1EEJA

Crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
216
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN
total genus 68
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1eejA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eejA02
4NHZA 5A4WA 1HNCA 2MMZA 1T1VA 2NVLA 1HNBA 4POMA 3BBYA 3TRPA 3QAVA 1VF3A 3CRTA 5HFKA 1UN2A 1M7TA 3M9JA 4EVMA 4EDZA 1SL2B 1PKWA 1AXDA 5AISA 3GA4A 1HNAA 1B48A 1FB0A 1SL0B 1TI1A 4MP4A 1T7PB 5IM9A 1N8JA 4EDYA 3DXBA 2IPAA 1SKRB 3FW2A 3MAKA 3HYPA 4X0XA 4D73A 2R6KA 3H4KA 3FZ5A 3L9VA 4MDCA 3KXOA 5IO0A 4MA9A 4PUAA 5IMAA 1F9MA 2H1DA 5ECKB 2LRCA 4ZL9A 1W89A 1ABAA 1O6JA 1YKAA 1V40A 4AJ7A 1PX6A 1JFUA 2IMIA 1ST9A 3IOSA 5FT3A 1TI3A 1K3LA 2LJKA 2HSHA 4KUNA 3WT1A 3W6GA 2DBCA 2DJ3A 1Z7RA 3GMFA 5CRHA 4BPYA 4MJCA 2PGTA 3ZVJD 1XWAA 3FYGA 4I8BA 2VCXA 2VLUA 3WGXA 2CX4A 1X0RA 1U3IA 3QPMA 2ON5A 5B7CA 1AUCA 3L9SA 2VOCA 1B4PA 3F6DA 2MZCA 2VL2C 1X9SB 4IS0A 4J56E 4AGSA 4G19A 2H76A 3IDVA 1GSEA 2IMFA 1QXHA 3A2VA 1EZKA 4XTSA 3GFKA 2AV4A 2WJUA 3HJMA 4RI6A 4GSNA 3WGEA 4F03A 1NW2A 5KN0A 16GSA 4ZXGA 2PBJA 5J4UA 1YF0A 1THOA 3O76A 4G9HA 5D9TA 4DVCA 5J9BA 2HE3A 3VPQA 5COHA 1G7OA 1SK2A 4GLTA 1H75A 2PUKC 3D4MA 5IMFA 3P2AA 4TW5A 4X43A 2A2RA 5D9WA 4I2UA 1LU4A 2HRFA 1A23A 3PR8A 4HS1A 1GTAA 4K7OA 3WGDA 4AJ6A 2P0GA 1AC1A 3APSA 4JBBA 4ULXA 3ZL5A 3VWWA 1BEDA 4KW6A 1XOAA 1TDIA 2H01A 4IW9A 5D93A 4MMMA 4KSOA 4D73B 5IPGA 1ZMAA 1ERUA 4GTUA 5AGYA 1CQGA 4ECIA 1K0DA 2FCHA 1FVKA 1TRSA 4HI7A 5DBQA 3QFAC 2HXKA 1KEBA 3TKSC 4OFMA 2YP6A 4JRRA 2NTOA 3UMAA 3DYRA 1PKZA 2VM2A 2KP1A 2O7KA 1Z3EA 5G5EA 1EP7A 2OBIA 4MPFA 1TRUA 4N11A 2GSQA 3FZ4A 2VD0A 4HDEA 2K8SA 2LV3A 3EYTA 2IMDA 2LEGA 4K7IA 3C71A 3CTFA 1XCCA 3Q18A 3CMIA 2VL9A 3WYWA 3KTBA 1GNWA 2P5RA 1SK1A 4G2EA 4L0UA 4I5QA 2VD1A 3CTGA 2J23A 2PU9C 2WDUA 3LFLA 1F2EA 1PL2A 1XXUA 1NHYA 2N5BA 2FD3A 2YCDA 4K1FA 2F8FA 2OE0A 4WKWA 19GSA 1M9AA 2XBQA 5IPHA 3ERGA 3ZZXA 3DKSA 2HNLA 1EV4A 3F4RA 2IYJA 1TKDB 2XBIA 1O8XA 4IJ3A 3APOA 2V1MA 4KE3A 3RBTA 1JZWA 1PD21 2N5AA 2P5QA 5B6NA 4POKA 4JEDA 5KN2A 1GSQA 2FWHA 2WULA 2H6ZA 1U6TA 3ME8A 1XVWA 2LSTA 3KZQA 3W8JA 3D4TA 1G6YA 12GSA 3M9KA 2E2MA 4ML6A 2CZ3A 2L5OA 3C1SA 4MZWA 2H0IA 3LEFA 1S3DA 3I9V2 2OA7A 4GQCA 1O85A 2IL3A 2YWNA 3JCML 3UVTA 3ZVJA 2YWIA 1PX7A 3DVXA 1PRXA 1TTZA 2GVPA 3LYPA 3SWLA 2RM5A 4V1Ap 3GTUA 1TK8B 1NM3A 4LMVA 3F4SA 1PL1A 1DUGA 2M72A 1VF1A 1XW5A 1K0AA 5KEJA 2B5EA 2I81A 2K6VA 2JSZA 3GX8A 5IO2A 2H8LA 3P7XA 4HU7A 4AJ8A 1SL1B 3TJFA 1BQ7A 2FHEA 2H66A 1MEKA 1GL8A 4IKHA 4L5LA 4ZIJA 4JZQA 1FG4A 2AAWA 2GZYA 4ZL8A 2GTUA 6GSWA 1JHBA 1YF1A 3DMLA 1SYXA 2MYGA 1TRVA 3ZLPA 2KUCA 1WJKA 3F8UA 4NHWA 4KB3A 4WF4A 3H1NA 4NAXA 2L57A 4F0CA 1A2LA 3TRXA 5H5SA 4TXOA 3VLNA 4BA7A 3QAWA 2B6MA 5ECIB 1MTCA 3EMXA 1SYRA 5DQYA 3D5JA 2MBTA 3QR6A 2H71A 2YV7A 3HJOA 1MDJA 1DE1A 3DD3A 1USBA 2KLXA 1G7EA 2WGRA 5JWRB 4TVEA 2I9HA 1TU7A 3C73A 4RUVA 4MH3A 2RUFA 5CRWA 3IXRA 4MF7A 5D9XA 2BTOT 2FA8A 2LQQA 1SJZA 1WIKA 2ZCTA 3N5OA 1YJ6A 5C04A 4IBPA 4ZB8A 1WPIA 3ERWA 1XOBA 4PUFC 5G30A 5CREA 2FWEA 3Q74A 6GSVA 3HZ4A 4IP6A 3H8QA 4V2MA 3GH9A 4EL1A 4WF5A 2GDRA 3GHAA 4ML1A 1SD9A 1QUWA 3UEMA 1WP0A 2YANA 2VL2A 4Q5FA 2L4CA 3E0UA 3IK9A 3UOMA 1A8YA 1GULA 3F3RA 5E4WA 3PINA 3RPNA 2VCVA 22GSA 1AQVA 2VL3A 2XPDA 4GF0A 2BJXA 2O89A 1J0FA 3GSTA 5DAKA 1XIYA 5LD0A 4WR4A 1OC3A 2B1KA 2X8CA 3KH9A 2IFQA 5AN1A 2ZUPA 4HQZA 3NZNA 3IR4A 1MDKA 6GSYA 3S9FA 2QSIA 3G7JA 2B7JA 3ZTLA 4EXJA 2KOKA 5A4VA 3DIEA 1G0TA 2MMNA 4EUYA 1KBNA 3ZREA 2H0HA 4L8EA 4NWYA 5ECLB 2YWOA 1GSSA 3FKFA 2OJLA 3EVIA 2ES7A 3MSZA 17GSA 1R26A 1TK0B 2PN8A 5AIXA 10GSA 2H73A 1VGLA 5D9VA 1EOGA 3FHKA 3G7IA 18GSA 3W8SA 5CYYA 3ME7A 1C72A 3LQ7A 3U6VA 3F6FA 4O92A 1W4VA 1SJIA 4JE1A 5INYA 3TCOA 2C80A 4XCSA 2MMOA 5IMDA 4GCIA 5GZZB 1URMA 2LUSA 3DWVA 4MPGA 5HQPA 4IVFA 4H86A 2GSTA 1UVZA 4TN8A 2DIZA 1QMVA 3BCIA 3KM6A 3UBKA 5D96A 2X64A 4TXVA 2E7PA 5DALB 3I43A 1Z6MA 4CW9A 4XS1A 1M9BA 1GSUA 1LJRA 5KN3A 5J5NA 4K2DA 1V2AA 5DCHA 3LORA 2C0EA 1G6WA 2AUVA 3MWHA 3PH9A 5HR3A 3A2WA 5ABRA 1X5CA 3APQA 2AJQB 2B5XA 2LKUA 3GL5A 1BAYA 5KN1A 5G2ZA 4N0ZA 3ZMLA 1F3BA 1JLVA 5G31A 2GLRA 1AAZA 1YKCA 4GWRA 2OE3A 3P90A 3HA9A 4O5RA 4OO5A 4XS4B 3FZAA 3VPTA 3F4TA 4TXOB 1EEJA 2EIOA 2GT6A 2HLSA 4V2LA 4ECJA 2YWMA 1THXA 3KGKA 1GTBA 5D73A 4IQ1A 4DEJA 3LJRA 2H74A 5HR2A 2AB6A 3TB2A 2HRNA 2QGVA 1AQWA 1ML6A 4YAVA 1KNGA 3O6TA 2GS3A 1TOFA 3RDWA 2WS2A 5F8BA 1XWGA 3O3TA 1T4ZA 5EVOA 2RIIA 2JZTA 1B9YC 2M80A 1KTEA 2LRTA 2DIYA 4XHMA 4KX4A 3HD5A 5HFIA 1XWCA 1EV9A 4TOPA 2YOIA 2DJ0A 1OKTA 3DGQA 2QKEA 3TOTA 4N10A 4L5OA 4IJIA 5DQSA 1PA3A 1AIUA 2PVQA 3Q19A 1GLQA 3FEUA 1U87A 4BVXA 2FNOA 2V41A 2H30A 4XRDA 2H70A 3EE2A 1UC7A 2LNSA 5CO3A 5LNKe 4OFNA 5JCUA 5DDLA 3TRQA 3IK7A 2IY2A 3DRNA 5DAKB 2VAFA 3F3QA 4I2TA 2CT6A 2HYXA 2JADA 1ZZYA 1TRWA 1M2AA 2NBSA 4AF2A 2GQMA 2FUG2 1Z9HA 2X8GA 1GSFA 1GP1A 5JCWA 3BCKA 1YQ1A 3VI5A 3L4NA 3TJGA 1V58A 3LXTA 1V98A 2PWJA 4Q5RA 2FY6A 3UBLA 1LBKA 4K0GA 3VWUA 2LNTA 2B1LA 3LSZA 4QL7A 5IQYA 4JU5A 1TK5B 4FH8A 3WD6A 2C3TA 2HZEA 4KDYA 4MJBA 1M99A 5B6MA 5CAXA 1F3AA 1TU8A 1A2MA 3IC4A 5F07A 1IYIA 2YJHA 2FWGA 1ON4A 5ECNB 6GSXA 4KCEA 1K0CA 2HI7A 4X1UA 3F63A 2VIMA 1HQOA 2B3SA 4KDUA 2DC5A 1PGTA 3TKSA 4PQHA 2YV9A 1TW9A 2C8UA 2Z9SA 4F82A 5CNWA 1U3AA 2WRTA 1YEXA 2G0FA 3RAZA 4HEA2 4MH2A 2RM6A 4GQFA 3E3EA 2V6OA 5B8AA 2OBKA 4POBA 1N2AA 1XPVA 1ZCPA 3ZMKA 1BX9A 2YN1A 1RK4A 3I69A 5IMVA 3D21A 6GSTA 2L6CA 1EOHA 4GSSA 1S3AA 4ZB9A 1K0BA 3FRCA 3UAPA 4I6XA 4HZ4A 4FIWA 3GRXA 2O87A 1GUHA 1R4WA 3CRUA 2H75A 3WT2A 2EC4A 1EWXA 2VCWA 1OE8A 4WR5A 3TKSE 3A3TA 3TKRA 4KCAA 2IN3A 2GSSA 3TJKA 1XWBA 4L0WA 2A4VA 3HY2A 4PNGA 2V32A 5JCGA 3G7YA 1K0MA 4HZ2A 5IOWA 4EE0A 4K0NA 4PNFA 4NPBA 3SBCA 3HVSA 3MDKA 4EC0A 1XVQA 2KHPA 1FOVA 3GKKA 20GSA 4MJAA 3IV4A 2VM1A 1T4YA 3OR5A 1OKDA 3LGCA 4NXIA 1K3YA 1GTIA 1SK0A 3TOUA 1XFLA 3GURA 3UL3A 14GSA 1BJXA 4ZBBA 3ZIJA 1GH2A 2NPBA 1I9DA 2C0DA 1YZXA 3M1GA 2IMEA 3TUEA 2MMAA 5J9CA 4HQSA 5IMZA 5F05A 1ERTA 1GNEA 3HZ8A 1PN9A 1O73A 3FY7A 3GKNA 5IMCA 3KTLA 4IGJA 3D22A 3HXSA 5B8BA 1O81A 4DSQA 2H6YA 4Z7XA 2AHEA 4GSTA 2F51A 3RHCA 5G5FA 1XWKA 1WWJA 2CAIA 2H1AA 2BMXA 2LS5A 4P3YB 1X9WB 2O85A 3GYKA 3J7Yk 1S3CA 3BOAA 4DSSB 2CVBA 1U88A 2JZSA 1K3OA 4IELA 3EMPA 3IPZA 2DJ2A 4PQIA 4OWYA 2REMA 4QQ7A 2RUEA 3EU4A 2JL4A 1R5PA 1FW1A 2IFQB 3LYKA 3L0HA 1QGVA 1GSDA 4KA0A 4OO4A 4PXOA 2V6KA 3FR9A 4EF0A 4G10A 2VLTA 4TKYA 1SJ6A 1B4QA 3C8EA 3IHQA 1JZRA 5G1LA 4IQAA 2PMTA 3FK8A 2CVKA 3HVVA 3GX0A 2TIRA 3HKRA 5ECMB 1CQHA 4DSRA 3VWVA 1QK8A 2IIYA 3L9UA 3US3A 4ZB6A 3GIXA 3HJPA 2LJAA 2LRNA 2L6DA 3UJ1A 3LWAA 5EY6A 3KEBA 2R37A 2DSAA 4N0VA 1BG5A 3KD0A 2P31A 2L4QA 2CZ2A 3GN3A 2YZHA 2IWTA 4LA1A 4E8HA 2H19A 2HFDA 3UIWA 1HD2A 4NMUA 2L59A 1EGRA 4GRFA 1TJDA 3I6AA 6GSUA 1V9WA 2GQKA 3BD2A 3J7Yb 1FHEA 3IRAA 2FLSA 2M46A 3QMXA 4GXZA 5G1KA 3HCZA 4MF5A 5F0GA 4BVYA 2L5LA 2VUPA 4MJEA 4PX1A 3G9BA 1ZYQB 4NV5A 1GTUA 1F37A 1O8WA 4K9ZA 2HT9A 2FWFA 4BL7A 4TR3A 3FR6A 1Q4JA 2X8HA 4K8MA 4BWQA 5ELGA 2WFCA 1OC8A 3TKQA 4WXTA 3RPPA 4E8EA 1OVNA 5ID2A 4OFTA 3A5WA 1Z6NA 4K6XA 3IE3A 4KNDA 4ZILA 2K8VA 1T00A 1M2DA 1RQMA 3VFIA 4XIHA 3N9JA 2YNXA 4XS4A 2VO4A 5DJMA 5ECPB 3PGTA 3ZFLA 5ENUA 4ECBA 4F9ZA 1E2YA 1PQNA 2F8AA 3KH7A 1RW1A 2B7KA 1X5EA 2OACA 2O8VB 2PPTA 4IN0A 1ERVA 4HUAA 4RQRA 2F9SA 11GSA 3TKPA 4MF6A 1A2JA 4BWSA 3D6IA 2VLVA 2C1YA 2CX3A 5ELAA 3ISOA 1FVJA 1A8LA 2HZFA 1JZDA 4FYUA 1OYJA 4J57E 3TDGA 5DCGA 1A24A 2HZEB 3VURA 3L78A 4YAPA 1ILOA 3QOUA 4KSMA 5GSSA 1YY7A 3CBUA 2YPMA 3LG6A 3K8NA 3KCMA 1Y25A 3TJJA 1X9MB 2C3NA 4F0BA 4CDOA 4TR4A 5GAND 4ECCA 1Z5YE 4MZBA 4NV2A 2TRCP 5DJLA 2F3MA 2GGTA 1GUKA 3A2XA 3CSJA 2E0QA 2RLIA 3C7MA 3GL3A 4TR1B 1WRYA 1EP8A 3D0ZA 5CRGA 1J08A 5ECHB 1OAZA 1PSQA 2CQ9A 1R5AA 4MK3A 2TRXA 2H0GA 4TRXA 1DBYA 5C00A 5IIZA 2ZNMA 4HOJA 5EL8A 2FGXA 3EC3A 2R3XA 2J9HA 2KP2A 4HU9A 4Q5QA 1MD4A 1SENA 2LTKA 2JZRA 1B8XA 2H6XA 1SKWB 4PGTA 4YQVA 1PMTA 1XBSA 2R4VA 2NDOA 3H79A 4ACSA 5HR1A 2K18A 3ZITA 5IOXA 3TJBA 4V1Ag 3EINA 2C0FA 1NSWA 3KMNA 1NHOA 1I5GA 2IJYA 1GSYA 3QD9A 1M2BA 2GZPA 3NIVA 3DVWA 4F2IA 4POLA 3MNGA 2DLXA 1FO5A 1MDIA 4J2FA 4KH7A 2HSYA 2QC7A 5CP1A 4O32A 2B5YA 5CRDA 3VWXA 1H4OA 2MBSA 2LJRA 2YJ7A 1TXXA 2WZ9A 3HVXA 2K9FA 3CYNA 5AIVA 4HJMA 4OMVA 4KAEA 5LCZA 4IP1A 3F9UA 8GSSA 2X99A 1VF4A 3H93A 3ZIVA 4FYCA 2R2JA 5L71A 5DVBA 4ZBDA 2A2SA 2PERA 5A4UA 5H5RA 3RHBA 3ZFBA 4LMWA 2G2QA 3VK9A 3R2QA 2YZUA 1ERWA 2GZZA 4I97A 1HYUA 1GLPA 4OD7A 1VRSD 3GKMA 4KGIA 2XHFA 4JR6A 2DJJA 3E9JB 3CSIA 4HJ2A 2DMMA 3QFBC 3ZYWA 3IA1A 4DSSA 2CV4A 6GSSA 4Q5NA 5ID2B 1XW6A 1ZGNA 3KJYA 3HDCA 2WB9A 9GSSA 5A5KA 7GSSA 4XS6A 5GSTA 1SD8A 4JR4A 3GSSA 5J41A 5FWGA 4RI7A 4MCUA 2CA8A 2H72A 2H1GA 3M0FA 1X5DA 4ID0A 4ILFA 3KP9A 3CXGA 3BJ5A 4O7HA 2LQOA 1F6MC 3GNJA 3ED3A 4MZCA 2N5FA 1Z7PA 5H5QA 1XW9A 3KMOA 1ZYEA 5HR0A 3TGZA 1ZL9A 4RQXA 4N30A 1A0FA 13GSA 1AQXA 2IMKA 3CSHA 4TR1A 5DALA 5GAPD 1UA5A 2JSYA 1Y6EA 2FA4A 3HHVA 3KP8A 3FZ9A 4CHSA 2DMLA 5D8IA 1QFNA 3IAM2 4YH2A 1BYEA 3C1RA 3P8WA 1GWCA 2ON7A 2AYTA 2JACA 3GTUB 1J9BA 4ZBAA 4WEYA 2JU5A 1WE0A 4WBRD 2C3QA 1ZOFA 2I1UA 1K0NA 4FYBA 5ECRB 4YQMA 3GKXA 3M8NA 5ECOB 2E2GA 4PQ1A 2R5GA 2PVOC 3UVHA 3QAGA 1YDKA 1E6BA 4EKZA 2D2ZA 5EPFA 3ERFA 4MLYA 4WBJA 3LXZA 4KDXA 4XRAA 2H1BA 1DE2A 3AY8A 4PURA 5JWOB 3IAS2 4LL4B 2I3YA 1ACVA 5ECSA 1TP9A 1V57A 1R7HA 1VF2A 4TR0A 1T3BA 1XZOA 4OCFA 1WMJA 1OE7A 2OADA 2XPEA 2VCZA 4YQUA 4LL1B 3GH6A 4V2NA 2EIRA 1FB6A 1SU9A 3EURA 2CAQA 2EIQA 5FHIA 3FR3A 3QCPA 1B9XC 1FAAA 1EEMA 4ZL7A 1EGOA 2C4JA 2ALBA 1MD3A 1GRXA 2DJKA 2OKAA 1K0OA 1O7UA 3KIJA 1A0RP 2GQLA 3EU3A 1JLWA 5F06A 1IYHA 3UARA 1WOUA 1Q98A 2VCTA 1SKSB 2CVDA 1OC9A 4FO5A 3VI7A 3ZRDA 2C0GA 3DEXA 4ISDA 3EWLA 2GSRA 1DSBA 2V2GA 2XC2A 4EO3A 3QDNA 5J3RA 2GT5A 3U5RE 3NOFA 4QL9A 1T8EB 1YEPA 1AW9A 4MABA 5E59A 5JWQB 4IHUA 1M0UA 3F0IA 4OCEA 3GV1A 2WCIA 2DJ1A 4LLRA 4WETA 2I4AA 1QQ2A 5ECQB 3IBHA 2OE1A 2VCQA 3V1WA 3M3MA 1GUMA 1JZOA 1OC9B 3GUSA 5HFGA 4K7NA 3Q6OA
