;  5BRT A;  4EIQ A;  5B6M A;  4NAX A;  1E2Y A;  5EL8 A;  4X2H A;  1ERW A;  4K1F A;  22GS A;  1LOV A;  4J56 E;  2OA7 A;  3CCM 3;  5GST A;  3ZIV A;  5CP1 A;  3PR8 A;  4FQU A;  4D73 A;  2VAF A;  3MNG A;  3EF8 A;  2H6Z A;  2H01 A;  4KDU A;  1HNA A;  3LTC A;  1ISK A;  4LMV A;  3TJF A;  1F3A A;  2WZ9 A;  5CRH A;  3O6T A;  1A2L A;  4MAB A;  1SL1 B;  3LTD A;  4HM1 B;  2HNL A;  3HZ4 A;  4K9Z A;  3PIN A;  1VQM 3;  1QGV A;  4ZXG A;  2E2V A;  1O8X A;  1ABA A;  1N2A A;  3F14 A;  2WFC A;  1CH0 A;  4HZ9 B;  2IYJ A;  4Z7X A;  3K0Z A;  3LXU X;  1PSQ A;  3DD3 A;  1DMM A;  2LRC A;  3FLJ A;  4PQH A;  5B8A A;  2YFJ B;  4IEL A;  2WGR A;  3C8E A;  5JWR B;  3MIX A;  4MCU A;  1BVI A;  5A4W A;  3OR5 A;  2C80 A;  1LBK A;  2RBI A;  2LJK A;  4XTS A;  1UCK A;  2GZZ A;  2MBT A;  4YAV A;  3DEX A;  2NDO A;  2TRC P;  3ZLP A;  4EDY A;  1I8V A;  6GST A;  1ROA A;  1AQX A;  3I55 3;  2R0C A;  4CY6 A;  1FW7 A;  4GWR A;  3HVV A;  1H4O A;  2CIU A;  2Z6B A;  2HOH A;  4LA1 A;  1SAR A;  3WT1 A;  1ZOF A;  3BCI A;  2VM2 A;  2DBC A;  1AAZ A;  2DC5 A;  2VCV A;  4F0B A;  3DZL A;  2KLX A;  1S3R A;  1JBT A;  1OE7 A;  1X9M B;  3F9U A;  1VRS D;  4JE1 A;  1MEK A;  1Q7H A;  5BMU A;  1WMO A;  5AEW B;  1BNG A;  1ZCP A;  2W03 A;  3N5O A;  1AUC A;  4EXR A;  1V98 A;  3T0U A;  1ZYP A;  5DQY A;  1FAA A;  4K1V A;  1OC3 A;  1AVL A;  4MJC A;  1S3D A;  4XB5 A;  2B7K A;  2V6K A;  3UL6 A;  1H75 A;  4ZBB A;  4AF2 A;  2LV3 A;  1FVK A;  1I0V A;  13GS A;  4MJE A;  1V40 A;  2XBQ A;  3HJO A;  1M1K 4;  2R0P A;  2QGV A;  4MH3 A;  1VQ4 3;  4ZIL A;  3EC9 A;  3R3E A;  2WB9 A;  4MPF A;  3GTU B;  1N5P A;  3Q6O A;  3U1W A;  3KMO A;  2Z77 A;  2IIY A;  2R37 A;  5KP4 A;  3LML A;  4H3U A;  3ERW A;  3GA4 A;  2FGX A;  3O3T A;  3UAR A;  3LTA A;  3FG4 A;  2OCT A;  2V6O A;  4HZ4 A;  1E3R A;  4RNT A;  2YJH A;  4L0W A;  1VF4 A;  4FR9 A;  3RHC A;  1OAC A;  2P5Q A;  1S5A A;  1IVX A;  2JDI H;  2IMK A;  2L59 A;  3ZVJ D;  2KRT A;  4HJ2 A;  2K8S A;  2YZU A;  2LNS A;  3KE7 A;  1GSD A;  4EBG A;  2HZF A;  3B7C A;  1RQM A;  2C4B A;  1NDO B;  2DKH A;  1HQO A;  3HZ8 A;  4IVF A;  1EWX A;  3WHO A;  1EQK A;  2N5A A;  4ZB8 A;  3VPT A;  2INX A;  5IEP A;  3KGK A;  2LUS A;  1DE3 A;  1I2G A;  1LRA A;  2B1K A;  4Z2U A;  3Q3F A;  5DDL A;  3WGX A;  3EMX A;  3KIJ A;  3TOU A;  1XXU A;  5EVO A;  2E2G A;  3FY7 A;  2AJQ B;  3AMO A;  1B9Y C;  2R5G A;  1YIJ 3;  3GTU A;  2YX9 A;  4NXI A;  3APS A;  1VF3 A;  1TU8 A;  5AEU B;  1RNB A;  1AIU A;  2H66 A;  4ULX A;  2WGO A;  3OV4 A;  1SU9 A;  2EIQ A;  1YJ6 A;  4IBP A;  3KTB A;  4STD A;  1WQL B;  1U3I A;  3EWL A;  1BRS A;  3KKG A;  4R9L A;  1TW9 A;  3CTG A;  4Z2R A;  2F3M A;  1FB0 A;  1BYE A;  1B9X C;  3CD6 3;  1K0A A;  3E99 A;  1JZW A;  4K2D A;  2CG1 A;  3O8Y A;  4MMY B;  3P2A A;  2BJX A;  4AKZ A;  3F6D A;  3QMX A;  3CMI A;  3FMW A;  3CCR 3;  5ELJ A;  4GSN A;  1U5O A;  3F4R A;  3FZ4 A;  1OKT A;  1B3S A;  4LYL B;  2OE1 A;  4CHS A;  1RGH A;  1SEN A;  2XHF A;  1R4W A;  5IM9 A;  1UUV B;  3QCP A;  2REM A;  4WXT A;  1ON4 A;  3FG3 A;  1RRH A;  3F8H A;  3UEM A;  3S27 A;  2R2J A;  5CLK A;  3MYT A;  3K9M C;  2RM5 A;  2KF6 A;  2ON7 A;  1TRQ A;  3BB9 A;  3DGM A;  1IYY A;  4X0X A;  1M1X B;  5F0G A;  3IAM 2;  5ECK B;  5D83 A;  3TKS C;  1MGW A;  1JB2 A;  5CRW A;  1SJ6 A;  3LWA A;  3QFA C;  2YPM A;  4K6X A;  4PGT A;  3CSI A;  3GKN A;  2SBL A;  2OTL 3;  4O5Q A;  1C72 A;  1FA3 A;  1RW1 A;  2X64 A;  2W56 A;  1VQL 3;  4NHW A;  1Z6M A;  2P31 A;  3HYP A;  4EF0 A;  2G0F A;  4EE0 A;  4PNF A;  2MYG A;  2XH9 A;  5ELG A;  2N5B A;  2LNT A;  4KSO A;  4ZBD A;  3LYK A;  4ECJ A;  4BA7 A;  4ISD A;  4FMC A;  1LQM B;  2V1M A;  3D4M A;  3QK9 A;  5ECQ B;  2ZL8 A;  5I97 A;  1B20 A;  3NQZ A;  1YGE A;  4BTX A;  4I2U A;  1ZL9 A;  5D9X A;  4DVC A;  2WO0 A;  5G5F A;  5CF1 A;  5STD A;  2H0H A;  3HZP A;  2IN3 A;  3E0U A;  3UJM A;  6RNT A;  4AJ7 A;  12GS A;  3S9F A;  4MF5 A;  3ECF A;  1EP7 A;  3A2X A;  1FO5 A;  3HY2 A;  3RDW A;  1RGA A;  3JCM L;  3IRA A;  3HJM A;  5M19 A;  3UL3 A;  3KH9 A;  2FNQ A;  1M7T A;  1ROV A;  3KCH A;  2H0I A;  3TUE A;  1OF5 A;  3HVX A;  1TFO A;  1GMP A;  1AV4 A;  3URP A;  5IPH A;  3MSZ A;  1GOU A;  1WE0 A;  1Q40 B;  1ERV A;  4KFF A;  1TP6 A;  2RCD A;  5JPP A;  4R9K A;  2QIY A;  2CFG A;  3I9V 2;  4TR1 A;  4I8B A;  1R26 A;  1BAY A;  2B6M A;  3VLN A;  2PZV A;  2ML6 A;  5CYY A;  3IOS A;  3MG1 A;  4XDW A;  1RGG A;  1AY7 A;  3G71 3;  2E2M A;  3EYT A;  3H8Q A;  2RSX A;  1TU5 A;  4IW9 A;  4LL1 B;  2YOI A;  1OC9 A;  4POM A;  3EE1 A;  2K8V A;  4N6U A;  1X5E A;  3KH7 A;  3LXT A;  2A4V A;  6GSU A;  4YH2 A;  2RLI A;  4WKW A;  10GS A;  1TRU A;  5HQP A;  5AIG A;  3IR4 A;  1SL0 B;  2GQM A;  4HS1 A;  2PBJ A;  3DKS A;  1SPU A;  2VCT A;  1LU4 A;  2BMR B;  5KP3 A;  1Q86 4;  5C00 A;  1RKY A;  2CAQ A;  3M3M A;  4PUR A;  4ZL9 A;  1GSU A;  1JNQ A;  2IMF A;  1IDP A;  5IOX A;  3HX8 A;  3NBJ A;  2HRK A;  3A2W A;  2FGT A;  3M0F A;  4RQR A;  4KE3 A;  2GZP A;  3TKS A;  1M9G A;  5IQY A;  4K61 A;  5FHI A;  3D4T A;  2LRT A;  4PNG A;  1K0D A;  3UNL A;  1X1X A;  3F8X A;  1FUW A;  2CWV A;  3MWH A;  4KF9 A;  3GST A;  5HR2 A;  4CJN A;  1IQX A;  1B2S A;  1BRN L;  2PWJ A;  5IO2 A;  1QXH A;  3GUR A;  1TK8 B;  2HMO B;  3BJ5 A;  4KVH A;  1K0B A;  2L6C A;  5IMA A;  1UI8 A;  1PX6 A;  4J9A A;  4OFT A;  4RUV A;  5E59 A;  4J2F A;  2MBS A;  2XGL A;  3HK4 A;  2I81 A;  1ZYQ B;  3W8S A;  3S29 A;  3CC7 3;  2F99 A;  2B24 B;  1F9M A;  4XBY A;  3ZG5 A;  2F8F A;  1WJK A;  2IFQ A;  2VD1 A;  4JED A;  5J9C A;  1FOH A;  2JSY A;  3F6F A;  3W6G A;  1XZO A;  2YWN A;  3X3Y A;  2HE3 A;  1I3I A;  3TB2 A;  2K18 A;  4R80 A;  1RSN A;  2V32 A;  4HEA 2;  3CYN A;  16GS A;  3L9V A;  1YZX A;  4TXO B;  8CHO A;  2YNX A;  5H5S A;  4TR3 A;  3QAG A;  2I9W A;  2Y73 A;  1EP8 A;  1TKD B;  1B2X A;  3GRD A;  4PUF C;  4TW5 A;  3IHG A;  1RGC A;  3UIW A;  1VGL A;  1GSP A;  5TGN A;  3HVS A;  5ENU A;  1U87 A;  6GSP A;  1OYJ A;  2H74 A;  3D0Z A;  1B8X A;  3D6I A;  3LGC A;  5A5K A;  2H75 A;  3WOD G;  4Q5F A;  3NHX A;  4ECI A;  1FGQ A;  2AYT A;  4G10 A;  1J08 A;  3H93 A;  3A2V A;  1VZZ A;  2H6X A;  4KZ1 A;  5L71 A;  5LC7 A;  1RDS A;  1TJD A;  2QGU A;  4KDY A;  2B1X B;  3F7S A;  3EX9 A;  2IJY A;  1LNH A;  2VCQ A;  3NOF A;  1R4C A;  4K0G A;  4I4K A;  5IF6 A;  2AUV A;  2C0D A;  1I70 A;  4N3V A;  1C7H A;  2BMQ B;  4WYK B;  8RNT A;  1FG4 A;  2XFS A;  3LOY A;  5CF2 A;  2H1B A;  2YWI A;  3WYW A;  3CPO A;  2GST A;  11GS A;  1MDK A;  2P05 A;  2E7P A;  1LNI A;  2I3Y A;  1EGR A;  4WWU C;  2D42 A;  4GQC A;  1SK2 A;  1GH2 A;  4QL7 A;  4L5O A;  1UUW B;  1BQ7 A;  2GU3 A;  4MMZ B;  4F82 A;  4BIK A;  2AAE A;  2VL2 A;  3PXM