chains in the Genus database with same CATH superfamily
1TP6A 2CFDA 2B1XB 1QVG2 4NHZA 1AY7A 5A4WA 5BXQA 1HNCA 2MMZA 1T1VA 2NVLA 4WYKB 1HNBA 1RN7A 4POMA 3BBYA 3TRPA 3QAVA 1HKXA 6GSPA 1VF3A 3CRTA 1E97A 1GMRA 1UN2A 5HFKA 4XB5A 1M7TA 3M9JA 4EVMA 1BAOA 5JBSA 4EDZA 1IVVA 1SL2B 3S29A 1PKWA 4EIPA 3S5CA 3EF8A 1AXDA 3G4S3 5AISA 3NUVA 3GA4A 1HNAA 1B48A 1UGHI 1FB0A 3MG2A 1SL0B 1TI1A 4MP4A 1T7PB 3PGBA 3MHEA 5IM9A 1N8JA 4EDYA 1OHPA 3DXBA 4L8OA 3D4AA 3EQQB 2IPAA 1SKRB 1OACA 3FW2A 3MAKA 1JN5B 3HYPA 4X0XA 4D73A 3LTDA 2R6KA 1UUWB 1JJ22 3H4KA 6RNTA 3FZ5A 1GSPA 3L9VA 1BNFA 4MDCA 4KFFA 3KXOA 5IO0A 4MA9A 3T8UA 2XSHB 4PUAA 1O7HB 1RNTA 1F9MA 4XBXA 5IMAA 2BT3A 3FG3A 2H1DA 5ECKB 2CG0A 2LRCA 4ZL9A 1W89A 1ABAA 1O6JA 1YKAA 1V40A 4AJ7A 1PX6A 1JFUA 2XEPA 2IMIA 1ST9A 3DZLA 3IOSA 5FT3A 3Q1CA 1TI3A 1K3LA 2LJKA 1S723 2HSHA 4KUNA 3WT1A 3BNEA 1W6CA 3W6GA 1YJW3 4PTSA 1UCIA 2DBCA 1NJI4 1RGEA 4GSPA 2DJ3A 4J9AA 1Z7RA 3GMFA 1KD14 5CRHA 4HM4B 4HSCX 4BPYA 4MJCA 1AR0A 2PGTA 3ZVJD 1XWAA 3FYGA 4I8BA 2VCXA 1OF5B 2W56B 2VLUA 3MPHA 3CCQ3 3WGXA 2CX4A 1X0RA 1U3IA 1IQYA 3WODG 3QPMA 2ON5A 5B7CA 3PCSA 1AUCA 2RGQA 2Y74A 3L9SA 2VOCA 1B4PA 3F6DA 2MZCA 2VL2C 1X9SB 1BSCA 2E2TA 4IS0A 2CFGA 4J56E 1LXEA 2CX0A 3ALAA 4AGSA 4G19A 2QA43 2H76A 3IDVA 1BNGA 1GSEA 2IMFA 1QJGA 1QXHA 3X3XA 3AGOA 1JB5A 3A2VA 1EZKA 4XTSA 3CC23 3GFKA 2AV4A 3OWSA 1B20A 1IK3A 2WJUA 3HJMA 4YKFA 1E3RA 4RI6A 4GSNA 2UZ8A 3WGEA 4F03A 1NW2A 5KN0A 2Y73A 1W4NA 2L1SA 1K28A 16GSA 4ZXGA 1GD4A 5AEWB 2PBJA 3EN1B 5J4UA 1YF0A 1THOA 3O76A 4G9HA 5D9TA 4DVCA 1B3SA 5J9BA 1GS3A 2HE3A 3VPQA 1OCVA 5COHA 1G7OA 1SK2A 4HM0B 4GLTA 1H75A 2PUKC 1W2ZA 1LVNA 4PEJA 1BRGA 3D4MA 5IMFA 3V98A 3P2AA 4TW5A 4X43A 2A2RA 5D9WA 4I2UA 4CJNA 1C54A 1LU4A 2HRFA 1A23A 3PR8A 4HS1A 1GTAA 1T2HA 4K7OA 4YKGA 2J8XB 8CHOA 3WGDA 4AJ6A 2P0GA 1AC1A 3APSA 4JBBA 4ULXA 3ZL5A 3VWWA 1BEDA 2E2VA 3DGYA 4KW6A 1XOAA 4XDWA 5RNTA 2KF3A 1GMQA 1TDIA 1DMNA 2H01A 4K61A 4IW9A 3D5IA 2Z77A 3AHSA 1JBTA 5EEOA 4BU4A 2XF3A 5CF2A 5D93A 2C11A 4MMMA 4KSOA 1J2BA 1DYUA 4D73B 5IPGA 1ZMAA 1ERUA 5AYSC 1RGHA 4GTUA 2I9WA 1VQL3 5AGYA 1CQGA 1RN4A 1E3VA 4ECIA 1K0DA 4J5GA 2FCHA 1FVKA 1IVUA 5EQLA 1TRSA 1IVXA 2CK3H 4HI7A 3CD63 5DBQA 3QFAC 3EJVA 2HXKA 1KEBA 3TKSC 3LTAA 1FUSA 4OFMA 2YP6A 4JRRA 4AEQA 2YFJB 5BVBA 2NTOA 3UMAA 2AAEA 1PN0A 2QGUA 4NREA 3DYRA 1O7MB 1RRLA 1LOXA 1PKZA 2VM2A 1BNIA 2KP1A 2O7KA 1Z3EA 3RGRA 2OTL3 5G5EA 3B4OA 1EP7A 2OBIA 4MPFA 1TRUA 4N11A 2GSQA 2L4VA 3FZ4A 1C7HA 2VD0A 4HDEA 5I97A 2K8SA 2LV3A 3EYTA 3K0ZA 3ZG0A 1R4YA 2IMDA 2LEGA 3H3HA 1YNVX 1SIIA 3PYJA 4K7IA 3C71A 3CTFA 2RNTA 1BNSA 1XCCA 4RNZA 3X41A 1IV9A 3Q18A 3CMIA 2VL9A 3WYWA 3KTBA 1GNWA 2P5RA 1SK1A 2YFLB 4G2EA 4L0UA 1RJOA 3CNMA 4BL2A 1YJ93 4I5QA 2VD1A 3CTGA 2JDIH 3LOYA 3WR2A 1BUJA 2J23A 1LNIA 2PU9C 2WDUA 3LFLA 1NO3A 1F2EA 1TU5A 1PL2A 3KKGA 1XXUA 2CWTA 1NHYA 2N5BA 2FD3A 2YCDA 4K1FA 2F8FA 1EG9B 2OE0A 4WKWA 1BRIA 19GSA 1M9AA 2XBQA 5IPHA 3ERGA 3UL6A 1BRJA 3ZZXA 3DKSA 2HNLA 1EV4A 3F4RA 1Z1SA 2IYJA 5IW9A 2XBIA 1TKDB 5D82A 1O8XA 1I0VA 2A4HA 3APOA 4IJ3A 2V1MA 3VSYA 4KE3A 4O2HA 1JZWA 2N5AA 1PD21 2P5QA 3RBTA 2LQVA 2UGIA 5B6NA 3BLZA 4POKA 4JEDA 5KN2A 1GSQA 2FWHA 1MWSA 3CCR3 1VZZA 3ZG5A 2WULA 4G0LA 1NB3I 2H6ZA 1U6TA 3ME8A 1Q864 2KAAA 1XVWA 2LSTA 3KZQA 3W8JA 1IV7A 1N9JA 3D4TA 1G6YA 12GSA 3M9KA 2E2MA 3R3EA 4ML6A 2CZ3A 4AKYA 2L5OA 3MWZA 3C1SA 2HMJB 4MZWA 2H0IA 3LEFA 1Q814 1S3DA 3I9V2 3MYDA 3CC73 2OA7A 1U5OA 4GQCA 1O85A 1MWTA 2IL3A 2YWNA 3JCML 3UVTA 3ZVJA 2YWIA 1PX7A 3DVXA 1PRXA 1TTZA 2GVPA 2A2PA 3LYPA 3SWLA 2HMMB 2RM5A 4V1Ap 1DVDA 3GTUA 4J5KA 1TK8B 1NM3A 4LMVA 4LEHA 3F4SA 4USSA 1K41A 1PL1A 4HZBB 2F4YA 1DUGA 2M72A 1O7WB 1VF1A 2BHMA 1XW5A 1K0AA 2DKHA 3NM2A 5KEJA 4HKVB 5JPUA 2B5EA 2I81A 2K6VA 2JSZA 3M8CA 3X42A 3GX8A 4A5PA 5IO2A 3FSDA 2H8LA 3P7XA 4HU7A 3CME3 4GB5A 4AJ8A 1SL1B 3TJFA 1BQ7A 2FHEA 2H66A 1MEKA 4K90B 1GL8A 4IKHA 4L5LA 4ZIJA 1MOLA 4JZQA 1FG4A 2AAWA 2GZYA 4ZL8A 2GTUA 6GSWA 1JHBA 1YF1A 3E99A 3DMLA 1SYXA 3NX0A 2MYGA 1TRVA 3ZLPA 3G6E3 2KUCA 1WJKA 3F8UA 4NHWA 4KB3A 3IPTA 1BRHA 1STFI 4WF4A 5LC7A 1DMQA 2IA7A 1NU3A 3H1NA 1CEWI 4NAXA 2L57A 1LOVA 4EW5A 4F0CA 1A2LA 3GAXA 2D42A 3TRXA 5H5SA 4O5UA 2P38A 3BNCA 4TXOA 3VLNA 4BA7A 4CCVA 3QAWA 2B6MA 2Q07A 2OWPA 5ECIB 1MTCA 4KT3B 4JRFA 3EMXA 2F98A 2V1LA 2P05A 1SYRA 5DQYA 1VQ93 3UL5A 3D5JA 2MBTA 3QR6A 2H71A 2YV7A 2IMJA 3HJOA 5BIRA 3QK9A 1MDJA 1DE1A 3DD3A 4Z2TA 1USBA 2KLXA 1G7EA 2WGRA 5JWRB 4TVEA 2I9HA 1TU7A 3C73A 4RUVA 3OXAA 4MH3A 1OUNA 2RUFA 5CRWA 1GD3A 3IXRA 1W2B2 4MF7A 5D9XA 3LZAA 2BTOT 1RGAA 2FA8A 2LQQA 1SJZA 3FCSB 1K9M4 1WIKA 4FQUA 2ZCTA 2UUGC 3N5OA 1YJ6A 5C04A 1Q40B 4IBPA 4ZB8A 1WPIA 3ERWA 1WMPA 2CG1A 1XOBA 4PUFC 5G30A 5CREA 2FWEA 4X2HA 3Q74A 1RCKA 4HBRA 6GSVA 5IG5A 3HZ4A 4BTYA 4IP6A 3H8QA 4V2MA 3GH9A 4TX4A 3AMOB 4R4KA 3WMDA 1UUVB 4EL1A 4WF5A 2GDRA 3GHAA 3G16A 4LZIA 4ML1A 1SD9A 2R4IA 1QUWA 3UEMA 1JV2B 1WP0A 2YANA 1UCKA 3DGOA 2VL2A 3K63A 4Q5FA 2L4CA 4HM3B 3E0UA 2HOHA 3IK9A 3UOMA 3LT8A 3D5GA 1A8YA 2Z7AA 1GULA 3CCS3 3FGYA 3F3RA 5E4WA 3PINA 3RPNA 2VCVA 2IUJA 22GSA 5IENA 1AQVA 1UUGB 1FZUA 2VL3A 2XPDA 2Z76A 4GF0A 3K9MC 2BJXA 2O89A 1J0FA 3GSTA 5DAKA 1XIYA 5LD0A 3BU4A 2W0QA 4WR4A 3BNDA 1OC3A 1ASKA 2B1KA 3BB9A 3NBJA 1YI23 2X8CA 3KH9A 2IFQA 5AN1A 2ZUPA 4HQZA 3NZNA 4OVMA 2ZHXB 3IR4A 1MDKA 6GSYA 3S9FA 2QSIA 1BSEA 3G7JA 2B7JA 1ULJB 3ZTLA 4EXJA 4U13A 1YIJ3 2KOKA 3DIEA 5A4VA 1G0TA 1UGIA 1D6UA 1HYFA 2MMNA 4EUYA 2HMKB 2WOHA 1MWRA 1KBNA 3ZREA 4BVXB 2CIUA 2H0HA 2R0CA 4L8EA 4NWYA 5ECLB 3RNTA 2YWOA 1GSSA 3FKFA 2OJLA 1TRPA 3EVIA 2ES7A 1KWIA 3MSZA 1BOXA 1B27A 17GSA 1R26A 2GEXA 1TK0B 4X2OA 2PN8A 3ER7A 3NBRA 5AIXA 10GSA 2WO0A 3KN4A 4XM4A 2M7OA 2H73A 1VGLA 1M1XB 5D9VA 1EOGA 3FHKA 1OHSA 3G7IA 18GSA 3W8SA 4Z2UA 1S3RA 5CYYA 3I0YA 3ME7A 1C72A 3LQ7A 2BMQB 4HM6B 1YVSA 4MJDA 1X1UA 3U6VA 3SEDA 3F6FA 4O92A 1W4VA 7STDA 1SJIA 1BRNL 3DGNA 4JE1A 5INYA 3TCOA 2ML5A 2C80A 1CYVA 4FCMA 2PZVA 3QRDA 1JNQA 1KQS2 4XCSA 2MMOA 2GU3A 1A2PA 5IMDA 2CX1A 5TGNA 4GCIA 5GZZB 1URMA 2LUSA 3DWVA 4MPGA 5HQPA 3HVNA 4IVFA 1IYYA 4H86A 2GSTA 1UVZA 4TN8A 2DIZA 1QMVA 1G02A 3BCIA 3KM6A 3UBKA 5IG3A 5D96A 1VQ83 2X64A 4TXVA 2E7PA 5DALB 2O3OA 1FOHA 3I43A 1Z6MA 3MG3A 4CW9A 4XS1A 1M9BA 1GSUA 4FMBA 1LJRA 1BRSA 5KN3A 2B24B 3DUKA 5J5NA 4K2DA 1V2AA 5DCHA 3SXXA 3LORA 5IEOA 1DE3A 2CWUA 2FGTA 2C0EA 1G6WA 2AUVA 2KCDA 3MWHA 3PH9A 5HR3A 3STDA 2OOVA 3A2WA 4CDLA 5ABRA 4EBGA 1X5CA 3APQA 2AJQB 2B5XA 2LKUA 3GL5A 1BAYA 5KN1A 5G2ZA 4N0ZA 3ZMLA 1F3BA 1JLVA 5IERA 5G31A 3CCV3 5AIFA 2GLRA 3MKIA 1AAZA 3HI7A 1YKCA 5D81A 4GWRA 2OE3A 3NQZA 1I2FA 4KFEA 3P90A 3HA9A 4O5RA 2HRAA 4N6UA 3O8YA 2XRXB 3F7XA 5M19A 4OO5A 1RDSA 4XS4B 3WOEB 1T2IA 3FZAA 3GZYB 2HMLB 4LMIA 3F4TA 3VPTA 5STDA 4TXOB 1EEJA 3PXMA 3H51A 3G0KA 2EIOA 2LYXA 2XH9A 2P0MA 4G1MB 4EV5A 2GT6A 2HLSA 4V2LA 4ECJA 3B8LA 2E2UA 4MEIA 3DY5A 1THXA 2YWMA 3KGKA 3FG1A 1GTBA 2W56A 5D73A 1W00A 4IQ1A 1FUTA 4DEJA 1OHOA 3LJRA 2H74A 3X40A 5HR2A 2AB6A 3KSED 3TB2A 3MYTA 5CK6A 1CQSA 3FG4A 1QVF2 2HRNA 3FKAA 2KRTA 2QGVA 1AQWA 1ML6A 4YAVA 1KNGA 3O6TA 1SJWA 2GS3A 1TIJA 1TOFA 3RDWA 5KP3A 3KSPA 1RGKA 2WS2A 1G96A 5F8BA 3B7CA 1XWGA 3O3TA 2YX9A 1T4ZA 5EVOA 2RIIA 2JZTA 1IVWA 4EXRA 1B9YC 2M80A 1KTEA 2LRTA 2DIYA 4XHMA 2CWVA 4KX4A 1NDOB 5KP1A 3HD5A 5HFIA 1XWCA 1EV9A 2GEYA 4TOPA 2YOIA 3BIRA 2DJ0A 1OKTA 3DGQA 2QKEA 3CCM3 1B2UA 3TOTA 1LOWA 4L7KA 3HIIA 4N10A 1DETA 4L5OA 4IJIA 5DQSA 1WQLB 1PA3A 1AIUA 1GOUA 1M3IA 2PVQA 5BMUA 3Q19A 1BNJA 2KF4A 5D83A 1GLQA 2RCDA 3FEUA 1U87A 4BVXA 2FNOA 2V41A 2H30A 4XRDA 2H70A 3EE2A 3V99A 1UC7A 2LNSA 5CO3A 5LNKe 3U97A 4OFNA 1BU4A 5JCUA 3Q90A 1ISKA 2GBXB 9RNTA 5DDLA 3JUMA 3WA3A 3TRQA 3CXC2 3IK7A 1AVKA 1RGLA 4X4JA 1YGEA 4HVNA 3Q3FA 2IY2A 3DRNA 5DAKB 2VAFA 3S27A 3F3QA 3K7CA 1JRQA 4K5RA 4I2TA 2CT6A 4OK0A 2HYXA 1U8CB 2JADA 1ZZYA 1TRWA 1M2AA 1I3IA 2NBSA 4AF2A 2GQMA 1JBRA 2FUG2 4LSOA 1EKMA 3OV4A 5M18A 1Z9HA 2X8GA 1GSFA 4N6MA 1VQ43 1GP1A 5JCWA 3BCKA 1YQ1A 3VI5A 3L4NA 3TJGA 2CC3A 1V58A 3CU3A 1UCLA 3LXTA 1V98A 5M1AA 2PWJA 4Q5RA 1MGRA 2FY6A 3UBLA 1LBKA 4K0GA 3VWUA 1B21A 3JUNA 3IHGA 2LNTA 2B1LA 4ORLA 2OOVC 3S28A 1ROAA 2K54A 3LSZA 4QL7A 4KF9A 5IQYA 4JU5A 3CC43 4BVYB 1TK5B 4FH8A 3OWUA 3WD6A 1XG8A 2C3TA 2HZEA 4KDYA 4MJBA 1M99A 2BO9B 3EBYA 5B6MA 5CAXA 3CCL3 1F3AA 1TU8A 5KP4A 1A2MA 3IC4A 5F07A 1IYIA 4O5QA 2YJHA 1YHQ3 4CY6A 2FWGA 1ON4A 5ECNB 6GSXA 4KCEA 2HMOB 3FMWA 4BL7B 2XGLA 1K0CA 2HI7A 3F63A 4X1UA 3GZRA 4XDVA 2VIMA 3GZBA 2W9QA 1RCLA 1HQOA 2B3SA 4KDUA 2DC5A 1PGTA 3TKSA 1UDII 2CH9A 4PQHA 2YV9A 1TW9A 3OWYA 2C8UA 2Z9SA 4F82A 5CNWA 1FGQA 3DM8A 1U3AA 2WRTA 1YEXA 2G0FA 3RAZA 4HEA2 4MH2A 2FXTA 1M1K4 1I2GA 1QAFA 2RM6A 1O7GB 2KF6A 4GQFA 3E3EA 3I553 2CKFB 2V6OA 5B8AA 4FMCA 2OBKA 3NQYA 4POBA 3T8NA 1UI7A 3SX1A 1N2AA 1XPVA 1ZCPA 3EC9A 3ZMKA 1BIRA 3FF0A 1BX9A 2YN1A 1RK4A 3I69A 1RMSA 5IMVA 1BNEA 3D21A 6GSTA 1I0XA 2WGOA 2L6CA 1EOHA 4GSSA 1S3AA 4ZB9A 1K0BA 3FRCA 3UAPA 4I6XA 4HZ4A 4FIWA 3GRXA 2O87A 1GUHA 1R4WA 2P0XA 3CRUA 2H75A 3EHCA 3WT2A 5KOXA 2EC4A 1BNRA 1EWXA 1OE8A 2VCWA 4WR5A 3TKSE 3A3TA 3TKRA 1IDPA 4KCAA 2IN3A 1EQKA 5FGOA 2GSSA 3TJKA 3WA2X 1XWBA 3L0RA 4L0WA 2A4VA 4N6LA 3HY2A 4PNGA 3CCE3 2GSPA 2V32A 5JCGA 1YVBI 5ELUA 3G7YA 1K0MA 2BMRB 4HZ2A 5IOWA 4EE0A 4K0NA 2YFIB 4PNFA 5AIHA 2O9UX 4NPBA 3SBCA 1Q42A 1IQ8A 3HVSA 3MDKA 3D79A 3CMA3 4EC0A 1XVQA 3DMCA 3LMLA 2K0MA 2KHPA 1B2ZA 2Z6BA 2XSOB 2ZA4A 1JKGB 1FOVA 3GKKA 20GSA 4RNTA 4MJAA 1LNHA 3IV4A 2P09A 2VM1A 1T4YA 3OR5A 1OKDA 3LGCA 4NXIA 1K3YA 3X3ZA 1K8A4 1GTIA 4MMXB 1VQP3 1Q9EA 4CY8A 1SK0A 2R0GA 3TOUA 3FZWA 3NV0B 2SARA 1XFLA 3GURA 1US1A 1Q7Y4 3UL3A 14GSA 1Y4KA 3X3YA 3J7Yd 1BJXA 4ZBBA 3ZIJA 1N5PA 1GH2A 2NPBA 1PFOA 1ZO2A 1RLSA 1I9DA 2PNCA 3K5TA 2C0DA 1YZXA 3M1GA 2IMEA 3TUEA 2MMAA 3VF1A 5J9CA 3IJEB 4HQSA 5IMZA 1PY3A 4MMZB 2QIYA 