A;  3VWW A;  19GS A;  4E8H A;  5JCW A;  4CDO A;  1JFU A;  1FOV A;  3K5T A;  1JZO A;  2GVP A;  2QSI A;  3SLU A;  3DVX A;  3QAV A;  2UUG C;  3VPQ A;  4DEJ A;  4FYC A;  1ACV A;  5G31 A;  3IBH A;  3I0Y A;  4HU7 A;  1PN0 A;  4HVN A;  4ECC A;  3D22 A;  2MMA A;  4KX4 A;  3RGA A;  1Q4J A;  1G6Y A;  4YKG A;  3PCR A;  2H6Y A;  3H1N A;  1VQ9 3;  2F5W A;  3UB1 A;  1OC8 A;  1RGF A;  2LQO A;  3JUN A;  1AXD A;  4V2L A;  3FG1 A;  4L8P A;  2PU9 C;  2LS5 A;  4AJ6 A;  3GZB A;  5D96 A;  1TFK A;  3KSP A;  3RNT A;  1BUQ A;  2F5M A;  4WYK A;  4DSR A;  4MA9 A;  5D9V A;  2OJL A;  1M0U A;  2HRA A;  4N10 A;  2DJJ A;  2VL9 A;  5B7C A;  1JKG B;  2CAI A;  4D73 B;  3QPM A;  3A5I A;  1STD A;  2CKF B;  1T00 A;  2KAA A;  4RZM A;  3S28 A;  4HDE A;  2BT3 A;  2GLR A;  5DJL A;  1Z5Y E;  3D21 A;  3BNC A;  5KN1 A;  5AIX A;  1JZR A;  1NHY A;  3GZX B;  1W4V A;  5D82 A;  1Y4K A;  3G8Z A;  2HSM A;  1BRI A;  1LVN A;  5KN0 A;  3X41 A;  5J3R A;  4GSS A;  3H51 A;  3C71 A;  4FO5 A;  3TDG A;  1M99 A;  1URM A;  1PGT A;  4KT3 B;  2MMO A;  3NX0 A;  2FCH A;  2VCW A;  2W6J H;  1GTI A;  3GMF A;  4WBJ A;  2RNT A;  4HYZ A;  2W9Q A;  4BPY A;  2ES7 A;  1MD4 A;  1A90 A;  2QA1 A;  1YVS A;  1PKW A;  4XRA A;  3TRX A;  2YCD A;  5HR3 A;  1FGT A;  1AW9 A;  5AIH A;  2IMI A;  2Z9S A;  1ULJ B;  1ILO A;  1O6J A;  1GY5 A;  1EG9 B;  5GSP A;  2K0M A;  1D6Z A;  2AAD A;  2NPB A;  2KP1 A;  1ERT A;  1SYR A;  1JKG A;  3FYG A;  2V41 A;  2D1W A;  3CTF A;  1CYU A;  1M9B A;  1T4Y A;  2EIR A;  3GIX A;  1RN7 A;  3GL5 A;  1TUH A;  3ZML A;  3HD5 A;  2VLU A;  3TJG A;  2GU1 A;  5FW5 A;  5AIS A;  3ZIT A;  2J8X B;  2P0M A;  4KB3 A;  1W4N A;  1GD3 A;  1QAF A;  1U8C B;  1OH0 A;  1IYH A;  3L0R A;  1X9S B;  3FH1 A;  1RK4 A;  1JLW A;  5CNW A;  4IS0 A;  4RI6 A;  5IIZ A;  1GSQ A;  5H5R A;  3D5G A;  5F06 A;  3OWS A;  1CQG A;  3ZG0 A;  4O32 A;  3BD2 A;  2KOK A;  4EO3 A;  1MTC A;  1QUW A;  3KFQ C;  3K63 A;  5F07 A;  3LG6 A;  3KII A;  3VUR A;  1K3L A;  1AR0 A;  1PL2 A;  1WMJ A;  5ECN B;  1GSE A;  2GT6 A;  4KDX A;  2A2P A;  1SKW B;  3L78 A;  3BU4 A;  2W2C A;  4X43 A;  4Z2T A;  2RUE A;  1O7M B;  4ZB6 A;  1TI3 A;  4KH7 A;  3DMC A;  2M72 A;  1FZU A;  1SJW A;  2BNG A;  3GX8 A;  3LXZ A;  1B48 A;  1R5A A;  3M8C A;  4L8E A;  2K3D A;  4HQZ A;  5GZZ B;  4XIH A;  4MMX B;  3FZ9 A;  1AQW A;  2FXT A;  3F3Q A;  3ZRE A;  2H76 A;  5J5N A;  3F3R A;  5LCZ A;  2FNO A;  3OWU A;  2A15 A;  4G0L A;  1XWB A;  5JPU A;  2DMM A;  4KSM A;  2R4V A;  5ECM B;  4LGQ A;  1OPY A;  1XFL A;  5CRG A;  2CV4 A;  2UZ8 A;  3P8W A;  4ZBA A;  3VGN A;  5EQL A;  1NNV A;  1N8J A;  3IV4 A;  5DJM A;  3F9S A;  1U88 A;  3TJB A;  4N6O B;  3W8J A;  1UUG B;  3VSY A;  1EEM A;  3VK9 A;  7GSP A;  4RNZ A;  4TX4 A;  3F0I A;  1VQ5 3;  4OWY A;  4BTY A;  3AMO B;  3TKS E;  2GQL A;  2QA2 A;  3FZW A;  3U97 A;  2H70 A;  1PN9 A;  1SKS B;  4N6T A;  3SOA A;  3I6A A;  1A0R P;  1GTU A;  1YEX A;  1KC8 4;  1T2H A;  3GUS A;  3F4T A;  5EEO A;  1GUM A;  1YKA A;  3DRN A;  2WOF A;  5FT3 A;  5IMD A;  4RNY A;  2IL3 A;  5JCG A;  4XBX A;  2RFR A;  1GMR A;  4L8O A;  4MZC A;  5HFG A;  3RPP A;  2CWU A;  3RGR A;  1IV7 A;  2IUJ A;  4HZ2 A;  2OQE A;  4YAP A;  1STF I;  1PYL A;  2CC3 A;  2VM1 A;  1W5Z A;  2YFI B;  1V9W A;  1XBS A;  4HQS A;  4O7H A;  1UCL A;  1IT7 A;  6GSW A;  5AYS C;  1VF1 A;  2NVL A;  2PUK C;  4IT7 A;  2YJ7 A;  2TIR A;  4EL1 A;  1RMS A;  4EDZ A;  7STD A;  4O92 A;  3MKI A;  3PZW A;  1PMT A;  1K41 A;  1R5P A;  4HM3 B;  2C0G A;  5AYR B;  2E2T A;  2WRT A;  4HOJ A;  3NM2 A;  3JVC A;  1IV9 A;  5ECO B;  1BNF A;  3LEF A;  1BNI A;  2GGT A;  1Z7P A;  3NV0 A;  3MDK A;  3OWY A;  4YQM A;  4O3V A;  1QMV A;  2DLX A;  3CRT A;  1VQN 3;  1GTA A;  3FKF A;  5COH A;  2L4C A;  3APO A;  1OE8 A;  1UN2 A;  3MHE A;  4MPG A;  1BNS A;  3FZ5 A;  1A8Y A;  4F0C A;  1XW9 A;  5G5E A;  4GSP A;  3CCE 3;  3FR3 A;  3AGO A;  4LMI A;  1BJX A;  3G9B A;  3DXO A;  3D5J A;  5JCU A;  2GSR A;  1RCK A;  1THX A;  1Q98 A;  1Z1S A;  1GUH A;  3M8N A;  1UA5 A;  2ZHX B;  4J57 E;  1PFO A;  2W56 B;  1K3Y A;  4EC6 A;  3RPN A;  4R1K A;  1NSW A;  4L7K A;  2F51 A;  1IQ8 A;  2YWO A;  4OMV A;  5B8B A;  3RDE A;  1BG5 A;  3A3T A;  4K7I A;  3GKM A;  3M9K A;  3EN8 A;  4FMA A;  4K2X A;  3B4O A;  1OVN A;  2XRX B;  1BUJ A;  1EOG A;  3WA2 X;  3MPH A;  1RLS A;  4FIW A;  1AVK A;  3EU3 A;  1RTU A;  3ED3 A;  1FB6 A;  1GLP A;  4MJD A;  5GAP D;  5IMC A;  1WNH A;  4G1M B;  3IPZ A;  2JL4 A;  2KXG A;  5G1K A;  2CW9 A;  2A4H A;  4K7N A;  2QC7 A;  4PUA A;  5AIV A;  3TRQ A;  1JHB A;  4IIA A;  1X5C A;  4HAA A;  4K90 B;  1KSI A;  5CXO A;  1F37 A;  4J5K A;  2R0G A;  3SOY A;  2VUP A;  4Q5R A;  4OO5 A;  4CY8 A;  1CQS A;  5FGO A;  1W2B 2;  2R6K A;  1OF5 B;  4EYC A;  4HU9 A;  1ZMA A;  5DQS A;  2HT9 A;  1HYF A;  2MMZ A;  4ZIJ A;  4LSO A;  4A5P A;  4HZB B;  1TI1 A;  1HZ1 A;  1W6Y A;  3BNB A;  1YHQ 3;  2FA8 A;  1I2F A;  4TR1 B;  1PY3 A;  3KEB A;  2HZE B;  3IC8 A;  2C3Q A;  3CSH A;  1O7N B;  1MNL A;  4O02 B;  2WJU A;  1OC9 B;  3DGY A; 
#chains in the Genus database with same CATH homology
 2AV4 A;  2IME A;  4H86 A;  4KAE A;  4MZW A;  3LOR A;  2GT5 A;  1S3C A;  4NWY A;  1KBN A;  3QDN A;  1SD9 A;  4K5S A;  1K3O A;  3RBT A;  3US3 A;  1YQ1 A;  1T3B A;  3FK8 A;  4JZQ A;  4ML6 A;  1ZYN A;  2JSZ A;  5KN2 A;  1GSS A;  2HYX A;  3HHV A;  3SBC A;  2MMN A;  2KHP A;  2O85 A;  1PA3 A;  3VWX A;  5IMV A;  1I9D A;  4MLY A;  2B7J A;  1GRX A;  1I5G A;  3IA1 A;  3LJR A;  4KA0 A;  5DVB A;  2HZE A;  4DSS A;  3M9J A;  4IP1 A;  3KMN A;  2IFQ B;  2H0G A;  2B5E A;  3KTL A;  2HFD A;  1WP0 A;  3AY8 A;  2OE3 A;  4EXJ A;  2FY6 A;  5A4U A;  5IMZ A;  3CXG A;  2C8U A;  3TJJ A;  3F4S A;  1TOF A;  4JRR A;  4V2M A;  3L0H A;  18GS A;  2CVD A;  2X8C A;  4YQU A;  3DYR A;  3LFL A;  3QAW A;  4GST A;  1WRY A;  2BTO T;  4IKH A;  3IE3 A;  3UVH A;  4L5L A;  2VLV A;  4KUN A;  3F8U A;  4TKY A;  4TOP A;  4OO4 A;  5DCH A;  2C1Y A;  4KGI A;  3CSJ A;  1U6T A;  2MZC A;  3MYD A;  1CQH A;  2ZUP A;  2B5X A;  2OKA A;  1BX9 A;  2VL2 C;  4TR0 A;  1ERU A;  2L5O A;  1DSB A;  4KW6 A;  4N30 A;  1USB A;  3FW2 A;  3H79 A;  3G7J A;  4WF4 A;  5ECP B;  4K7O A;  1XVW A;  3DML A;  5HFK A;  3WGD A;  5DAK A;  1XOA A;  3ZRD A;  3EMP A;  2OBK A;  1QQ2 A;  1UVZ A;  2OE0 A;  2PER A;  4G2E A;  1TRS A;  3LQ7 A;  1XWK A;  1V57 A;  1JZD A;  2JZR A;  4F9Z A;  1FHE A;  1EGO A;  4XS4 A;  6GSX A;  1NHO A;  4N0Z A;  4MJB A;  1PQN A;  3E3E A;  5ECS A;  3CRU A;  3GSS A;  2DJ1 A;  1T7P B;  20GS A;  3EC3 A;  4EC0 A;  3FR9 A;  4P3Y B;  1FVJ A;  3O76 A;  3SWL A;  2GSS A;  1WIK A;  3GHA A;  1X5D A;  5D9T A;  3FZA A;  5F05 A;  5IPG A;  3KZQ A;  5E4W A;  3DGQ A;  1ZZY