5F05A 1ERTA 1SQWA 2R41A 1ZS7A 1GNEA 2WGQA 3HZ8A 5AYRB 1PN9A 1CH0A 4HOHA 1O73A 3FY7A 3SYUA 3GKNA 5IMCA 1S5AA 4HJLB 3KTLA 4IGJA 3Q2PA 3D22A 3HXSA 5B8BA 1ZYPA 1O81A 4DSQA 2H6YA 3UNLA 1BSDA 4Z7XA 2AHEA 1B2SA 4GSTA 1O7NB 2F51A 1AQZA 3RHCA 4KVHA 1N5HA 5G5FA 1XWKA 1WWJA 4GHOA 2CAIA 1I70A 2H1AA 2BMXA 2LS5A 4P3YB 1X9WB 1GY7A 4XBYA 1LQMB 1KC84 1VQK3 4Z2RA 2O85A 3GYKA 3J7Yk 1S3CA 3BOAA 4DSSB 1VQ73 4HM2B 2CVBA 1U88A 2JZSA 1K3OA 5ELJA 4IELA 3EMPA 2W03A 3IPZA 2DJ2A 4PQIA 4OWYA 2REMA 1NB5I 2RUEA 4QQ7A 2XFTA 1VQO3 3EU4A 1TUHA 2JL4A 1QAKA 2CW9A 1R5PA 1BUQA 1FW1A 1JB2A 2IFQB 3LYKA 3L0HA 1QGVA 3RGAA 4O02B 4N6NB 3PZWA 1GSDA 4KA0A 4OO4A 4QWTA 2CHCA 4PXOA 2V6KA 1GOVA 2STDA 3FR9A 4EF0A 4G10A 2VLTA 4XBTA 4TKYA 1SJ6A 1B4QA 3WOFB 3C8EA 2QEX3 3IHQA 1JZRA 3ZFZA 5G1LA 4IQAA 1I2EA 3KE7A 2PMTA 3FK8A 2CVKA 3HVVA 3GX0A 1GMPA 2TIRA 3HKRA 5ECMB 1IU7A 3DGLA 3PCRA 1CQHA 3FH1A 4DSRA 3VWVA 1QK8A 4H3UA 1F8NA 2KXGA 2IIYA 1D6ZA 4LYLB 3L9UA 3US3A 4ZB6A 4K1VA 3GIXA 1I3FA 3HJPA 3SOYA 2LJAA 1TRQA 2UX0A 2LRNA 2L6DA 3UJ1A 3LWAA 1Q824 4FCJA 5EY6A 3KZTA 3KEBA 2R37A 1FYSA 2F56A 1OPYA 1UI8A 2C4BA 2DSAA 4N0VA 1WMNA 1BG5A 3KD0A 2P31A 4HM7B 3D3LA 2L4QA 3NHXA 3HZPA 2CZ2A 1ZYNA 3GN3A 1RTUA 2YZHA 1L5GB 4MNNA 2IWTA 4LA1A 3NBBA 4BTWA 4E8HA 1A2VA 5HOHA 2H19A 4Q53A 2HFDA 3UIWA 4HM1B 2IUKA 2SBLA 5IG0A 3EBTA 1HD2A 4NMUA 2L59A 1EGRA 1W6GA 4BIRA 5CXOA 4JF8A 1A67A 1TJDA 3I6AA 4GRFA 1BVIA 6GSUA 1KSIA 1V9WA 5AEUB 2GQKA 3BD2A 3J7Yb 1Q40A 2OTJ3 5GSPA 1FHEA 3IRAA 1K734 4K5SA 3EE1A 5FW5A 2FLSA 1W7CA 2M46A 3QMXA 4GXZA 5KOWA 5G1KA 3HCZA 4MF5A 5F0GA 4BVYA 4OUQA 2DKIA 1UW1A 2CFKA 2L5LA 2VUPA 4MJEA 4PX1A 3G9BA 1ZYQB 4NV5A 4FR9A 2A15A 1X1YA 1GTUA 3LXUX 2GBWB 1F37A 1O8WA 2QA2A 4K9ZA 2W6JH 2HT9A 5LC6A 4G0IA 1TFKA 2FWFA 4BL7A 2ZL8A 1RNBA 5G2GA 4TR3A 3FR6A 1Q4JA 1R4CA 2GU1A 2X8HA 4K8MA 3FLJA 5BU4A 5ELGA 4BWQA 4HZ9B 2WFCA 1OC8A 2OCTA 3TKQA 4WXTA 3AGNA 3RPPA 5AIIA 1JB4A 4E8EA 1OVNA 1NNVA 2JQ5A 5ID2A 2CFWA 4OFTA 3A5WA 1Z6NA 4K6XA 3IE3A 1GY6A 4KNDA 4ZILA 3IMAB 1M3JA 2K8VA 1T00A 1M2DA 1RQMA 3MG1A 3VFIA 4XIHA 3N9JA 2YNXA 4XS4A 2VO4A 3LYGA 5DJMA 5ECPB 1V74A 3PGTA 3ZFLA 1FGRA 1N9EA 5ENUA 4ECBA 4F9ZA 1E2YA 1PQNA 3A76A 2F8AA 4EV2A 3KH7A 1RW1A 2B7KA 2OQEC 3EN8A 3UB1A 1VQM3 1X5EA 1SPUA 1Q7HA 2OACA 2O8VB 2PPTA 4IN0A 1ERVA 4HUAA 1WTHA 4R9KA 4RQRA 3G713 5CF1A 4FCZA 1B2XA 2F9SA 11GSA 1MWUA 3LTBA 3F9SA 4K1UA 3TKPA 4GL6A 4MF6A 1A2JA 3CCU3 4BWSA 3GRDA 1I8VA 3D6IA 1M904 4HYZA 1SARA 3JVCA 2VLVA 2C1YA 2CX3A 5ELAA 3ISOA 1FVJA 1A8LA 1LQGC 2HZFA 1JZDA 4FYUA 2WOFA 3TDGA 1OYJA 4J57E 4R1KA 4HM5B 5DCGA 1A24A 2HZEB 3VURA 3L78A 4YAPA 1ILOA 3QOUA 4K2XA 4KSMA 4WYKA 3SLUA 1OF5A 5GSSA 3LT9A 1YY7A 3CBUA 2YPMA 3LG6A 3DXOA 8RNTA 3K8NA 4ICYA 3KCMA 3DGMA 4WFOA 3WDGB 1Y25A 4N6V0 3TJJA 1X9MB 4O8SA 5AI1A 2C3NA 4F0BA 1BSAA 3NM7A 4CDOA 3AMOA 3HX8A 4TR4A 1RHLA 5GAND 2MC8A 5IF6A 4ECCA 1Z5YE 3EPTA 3HK4A 3CCJ3 4MZBA 1STDA 1IQXA 2TRCP 4NV2A 3V92A 5DJLA 2F3MA 2GGTA 1GUKA 3A2XA 3CSJA 4WP5A 2E0QA 2RLIA 3C7MA 3GL3A 4TR1B 1WRYA 3N54B 1FGMA 1EP8A 3D0ZA 5CRGA 2W2CA 1J08A 5ECHB 1OAZA 2HRKA 1PSQA 2CQ9A 1R5AA 4MK3A 1GOYA 2TRXA 4BTXA 3LW9A 2H0GA 4TRXA 1DBYA 5C00A 3OW22 5IIZA 2ZNMA 4HOJA 3KIIA 1VQ53 5EL8A 2FGXA 3EC3A 2R3XA 2J9HA 2KP2A 1WMOA 4HU9A 1FUWA 4Q5QA 1JN5A 1CYUA 1MD4A 1SENA 2LTKA 1D6YA 2JZRA 1B8XA 2H6XA 1SKWB 4PGTA 4YQVA 1PMTA 1XBSA 2R4VA 2NDOA 4FMAA 3H79A 4ACSA 4EC6A 2XR8B 5HR1A 1DMMA 2K18A 3ZITA 5IOXA 3TJBA 4V1Ag 1SIHA 3EINA 2C0FA 2BMOB 1NSWA 3KMNA 1W01A 1NHOA 3FF2A 1LRAA 1I5GA 1IT8A 1GSYA 2IJYA 3QD9A 1YIT3 1M2BA 2GZPA 3NIVA 3DVWA 4F2IA 4O3VA 4POLA 5DREA 3MNGA 4HAAA 1RSNA 2X49A 2DLXA 1FO5A 1MDIA 1PFPA 4J2FA 4KH7A 2GXFA 2HSYA 2D1WA 5A0OB 3F40A 2QC7A 2W9PA 1MGWA 1ULIB 3F8HA 1OH0A 5CP1A 2QA1A 4O32A 2W04A 2B5YA 5CRDA 3VWXA 1AVLA 1WNHA 1AV4A 1H4OA 2MBSA 4LGQA 2LJRA 2YJ7A 1TXXA 1HZ1A 2FNQA 7GSPA 2WZ9A 3HVXA 2K9FA 3CYNA 5AIVA 4HJMA 3N8BA 4OMVA 3F7SA 2AADA 4KAEA 3URPA 5LCZA 4IP1A 2RSXA 3F9UA 8GSSA 4KZ1A 3EX9A 2X99A 1VF4A 4N6OB 3H93A 3ZIVA 3CPW2 3KFQC 4FYCA 1NWWA 2R2JA 5L71A 5DVBA 4ZBDA 2A2SA 2PERA 6STDA 5A4UA 5H5RA 3N9HA 3RHBA 3ZFBA 4LMWA 2G2QA 3VK9A 3R2QA 2X4AA 3U1WA 2YZUA 2ZDJA 1ERWA 2GZZA 1DVCA 4I97A 2XGNA 1HYUA 1GLPA 4OD7A 1VRSD 5AIGA 1ZGXA 3GKMA 1MNLA 1N8QA 5IEPA 4KGIA 1RRHA 2XHFA 4JR6A 2DJJA 1RGFA 3CSIA 3E9JB 4HJ2A 2DMMA 3QFBC 3ZYWA 3B4PA 3IA1A 4DSSA 4RBNA 1OGZA 2CV4A 4H61A 1GY5A 4CPKA 4EIQA 1FGTA 2RFRA 1RGCA 6GSSA 4IPBA 4Q5NA 5ID2B 3GWRA 3WHOA 1XW6A 3HOHA 1VQQA 1ZGNA 3JUOA 2CFLA 3KJYA 3HDCA 1RN1A 2WB9A 1JKGA 9GSSA 1BGSA 1JBSA 4I4KA 5A5KA 7GSSA 2RBIA 1EUIC 1PU4A 1FW7A 4ZM8A 2HSMA 4XS6A 5GSTA 1B2MA 1SD8A 4JR4A 3GSSA 5J41A 5FWGA 1IT7A 4RI7A 4MCUA 2INXA 2CA8A 2H72A 2H1GA 3M0FA 1X5DA 2F5MA 4J8TA 4ID0A 4ILFA 3KP9A 3JUQA 3CXGA 3BJ5A 4O7HA 5BRTA 4MMYB 2C10A 2LQOA 5CLKA 1F6MC 3GNJA 3ED3A 4MZCA 3JUPA 1LOYA 2N5FA 1Z7PA 5H5QA 1XW9A 1TTOA 3KMOA 1A2KA 3IC8A 1O7PB 1ZYEA 5HR0A 3TGZA 1UCJA 1ZL9A 4RQXA 2ML6A 3BNBA 4N3VA 3EB8A 4N30A 1A0FA 4RNYA 13GSA 1AQXA 2IMKA 1RKYA 3CSHA 3MSOA 4TR1A 1BSBA 4DKIA 5DALA 2F99A 2F86B 5GAPD 1UA5A 2JSYA 1Y6EA 4EYCA 2FA4A 3HHVA 3KP8A 1W6YA 3D9RA 3FZ9A 4R9LA 4CHSA 2DMLA 5D8IA 3NXJA 1QFNA 3CQFA 3IAM2 4YH2A 1BYEA 3C1RA 3P8WA 2OQEA 5IG4A 1GWCA 2ON7A 2AYTA 2JACA 3GTUB 1J9BA 4ZBAA 1W5ZA 3SVAA 4WEYA 3LH4A 2JU5A 1WE0A 1T5YA 4WBRD 1VQN3 2C3QA 1ZOFA 2I1UA 2K3DA 1K0NA 4FYBA 5ECRB 4YQMA 4L8PA 3GKXA 3M8NA 4BIKA 5ECOB 2E2GA 4PQ1A 4IT7A 2R5GA 2PVOC 3S67A 3UVHA 3QAGA 1YDKA 3HIGA 1E6BA 3F14A 4EKZA 3NV0A 2D2ZA 5EPFA 3ERFA 3I563 4BL3A 3GSPA 1HU9A 4MLYA 1FGOA 4IIAA 4WBJA 4N6TA 3LXZA 4KDXA 4XRAA 2H1BA 4NHFA 1DE2A 3PPUA 3AY8A 4PURA 1N8R4 5JWOB 3IAS2 4LL4B 2I3YA 1ACVA 5ECSA 1TP9A 4WWUC 1V57A 1R7HA 1VF2A 4R80A 4TR0A 1T3BA 3CPOA 4STDA 1XZOA 4OCFA 1WMJA 1X1WA 1RGGA 1OE7A 3DH2A 1X1XA 2OADA 2XPEA 2HMNB 2VCZA 3SOAA 4YQUA 3A5IA 1YGWA 4LL1B 3F8XA 3GH6A 4V2NA 2EIRA 1FB6A 1SU9A 3EURA 2CAQA 3G8ZA 3UJMA 1GYBA 2EIQA 5FHIA 3GZXB 3FR3A 2F5WA 2BIRA 1YJN3 1TFOA 3QCPA 1VQ63 1B9XC 3LTCA 4G0KA 1W02A 1FAAA 1EEMA 4ZL7A 4FMDA 1EGOA 3OX9A 2C4JA 1ROVA 2ALBA 1QALA 2MF7A 1MD3A 1GRXA 4AKZA 2DJKA 1BRKA 3PS8A 4RZMA 2OKAA 3RDEA 1K0OA 4KFDA 1O7UA 1OGXA 3KIJA 1A0RP 2GQLA 3EU3A 3CNXA 1JLWA 5F06A 1IYHA 1M9GA 3UARA 1EA2A 1WOUA 1Q98A 2VCTA 1SKSB 3ROBA 2CVDA 1OC9A 4FO5A 3VI7A 3ZRDA 1A90A 2C0GA 3DEXA 4ISDA 3EWLA 4WHAA 1PYLA 5EVHA 2GSRA 3MIXA 1DSBA 2V2GA 5JPPA 2XC2A 2R0PA 4EO3A 3QDNA 5J3RA 2GT5A 3NOFA 3U5RE 4QL9A 1T8EB 1YEPA 3ECFA 2XFSA 1AW9A 3KCHA 4MABA 5E59A 1ZX2A 1QMAA 5JWQB 4IHUA 1M0UA 3F0IA 4HM8B 2BU4A 4OCEA 3GV1A 3VGNA 2KF5A 2WCIA 2DJ1A 3A5EA 2BNGA 4LLRA 7RNTA 5HGRA 4WETA 2I4AA 1BANA 1QQ2A 5ECQB 3IBHA 5DRVA 2OE1A 2VCQA 1FA3A 3V1WA 3M3MA 1GUMA 1JZOA 3T0UA 3AHWA 1OC9B 3GUSA 5HFGA 4K7NA 3Q6OA
chains in the Genus database with same CATH topology
4NHZA 5A4WA 1HNCA 2MMZA 1T1VA 2NVLA 1HNBA 4POMA 3BBYA 3TRPA 3QAVA 1VF3A 3CRTA 5HFKA 1UN2A 1M7TA 3M9JA 4EVMA 4EDZA 1SL2B 1PKWA 4EIPA 1AXDA 5AISA 3GA4A 1HNAA 1B48A 1FB0A 1SL0B 1TI1A 4MP4A 1T7PB 5IM9A 1N8JA 4EDYA 3DXBA 2IPAA 1SKRB 3FW2A 3MAKA 3HYPA 4X0XA 4D73A 2R6KA 3H4KA 3FZ5A 3L9VA 4MDCA 3KXOA 5IO0A 4MA9A 4PUAA 5IMAA 1F9MA 2H1DA 5ECKB 2LRCA 4ZL9A 1W89A 1ABAA 1O6JA 1YKAA 1V40A 4AJ7A 1PX6A 1JFUA 2IMIA 1ST9A 3IOSA 5FT3A 1TI3A 1K3LA 2LJKA 2HSHA 4KUNA 3WT1A 3W6GA 4PTSA 2DBCA 2DJ3A 1Z7RA 3GMFA 5CRHA 4BPYA 4MJCA 2PGTA 3ZVJD 1XWAA 3FYGA 4I8BA 2VCXA 2VLUA 3WGXA 2CX4A 1X0RA 1U3IA 3QPMA 2ON5A 5B7CA 1AUCA 3L9SA 2VOCA 1B4PA 3F6DA 2MZCA 2VL2C 1X9SB 4IS0A 4J56E 4AGSA 4G19A 2H76A 3IDVA 1GSEA 2IMFA 1QXHA 3A2VA 1EZKA 4XTSA 3GFKA 2AV4A 2WJUA 3HJMA 4YKFA 4RI6A 4GSNA 2UZ8A 3WGEA 4F03A 1NW2A 5KN0A 16GSA 4ZXGA 2PBJA 5J4UA 1YF0A 1THOA 3O76A 4G9HA 5D9TA 4DVCA 5J9BA 2HE3A 3VPQA 5COHA 1G7OA 1SK2A 4GLTA 1H75A 2PUKC 3D4MA 5IMFA 3P2AA 4TW5A 4X43A 2A2RA 5D9WA 4I2UA 1LU4A 2HRFA 1A23A 3PR8A 4HS1A 1GTAA 4K7OA 4YKGA 3WGDA 4AJ6A 2P0GA 1AC1A 3APSA 4JBBA 4ULXA 3ZL5A 3VWWA 1BEDA 4KW6A 1XOAA 1TDIA 2H01A 4IW9A 5D93A 4MMMA 4KSOA 4D73B 5IPGA 1ZMAA 1ERUA 4GTUA 5AGYA 1CQGA 4ECIA 1K0DA 2FCHA 1FVKA 1TRSA 4HI7A 5DBQA 3QFAC 2HXKA 1KEBA 3TKSC 4OFMA 2YP6A 4JRRA 2NTOA 3UMAA 1PN0A 3DYRA 1PKZA 2VM2A 2KP1A 2O7KA 1Z3EA 5G5EA 1EP7A 2OBIA 4MPFA 1TRUA 4N11A 2GSQA 3FZ4A 2VD0A 4HDEA 2K8SA 2LV3A 3EYTA 2IMDA 2LEGA 4K7IA 3C71A 3CTFA 1XCCA 3Q18A 3CMIA 2VL9A 3WYWA 3KTBA 1GNWA 2P5RA 1SK1A 4G2EA 4L0UA 4I5QA 2VD1A 3CTGA 2J23A 2PU9C 2WDUA 3LFLA 1F2EA 1PL2A 1XXUA 1NHYA 2N5BA 2FD3A 2YCDA 4K1FA 2F8FA 2OE0A 4WKWA 19GSA 1M9AA 2XBQA 5IPHA 3ERGA 3ZZXA 3DKSA 2HNLA 1EV4A 3F4RA 2IYJA 1TKDB 2XBIA 1O8XA 4IJ3A 2A4HA 3APOA 2V1MA 4KE3A 3RBTA 1JZWA 1PD21 2N5AA 2P5QA 5B6NA 4POKA 4JEDA 5KN2A 1GSQA 2FWHA 4G0LA 2WULA 2H6ZA 1U6TA 3ME8A 1XVWA 2LSTA 3KZQA 3W8JA 3D4TA 1G6YA 12GSA 3M9KA 2E2MA 3R3EA 4ML6A 2CZ3A 2L5OA 3C1SA 4MZWA 2H0IA 3LEFA 1S3DA 3I9V2 3MYDA 2OA7A 4GQCA 1O85A 2IL3A 2YWNA 3JCML 3UVTA 3ZVJA 2YWIA 1PX7A 3DVXA 1PRXA 1TTZA 2GVPA 2A2PA 3LYPA 3SWLA 2RM5A 4V1Ap 3GTUA 1TK8B 1NM3A 4LMVA 3F4SA 4USSA 1PL1A 1DUGA 2M72A 1VF1A 1XW5A 1K0AA 2DKHA 5KEJA 2B5EA 2I81A 2K6VA 2JSZA 3GX8A 4A5PA 5IO2A 2H8LA 3P7XA 4HU7A 4AJ8A 1SL1B 3TJFA 1BQ7A 2FHEA 2H66A 1MEKA 1GL8A 4IKHA 4L5LA 4ZIJA 4JZQA 1FG4A 2AAWA 2GZYA 4ZL8A 2GTUA 6GSWA 1JHBA 1YF1A 3DMLA 1SYXA 2MYGA 1TRVA 3ZLPA 2KUCA 1WJKA 3F8UA 4NHWA 4KB3A 4WF4A 3H1NA 4NAXA 2L57A 4F0CA 1A2LA 3TRXA 5H5SA 4O5UA 4TXOA 3VLNA 4BA7A 3QAWA 2B6MA 5ECIB 1MTCA 3EMXA 1SYRA 5DQYA 3D5JA 2MBTA 3QR6A 2H71A 2YV7A 3HJOA 1MDJA 1DE1A 3DD3A 4Z2TA 1USBA 2KLXA 1G7EA 2WGRA 5JWRB 4TVEA 2I9HA 1TU7A 3C73A 4RUVA 4MH3A 2RUFA 5CRWA 3IXRA 4MF7A 5D9XA 2BTOT 2FA8A 2LQQA 1SJZA 1WIKA 4FQUA 2ZCTA 3N5OA 1YJ6A 5C04A 4IBPA 4ZB8A 1WPIA 3ERWA 1XOBA 4PUFC 5G30A 5CREA 2FWEA 3Q74A 6GSVA 3HZ4A 4IP6A 3H8QA 4V2MA 3GH9A 4EL1A 4WF5A 2GDRA 3GHAA 4ML1A 1SD9A 1QUWA 3UEMA 1WP0A 2YANA 2VL2A 4Q5FA 2L4CA 3E0UA 3IK9A 3UOMA 