A;  1B4P A;  1A24 A;  4OFM A;  2VLT A;  4XRD A;  4EIP A;  4KCA A;  4TXV A;  3P90 A;  4MDC A;  3ZFL A;  4PTS A;  2FA4 A;  1S3A A;  2C4J A;  1GTB A;  4Q5N A;  5C04 A;  5HFI A;  3RHB A;  2FWH A;  4XS1 A;  1G7O A;  2ON5 A;  1J0F A;  2HRN A;  5ABR A;  3IK7 A;  4BVY A;  4ML1 A;  2OAC A;  1M2A A;  4N11 A;  2CA8 A;  1A23 A;  3TOT A;  3PGT A;  1DUG A;  3PPU A;  2H1A A;  2CZ2 A;  4K5R A;  3V1W A;  3EIN A;  2O87 A;  4ZL7 A;  5IO0 A;  2I4A A;  1QFN A;  3QR6 A;  2HLS A;  4MNN A;  6GSV A;  3ERG A;  3FR6 A;  3ZL5 A;  3TJK A;  1GSY A;  1XWG A;  3KP8 A;  3BOA A;  2DSA A;  5ECR B;  4MH2 A;  4I6X A;  2GS3 A;  3M1G A;  2DKI A;  2P5R A;  4BVX A;  1GL8 A;  2YV7 A;  2B5Y A;  2C0F A;  4BWS A;  1TDI A;  3TKR A;  4YQV A;  5D73 A;  5KOX A;  3TKQ A;  2L57 A;  2GZY A;  2M46 A;  4ZL8 A;  1EOH A;  6GSY A;  2H30 A;  3GYK A;  1TXX A;  2F9S A;  3ZFB A;  1V2A A;  4POB A;  1UC7 A;  5KEJ A;  2RUF A;  3C1S A;  3HA9 A;  2EIO A;  2NTO A;  1E6B A;  2LEG A;  3ISO A;  1XWA A;  2JAC A;  3E9J B;  4IQ1 A;  1HD2 A;  2X8G A;  2VOC A;  1MD3 A;  2H1G A;  2L4Q A;  1X0R A;  3DXB A;  3UMA A;  1TK0 B;  4ECB A;  2GQK A;  1XPV A;  2D2Z A;  4MMM A;  4N0V A;  1XCC A;  3ME7 A;  1YEP A;  5AN1 A;  4GQF A;  4ICY A;  5H5Q A;  4I97 A;  4POK A;  3GN3 A;  2KUC A;  3EUR A;  4IN0 A;  4E8E A;  2C0E A;  2LJR A;  2WCI A;  4LL4 B;  2G2Q A;  3GV1 A;  6GSS A;  3WT2 A;  2ZNM A;  1DBY A;  3FHK A;  5ECH B;  5J4U A;  2P0G A;  1R7H A;  4NMU A;  2L6D A;  4XS6 A;  1GNW A;  2VD0 A;  5DAL A;  2DML A;  2PGT A;  5D9W A;  9GSS A;  5J41 A;  4NV2 A;  7GSS A;  1SJZ A;  1PD2 1;  1Y25 A;  5HR0 A;  4LMW A;  2CX3 A;  2XBI A;  14GS A;  4G9H A;  5HR1 A;  4PQI A;  3ZVJ A;  4WR5 A;  1M2D A;  1V58 A;  4AJ8 A;  4QQ7 A;  2I9H A;  1T8E B;  3CBU A;  3GRX A;  5FWG A;  3VFI A;  4QL9 A;  2YN1 A;  4IJI A;  3HJP A;  5INY A;  1A2M A;  3WGE A;  2M80 A;  4ID0 A;  4RI7 A;  1O7U A;  1YDK A;  5DCG A;  3LYP A;  1G6W A;  1IYI A;  3U5R E;  1DE2 A;  2HRF A;  2E0Q A;  4O5R A;  3IAS 2;  2VL3 A;  1BED A;  2GSQ A;  5F8B A;  2WUL A;  4PX1 A;  8GSS A;  5DBQ A;  1EEJ A;  2DJ3 A;  1Z3E A;  3GFK A;  2JZT A;  2CVK A;  4GXZ A;  4JBB A;  1U3A A;  1A2J A;  1XOB A;  1GSF A;  1GUL A;  1ZGN A;  1TRW A;  1MDJ A;  3ZTL A;  1O85 A;  4PQ1 A;  4G19 A;  2H19 A;  3HDC A;  2WDU A;  5ECI B;  4IGJ A;  1A0F A;  3L9U A;  3R2Q A;  2OAD A;  2IWT A;  1DE1 A;  5ID2 B;  2VIM A;  2YWM A;  2FWG A;  1GUK A;  3TKP A;  1F6M C;  4OCE A;  2J9H A;  2X8H A;  3G7Y A;  2HSY A;  4WET A;  1A8L A;  1KEB A;  2AAW A;  4RQX A;  1SYX A;  3H4K A;  3Q74 A;  5CRE A;  5KN3 A;  1ZYE A;  4ZB9 A;  4F03 A;  2QKE A;  1Y6E A;  2YV9 A;  1KNG A;  4WR4 A;  1W89 A;  3C7M A;  2PN8 A;  2O7K A;  4MK3 A;  3UAP A;  4GLT A;  2IMD A;  2FWF A;  5JWQ B;  1PL1 A;  3GH6 A;  1EZK A;  5CO3 A;  1F2E A;  4MF6 A;  2VCX A;  5LD0 A;  5ID2 A;  2H72 A;  1SK1 A;  3BCK A;  3GL3 A;  1MDI A;  2CQ9 A;  3GH9 A;  2YAN A;  4USS A;  1ST9 A;  3GKK A;  2PMT A;  1EV4 A;  2F8A A;  1TK5 B;  1FW1 A;  5D93 A;  3L9S A;  5ECL B;  3TGZ A;  4ACS A;  5JWO B;  4GCI A;  1XWC A;  2KP2 A;  3HKR A;  2LST A;  3UBK A;  3KXO A;  3MAK A;  1PKZ A;  3IHQ A;  1M2B A;  3ZZX A;  1HNC A;  4EKZ A;  2OBI A;  2X49 A;  4I5Q A;  3EU4 A;  3Q19 A;  1EV9 A;  2FUG 2;  1Z7R A;  5CRD A;  1SJI A;  3UJ1 A;  4DSS B;  4IQA A;  1KTE A;  1PRX A;  1SL2 B;  1XW5 A;  4HI7 A;  4XCS A;  2FHE A;  3KP9 A;  1JLV A;  3EVI A;  1LJR A;  3UBL A;  3QD9 A;  3FRC A;  5B6N A;  4PXO A;  5J9B A;  2FD3 A;  3ME8 A;  2XPE A;  2PVO C;  2LKU A;  2A2S A;  2L5L A;  4V2N A;  1O73 A;  5G30 A;  3NZN A;  4IHU A;  1Z9H A;  3KJY A;  3ZYW A;  1J9B A;  5KOW A;  1WPI A;  4LLR A;  1XVQ A;  1K0O A;  3IXR A;  1YF0 A;  3LW9 A;  4I2T A;  3A5W A;  5AGY A;  4BWQ A;  1T1V A;  1TRV A;  2B1L A;  2DIY A;  4MZB A;  4POL A;  2PVQ A;  1GLQ A;  5DAK B;  1SD8 A;  2LQQ A;  4V1A g;  2AHE A;  3J7Y b;  1SK0 A;  2LJA A;  5GSS A;  1ML6 A;  3PH9 A;  2LTK A;  2V2G A;  1B4Q A;  4V1A p;  4L0U A;  4K8M A;  3IC4 A;  5LNK e;  2JZS A;  3WD6 A;  2GTU A;  4XS4 B;  2JU5 A;  1WOU A;  2C3N A;  1K0C A;  2H8L A;  2K6V A;  2J23 A;  3ZMK A;  4TN8 A;  4O5U A;  2I1U A;  4IJ3 A;  2DJ0 A;  1O8W A;  3GNJ A;  1HYU A;  2VO4 A;  4BL7 B;  1NW2 A;  4TVE A;  2WS2 A;  3ERF A;  1OKD A;  2A2R A;  5IOW A;  4DSQ A;  2O8V B;  3K8N A;  3IK9 A;  3HCZ A;  2R3X A;  4NV5 A;  2K9F A;  2IY2 A;  5D8I A;  4WBR D;  4FH8 A;  1HNB A;  3EE2 A;  5G2Z A;  4BVY B;  4HJM A;  3UVT A;  3DWV A;  3U6V A;  3VI5 A;  2HXK A;  4KND A;  3VI7 A;  3DIE A;  3C73 A;  4MP4 A;  3IDV A;  5EPF A;  1O81 A;  4K0N A;  3VWV A;  3LSZ A;  2IPA A;  4JR6 A;  1SKR B;  3NIV A;  2X4A A;  3N9J A;  4OD7 A;  4BL7 A;  2X99 A;  4MF7 A;  4GF0 A;  3HXS A;  4YKF A;  4Q5Q A;  5A4V A;  3TCO A;  2FWE A;  1QK8 A;  2PPT A;  2DIZ A;  4AGS A;  3DVW A;  4HUA A;  2RM6 A;  1GNE A;  1WWJ A;  4BVX B;  1NM3 A;  1T4Z A;  3QFB C;  4GRF A;  2CZ3 A;  2HI7 A;  5IMF A;  2JAD A;  2H71 A;  2GDR A;  4X4J A;  4MJA A;  2BMX A;  1XW6 A;  4WEY A;  2NBS A;  2EC4 A;  2LRN A;  4ILF A;  1GP1 A;  2FLS A;  3KD0 A;  4TXO A;  3BBY A;  4G0K A;  4TR4 A;  3ZIJ A;  4NPB A;  3L4N A;  2DJK A;  3KM6 A;  2TRX A;  4X1U A;  2YP6 A;  3TRP A;  4JR4 A;  1OAZ A;  3KCM A;  4FYB A;  2ZCT A;  1GWC A;  2C3T A;  3APQ A;  2YZH A;  4JU5 A;  1G7E A;  1YY7 A;  4G0I A;  3Q18 A;  3QOU A;  17GS A;  3P7X A;  3EPT A;  2DJ2 A;  1AC1 A;  2XPD A;  1PX7 A;  4IP6 A;  4NHZ A;  2B3S A;  3GKX A;  3UOM A;  2XC2 A;  1YKC A;  1AQV A;  2H73 A;  2O89 A;  2N5F A;  2AB6 A;  2ALB A;  2VCZ A;  4FYU A;  3RAZ A;  1YF1 A;  1G0T A;  3G7I A;  3F63 A;  4EUY A;  4KCE A;  4XHM A;  2HSH A;  1Z6N A;  4EVM A;  3GX0 A;  3I69 A;  5DAL B;  4F2I A;  1K0N A;  2CT6 A;  5EY6 A;  4WF5 A;  4CW9 A;  1THO A;  4TRX A;  1TP9 A;  1X9W B;  3C1R A;  4GTU A;  5ELA A;  2H1D A;  2CVB A;  3FEU A;  1M9A A;  5G1L A;  3VWU A;  1TTZ A;  5CAX A;  3I43 A;  4OCF A;  4OFN A;  5GAN D;  1TU7 A;  1F3B A;  2CX4 A;  3J7Y k;  1XIY A;  2RII A;  1VF2 A;  1K0M A;  5BRT A;  4EIQ A;  5B6M A;  4NAX A;  1E2Y A;  5EL8 A;  1ERW A;  4K1F A;  22GS A;  4J56 E;  2OA7 A;  5GST A;  3ZIV A;  5CP1 A;  3PR8 A;  4FQU A;  4D73 A;  2VAF A;  3MNG A;  2H6Z A;  2H01 A;  4KDU A;  1HNA A;  4LMV A;  3TJF A;  1F3A A;  2WZ9 A;  5CRH A;  3O6T A;  1A2L A;  4MAB A;  1SL1 B;  2HNL A;  3HZ4 A;  4K9Z A;  3PIN A;  1QGV A;  4ZXG A;  1O8X A;  1ABA A;  1N2A A;  2WFC A;  4Z7X A;  2IYJ A;  1PSQ A;  3DD3 A;  2LRC A;  4PQH A;  5B8A A;  4IEL A;  2WGR A;  3C8E A;  5JWR B;  3MIX A;  4MCU A;  5A4W A;  3OR5 A;  2C80 A;  1LBK A;  2LJK A;  4XTS A;  2GZZ A;  2MBT A;  4YAV A;  3DEX A;  2NDO A;  2TRC P;  3ZLP A;  4EDY A;  6GST A;  1AQX A;  2R0C A;  4CY6 A;  4GWR A;  3HVV A;  1H4O