1A8YA 1GULA 3F3RA 5E4WA 3PINA 3RPNA 2VCVA 22GSA 1AQVA 2VL3A 2XPDA 4GF0A 2BJXA 2O89A 1J0FA 3GSTA 5DAKA 1XIYA 5LD0A 4WR4A 1OC3A 2B1KA 2X8CA 3KH9A 2IFQA 5AN1A 2ZUPA 4HQZA 3NZNA 3IR4A 1MDKA 6GSYA 3S9FA 2QSIA 3G7JA 2B7JA 3ZTLA 4EXJA 2KOKA 5A4VA 3DIEA 1G0TA 2MMNA 4EUYA 1KBNA 3ZREA 4BVXB 2H0HA 2R0CA 4L8EA 4NWYA 5ECLB 2YWOA 1GSSA 3FKFA 2OJLA 3EVIA 2ES7A 3MSZA 17GSA 1R26A 1TK0B 2PN8A 5AIXA 10GSA 2H73A 1VGLA 5D9VA 1EOGA 3FHKA 3G7IA 18GSA 3W8SA 4Z2UA 5CYYA 3ME7A 1C72A 3LQ7A 3U6VA 3F6FA 4O92A 1W4VA 1SJIA 4JE1A 5INYA 3TCOA 2C80A 4XCSA 2MMOA 5IMDA 4GCIA 5GZZB 1URMA 2LUSA 3DWVA 4MPGA 5HQPA 4IVFA 4H86A 2GSTA 1UVZA 4TN8A 2DIZA 1QMVA 3BCIA 3KM6A 3UBKA 5D96A 2X64A 4TXVA 2E7PA 5DALB 1FOHA 3I43A 1Z6MA 4CW9A 4XS1A 1M9BA 1GSUA 1LJRA 5KN3A 5J5NA 4K2DA 1V2AA 5DCHA 3LORA 2C0EA 1G6WA 2AUVA 3MWHA 3PH9A 5HR3A 3A2WA 5ABRA 1X5CA 3APQA 2AJQB 2B5XA 2LKUA 3GL5A 1BAYA 5KN1A 5G2ZA 4N0ZA 3ZMLA 1F3BA 1JLVA 5G31A 2GLRA 1AAZA 1YKCA 4GWRA 2OE3A 3P90A 3HA9A 4O5RA 2HRAA 4OO5A 4XS4B 3FZAA 3VPTA 3F4TA 4TXOB 1EEJA 2EIOA 2GT6A 2HLSA 4V2LA 4ECJA 2YWMA 1THXA 3KGKA 1GTBA 5D73A 4IQ1A 4DEJA 3LJRA 2H74A 5HR2A 2AB6A 3TB2A 2HRNA 2QGVA 1AQWA 1ML6A 4YAVA 1KNGA 3O6TA 2GS3A 1TOFA 3RDWA 2WS2A 5F8BA 1XWGA 3O3TA 1T4ZA 5EVOA 2RIIA 2JZTA 1B9YC 2M80A 1KTEA 2LRTA 2DIYA 4XHMA 4KX4A 3HD5A 5HFIA 1XWCA 1EV9A 4TOPA 2YOIA 2DJ0A 1OKTA 3DGQA 2QKEA 3TOTA 4N10A 4L5OA 4IJIA 5DQSA 1PA3A 1AIUA 5BMUA 2PVQA 3Q19A 1GLQA 3FEUA 1U87A 4BVXA 2FNOA 2V41A 2H30A 4XRDA 2H70A 3EE2A 1UC7A 2LNSA 5CO3A 5LNKe 4OFNA 5JCUA 5DDLA 3TRQA 3IK7A 4X4JA 2IY2A 3DRNA 5DAKB 2VAFA 3F3QA 4K5RA 4I2TA 2CT6A 2HYXA 2JADA 1TRWA 1ZZYA 1M2AA 2NBSA 4AF2A 2GQMA 2FUG2 1Z9HA 2X8GA 1GSFA 1GP1A 5JCWA 3BCKA 1YQ1A 3VI5A 3L4NA 3TJGA 1V58A 3LXTA 1V98A 2PWJA 4Q5RA 2FY6A 3UBLA 1LBKA 4K0GA 3VWUA 3IHGA 2LNTA 2B1LA 3LSZA 4QL7A 4KF9A 5IQYA 4JU5A 4BVYB 1TK5B 4FH8A 3WD6A 2C3TA 2HZEA 4KDYA 4MJBA 1M99A 5B6MA 5CAXA 1F3AA 1TU8A 1A2MA 3IC4A 5F07A 1IYIA 4O5QA 2YJHA 4CY6A 2FWGA 1ON4A 5ECNB 6GSXA 4KCEA 4BL7B 3FMWA 1K0CA 2HI7A 4X1UA 3F63A 2VIMA 1HQOA 2B3SA 4KDUA 2DC5A 1PGTA 3TKSA 4PQHA 2YV9A 1TW9A 2C8UA 2Z9SA 4F82A 5CNWA 1U3AA 2WRTA 1YEXA 2G0FA 3RAZA 4HEA2 4MH2A 2RM6A 4GQFA 3E3EA 2V6OA 5B8AA 2OBKA 4POBA 1N2AA 1XPVA 1ZCPA 3ZMKA 1BX9A 2YN1A 1RK4A 3I69A 5IMVA 3D21A 6GSTA 2L6CA 1EOHA 4GSSA 1S3AA 4ZB9A 1K0BA 3FRCA 3UAPA 4I6XA 4HZ4A 4FIWA 3GRXA 2O87A 1GUHA 1R4WA 3CRUA 2H75A 3WT2A 5KOXA 2EC4A 1EWXA 2VCWA 1OE8A 4WR5A 3TKSE 3A3TA 3TKRA 4KCAA 2IN3A 2GSSA 3TJKA 1XWBA 4L0WA 2A4VA 3HY2A 4PNGA 2V32A 5JCGA 3G7YA 1K0MA 4HZ2A 5IOWA 4EE0A 4K0NA 4PNFA 4NPBA 3SBCA 3HVSA 3MDKA 4EC0A 1XVQA 2KHPA 1FOVA 3GKKA 20GSA 4MJAA 3IV4A 2VM1A 1T4YA 3OR5A 1OKDA 3LGCA 4NXIA 1K3YA 1GTIA 4CY8A 1SK0A 2R0GA 3TOUA 1XFLA 3GURA 3UL3A 14GSA 1BJXA 4ZBBA 3ZIJA 1GH2A 2NPBA 1I9DA 2C0DA 1YZXA 3M1GA 2IMEA 3TUEA 2MMAA 5J9CA 4HQSA 5IMZA 5F05A 1ERTA 1GNEA 3HZ8A 1PN9A 1O73A 3FY7A 3GKNA 5IMCA 3KTLA 4IGJA 3D22A 3HXSA 5B8BA 1ZYPA 1O81A 4DSQA 2H6YA 4Z7XA 2AHEA 4GSTA 2F51A 3RHCA 5G5FA 1XWKA 1WWJA 2CAIA 2H1AA 2BMXA 2LS5A 4P3YB 1X9WB 4Z2RA 2O85A 3GYKA 3J7Yk 1S3CA 3BOAA 4DSSB 2CVBA 1U88A 2JZSA 1K3OA 4IELA 3EMPA 3IPZA 2DJ2A 4PQIA 4OWYA 2REMA 4QQ7A 2RUEA 3EU4A 2JL4A 1R5PA 1FW1A 2IFQB 3LYKA 3L0HA 1QGVA 1GSDA 4KA0A 4OO4A 4PXOA 2V6KA 3FR9A 4EF0A 4G10A 2VLTA 4TKYA 1SJ6A 1B4QA 3C8EA 3IHQA 1JZRA 5G1LA 4IQAA 2PMTA 3FK8A 2CVKA 3HVVA 3GX0A 2TIRA 3HKRA 5ECMB 1CQHA 4DSRA 3VWVA 1QK8A 2IIYA 3L9UA 3US3A 4ZB6A 3GIXA 3HJPA 2LJAA 2LRNA 2L6DA 3UJ1A 3LWAA 5EY6A 3KEBA 2R37A 2DSAA 4N0VA 1BG5A 3KD0A 2P31A 2L4QA 2CZ2A 1ZYNA 3GN3A 2YZHA 4MNNA 2IWTA 4LA1A 4E8HA 2H19A 2HFDA 3UIWA 1HD2A 4NMUA 2L59A 1EGRA 4GRFA 1TJDA 3I6AA 6GSUA 1V9WA 2GQKA 3BD2A 3J7Yb 1FHEA 3IRAA 4K5SA 2FLSA 2M46A 3QMXA 4GXZA 5KOWA 5G1KA 3HCZA 4MF5A 5F0GA 4BVYA 2DKIA 2L5LA 2VUPA 4MJEA 4PX1A 3G9BA 1ZYQB 4NV5A 1GTUA 1F37A 4K9ZA 1O8WA 2QA2A 2HT9A 4G0IA 2FWFA 4BL7A 4TR3A 3FR6A 1Q4JA 2X8HA 4K8MA 4BWQA 5ELGA 2WFCA 1OC8A 3TKQA 4WXTA 3RPPA 4E8EA 1OVNA 5ID2A 4OFTA 3A5WA 1Z6NA 4K6XA 3IE3A 4KNDA 4ZILA 2K8VA 1T00A 1M2DA 1RQMA 3VFIA 4XIHA 3N9JA 2YNXA 4XS4A 2VO4A 5DJMA 5ECPB 3PGTA 3ZFLA 5ENUA 4ECBA 4F9ZA 1E2YA 1PQNA 2F8AA 3KH7A 1RW1A 2B7KA 1X5EA 2OACA 2O8VB 2PPTA 4IN0A 1ERVA 4HUAA 4RQRA 2F9SA 11GSA 3TKPA 4MF6A 1A2JA 4BWSA 3D6IA 2VLVA 2C1YA 2CX3A 5ELAA 3ISOA 1FVJA 1A8LA 2HZFA 1JZDA 4FYUA 1OYJA 4J57E 3TDGA 5DCGA 1A24A 2HZEB 3VURA 3L78A 4YAPA 1ILOA 3QOUA 4K2XA 4KSMA 5GSSA 1YY7A 3CBUA 2YPMA 3LG6A 3K8NA 4ICYA 3KCMA 1Y25A 3TJJA 1X9MB 2C3NA 4F0BA 4CDOA 4TR4A 5GAND 4ECCA 1Z5YE 3EPTA 4MZBA 4NV2A 2TRCP 5DJLA 2F3MA 2GGTA 1GUKA 3A2XA 3CSJA 2E0QA 2RLIA 3C7MA 3GL3A 4TR1B 1WRYA 1EP8A 3D0ZA 5CRGA 1J08A 5ECHB 1OAZA 2HRKA 1PSQA 2CQ9A 1R5AA 4MK3A 2TRXA 3LW9A 2H0GA 4TRXA 1DBYA 5C00A 5IIZA 2ZNMA 4HOJA 5EL8A 2FGXA 3EC3A 2R3XA 2J9HA 2KP2A 4HU9A 4Q5QA 1MD4A 1SENA 2LTKA 2JZRA 1B8XA 2H6XA 1SKWB 4PGTA 4YQVA 1PMTA 1XBSA 2R4VA 2NDOA 3H79A 4ACSA 5HR1A 2K18A 3ZITA 5IOXA 3TJBA 4V1Ag 3EINA 2C0FA 1NSWA 3KMNA 1NHOA 1I5GA 2IJYA 1GSYA 3QD9A 1M2BA 2GZPA 3NIVA 3DVWA 4F2IA 4POLA 3MNGA 2X49A 2DLXA 1FO5A 1MDIA 4J2FA 4KH7A 2HSYA 2QC7A 5CP1A 2QA1A 4O32A 2B5YA 5CRDA 3VWXA 1H4OA 2MBSA 2LJRA 2YJ7A 1TXXA 2WZ9A 3HVXA 2K9FA 3CYNA 5AIVA 4HJMA 4OMVA 4KAEA 5LCZA 4IP1A 3F9UA 8GSSA 2X99A 1VF4A 3H93A 3ZIVA 4FYCA 2R2JA 5L71A 5DVBA 4ZBDA 2A2SA 2PERA 5A4UA 5H5RA 3RHBA 3ZFBA 4LMWA 2G2QA 3VK9A 3R2QA 2X4AA 2YZUA 1ERWA 2GZZA 4I97A 1HYUA 1GLPA 4OD7A 1VRSD 3GKMA 4KGIA 2XHFA 4JR6A 2DJJA 3E9JB 3CSIA 4HJ2A 2DMMA 3QFBC 3ZYWA 3IA1A 4DSSA 2CV4A 4EIQA 6GSSA 4Q5NA 5ID2B 1XW6A 1ZGNA 3KJYA 3HDCA 2WB9A 9GSSA 5A5KA 7GSSA 4XS6A 2HSMA 5GSTA 1SD8A 4JR4A 3GSSA 5J41A 5FWGA 4RI7A 4MCUA 2CA8A 2H72A 2H1GA 3M0FA 1X5DA 4ID0A 4ILFA 3KP9A 3CXGA 3BJ5A 4O7HA 5BRTA 2LQOA 1F6MC 3GNJA 3ED3A 4MZCA 2N5FA 1Z7PA 5H5QA 1XW9A 3KMOA 3IC8A 1ZYEA 5HR0A 3TGZA 1ZL9A 4RQXA 4N30A 1A0FA 13GSA 1AQXA 2IMKA 3CSHA 4TR1A 5DALA 5GAPD 1UA5A 2JSYA 1Y6EA 2FA4A 3HHVA 3KP8A 3FZ9A 4CHSA 2DMLA 5D8IA 1QFNA 3IAM2 4YH2A 1BYEA 3C1RA 3P8WA 1GWCA 2ON7A 2AYTA 2JACA 3GTUB 1J9BA 4ZBAA 4WEYA 2JU5A 1WE0A 4WBRD 2C3QA 1ZOFA 2I1UA 1K0NA 4FYBA 5ECRB 4YQMA 3GKXA 3M8NA 5ECOB 2E2GA 4PQ1A 2R5GA 2PVOC 3UVHA 3QAGA 1YDKA 1E6BA 4EKZA 2D2ZA 5EPFA 3ERFA 4MLYA 4WBJA 3LXZA 4KDXA 4XRAA 2H1BA 1DE2A 3PPUA 3AY8A 4PURA 5JWOB 3IAS2 4LL4B 2I3YA 1ACVA 5ECSA 1TP9A 1V57A 1R7HA 1VF2A 4TR0A 1T3BA 1XZOA 4OCFA 1WMJA 1OE7A 2OADA 2XPEA 2VCZA 4YQUA 3A5IA 4LL1B 3GH6A 4V2NA 2EIRA 1FB6A 1SU9A 3EURA 2CAQA 2EIQA 5FHIA 3FR3A 3QCPA 1B9XC 4G0KA 1FAAA 1EEMA 4ZL7A 1EGOA 2C4JA 2ALBA 1MD3A 1GRXA 2DJKA 2OKAA 1K0OA 1O7UA 3KIJA 1A0RP 2GQLA 3EU3A 1JLWA 5F06A 1IYHA 3UARA 1WOUA 1Q98A 2VCTA 1SKSB 2CVDA 1OC9A 4FO5A 3VI7A 3ZRDA 2C0GA 3DEXA 4ISDA 3EWLA 2GSRA 3MIXA 1DSBA 2V2GA 2XC2A 2R0PA 4EO3A 3QDNA 5J3RA 2GT5A 3U5RE 3NOFA 4QL9A 1T8EB 1YEPA 1AW9A 4MABA 5E59A 5JWQB 4IHUA 1M0UA 3F0IA 4OCEA 3GV1A 2WCIA 2DJ1A 4LLRA 4WETA 2I4AA 1QQ2A 5ECQB 3IBHA 2OE1A 2VCQA 3V1WA 3M3MA 1GUMA 1JZOA 1OC9B 3GUSA 5HFGA 4K7NA 3Q6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHZ A;  5A4W A;  1HNC A;  2MMZ A;  1T1V A;  2NVL A;  1HNB A;  4POM A;  3BBY A;  3TRP A;  3QAV A;  1VF3 A;  3CRT A;  5HFK A;  1UN2 A;  1M7T A;  3M9J A;  4EVM A;  4EDZ A;  1SL2 B;  1PKW A;  1AXD A;  5AIS A;  3GA4 A;  1HNA A;  1B48 A;  1FB0 A;  1SL0 B;  1TI1 A;  4MP4 A;  1T7P B;  5IM9 A;  1N8J A;  4EDY A;  3DXB A;  2IPA A;  1SKR B;  3FW2 A;  3MAK A;  3HYP A;  4X0X A;  4D73 A;  2R6K A;  3H4K A;  3FZ5 A;  3L9V A;  4MDC A;  3KXO A;  5IO0 A;  4MA9 A;  4PUA A;  5IMA A;  1F9M A;  2H1D A;  5ECK B;  2LRC A;  4ZL9 A;  1W89 A;  1ABA A;  1O6J A;  1YKA A;  1V40 A;  4AJ7 A;  1PX6 A;  1JFU A;  2IMI A;  1ST9 A;  3IOS A;  5FT3 A;  1TI3 A;  1K3L A;  2LJK A;  2HSH A;  4KUN A;  3WT1 A;  3W6G A;  2DBC A;  2DJ3 A;  1Z7R A;  3GMF A;  5CRH A;  4BPY A;  4MJC A;  2PGT A;  3ZVJ D;  1XWA A;  3FYG A;  4I8B A;  2VCX A;  2VLU A;  3WGX A;  2CX4 A;  1X0R A;  1U3I A;  3QPM A;  2ON5 A;  5B7C A;  1AUC A;  3L9S A;  2VOC A;  1B4P A;  3F6D A;  2MZC A;  2VL2 C;  1X9S B;  4IS0 A;  4J56 E;  4AGS A;  4G19 A;  2H76 A;  3IDV A;  1GSE A;  2IMF A;  1QXH A;  3A2V A;  1EZK A;  4XTS A;  3GFK A;  2AV4 A;  2WJU A;  3HJM A;  4RI6 A;  4GSN A;  3WGE A;  4F03 A;  1NW2 A;  5KN0 A;  16GS A;  4ZXG A;  2PBJ A;  5J4U A;  1YF0 A;  1THO A;  3O76 A;  4G9H A;  5D9T A;  4DVC A;  5J9B A;  2HE3 A;  3VPQ A;  5COH A;  1G7O A;  1SK2 A;  4GLT A;  1H75 A;  2PUK C;  3D4M A;  5IMF A;  3P2A A;  4TW5 A;  4X43 A;  2A2R A;  5D9W A;  4I2U A;  1LU4 A;  2HRF A;  1A23 A;  3PR8 A;  4HS1 A;  1GTA A;  4K7O A;  3WGD A;  4AJ6 A;  2P0G A;  1AC1 A;  3APS A;  4JBB A;  4ULX A;  3ZL5 A;  3VWW A;  1BED A;  4KW6 A;  1XOA A;  1TDI A;  2H01 A;  4IW9 A;  5D93 A;  4MMM A;  4KSO A;  4D73 B;  5IPG A;  1ZMA A;  1ERU A;  4GTU A;  5AGY A;  1CQG A;  4ECI A;  1K0D A;  2FCH A;  1FVK A;  1TRS A;  4HI7 A;  5DBQ A;  3QFA C;  2HXK A;  1KEB A;  3TKS C;  4OFM A;  2YP6 A;  4JRR A;  2NTO A;  3UMA A;  3DYR A;  1PKZ A;  2VM2 A;  2KP1 A;  2O7K A;  1Z3E A;  5G5E A;  1EP7 A;  2OBI A;  4MPF A;  1TRU A;  4N11 A;  2GSQ A;  3FZ4 A;  2VD0 A;  4HDE A;  2K8S A;  2LV3 A;  3EYT A;  2IMD A;  2LEG A;  4K7I A;  3C71 A;  3CTF A;  1XCC A;  3Q18 A;  3CMI A;  2VL9 A;  3WYW A;  3KTB A;  1GNW A;  2P5R A;  1SK1 A;  4G2E A;  4L0U A;  4I5Q A;  2VD1 A;  3CTG A;  2J23 A;  2PU9 C;  2WDU A;  3LFL A;  1F2E A;  1PL2 A;  1XXU A;  1NHY A;  2N5B A;  2FD3 A;  2YCD A;  4K1F A;  2F8F A;  2OE0 A;  4WKW A;  19GS A;  1M9A A;  2XBQ A;  5IPH A;  3ERG A;  3ZZX A;  3DKS A;  2HNL A;  1EV4 A;  3F4R A;  2IYJ A;  1TKD B;  2XBI A;  1O8X A;  4IJ3 A;  3APO A;  2V1M A;  4KE3 A;  3RBT A;  1JZW A;  1PD2 1;  2N5A A;  2P5Q A;  5B6N A;  4POK A;  4JED A;  5KN2 A;  1GSQ A;  2FWH A;  2WUL A;  2H6Z A;  1U6T A;  3ME8 A;  1XVW A;  2LST A;  3KZQ A;  3W8J A;  