A;  4LA1 A;  3WT1 A;  1ZOF A;  3BCI A;  2VM2 A;  2DBC A;  1AAZ A;  2DC5 A;  2VCV A;  4F0B A;  2KLX A;  1OE7 A;  1X9M B;  3F9U A;  1VRS D;  4JE1 A;  1MEK A;  5BMU A;  1ZCP A;  3N5O A;  1AUC A;  1V98 A;  1ZYP A;  5DQY A;  1FAA A;  1OC3 A;  4MJC A;  1S3D A;  2B7K A;  2V6K A;  4ZBB A;  1H75 A;  4AF2 A;  2LV3 A;  1FVK A;  13GS A;  4MJE A;  1V40 A;  2XBQ A;  3HJO A;  2R0P A;  2QGV A;  4MH3 A;  4ZIL A;  3R3E A;  2WB9 A;  4MPF A;  3GTU B;  3Q6O A;  3KMO A;  2IIY A;  2R37 A;  3ERW A;  3GA4 A;  2FGX A;  3O3T A;  3UAR A;  2V6O A;  4HZ4 A;  2YJH A;  4L0W A;  1VF4 A;  3RHC A;  2P5Q A;  2IMK A;  2L59 A;  3ZVJ D;  4HJ2 A;  2K8S A;  2YZU A;  2LNS A;  1GSD A;  2HZF A;  1RQM A;  2DKH A;  1HQO A;  3HZ8 A;  4IVF A;  1EWX A;  2N5A A;  4ZB8 A;  3VPT A;  3KGK A;  2LUS A;  2B1K A;  4Z2U A;  5DDL A;  3WGX A;  3EMX A;  3KIJ A;  3TOU A;  1XXU A;  5EVO A;  2E2G A;  3FY7 A;  2AJQ B;  1B9Y C;  2R5G A;  3GTU A;  4NXI A;  3APS A;  1VF3 A;  1TU8 A;  1AIU A;  2H66 A;  4ULX A;  1SU9 A;  2EIQ A;  1YJ6 A;  4IBP A;  3KTB A;  1U3I A;  3EWL A;  1TW9 A;  3CTG A;  4Z2R A;  2F3M A;  1FB0 A;  1BYE A;  1B9X C;  1K0A A;  1JZW A;  4K2D A;  3P2A A;  2BJX A;  3F6D A;  3QMX A;  3CMI A;  3FMW A;  4GSN A;  3FZ4 A;  3F4R A;  1OKT A;  2OE1 A;  4CHS A;  1SEN A;  2XHF A;  1R4W A;  5IM9 A;  3QCP A;  2REM A;  4WXT A;  1ON4 A;  3UEM A;  2R2J A;  2RM5 A;  2ON7 A;  4X0X A;  5F0G A;  3IAM 2;  5ECK B;  3TKS C;  5CRW A;  1SJ6 A;  3LWA A;  3QFA C;  2YPM A;  4K6X A;  4PGT A;  3CSI A;  3GKN A;  4O5Q A;  1C72 A;  1RW1 A;  2X64 A;  4NHW A;  1Z6M A;  2P31 A;  3HYP A;  4EF0 A;  2G0F A;  4EE0 A;  4PNF A;  2MYG A;  5ELG A;  2N5B A;  2LNT A;  4KSO A;  4ZBD A;  3LYK A;  4ECJ A;  4BA7 A;  4ISD A;  2V1M A;  3D4M A;  5ECQ B;  4I2U A;  1ZL9 A;  5D9X A;  4DVC A;  5G5F A;  2H0H A;  2IN3 A;  3E0U A;  4AJ7 A;  12GS A;  3S9F A;  4MF5 A;  1EP7 A;  3A2X A;  1FO5 A;  3HY2 A;  3RDW A;  3JCM L;  3IRA A;  3HJM A;  3UL3 A;  3KH9 A;  1M7T A;  2H0I A;  3TUE A;  3HVX A;  5IPH A;  3MSZ A;  1WE0 A;  1ERV A;  3I9V 2;  4TR1 A;  4I8B A;  1R26 A;  1BAY A;  2B6M A;  3VLN A;  5CYY A;  3IOS A;  2E2M A;  3EYT A;  3H8Q A;  4IW9 A;  4LL1 B;  2YOI A;  1OC9 A;  4POM A;  2K8V A;  1X5E A;  3KH7 A;  3LXT A;  6GSU A;  2A4V A;  4YH2 A;  2RLI A;  4WKW A;  10GS A;  1TRU A;  5HQP A;  3IR4 A;  1SL0 B;  2GQM A;  4HS1 A;  2PBJ A;  3DKS A;  2VCT A;  1LU4 A;  4ZL9 A;  5C00 A;  2CAQ A;  3M3M A;  4PUR A;  1GSU A;  2IMF A;  5IOX A;  2HRK A;  3A2W A;  3M0F A;  4RQR A;  4KE3 A;  2GZP A;  3TKS A;  5IQY A;  5FHI A;  3D4T A;  2LRT A;  4PNG A;  1K0D A;  3MWH A;  4KF9 A;  3GST A;  5HR2 A;  5IO2 A;  2PWJ A;  1TK8 B;  1QXH A;  3GUR A;  3BJ5 A;  1K0B A;  2L6C A;  5IMA A;  4RUV A;  1PX6 A;  4OFT A;  5E59 A;  4J2F A;  2MBS A;  2I81 A;  1ZYQ B;  3W8S A;  1F9M A;  2F8F A;  1WJK A;  2IFQ A;  2VD1 A;  4JED A;  5J9C A;  1FOH A;  2JSY A;  3F6F A;  3W6G A;  1XZO A;  2YWN A;  2HE3 A;  3TB2 A;  2K18 A;  4HEA 2;  2V32 A;  3CYN A;  16GS A;  3L9V A;  1YZX A;  4TXO B;  2YNX A;  5H5S A;  4TR3 A;  3QAG A;  1EP8 A;  1TKD B;  4PUF C;  4TW5 A;  3IHG A;  3UIW A;  1VGL A;  3HVS A;  5ENU A;  1U87 A;  3D0Z A;  1OYJ A;  2H74 A;  3D6I A;  1B8X A;  3LGC A;  5A5K A;  2H75 A;  4Q5F A;  4ECI A;  2AYT A;  4G10 A;  1J08 A;  3H93 A;  3A2V A;  2H6X A;  5L71 A;  1TJD A;  4KDY