3D4T A;  1G6Y A;  12GS A;  3M9K A;  2E2M A;  4ML6 A;  2CZ3 A;  2L5O A;  3C1S A;  4MZW A;  2H0I A;  3LEF A;  1S3D A;  3I9V 2;  2OA7 A;  4GQC A;  1O85 A;  2IL3 A;  2YWN A;  3JCM L;  3UVT A;  3ZVJ A;  2YWI A;  1PX7 A;  3DVX A;  1PRX A;  1TTZ A;  2GVP A;  3LYP A;  3SWL A;  2RM5 A;  4V1A p;  3GTU A;  1TK8 B;  1NM3 A;  4LMV A;  3F4S A;  1PL1 A;  1DUG A;  2M72 A;  1VF1 A;  1XW5 A;  1K0A A;  5KEJ A;  2B5E A;  2I81 A;  2K6V A;  2JSZ A;  3GX8 A;  5IO2 A;  2H8L A;  3P7X A;  4HU7 A;  4AJ8 A;  1SL1 B;  3TJF A;  1BQ7 A;  2FHE A;  2H66 A;  1MEK A;  1GL8 A;  4IKH A;  4L5L A;  4ZIJ A;  4JZQ A;  1FG4 A;  2AAW A;  2GZY A;  4ZL8 A;  2GTU A;  6GSW A;  1JHB A;  1YF1 A;  3DML A;  1SYX A;  2MYG A;  1TRV A;  3ZLP A;  2KUC A;  1WJK A;  3F8U A;  4NHW A;  4KB3 A;  4WF4 A;  3H1N A;  4NAX A;  2L57 A;  4F0C A;  1A2L A;  3TRX A;  5H5S A;  4TXO A;  3VLN A;  4BA7 A;  3QAW A;  2B6M A;  5ECI B;  1MTC A;  3EMX A;  1SYR A;  5DQY A;  3D5J A;  2MBT A;  3QR6 A;  2H71 A;  2YV7 A;  3HJO A;  1MDJ A;  1DE1 A;  3DD3 A;  1USB A;  2KLX A;  1G7E A;  2WGR A;  5JWR B;  4TVE A;  2I9H A;  1TU7 A;  3C73 A;  4RUV A;  4MH3 A;  2RUF A;  5CRW A;  3IXR A;  4MF7 A;  5D9X A;  2BTO T;  2FA8 A;  2LQQ A;  1SJZ A;  1WIK A;  2ZCT A;  3N5O A;  1YJ6 A;  5C04 A;  4IBP A;  4ZB8 A;  1WPI A;  3ERW A;  1XOB A;  4PUF C;  5G30 A;  5CRE A;  2FWE A;  3Q74 A;  6GSV A;  3HZ4 A;  4IP6 A;  3H8Q A;  4V2M A;  3GH9 A;  4EL1 A;  4WF5 A;  2GDR A;  3GHA A;  4ML1 A;  1SD9 A;  1QUW A;  3UEM A;  1WP0 A;  2YAN A;  2VL2 A;  4Q5F A;  2L4C A;  3E0U A;  3IK9 A;  3UOM A;  1A8Y A;  1GUL A;  3F3R A;  5E4W A;  3PIN A;  3RPN A;  2VCV A;  22GS A;  1AQV A;  2VL3 A;  2XPD A;  4GF0 A;  2BJX A;  2O89 A;  1J0F A;  3GST A;  5DAK A;  1XIY A;  5LD0 A;  4WR4 A;  1OC3 A;  2B1K A;  2X8C A;  3KH9 A;  2IFQ A;  5AN1 A;  2ZUP A;  4HQZ A;  3NZN A;  3IR4 A;  1MDK A;  6GSY A;  3S9F A;  2QSI A;  3G7J A;  2B7J A;  3ZTL A;  4EXJ A;  2KOK A;  5A4V A;  3DIE A;  1G0T A;  2MMN A;  4EUY A;  1KBN A;  3ZRE A;  2H0H A;  4L8E A;  4NWY A;  5ECL B;  2YWO A;  1GSS A;  3FKF A;  2OJL A;  3EVI A;  2ES7 A;  3MSZ A;  17GS A;  1R26 A;  1TK0 B;  2PN8 A;  5AIX A;  10GS A;  2H73 A;  1VGL A;  5D9V A;  1EOG A;  3FHK A;  3G7I A;  18GS A;  3W8S A;  5CYY A;  3ME7 A;  1C72 A;  3LQ7 A;  3U6V A;  3F6F A;  4O92 A;  1W4V A;  1SJI A;  4JE1 A;  5INY A;  3TCO A;  2C80 A;  4XCS A;  2MMO A;  5IMD A;  4GCI A;  5GZZ B;  1URM A;  2LUS A;  3DWV A;  4MPG A;  5HQP A;  4IVF A;  4H86 A;  2GST A;  1UVZ A;  4TN8 A;  2DIZ A;  1QMV A;  3BCI A;  3KM6 A;  3UBK A;  5D96 A;  2X64 A;  4TXV A;  2E7P A;  5DAL B;  3I43 A;  1Z6M A;  4CW9 A;  4XS1 A;  1M9B A;  1GSU A;  1LJR A;  5KN3 A;  5J5N A;  4K2D A;  1V2A A;  5DCH A;  3LOR A;  2C0E A;  1G6W A;  2AUV A;  3MWH A;  3PH9 A;  5HR3 A;  3A2W A;  5ABR A;  1X5C A;  3APQ A;  2AJQ B;  2B5X A;  2LKU A;  3GL5 A;  1BAY A;  5KN1 A;  5G2Z A;  4N0Z A;  3ZML A;  1F3B A;  1JLV A;  5G31 A;  2GLR A;  1AAZ A;  1YKC A;  4GWR A;  2OE3 A;  3P90 A;  3HA9 A;  4O5R A;  4OO5 A;  4XS4 B;  3FZA A;  3VPT A;  3F4T A;  4TXO B;  1EEJ A;  2EIO A;  2GT6 A;  2HLS A;  4V2L A;  4ECJ A;  2YWM A;  1THX A;  3KGK A;  1GTB A;  5D73 A;  4IQ1 A;  4DEJ A;  3LJR A;  2H74 A;  5HR2 A;  2AB6 A;  3TB2 A;  2HRN A;  2QGV A;  1AQW A;  1ML6 A;  4YAV A;  1KNG A;  3O6T A;  2GS3 A;  1TOF A;  3RDW A;  2WS2 A;  5F8B A;  1XWG A;  3O3T A;  1T4Z A;  5EVO A;  2RII A;  2JZT A;  1B9Y C;  2M80 A;  1KTE A;  2LRT A;  2DIY A;  4XHM A;  4KX4 A;  3HD5 A;  5HFI A;  1XWC A;  1EV9 A;  4TOP A;  2YOI A;  2DJ0 A;  1OKT A;  3DGQ A;  2QKE A;  3TOT A;  4N10 A;  4L5O A;  4IJI A;  5DQS A;  1PA3 A;  1AIU A;  2PVQ A;  3Q19 A;  1GLQ A;  3FEU A;  1U87 A;  4BVX A;  2FNO A;  2V41 A;  2H30 A;  4XRD A;  2H70 A;  3EE2 A;  1UC7 A;  2LNS A;  5CO3 A;  5LNK e;  4OFN A;  5JCU A;  5DDL A;  3TRQ A;  3IK7 A;  2IY2 A;  3DRN A;  5DAK B;  2VAF A;  3F3Q A;  4I2T A;  2CT6 A;  2HYX A;  2JAD A;  1ZZY A;  1TRW A;  1M2A A;  2NBS A;  4AF2 A;  2GQM A;  2FUG 2;  1Z9H A;  2X8G A;  1GSF A;  1GP1 A;  5JCW A;  3BCK A;  1YQ1 A;  3VI5 A;  3L4N A;  3TJG A;  1V58 A;  3LXT A;  1V98 A;  2PWJ A;  4Q5R A;  2FY6 A;  3UBL A;  1LBK A;  4K0G A;  3VWU A;  2LNT A;  2B1L A;  3LSZ A;  4QL7 A;  5IQY A;  4JU5 A;  1TK5 B;  4FH8 A;  3WD6 A;  2C3T A;  2HZE A;  4KDY A;  4MJB A;  1M99 A;  5B6M A;  5CAX A;  1F3A A;  1TU8 A;  1A2M A;  3IC4 A;  5F07 A;  1IYI A;  2YJH A;  2FWG A;  1ON4 A;  5ECN B;  6GSX A;  4KCE A;  1K0C A;  2HI7 A;  4X1U A;  3F63 A;  2VIM A;  1HQO A;  2B3S A;  4KDU A;  2DC5 A;  1PGT A;  3TKS A;  4PQH A;  2YV9 A;  1TW9 A;  2C8U A;  2Z9S A;  4F82 A;  5CNW A;  1U3A A;  2WRT A;  1YEX A;  2G0F A;  3RAZ A;  4HEA 2;  4MH2 A;  2RM6 A;  4GQF A;  3E3E A;  2V6O A;  5B8A A;  2OBK A;  4POB A;  1N2A A;  1XPV A;  1ZCP A;  3ZMK A;  1BX9 A;  2YN1 A;  1RK4 A;  3I69 A;  5IMV A;  3D21 A;  6GST A;  2L6C A;  1EOH A;  4GSS A;  1S3A A;  4ZB9 A;  1K0B A;  3FRC A;  3UAP A;  4I6X A;  4HZ4 A;  4FIW A;  3GRX A;  2O87 A;  1GUH A;  1R4W A;  3CRU A;  2H75 A;  3WT2 A;  2EC4 A;  1EWX A;  2VCW A;  1OE8 A;  4WR5 A;  3TKS E;  3A3T A;  3TKR A;  4KCA A;  2IN3 A;  2GSS A;  3TJK A;  1XWB A;  4L0W A;  2A4V A;  3HY2 A;  4PNG A;  2V32 A;  5JCG A;  3G7Y A;  1K0M A;  4HZ2 A;  5IOW A;  4EE0 A;  4K0N A;  4PNF A;  4NPB A;  3SBC A;  3HVS A;  3MDK A;  4EC0 A;  1XVQ A;  2KHP A;  1FOV A;  3GKK A;  20GS A;  4MJA A;  3IV4 A;  2VM1 A;  1T4Y A;  3OR5 A;  1OKD A;  3LGC A;  4NXI A;  1K3Y A;  1GTI A;  1SK0 A;  3TOU A;  1XFL A;  3GUR A;  3UL3 A;  14GS A;  1BJX A;  4ZBB A;  3ZIJ A;  1GH2 A;  2NPB A;  1I9D A;  2C0D A;  1YZX A;  3M1G A;  2IME A;  3TUE A;  2MMA A;  5J9C A;  4HQS A;  5IMZ A;  5F05 A;  1ERT A;  1GNE A;  3HZ8 A;  1PN9 A;  1O73 A;  3FY7 A;  3GKN A;  5IMC A;  3KTL A;  4IGJ A;  3D22 A;  3HXS A;  5B8B A;  1O81 A;  4DSQ A;  2H6Y A;  4Z7X A;  2AHE A;  4GST A;  2F51 A;  3RHC A;  5G5F A;  1XWK A;  1WWJ A;  2CAI A;  2H1A A;  2BMX A;  2LS5 A;  4P3Y B;  1X9W B;  2O85 A;  3GYK A;  3J7Y k;  1S3C A;  3BOA A;  4DSS B;  2CVB A;  1U88 A;  2JZS A;  1K3O A;  4IEL A;  3EMP A;  3IPZ A;  2DJ2 A;  4PQI A;  4OWY A;  2REM A;  4QQ7 A;  2RUE A;  3EU4 A;  2JL4 A;  1R5P A;  1FW1 A;  2IFQ B;  3LYK A;  3L0H A;  1QGV A;  1GSD A;  4KA0 A;  4OO4 A;  4PXO A;  2V6K A;  3FR9 A;  4EF0 A;  4G10 A;  2VLT A;  4TKY A;  1SJ6 A;  1B4Q A;  3C8E A;  3IHQ A;  1JZR A;  5G1L A;  4IQA A;  2PMT A;  3FK8 A;  2CVK A;  3HVV A;  3GX0 A;  2TIR A;  3HKR A;  5ECM B;  1CQH A;  4DSR A;  3VWV A;  1QK8 A;  2IIY A;  3L9U A;  3US3 A;  4ZB6 A;  3GIX A;  3HJP A;  2LJA A;  2LRN A;  2L6D A;  3UJ1 A;  3LWA A;  5EY6 A;  3KEB A;  2R37 A;  2DSA A;  4N0V A;  1BG5 A;  3KD0 A;  2P31 A;  2L4Q A;  2CZ2 A;  3GN3 A;  2YZH A;  2IWT A;  4LA1 A;  4E8H A;  2H19 A;  2HFD A;  3UIW A;  1HD2 A;  4NMU A;  2L59 A;  1EGR A;  4GRF A;  1TJD A;  3I6A A;  6GSU A;  1V9W A;  2GQK A;  3BD2 A;  3J7Y b;  1FHE A;  3IRA A;  2FLS A;  2M46 A;  3QMX A;  4GXZ A;  5G1K A;  3HCZ A;  4MF5 A;  5F0G A;  4BVY A;  2L5L A;  2VUP A;  4MJE A;  4PX1 A;  3G9B A;  1ZYQ B;  4NV5 A;  1GTU A;  1F37 A;  1O8W A;  4K9Z A;  2HT9 A;  2FWF A;  4BL7 A;  4TR3 A;  3FR6 A;  1Q4J A;  2X8H A;  4K8M A;  4BWQ A;  5ELG A;  2WFC A;  1OC8 A;  3TKQ A;  4WXT A;  3RPP A;  4E8E A;  1OVN A;  5ID2 A;  4OFT A;  3A5W A;  1Z6N A;  4K6X A;  3IE3 A;  4KND A;  4ZIL A;  2K8V A;  1T00 A;  1M2D A;  1RQM A;  3VFI A;  4XIH A;  3N9J A;  2YNX A;  4XS4 A;  2VO4 A;  5DJM A;  5ECP B;  3PGT A;  3ZFL A;  5ENU A;  4ECB A;  4F9Z A;  1E2Y A;  1PQN A;  2F8A A;  3KH7 A;  1RW1 A;  2B7K A;  1X5E A;  2OAC A;  2O8V B;  2PPT A;  4IN0 A;  1ERV A;  4HUA A;  4RQR A;  2F9S A;  11GS A;  3TKP A;  4MF6 A;  1A2J A;  4BWS A;  3D6I A;  2VLV A;  2C1Y A;  2CX3 A;  5ELA A;  3ISO A;  1FVJ A;  1A8L A;  2HZF A;  1JZD A;  4FYU A;  1OYJ A;  4J57 E;  3TDG A;  5DCG A;  1A24 A;  2HZE B;  3VUR A;  3L78 A;  4YAP A;  1ILO A;  3QOU A;  4KSM A;  5GSS A;  1YY7 A;  3CBU A;  2YPM A;  3LG6 A;  3K8N A;  3KCM A;  1Y25 A;  3TJJ A;  1X9M B;  2C3N A;  4F0B A;  4CDO A;  4TR4 A;  5GAN D;  4ECC A;  1Z5Y E;  4MZB A;  4NV2 A;  2TRC P;  5DJL A;  2F3M A;  2GGT A;  1GUK A;  3A2X A;  3CSJ A;  2E0Q A;  2RLI A;  3C7M A;  3GL3 A;  4TR1 B;  1WRY A;  1EP8 A;  3D0Z A;  5CRG A;  1J08 A;  5ECH B;  1OAZ A;  1PSQ A;  2CQ9 A;  1R5A A;  4MK3 A;  2TRX A;  2H0G A;  4TRX A;  1DBY A;  5C00 A;  5IIZ A;  2ZNM A;  4HOJ A;  5EL8 A;  2FGX A;  3EC3 A;  2R3X A;  2J9H A;  2KP2 A;  4HU9 A;  4Q5Q A;  1MD4 A;  1SEN A;  2LTK A;  2JZR A;  1B8X A;  2H6X A;  1SKW B;  4PGT A;  4YQV A;  1PMT A;  1XBS A;  2R4V A;  2NDO A;  3H79 A;  4ACS A;  5HR1 A;  2K18 A;  3ZIT A;  5IOX A;  3TJB A;  4V1A g;  3EIN A;  2C0F A;  1NSW A;  3KMN A;  1NHO A;  1I5G A;  2IJY A;  1GSY A;  3QD9 A;  1M2B A;  2GZP A;  3NIV A;  3DVW A;  4F2I A;  4POL A;  3MNG A;  2DLX A;  1FO5 A;  1MDI A;  4J2F A;  4KH7 A;  2HSY A;  2QC7 A;  5CP1 A;  4O32 A;  2B5Y A;  5CRD A;  3VWX A;  1H4O A;  2MBS A;  2LJR A;  2YJ7 A;  1TXX A;  2WZ9 A;  3HVX A;  2K9F A;  3CYN A;  5AIV A;  4HJM A;  4OMV A;  4KAE A;  5LCZ A;  4IP1 A;  3F9U A;  8GSS A;  2X99 A;  1VF4 A;  3H93 A;  3ZIV A;  4FYC A;  2R2J A;  5L71 A;  5DVB A;  4ZBD A;  2A2S A;  2PER A;  5A4U A;  5H5R A;  3RHB A;  3ZFB A;  4LMW A;  2G2Q A;  3VK9 A;  3R2Q A;  2YZU A;  1ERW A;  2GZZ A;  4I97 A;  1HYU A;  1GLP A;  4OD7 A;  1VRS D;  3GKM A;  4KGI A;  2XHF A;  4JR6 A;  2DJJ A;  3E9J B;  3CSI A;  4HJ2 A;  2DMM A;  3QFB C;  3ZYW A;  3IA1 A;  4DSS A;  2CV4 A;  6GSS A;  4Q5N A;  5ID2 B;  1XW6 A;  1ZGN A;  3KJY A;  3HDC A;  2WB9 A;  9GSS A;  5A5K A;  7GSS A;  4XS6 A;  5GST A;  1SD8 A;  4JR4 A;  3GSS A;  5J41 A;  5FWG A;  4RI7 A;  4MCU A;  2CA8 A;  2H72 A;  2H1G A;  3M0F A;  1X5D A;  4ID0 A;  4ILF A;  3KP9 A;  3CXG