A;  2IJY A;  2VCQ A;  3NOF A;  4K0G A;  2AUV A;  2C0D A;  1FG4 A;  2H1B A;  2YWI A;  3WYW A;  2GST A;  11GS A;  1MDK A;  2E7P A;  2I3Y A;  1EGR A;  4GQC A;  1SK2 A;  4QL7 A;  1GH2 A;  4L5O A;  1BQ7 A;  4F82 A;  2VL2 A;  3VWW A;  19GS A;  4E8H A;  5JCW A;  4CDO A;  1JFU A;  1FOV A;  1JZO A;  2GVP A;  2QSI A;  3DVX A;  3QAV A;  3VPQ A;  4DEJ A;  4FYC A;  1ACV A;  5G31 A;  3IBH A;  4HU7 A;  1PN0 A;  4ECC A;  3D22 A;  2MMA A;  4KX4 A;  1Q4J A;  1G6Y A;  4YKG A;  2H6Y A;  3H1N A;  1OC8 A;  2LQO A;  1AXD A;  4V2L A;  2PU9 C;  2LS5 A;  4AJ6 A;  5D96 A;  4DSR A;  4MA9 A;  5D9V A;  2OJL A;  1M0U A;  2HRA A;  4N10 A;  2DJJ A;  2VL9 A;  5B7C A;  2CAI A;  4D73 B;  3QPM A;  3A5I A;  1T00 A;  4HDE A;  2GLR A;  5DJL A;  1Z5Y E;  3D21 A;  5KN1 A;  5AIX A;  1JZR A;  1NHY A;  1W4V A;  2HSM A;  5KN0 A;  5J3R A;  4GSS A;  3C71 A;  4FO5 A;  1M99 A;  3TDG A;  1URM A;  1PGT A;  2MMO A;  2FCH A;  2VCW A;  1GTI A;  3GMF A;  4WBJ A;  4BPY A;  2ES7 A;  1MD4 A;  2QA1 A;  1PKW A;  4XRA A;  3TRX A;  2YCD A;  5HR3 A;  1AW9 A;  2IMI A;  2Z9S A;  1ILO A;  1O6J A;  2NPB A;  2KP1 A;  1ERT A;  1SYR A;  3FYG A;  2V41 A;  3CTF A;  1T4Y A;  1M9B A;  2EIR A;  3GL5 A;  3GIX A;  3ZML A;  3HD5 A;  2VLU A;  3TJG A;  5AIS A;  3ZIT A;  4KB3 A;  1IYH A;  1X9S B;  1RK4 A;  1JLW A;  5CNW A;  4IS0 A;  4RI6 A;  5IIZ A;  1GSQ A;  5H5R A;  5F06 A;  1CQG A;  4O32 A;  3BD2 A;  2KOK A;  4EO3 A;  1MTC A;  1QUW A;  5F07 A;  3LG6 A;  3VUR A;  1K3L A;  1PL2 A;  1WMJ A;  5ECN B;  1GSE A;  2GT6 A;  4KDX A;  2A2P A;  1SKW B;  3L78 A;  4X43 A;  4Z2T A;  2RUE A;  4ZB6 A;  1TI3 A;  4KH7 A;  2M72 A;  3GX8 A;  3LXZ A;  1B48 A;  1R5A A;  4L8E A;  4HQZ A;  5GZZ B;  4XIH A;  3FZ9 A;  1AQW A;  3F3Q A;  3ZRE A;  2H76 A;  5J5N A;  3F3R A;  5LCZ A;  2FNO A;  4G0L A;  1XWB A;  4KSM A;  2DMM A;  2R4V A;  5ECM B;  1XFL A;  5CRG A;  2CV4 A;  2UZ8 A;  3P8W A;  4ZBA A;  1N8J A;  3IV4 A;  5DJM A;  1U88 A;  3TJB A;  3W8J A;  1EEM A;  3VK9 A;  3F0I A;  4OWY A;  3TKS E;  2GQL A;  2QA2 A;  2H70 A;  1PN9 A;  1SKS B;  3I6A A;  1A0R P;  1GTU A;  1YEX A;  3GUS A;  3F4T A;  1GUM A;  1YKA A;  3DRN A;  5FT3 A;  5IMD A;  2IL3 A;  5JCG A;  4MZC A;  5HFG A;  3RPP A;  4HZ2 A;  4YAP A;  2VM1 A;  1V9W A;  1XBS A;  4HQS A;  4O7H A;  6GSW A;  1VF1 A;  2NVL A;  2PUK C;  2YJ7 A;  2TIR A;  4EL1 A;  4EDZ A;  4O92 A;  1PMT A;  1R5P A;  2C0G A;  2WRT A;  4HOJ A;  5ECO B;  3LEF A;  2GGT A;  1Z7P A;  3MDK A;  4YQM A;  1QMV A;  2DLX A;  3CRT A;  1GTA A;  3FKF A;  5COH A;  2L4C A;  3APO A;  1OE8 A;  1UN2 A;  4MPG A;  3FZ5 A;  1A8Y A;  4F0C A;  1XW9 A;  5G5E A;  3FR3 A;  1BJX A;  3G9B A;  3D5J A;  5JCU A;  2GSR A;  1THX A;  1Q98 A;  1GUH A;  3M8N A;  1UA5 A;  4J57 E;  1K3Y A;  3RPN A;  1NSW A;  2F51 A;  2YWO A;  4OMV A;  5B8B A;  1BG5 A;  3A3T A;  4K7I A;  3GKM A;  3M9K A;  4K2X A;  1OVN A;  1EOG A;  4FIW A;  3EU3 A;  3ED3 A;  1FB6 A;  1GLP A;  5GAP D;  5IMC A;  3IPZ A;  2JL4 A;  2A4H A;  5G1K A;  4K7N A;  2QC7 A;  4PUA A;  5AIV A;  3TRQ A;  1JHB A;  1X5C A;  1F37 A;  2R0G A;  2VUP A;  4Q5R A;  4OO5 A;  4CY8 A;  2R6K A;  4HU9 A;  1ZMA A;  5DQS A;  2HT9 A;  2MMZ A;  4ZIJ A;  4A5P A;  1TI1 A;  2FA8 A;  4TR1 B;  3KEB A;  2HZE B;  3IC8 A;  2C3Q A;  3CSH A;  2WJU A;  1OC9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...