A;  3BJ5 A;  4O7H A;  2LQO A;  1F6M C;  3GNJ A;  3ED3 A;  4MZC A;  2N5F A;  1Z7P A;  5H5Q A;  1XW9 A;  3KMO A;  1ZYE A;  5HR0 A;  3TGZ A;  1ZL9 A;  4RQX A;  4N30 A;  1A0F A;  13GS A;  1AQX A;  2IMK A;  3CSH A;  4TR1 A;  5DAL A;  5GAP D;  1UA5 A;  2JSY A;  1Y6E A;  2FA4 A;  3HHV A;  3KP8 A;  3FZ9 A;  4CHS A;  2DML A;  5D8I A;  1QFN A;  3IAM 2;  4YH2 A;  1BYE A;  3C1R A;  3P8W A;  1GWC A;  2ON7 A;  2AYT A;  2JAC A;  3GTU B;  1J9B A;  4ZBA A;  4WEY A;  2JU5 A;  1WE0 A;  4WBR D;  2C3Q A;  1ZOF A;  2I1U A;  1K0N A;  4FYB A;  5ECR B;  4YQM A;  3GKX A;  3M8N A;  5ECO B;  2E2G A;  4PQ1 A;  2R5G A;  2PVO C;  3UVH A;  3QAG A;  1YDK A;  1E6B A;  4EKZ A;  2D2Z A;  5EPF A;  3ERF A;  4MLY A;  4WBJ A;  3LXZ A;  4KDX A;  4XRA A;  2H1B A;  1DE2 A;  3AY8 A;  4PUR A;  5JWO B;  3IAS 2;  4LL4 B;  2I3Y A;  1ACV A;  5ECS A;  1TP9 A;  1V57 A;  1R7H A;  1VF2 A;  4TR0 A;  1T3B A;  1XZO A;  4OCF A;  1WMJ A;  1OE7 A;  2OAD A;  2XPE A;  2VCZ A;  4YQU A;  4LL1 B;  3GH6 A;  4V2N A;  2EIR A;  1FB6 A;  1SU9 A;  3EUR A;  2CAQ A;  2EIQ A;  5FHI A;  3FR3 A;  3QCP A;  1B9X C;  1FAA A;  1EEM A;  4ZL7 A;  1EGO A;  2C4J A;  2ALB A;  1MD3 A;  1GRX A;  2DJK A;  2OKA A;  1K0O A;  1O7U A;  3KIJ A;  1A0R P;  2GQL A;  3EU3 A;  1JLW A;  5F06 A;  1IYH A;  3UAR A;  1WOU A;  1Q98 A;  2VCT A;  1SKS B;  2CVD A;  1OC9 A;  4FO5 A;  3VI7 A;  3ZRD A;  2C0G A;  3DEX A;  4ISD A;  3EWL A;  2GSR A;  1DSB A;  2V2G A;  2XC2 A;  4EO3 A;  3QDN A;  5J3R A;  2GT5 A;  3U5R E;  3NOF A;  4QL9 A;  1T8E B;  1YEP A;  1AW9 A;  4MAB A;  5E59 A;  5JWQ B;  4IHU A;  1M0U A;  3F0I A;  4OCE A;  3GV1 A;  2WCI A;  2DJ1 A;  4LLR A;  4WET A;  2I4A A;  1QQ2 A;  5ECQ B;  3IBH A;  2OE1 A;  2VCQ A;  3V1W A;  3M3M A;  1GUM A;  1JZO A;  1OC9 B;  3GUS A;  5HFG A;  4K7N A;  3Q6O A; 
#chains in the Genus database with same CATH topology
 1TP6 A;  2CFD A;  2B1X B;  1QVG 2;  4NHZ A;  1AY7 A;  5A4W A;  5BXQ A;  1HNC A;  2MMZ A;  1T1V A;  2NVL A;  4WYK B;  1HNB A;  1RN7 A;  4POM A;  3BBY A;  3TRP A;  3QAV A;  1HKX A;  6GSP A;  1VF3 A;  3CRT A;  1E97 A;  1GMR A;  1UN2 A;  5HFK A;  4XB5 A;  1M7T A;  3M9J A;  4EVM A;  1BAO A;  5JBS A;  4EDZ A;  1IVV A;  1SL2 B;  3S29 A;  1PKW A;  4EIP A;  3S5C A;  3EF8 A;  1AXD A;  3G4S 3;  5AIS A;  3NUV A;  3GA4 A;  1HNA A;  1B48 A;  1UGH I;  1FB0 A;  3MG2 A;  1SL0 B;  1TI1 A;  4MP4 A;  1T7P B;  3PGB A;  3MHE A;  5IM9 A;  1N8J A;  4EDY A;  1OHP A;  3DXB A;  4L8O A;  3D4A A;  3EQQ B;  2IPA A;  1SKR B;  1OAC A;  3FW2 A;  3MAK A;  1JN5 B;  3HYP A;  4X0X A;  4D73 A;  3LTD A;  2R6K A;  1UUW B;  1JJ2 2;  3H4K A;  6RNT A;  3FZ5 A;  1GSP A;  3L9V A;  1BNF A;  4MDC A;  4KFF A;  3KXO A;  5IO0 A;  4MA9 A;  3T8U A;  2XSH B;  4PUA A;  1O7H B;  1RNT A;  1F9M A;  4XBX A;  5IMA A;  2BT3 A;  3FG3 A;  2H1D A;  5ECK B;  2CG0 A;  2LRC A;  4ZL9 A;  1W89 A;  1ABA A;  1O6J A;  1YKA A;  1V40 A;  4AJ7 A;  1PX6 A;  1JFU A;  2XEP A;  2IMI A;  1ST9 A;  3DZL A;  3IOS A;  5FT3 A;  3Q1C A;  1TI3 A;  1K3L A;  2LJK A;  1S72 3;  2HSH A;  4KUN A;  3WT1 A;  3BNE A;  1W6C A;  3W6G A;  1YJW 3;  4PTS A;  1UCI A;  2DBC A;  1NJI 4;  1RGE A;  4GSP A;  2DJ3 A;  4J9A A;  1Z7R A;  3GMF A;  1KD1 4;  5CRH A;  4HM4 B;  4HSC X;  4BPY A;  4MJC A;  1AR0 A;  2PGT A;  3ZVJ D;  1XWA A;  3FYG A;  4I8B A;  2VCX A;  1OF5 B;  2W56 B;  2VLU A;  3MPH A;  3CCQ 3;  3WGX A;  2CX4 A;  1X0R A;  1U3I A;  1IQY A;  3WOD G;  3QPM A;  2ON5 A;  5B7C A;  3PCS A;  1AUC A;  2RGQ A;  2Y74 A;  3L9S A;  2VOC A;  1B4P A;  3F6D A;  2MZC A;  2VL2 C;  1X9S B;  1BSC A;  2E2T A;  4IS0 A;  2CFG A;  4J56 E;  1LXE A;  2CX0 A;  3ALA A;  4AGS A;  4G19 A;  2QA4 3;  2H76 A;  3IDV A;  1BNG A;  1GSE A;  2IMF A;  1QJG A;  1QXH A;  3X3X A;  3AGO A;  1JB5 A;  3A2V A;  1EZK A;  4XTS A;  3CC2 3;  3GFK A;  2AV4 A;  3OWS A;  1B20 A;  1IK3 A;  2WJU A;  3HJM A;  4YKF A;  1E3R A;  4RI6 A;  4GSN A;  2UZ8 A;  3WGE A;  4F03 A;  1NW2 A;  5KN0 A;  2Y73 A;  1W4N A;  2L1S A;  1K28 A;  16GS A;  4ZXG A;  1GD4 A;  5AEW B;  2PBJ A;  3EN1 B;  5J4U A;  1YF0 A;  1THO A;  3O76 A;  4G9H A;  5D9T A;  4DVC A;  1B3S A;  5J9B A;  1GS3 A;  2HE3 A;  3VPQ A;  1OCV A;  5COH A;  1G7O A;  1SK2 A;  4HM0 B;  4GLT A;  1H75 A;  2PUK C;  1W2Z A;  1LVN A;  4PEJ A;  1BRG A;  3D4M A;  5IMF A;  3V98 A;  3P2A A;  4TW5 A;  4X43 A;  2A2R A;  5D9W A;  4I2U A;  4CJN A;  1C54 A;  1LU4 A;  2HRF A;  1A23 A;  3PR8 A;  4HS1 A;  1GTA A;  1T2H A;  4K7O A;  4YKG A;  2J8X B;  8CHO A;  3WGD A;  4AJ6 A;  2P0G A;  1AC1 A;  3APS A;  4JBB A;  4ULX A;  3ZL5 A;  3VWW A;  1BED A;  2E2V A;  3DGY A;  4KW6 A;  1XOA A;  4XDW A;  5RNT A;  2KF3 A;  1GMQ A;  1TDI A;  1DMN A;  2H01 A;  4K61 A;  4IW9 A;  3D5I A;  2Z77 A;  3AHS A;  1JBT A;  5EEO A;  4BU4 A;  2XF3 A;  5CF2 A;  5D93 A;  2C11 A;  4MMM A;  4KSO A;  1J2B A;  1DYU A;  4D73 B;  5IPG A;  1ZMA A;  1ERU A;  5AYS C;  1RGH A;  4GTU A;  2I9W A;  1VQL 3;  5AGY A;  1CQG A;  1RN4 A;  1E3V A;  4ECI A;  1K0D A;  4J5G A;  2FCH A;  1FVK A;  1IVU A;  5EQL A;  1TRS A;  1IVX A;  2CK3 H;  4HI7 A;  3CD6 3;  5DBQ A;  3QFA C;  3EJV A;  2HXK A;  1KEB A;  3TKS C;  3LTA A;  1FUS A;  4OFM A;  2YP6 A;  4JRR A;  4AEQ A;  2YFJ B;  5BVB A;  2NTO A;  3UMA A;  2AAE A;  1PN0 A;  2QGU A;  4NRE A;  3DYR A;  1O7M B;  1RRL A;  1LOX A;  1PKZ A;  2VM2 A;  1BNI A;  2KP1 A;  2O7K A;  1Z3E A;  3RGR A;  2OTL 3;  5G5E A;  3B4O A;  1EP7 A;  2OBI A;  4MPF A;  1TRU A;  4N11 A;  2GSQ A;  2L4V A;  3FZ4 A;  1C7H A;  2VD0 A;  4HDE A;  5I97 A;  2K8S A;  2LV3 A;  3EYT A;  3K0Z A;  3ZG0 A;  1R4Y A;  2IMD A;  2LEG A;  3H3H A;  1YNV X;  1SII A;  3PYJ A;  4K7I A;  3C71 A;  3CTF A;  2RNT A;  1BNS A;  1XCC A;  4RNZ A;  3X41 A;  1IV9 A;  3Q18 A;  3CMI A;  2VL9 A;  3WYW A;  3KTB A;  1GNW A;  2P5R A;  1SK1 A;  2YFL B;  4G2E A;  4L0U A;  1RJO A;  3CNM A;  4BL2 A;  1YJ9 3;  4I5Q A;  2VD1 A;  3CTG A;  2JDI H;  3LOY A;  3WR2 A;  1BUJ A;  2J23 A;  1LNI A;  2PU9 C;  2WDU A;  3LFL A;  1NO3 A;  1F2E A;  1TU5 A;  1PL2 A;  3KKG A;  1XXU A;  2CWT A;  1NHY A;  2N5B A;  2FD3 A;  2YCD A;  4K1F A;  2F8F A;  1EG9 B;  2OE0 A;  4WKW A;  1BRI A;  19GS A;  1M9A A;  2XBQ A;  5IPH A;  3ERG A;  3UL6 A;  1BRJ A;  3ZZX A;  3DKS A;  2HNL A;  1EV4 A;  3F4R A;  1Z1S A;  2IYJ A;  5IW9 A;  2XBI A;  1TKD B;  5D82 A;  1O8X A;  1I0V A;  2A4H A;  3APO A;  4IJ3 A;  2V1M A;  3VSY A;  4KE3 A;  4O2H A;  1JZW A;  2N5A A;  1PD2 1;  2P5Q A;  3RBT A;  2LQV A;  2UGI A;  5B6N A;  3BLZ A;  4POK A;  4JED A;  5KN2 A;  1GSQ A;  2FWH A;  1MWS A;  3CCR 3;  1VZZ A;  3ZG5 A;  2WUL A;  4G0L A;  1NB3 I;  2H6Z A;  1U6T A;  3ME8 A;  1Q86 4;  2KAA A;  1XVW A;  2LST A;  3KZQ A;  3W8J A;  1IV7 A;  1N9J A;  3D4T A;  1G6Y A;  12GS A;  3M9K A;  2E2M A;  3R3E A;  4ML6 A;  2CZ3 A;  4AKY A;  2L5O A;  3MWZ A;  3C1S A;  2HMJ B;  4MZW A;  2H0I A;  3LEF A;  1Q81 4;  1S3D A;  3I9V 2;  3MYD A;  3CC7 3;  2OA7 A;  1U5O A;  4GQC A;  1O85 A;  1MWT A;  2IL3 A;  2YWN A;  3JCM L;  3UVT A;  3ZVJ A;  2YWI A;  1PX7 A;  3DVX A;  1PRX A;  1TTZ A;  2GVP A;  2A2P A;  3LYP A;  3SWL A;  2HMM B;  2RM5 A;  4V1A p;  1DVD A;  3GTU A;  4J5K A;  1TK8 B;  1NM3 A;  4LMV A;  4LEH A;  3F4S A;  4USS A;  1K41 A;  1PL1 A;  4HZB B;  2F4Y A;  1DUG A;  2M72 A;  1O7W B;  1VF1 A;  2BHM A;  1XW5 A;  1K0A A;  2DKH A;  3NM2 A;  5KEJ A;  4HKV B;  5JPU A;  2B5E A;  2I81 A;  2K6V A;  2JSZ A;  3M8C A;  3X42 A;  3GX8 A;  4A5P A;  5IO2 A;  3FSD A;  2H8L A;  3P7X A;  4HU7 A;  3CME 3;  4GB5 A;  4AJ8 A;  1SL1 B;  3TJF A;  1BQ7 A;  2FHE A;  2H66 A;  1MEK A;  4K90 B;  1GL8 A;  4IKH A;  4L5L A;  4ZIJ A;  1MOL A;  4JZQ A;  1FG4 A;  2AAW A;  2GZY A;  4ZL8 A;  2GTU A;  6GSW A;  1JHB A;  1YF1 A;  3E99 A;  3DML A;  1SYX A;  3NX0 A;  2MYG A;  1TRV A;  3ZLP A;  3G6E 3;  2KUC A;  1WJK A;  3F8U A;  4NHW A;  4KB3 A;  3IPT A;  1BRH A;  1STF I;  4WF4 A;  5LC7 A;  1DMQ A;  2IA7 A;  1NU3 A;  3H1N A;  1CEW I;  4NAX A;  2L57 A;  1LOV A;  4EW5 A;  4F0C A;  1A2L A;  3GAX A;  2D42 A;  3TRX A;  5H5S A;  4O5U A;  2P38 A;  3BNC A;  4TXO A;  3VLN A;  4BA7 A;  4CCV A;  3QAW A;  2B6M A;  2Q07 A;  2OWP A;  5ECI B;  1MTC A;  4KT3 B;  4JRF A;  3EMX A;  2F98 A;  2V1L A;  2P05 A;  1SYR A;  5DQY A;  1VQ9 3;  3UL5 A;  3D5J A;  2MBT A;  3QR6 A;  2H71 A;  2YV7 A;  2IMJ A;  3HJO A;  5BIR A;  3QK9 A;  1MDJ A;  1DE1 A;  3DD3 A;  4Z2T A;  1USB A;  2KLX A;  1G7E A;  2WGR A;  5JWR B;  4TVE A;  2I9H A;  1TU7 A;  3C73 A;  4RUV A;  3OXA A;  4MH3 A;  1OUN A;  2RUF A;  5CRW A;  1GD3 A;  3IXR A;  1W2B 2;  4MF7 A;  5D9X A;  3LZA A;  2BTO T;  1RGA A;  2FA8 A;  2LQQ A;  1SJZ A;  3FCS B;  1K9M 4;  1WIK A;  4FQU A;  2ZCT A;  2UUG C;  3N5O A;  1YJ6 A;  5C04 A;  1Q40 B;  4IBP A;  4ZB8 A;  1WPI A;  3ERW A;  1WMP A;  2CG1 A;  1XOB A;  4PUF C;  5G30 A;  5CRE A;  2FWE A;  4X2H A;  3Q74 A;  1RCK A;  4HBR A;  6GSV A;  5IG5 A;  3HZ4 A;  4BTY A;  4IP6 A;  3H8Q A;  4V2M A;  3GH9 A;  4TX4 A;  3AMO B;  4R4K A;  3WMD A;  1UUV B;  4EL1 A;  4WF5 A;  2GDR A;  3GHA A;  3G16 A;  4LZI A;  4ML1 A;  1SD9 A;  2R4I A;  1QUW A;  3UEM A;  1JV2 B;  1WP0 A;  2YAN A;  1UCK A;  3DGO A;  2VL2 A;  3K63 A;  4Q5F A;  2L4C A;  4HM3 B;  3E0U A;  2HOH A;  3IK9 A;  3UOM A;  3LT8 A;  3D5G A;  1A8Y A;  2Z7A A;  1GUL A;  3CCS 3;  3FGY A;  3F3R A;  5E4W A;  3PIN A;  3RPN A;  2VCV A;  2IUJ A;  22GS A;  5IEN A;  1AQV A;  1UUG B;  1FZU A;  2VL3 A;  2XPD A;  2Z76 A;  4GF0 A;  3K9M C;  2BJX A;  2O89 A;  1J0F A;  3GST A;  5DAK A;  1XIY A;  5LD0 A;  3BU4 A;  2W0Q A;  4WR4 A;  3BND A;  1OC3 A;  1ASK A;  2B1K A;  3BB9 A;  3NBJ A;  1YI2 3;  2X8C A;  3KH9 A;  2IFQ A;  5AN1 A;  2ZUP A;  4HQZ A;  3NZN A;  4OVM A;  2ZHX B;  3IR4 A;  1MDK A;  6GSY A;  3S9F A;  2QSI A;  1BSE A;  3G7J A;  2B7J A;  1ULJ B;  3ZTL A;  4EXJ A;  4U13 A;  1YIJ 3;  2KOK A;  3DIE A;  5A4V A;  1G0T A;  1UGI A;  1D6U A;  1HYF A;  2MMN A;  4EUY A;  2HMK B;  2WOH A;  1MWR A;  1KBN A;  3ZRE A;  4BVX B;  2CIU A;  2H0H A;  2R0C A;  4L8E A;  4NWY A;  5ECL B;  3RNT A;  2YWO A;  1GSS A;  3FKF A;  2OJL A;  1TRP A;  3EVI A;  2ES7 A;  1KWI A;  3MSZ A;  1BOX A;  1B27 A;  17GS A;  1R26 A;  2GEX A;  1TK0 B;  4X2O A;  2PN8 A;  3ER7 A;  3NBR A;  5AIX A;  10GS A;  2WO0 A;  3KN4 A;  4XM4 A;  2M7O A;  2H73 A;  1VGL A;  1M1X B;  5D9V A;  1EOG A;  3FHK A;  1OHS A;  3G7I A;  18GS A;  3W8S A;  4Z2U A;  1S3R A;  5CYY A;  3I0Y A;  3ME7 A;  1C72 A;  3LQ7 A;  2BMQ B;  4HM6 B;  1YVS A;  4MJD A;  1X1U A;  3U6V A;  3SED A;  3F6F A;  4O92 A;  1W4V A;  7STD A;  1SJI A;  1BRN L;  3DGN A;  4JE1 A;  5INY A;  3TCO A;  2ML5 A;  2C80 A;  1CYV A;  4FCM A;  2PZV A;  3QRD A;  1JNQ A;  1KQS 2;  4XCS A;  2MMO A;  2GU3 A;  1A2P A;  5IMD A;  2CX1 A;  5TGN A;  4GCI A;  5GZZ B;  1URM A;  2LUS A;  3DWV A;  4MPG A;  5HQP A;  3HVN A;  4IVF A;  1IYY A;  4H86 A;  2GST A;  1UVZ A;  4TN8 A;  2DIZ A;  1QMV A;  1G02 A;  3BCI A;  3KM6 A;  3UBK A;  5IG3 A;  5D96 A;  1VQ8 3;  2X64 A;  4TXV A;  2E7P A;  5DAL B;  2O3O A;  1FOH A;  3I43 A;  1Z6M A;  3MG3 A;  4CW9 A;  4XS1 A;  1M9B A;  1GSU A;  4FMB A;  1LJR A;  1BRS A;  5KN3 A;  2B24 B;  3DUK A;  5J5N A;  4K2D A;  1V2A A;  5DCH A;  3SXX A;  3LOR A;  5IEO A;  1DE3 A;  2CWU A;  2FGT A;  2C0E A;  1G6W A;  2AUV A;  2KCD A;  3MWH A;  3PH9 A;  5HR3 A;  3STD A;  2OOV A;  3A2W A;  4CDL A;  5ABR A;  4EBG A;  1X5C A;  3APQ A;  2AJQ B;  2B5X A;  2LKU A;  3GL5 A;  1BAY A;  5KN1 A;  5G2Z A;  4N0Z A;  3ZML A;  1F3B A;  1JLV A;  5IER A;  5G31 A;  3CCV 3;  5AIF A;  2GLR A;  3MKI A;  1AAZ A;  3HI7 A;  1YKC A;  5D81 A;  4GWR A;  2OE3 A;  3NQZ A;  1I2F A;  4KFE A;  3P90 A;  3HA9 A;  4O5R A;  2HRA A;  4N6U A;  3O8Y A;  2XRX B;  3F7X A;  5M19 A;  4OO5 A;  1RDS A;  4XS4 B;  3WOE B;  1T2I A;  3FZA A;  3GZY B;  2HML B;  4LMI A;  3F4T A;  3VPT A;  5STD A;  4TXO B;  1EEJ A;  3PXM A;  3H51 A;  3G0K A;  2EIO A;  2LYX A;  2XH9 A;  2P0M A;  4G1M B;  4EV5 A;  2GT6 A;  2HLS A;  4V2L A;  4ECJ A;  3B8L A;  2E2U A;  4MEI A;  3DY5 A;  1THX A;  2YWM A;  3KGK A;  3FG1 A;  1GTB A;  2W56 A;  5D73 A;  1W00 A;  4IQ1 A;  1FUT A;  4DEJ A;  1OHO A;  3LJR A;  2H74 A;  3X40 A;  5HR2 A;  2AB6 A;  3KSE D;  3TB2 A;  3MYT A;  5CK6 A;  1CQS A;  3FG4 A;  1QVF 2;  2HRN A;  3FKA A;  2KRT A;  2QGV A;  1AQW A;  1ML6 A;  4YAV A;  1KNG A;  3O6T A;  1SJW A;  2GS3 A;  1TIJ A;  1TOF A;  3RDW A;  5KP3 A;  3KSP A;  1RGK A;  2WS2 A;  1G96 A;  5F8B A;  3B7C A;  1XWG A;  3O3T A;  2YX9 A;  1T4Z A;  5EVO A;  2RII A;  2JZT A;  1IVW A;  4EXR A;  1B9Y C;  2M80 A;  1KTE A;  2LRT A;  2DIY A;  4XHM A;  2CWV A;  4KX4 A;  1NDO B;  5KP1 A;  3HD5 A;  5HFI A;  1XWC A;  1EV9 A;  2GEY A;  4TOP A;  2YOI A;  3BIR A;  2DJ0 A;  1OKT A;  3DGQ A;  2QKE A;  3CCM 3;  1B2U A;  3TOT A;  1LOW A;  4L7K A;  3HII A;  4N10 A;  1DET A;  4L5O A;  4IJI A;  5DQS A;  1WQL B;  1PA3 A;  1AIU A;  1GOU A;  1M3I A;  2PVQ A;  5BMU A;  3Q19 A;  1BNJ A;  2KF4 A;  5D83 A;  1GLQ A;  2RCD A;  3FEU A;  1U87 A;  4BVX A;  2FNO A;  2V41 A;  2H30 A;  4XRD A;  2H70 A;  3EE2 A;  3V99 A;  1UC7 A;  2LNS A;  5CO3 A;  5LNK e;  3U97 A;  4OFN A;  1BU4 A;  5JCU A;  3Q90 A;  1ISK A;  2GBX B;  9RNT A;  5DDL A;  3JUM A;  3WA3 A;  3TRQ A;  3CXC 2;  3IK7 A;  1AVK A;  1RGL A;  4X4J A;  1YGE A;  4HVN A;  3Q3F A;  2IY2 A;  3DRN A;  5DAK B;  2VAF A;  3S27 A;  3F3Q A;  3K7C A;  1JRQ A;  4K5R A;  4I2T A;  2CT6 A;  4OK0 A;  2HYX A;  1U8C B;  2JAD A;  1ZZY A;  1TRW A;  1M2A A;  1I3I A;  2NBS A;  4AF2 A;  2GQM A;  1JBR A;  2FUG 2;  4LSO A;  1EKM A;  3OV4 A;  5M18 A;  1Z9H A;  2X8G A;  1GSF A;  4N6M A;  1VQ4 3;  1GP1 A;  5JCW A;  3BCK A;  1YQ1 A;  3VI5 A;  3L4N A;  3TJG A;  2CC3 A;  1V58 A;  3CU3 A;  1UCL A;  3LXT A;  1V98 A;  5M1A A;  2PWJ A;  4Q5R A;  1MGR A;  2FY6 A;  3UBL A;  1LBK A;  4K0G A;  3VWU A;  1B21 A;  3JUN A;  3IHG A;  2LNT A;  2B1L A;  4ORL A;  2OOV C;  3S28 A;  1ROA A;  2K54 A;  3LSZ A;  4QL7 A;  4KF9 A;  5IQY A;  4JU5 A;  3CC4 3;  4BVY B;  1TK5 B;  4FH8 A;  3OWU A;  3WD6 A;  1XG8 A;  2C3T A;  2HZE A;  4KDY A;  4MJB A;  1M99 A;  2BO9 B;  3EBY A;  5B6M A;  5CAX A;  3CCL 3;  1F3A A;  1TU8 A;  5KP4 A;  1A2M A;  3IC4 A;  5F07 A;  1IYI A;  4O5Q A;  2YJH A;  1YHQ 3;  4CY6 A;  2FWG A;  1ON4 A;  5ECN B;  6GSX A;  4KCE A;  2HMO B;  3FMW A;  4BL7 B;  2XGL A;  1K0C A;  2HI7 A;  3F63 A;  4X1U A;  3GZR A;  4XDV A;  2VIM A;  3GZB A;  2W9Q A;  1RCL A;  1HQO A;  2B3S A;  4KDU A;  2DC5 A;  1PGT A;  3TKS A;  1UDI I;  2CH9 A;  4PQH A;  2YV9 A;  1TW9 A;  3OWY A;  2C8U A;  2Z9S A;  4F82 A;  5CNW A;  1FGQ A;  3DM8 A;  1U3A A;  2WRT A;  1YEX A;  2G0F A;  3RAZ A;  4HEA 2;  4MH2 A;  2FXT A;  1M1K 4;  1I2G A;  1QAF A;  2RM6 A;  1O7G B;  2KF6 A;  4GQF A;  3E3E A;  3I55 3;  2CKF B;  2V6O A;  5B8A A;  4FMC A;  2OBK A;  3NQY A;  4POB A;  3T8N A;  1UI7 A;  3SX1 A;  1N2A A;  1XPV A;  1ZCP A;  3EC9 A;  3ZMK A;  1BIR A;  3FF0 A;  1BX9 A;  2YN1 A;  1RK4 A;  3I69 A;  1RMS A;  5IMV A;  1BNE A;  3D21 A;  6GST A;  1I0X A;  2WGO A;  2L6C A;  1EOH A;  4GSS A;  1S3A A;  4ZB9 A;  1K0B A;  3FRC A;  3UAP A;  4I6X A;  4HZ4 A;  4FIW A;  3GRX A;  2O87 A;  1GUH A;  1R4W A;  2P0X A;  3CRU A;  2H75 A;  3EHC A;  3WT2 A;  5KOX A;  2EC4 A;  1BNR A;  1EWX A;  1OE8 A;  2VCW A;  4WR5 A;  3TKS E;  3A3T A;  3TKR A;  1IDP A;  4KCA A;  2IN3 A;  1EQK A;  5FGO A;  2GSS A;  3TJK A;  3WA2 X;  1XWB A;  3L0R A;  4L0W A;  2A4V A;  4N6L A;  3HY2 A;  4PNG A;  3CCE 3;  2GSP A;  2V32 A;  5JCG A;  1YVB I;  5ELU A;  3G7Y A;  1K0M A;  2BMR B;  4HZ2 A;  5IOW A;  4EE0 A;  4K0N A;  2YFI B;  4PNF A;  5AIH A;  2O9U X;  4NPB A;  3SBC A;  1Q42 A;  1IQ8 A;  3HVS A;  3MDK A;  3D79 A;  3CMA 3;  4EC0 A;  1XVQ A;  3DMC A;  3LML A;  2K0M A;  2KHP A;  1B2Z A;  2Z6B A;  2XSO B;  2ZA4 A;  1JKG B;  1FOV A;  3GKK A;  20GS A;  4RNT A;  4MJA A;  1LNH A;  3IV4 A;  2P09 A;  2VM1 A;  1T4Y A;  3OR5 A;  1OKD A;  3LGC A;  4NXI A;  1K3Y A;  3X3Z A;  1K8A 4;  1GTI A;  4MMX B;  1VQP 3;  1Q9E A;  4CY8 A;  1SK0 A;  2R0G A;  3TOU A;  3FZW A;  3NV0 B;  2SAR A;  1XFL A;  3GUR A;  1US1 A;  1Q7Y 4;  3UL3 A;  14GS A;  1Y4K A;  3X3Y A;  3J7Y d;  1BJX A;  4ZBB A;  3ZIJ A;  1N5P A;  1GH2 A;  2NPB A;  1PFO A;  1ZO2 A;  1RLS A;  1I9D A;  2PNC A;  3K5T A;  2C0D A;  1YZX A;  3M1G A;  2IME A;  3TUE A;  2MMA A;  3VF1 A;  5J9C A;  3IJE B;  4HQS A;  5IMZ A;  1PY3 A;  4MMZ B;  2QIY A;  5F05 A;  1ERT A;  1SQW A;  2R41 A;  1ZS7 A;  1GNE A;  2WGQ A;  3HZ8 A;  5AYR B;  1PN9 A;  1CH0 A;  4HOH A;  1O73 A;  3FY7 A;  3SYU A;  3GKN A;  5IMC A;  1S5A A;  4HJL B;  3KTL A;  4IGJ A;  3Q2P A;  3D22 A;  3HXS A;  5B8B A;  1ZYP A;  1O81 A;  4DSQ A;  2H6Y A;  3UNL A;  1BSD A;  4Z7X A;  2AHE A;  1B2S A;  4GST A;  1O7N B;  2F51 A;  1AQZ A;  3RHC A;  4KVH A;  1N5H A;  5G5F A;  1XWK A;  1WWJ A;  4GHO A;  2CAI A;  1I70 A;  2H1A A;  2BMX A;  2LS5 A;  4P3Y B;  1X9W B;  1GY7 A;  4XBY A;  1LQM B;  1KC8 4;  1VQK 3;  4Z2R A;  2O85 A;  3GYK A;  3J7Y k;  1S3C A;  3BOA A;  4DSS B;  1VQ7 3;  4HM2 B;  2CVB A;  1U88 A;  2JZS A;  1K3O A;  5ELJ A;  4IEL A;  3EMP A;  2W03 A;  3IPZ A;  2DJ2 A;  4PQI A;  4OWY A;  2REM A;  1NB5 I;  2RUE A;  4QQ7 A;  2XFT A;  1VQO 3;  3EU4 A;  1TUH A;  2JL4 A;  1QAK A;  2CW9 A;  1R5P A;  1BUQ A;  1FW1 A;  1JB2 A;  2IFQ B;  3LYK A;  3L0H A;  1QGV A;  3RGA A;  4O02 B;  4N6N B;  3PZW A;  1GSD A;  4KA0 A;  4OO4 A;  4QWT A;  2CHC A;  4PXO A;  2V6K A;  1GOV A;  2STD A;  3FR9 A;  4EF0 A;  4G10 A;  2VLT A;  4XBT A;  4TKY A;  1SJ6 A;  1B4Q A;  3WOF B;  3C8E A;  2QEX 3;  3IHQ A;  1JZR A;  3ZFZ A;  5G1L A;  4IQA A;  1I2E A;  3KE7 A;  2PMT A;  3FK8 A;  2CVK A;  3HVV A;  3GX0 A;  1GMP A;  2TIR A;  3HKR A;  5ECM B;  1IU7 A;  3DGL A;  3PCR A;  1CQH A;  3FH1 A;  4DSR A;  3VWV A;  1QK8 A;  4H3U A;  1F8N A;  2KXG A;  2IIY A;  1D6Z A;  4LYL B;  3L9U A;  3US3 A;  4ZB6 A;  4K1V A;  3GIX A;  1I3F A;  3HJP A;  3SOY A;  2LJA A;  1TRQ A;  2UX0 A;  2LRN A;  2L6D A;  3UJ1 A;  3LWA A;  1Q82 4;  4FCJ A;  5EY6 A;  3KZT A;  3KEB A;  2R37 A;  1FYS A;  2F56 A;  1OPY A;  1UI8 A;  2C4B A;  2DSA A;  4N0V A;  1WMN A;  1BG5 A;  3KD0 A;  2P31 A;  4HM7 B;  3D3L A;  2L4Q A;  3NHX A;  3HZP A;  2CZ2 A;  1ZYN A;  3GN3 A;  1RTU A;  2YZH A;  1L5G B;  4MNN A;  2IWT A;  4LA1 A;  3NBB A;  4BTW A;  4E8H A;  1A2V A;  5HOH A;  2H19 A;  4Q53 A;  2HFD A;  3UIW A;  4HM1 B;  2IUK A;  2SBL A;  5IG0 A;  3EBT A;  1HD2 A;  4NMU A;  2L59 A;  1EGR A;  1W6G A;  4BIR A;  5CXO A;  4JF8 A;  1A67 A;  1TJD A;  3I6A A;  4GRF A;  1BVI A;  6GSU A;  1KSI A;  1V9W A;  5AEU B;  2GQK A;  3BD2 A;  3J7Y b;  1Q40 A;  2OTJ 3;  5GSP A;  1FHE A;  3IRA A;  1K73 4;  4K5S A;  3EE1 A;  5FW5 A;  2FLS A;  1W7C A;  2M46 A;  3QMX A;  4GXZ A;  5KOW A;  5G1K A;  3HCZ A;  4MF5 A;  5F0G A;  4BVY A;  4OUQ A;  2DKI A;  1UW1 A;  2CFK A;  2L5L A;  2VUP A;  4MJE A;  4PX1 A;  3G9B A;  1ZYQ B;  4NV5 A;  4FR9 A;  2A15 A;  1X1Y A;  1GTU A;  3LXU X;  2GBW B;  1F37 A;  1O8W A;  2QA2 A;  4K9Z A;  2W6J H;  2HT9 A;  5LC6 A;  4G0I A;  1TFK A;  2FWF A;  4BL7 A;  2ZL8 A;  1RNB A;  5G2G A;  4TR3 A;  3FR6 A;  1Q4J A;  1R4C A;  2GU1 A;  2X8H A;  4K8M A;  3FLJ A;  5BU4 A;  5ELG A;  4BWQ A;  4HZ9 B;  2WFC A;  1OC8 A;  2OCT A;  3TKQ A;  4WXT A;  3AGN A;  3RPP A;  5AII A;  1JB4 A;  4E8E A;  1OVN A;  1NNV A;  2JQ5 A;  5ID2 A;  2CFW A;  4OFT A;  3A5W A;  1Z6N A;  4K6X A;  3IE3 A;  1GY6 A;  4KND A;  4ZIL A;  3IMA B;  1M3J A;  2K8V A;  1T00 A;  1M2D A;  1RQM A;  3MG1 A;  3VFI A;  4XIH A;  3N9J A;  2YNX A;  4XS4 A;  2VO4 A;  3LYG A;  5DJM A;  5ECP B;  1V74 A;  3PGT A;  3ZFL A;  1FGR A;  1N9E A;  5ENU A;  4ECB A;  4F9Z A;  1E2Y A;  1PQN A;  3A76 A;  2F8A A;  4EV2 A;  3KH7 A;  1RW1 A;  2B7K A;  2OQE C;  3EN8 A;  3UB1 A;  1VQM 3;  1X5E A;  1SPU A;  1Q7H A;  2OAC A;  2O8V B;  2PPT A;  4IN0 A;  1ERV A;  4HUA A;  1WTH A;  4R9K A;  4RQR A;  3G71 3;  5CF1 A;  4FCZ A;  1B2X A;  2F9S A;  11GS A;  1MWU A;  3LTB A;  3F9S A;  4K1U A;  3TKP A;  4GL6 A;  4MF6 A;  1A2J A;  3CCU 3;  4BWS A;  3GRD A;  1I8V A;  3D6I A;  1M90 4;  4HYZ A;  1SAR A;  3JVC A;  2VLV A;  2C1Y A;  2CX3 A;  5ELA A;  3ISO A;  1FVJ A;  1A8L A;  1LQG C;  2HZF A;  1JZD A;  4FYU A;  2WOF A;  3TDG A;  1OYJ A;  4J57 E;  4R1K A;  4HM5 B;  5DCG A;  1A24 A;  2HZE B;  3VUR A;  3L78 A;  4YAP A;  1ILO A;  3QOU A;  4K2X A;  4KSM A;  4WYK A;  3SLU A;  1OF5 A;  5GSS A;  3LT9 A;  1YY7 A;  3CBU A;  2YPM A;  3LG6 A;  3DXO A;  8RNT A;  3K8N A;  4ICY A;  3KCM A;  3DGM A;  4WFO A;  3WDG B;  1Y25 A;  4N6V 0;  3TJJ A;  1X9M B;  4O8S A;  5AI1 A;  2C3N A;  4F0B A;  1BSA A;  3NM7 A;  4CDO A;  3AMO A;  3HX8 A;  4TR4 A;  1RHL A;  5GAN D;  2MC8 A;  5IF6 A;  4ECC A;  1Z5Y E;  3EPT A;  3HK4 A;  3CCJ 3;  4MZB A;  1STD A;  1IQX A;  2TRC P;  4NV2 A;  3V92 A;  5DJL A;  2F3M A;  2GGT A;  1GUK A;  3A2X A;  3CSJ A;  4WP5 A;  2E0Q A;  2RLI A;  3C7M A;  3GL3 A;  4TR1 B;  1WRY A;  3N54 B;  1FGM A;  1EP8 A;  3D0Z A;  5CRG A;  2W2C A;  1J08 A;  5ECH B;  1OAZ A;  2HRK A;  1PSQ A;  2CQ9 A;  1R5A A;  4MK3 A;  1GOY A;  2TRX A;  4BTX A;  3LW9 A;  2H0G A;  4TRX A;  1DBY A;  5C00 A;  3OW2 2;  5IIZ A;  2ZNM A;  4HOJ A;  3KII A;  1VQ5 3;  5EL8 A;  2FGX A;  3EC3 A;  2R3X A;  2J9H A;  2KP2 A;  1WMO A;  4HU9 A;  1FUW A;  4Q5Q A;  1JN5 A;  1CYU A;  1MD4 A;  1SEN A;  2LTK A;  1D6Y A;  2JZR A;  1B8X A;  2H6X A;  1SKW B;  4PGT A;  4YQV A;  1PMT A;  1XBS A;  2R4V A;  2NDO A;  4FMA A;  3H79 A;  4ACS A;  4EC6 A;  2XR8 B;  5HR1 A;  1DMM A;  2K18 A;  3ZIT A;  5IOX A;  3TJB A;  4V1A g;  1SIH A;  3EIN A;  2C0F A;  2BMO B;  1NSW A;  3KMN A;  1W01 A;  1NHO A;  3FF2 A;  1LRA A;  1I5G A;  1IT8 A;  1GSY A;  2IJY A;  3QD9 A;  1YIT 3;  1M2B A;  2GZP A;  3NIV A;  3DVW A;  4F2I A;  4O3V A;  4POL A;  5DRE A;  3MNG A;  4HAA A;  1RSN A;  2X49 A;  2DLX A;  1FO5 A;  1MDI A;  1PFP A;  4J2F A;  4KH7 A;  2GXF A;  2HSY A;  2D1W A;  5A0O B;  3F40 A;  2QC7 A;  2W9P A;  1MGW A;  1ULI B;  3F8H A;  1OH0 A;  5CP1 A;  2QA1 A;  4O32 A;  2W04 A;  2B5Y A;  5CRD A;  3VWX A;  1AVL A;  1WNH A;  1AV4 A;  1H4O A;  2MBS A;  4LGQ A;  2LJR A;  2YJ7 A;  1TXX A;  1HZ1 A;  2FNQ A;  7GSP A;  2WZ9 A;  3HVX A;  2K9F A;  3CYN A;  5AIV A;  4HJM A;  3N8B A;  4OMV A;  3F7S A;  2AAD A;  4KAE A;  3URP A;  5LCZ A;  4IP1 A;  2RSX A;  3F9U A;  8GSS A;  4KZ1 A;  3EX9 A;  2X99 A;  1VF4 A;  4N6O B;  3H93 A;  3ZIV A;  3CPW 2;  3KFQ C;  4FYC A;  1NWW A;  2R2J A;  5L71 A;  5DVB A;  4ZBD A;  2A2S A;  2PER A;  6STD A;  5A4U A;  5H5R A;  3N9H A;  3RHB A;  3ZFB A;  4LMW A;  2G2Q A;  3VK9 A;  3R2Q A;  2X4A A;  3U1W A;  2YZU A;  2ZDJ A;  1ERW A;  2GZZ A;  1DVC A;  4I97 A;  2XGN A;  1HYU A;  1GLP A;  4OD7 A;  1VRS D;  5AIG A;  1ZGX A;  3GKM A;  1MNL A;  1N8Q A;  5IEP A;  4KGI A;  1RRH A;  2XHF A;  4JR6 A;  2DJJ A;  1RGF A;  3CSI A;  3E9J B;  4HJ2 A;  2DMM A;  3QFB C;  3ZYW A;  3B4P A;  3IA1 A;  4DSS A;  4RBN A;  1OGZ A;  2CV4 A;  4H61 A;  1GY5 A;  4CPK A;  4EIQ A;  1FGT A;  2RFR A;  1RGC A;  6GSS A;  4IPB A;  4Q5N A;  5ID2 B;  3GWR A;  3WHO A;  1XW6 A;  3HOH A;  1VQQ A;  1ZGN A;  3JUO A;  2CFL A;  3KJY A;  3HDC A;  1RN1 A;  2WB9 A;  1JKG A;  9GSS A;  1BGS A;  1JBS A;  4I4K A;  5A5K A;  7GSS A;  2RBI A;  1EUI C;  1PU4 A;  1FW7 A;  4ZM8 A;  2HSM A;  4XS6 A;  5GST A;  1B2M A;  1SD8 A;  4JR4 A;  3GSS A;  5J41 A;  5FWG A;  1IT7 A;  4RI7 A;  4MCU A;  2INX A;  2CA8 A;  2H72 A;  2H1G A;  3M0F A;  1X5D A;  2F5M A;  4J8T A;  4ID0 A;  4ILF A;  3KP9 A;  3JUQ A;  3CXG A;  3BJ5 A;  4O7H A;  5BRT A;  4MMY B;  2C10 A;  2LQO A;  5CLK A;  1F6M C;  3GNJ A;  3ED3 A;  4MZC A;  3JUP A;  1LOY A;  2N5F A;  1Z7P A;  5H5Q A;  1XW9 A;  1TTO A;  3KMO A;  1A2K A;  3IC8 A;  1O7P B;  1ZYE A;  5HR0 A;  3TGZ A;  1UCJ A;  1ZL9 A;  4RQX A;  2ML6 A;  3BNB A;  4N3V A;  3EB8 A;  4N30 A;  1A0F A;  4RNY A;  13GS A;  1AQX A;  2IMK A;  1RKY A;  3CSH A;  3MSO A;  4TR1 A;  1BSB A;  4DKI A;  5DAL A;  2F99 A;  2F86 B;  5GAP D;  1UA5 A;  2JSY A;  1Y6E A;  4EYC A;  2FA4 A;  3HHV A;  3KP8 A;  1W6Y A;  3D9R A;  3FZ9 A;  4R9L A;  4CHS A;  2DML A;  5D8I A;  3NXJ A;  1QFN A;  3CQF A;  3IAM 2;  4YH2 A;  1BYE A;  3C1R A;  3P8W A;  2OQE A;  5IG4 A;  1GWC A;  2ON7 A;  2AYT A;  2JAC A;  3GTU B;  1J9B A;  4ZBA A;  1W5Z A;  3SVA A;  4WEY A;  3LH4 A;  2JU5 A;  1WE0 A;  1T5Y A;  4WBR D;  1VQN 3;  2C3Q A;  1ZOF A;  2I1U A;  2K3D A;  1K0N A;  4FYB A;  5ECR B;  4YQM A;  4L8P A;  3GKX A;  3M8N A;  4BIK A;  5ECO B;  2E2G A;  4PQ1 A;  4IT7 A;  2R5G A;  2PVO C;  3S67 A;  3UVH A;  3QAG A;  1YDK A;  3HIG A;  1E6B A;  3F14 A;  4EKZ A;  3NV0 A;  2D2Z A;  5EPF A;  3ERF A;  3I56 3;  4BL3 A;  3GSP A;  1HU9 A;  4MLY A;  1FGO A;  4IIA A;  4WBJ A;  4N6T A;  3LXZ A;  4KDX A;  4XRA A;  2H1B A;  4NHF A;  1DE2 A;  3PPU A;  3AY8 A;  4PUR A;  1N8R 4;  5JWO B;  3IAS 2;  4LL4 B;  2I3Y A;  1ACV A;  5ECS A;  1TP9 A;  4WWU C;  1V57 A;  1R7H A;  1VF2 A;  4R80 A;  4TR0 A;  1T3B A;  3CPO A;  4STD A;  1XZO A;  4OCF A;  1WMJ A;  1X1W A;  1RGG A;  1OE7 A;  3DH2 A;  1X1X A;  2OAD A;  2XPE A;  2HMN B;  2VCZ A;  3SOA A;  4YQU A;  3A5I A;  1YGW A;  4LL1 B;  3F8X A;  3GH6 A;  4V2N A;  2EIR A;  1FB6 A;  1SU9 A;  3EUR A;  2CAQ A;  3G8Z A;  3UJM A;  1GYB A;  2EIQ A;  5FHI A;  3GZX B;  3FR3 A;  2F5W A;  2BIR A;  1YJN 3;  1TFO A;  3QCP A;  1VQ6 3;  1B9X C;  3LTC A;  4G0K A;  1W02 A;  1FAA A;  1EEM A;  4ZL7 A;  4FMD A;  1EGO A;  3OX9 A;  2C4J A;  1ROV A;  2ALB A;  1QAL A;  2MF7 A;  1MD3 A;  1GRX A;  4AKZ A;  2DJK A;  1BRK A;  3PS8 A;  4RZM A;  2OKA A;  3RDE A;  1K0O A;  4KFD A;  1O7U A;  1OGX A;  3KIJ A;  1A0R P;  2GQL A;  3EU3 A;  3CNX A;  1JLW A;  5F06 A;  1IYH A;  1M9G A;  3UAR A;  1EA2 A;  1WOU A;  1Q98 A;  2VCT A;  1SKS B;  3ROB A;  2CVD A;  1OC9 A;  4FO5 A;  3VI7 A;  3ZRD A;  1A90 A;  2C0G A;  3DEX A;  4ISD A;  3EWL A;  4WHA A;  1PYL A;  5EVH A;  2GSR A;  3MIX A;  1DSB A;  2V2G A;  5JPP A;  2XC2 A;  2R0P A;  4EO3 A;  3QDN A;  5J3R A;  2GT5 A;  3NOF A;  3U5R E;  4QL9 A;  1T8E B;  1YEP A;  3ECF A;  2XFS A;  1AW9 A;  3KCH A;  4MAB A;  5E59 A;  1ZX2 A;  1QMA A;  5JWQ B;  4IHU A;  1M0U A;  3F0I A;  4HM8 B;  2BU4 A;  4OCE A;  3GV1 A;  3VGN A;  2KF5 A;  2WCI A;  2DJ1 A;  3A5E A;  2BNG A;  4LLR A;  7RNT A;  5HGR A;  4WET A;  2I4A A;  1BAN A;  1QQ2 A;  5ECQ B;  3IBH A;  5DRV A;  2OE1 A;  2VCQ A;  1FA3 A;  3V1W A;  3M3M A;  1GUM A;  1JZO A;  3T0U A;  3AHW A;  1OC9 B;  3GUS A;  5HFG A;  4K7N A;  3Q6O A; 
#chains in the Genus database with same CATH homology
 4NHZ A;  5A4W A;  1HNC A;  2MMZ A;  1T1V A;  2NVL A;  1HNB A;  4POM A;  3BBY A;  3TRP A;  3QAV A;  1VF3 A;  3CRT A;  5HFK A;  1UN2 A;  1M7T A;  3M9J A;  4EVM A;  4EDZ A;  1SL2 B;  1PKW A;  4EIP A;  1AXD A;  5AIS A;  3GA4 A;  1HNA A;  1B48 A;  1FB0 A;  1SL0 B;  1TI1 A;  4MP4 A;  1T7P B;  5IM9 A;  1N8J A;  4EDY A;  3DXB A;  2IPA A;  1SKR B;  3FW2 A;  3MAK A;  3HYP A;  4X0X A;  4D73 A;  2R6K A;  3H4K A;  3FZ5 A;  3L9V A;  4MDC A;  3KXO A;  5IO0 A;  4MA9 A;  4PUA A;  5IMA A;  1F9M A;  2H1D A;  5ECK B;  2LRC A;  4ZL9 A;  1W89 A;  1ABA A;  1O6J A;  1YKA A;  1V40 A;  4AJ7 A;  1PX6 A;  1JFU A;  2IMI A;  1ST9 A;  3IOS A;  5FT3 A;  1TI3 A;  1K3L A;  2LJK A;  2HSH A;  4KUN A;  3WT1 A;  3W6G A;  4PTS A;  2DBC A;  2DJ3 A;  1Z7R A;  3GMF A;  5CRH A;  4BPY A;  4MJC A;  2PGT A;  3ZVJ D;  1XWA A;  3FYG A;  4I8B A;  2VCX A;  2VLU A;  3WGX A;  2CX4 A;  1X0R A;  1U3I A;  3QPM A;  2ON5 A;  5B7C A;  1AUC A;  3L9S A;  2VOC A;  1B4P A;  3F6D A;  2MZC A;  2VL2 C;  1X9S B;  4IS0 A;  4J56 E;  4AGS A;  4G19 A;  2H76 A;  3IDV A;  1GSE A;  2IMF A;  1QXH A;  3A2V A;  1EZK A;  4XTS A;  3GFK A;  2AV4 A;  2WJU A;  3HJM A;  4YKF A;  4RI6 A;  4GSN A;  2UZ8 A;  3WGE A;  4F03 A;  1NW2 A;  5KN0 A;  16GS A;  4ZXG A;  2PBJ A;  5J4U A;  1YF0 A;  1THO A;  3O76 A;  4G9H A;  5D9T A;  4DVC A;  5J9B A;  2HE3 A;  3VPQ A;  5COH A;  1G7O A;  1SK2 A;  4GLT A;  1H75 A;  2PUK C;  3D4M A;  5IMF A;  3P2A A;  4TW5 A;  4X43 A;  2A2R A;  5D9W A;  4I2U A;  1LU4 A;  2HRF A;  1A23 A;  3PR8 A;  4HS1 A;  1GTA A;  4K7O A;  4YKG A;  3WGD A;  4AJ6 A;  2P0G A;  1AC1 A;  3APS A;  4JBB A;  4ULX A;  3ZL5 A;  3VWW A;  1BED A;  4KW6 A;  1XOA A;  1TDI A;  2H01 A;  4IW9 A;  5D93 A;  4MMM A;  4KSO A;  4D73 B;  5IPG A;  1ZMA A;  1ERU A;  4GTU A;  5AGY A;  1CQG A;  4ECI A;  1K0D A;  2FCH A;  1FVK A;  1TRS A;  4HI7 A;  5DBQ A;  3QFA C;  2HXK A;  1KEB A;  3TKS C;  4OFM A;  2YP6 A;  4JRR A;  2NTO A;  3UMA A;  1PN0 A;  3DYR A;  1PKZ A;  2VM2 A;  2KP1 A;  2O7K A;  1Z3E A;  5G5E A;  1EP7 A;  2OBI A;  4MPF A;  1TRU A;  4N11 A;  2GSQ A;  3FZ4 A;  2VD0 A;  4HDE A;  2K8S A;  2LV3 A;  3EYT A;  2IMD A;  2LEG A;  4K7I A;  3C71 A;  3CTF A;  1XCC A;  3Q18 A;  3CMI A;  2VL9 A;  3WYW A;  3KTB A;  1GNW A;  2P5R A;  1SK1 A;  4G2E A;  4L0U A;  4I5Q A;  2VD1 A;  3CTG A;  2J23 A;  2PU9 C;  2WDU A;  3LFL A;  1F2E A;  1PL2 A;  1XXU A;  1NHY A;  2N5B A;  2FD3 A;  2YCD A;  4K1F A;  2F8F A;  2OE0 A;  4WKW A;  19GS A;  1M9A A;  2XBQ A;  5IPH A;  3ERG A;  3ZZX A;  3DKS A;  2HNL A;  1EV4 A;  3F4R A;  2IYJ A;  1TKD B;  2XBI A;  1O8X A;  4IJ3 A;  2A4H A;  3APO A;  2V1M A;  4KE3 A;  3RBT A;  1JZW A;  1PD2 1;  2N5A A;  2P5Q A;  5B6N A;  4POK A;  4JED A;  5KN2 A;  1GSQ A;  2FWH A;  4G0L A;  2WUL A;  2H6Z A;  1U6T A;  3ME8 A;  1XVW A;  2LST A;  3KZQ A;  3W8J A;  3D4T A;  1G6Y A;  12GS A;  3M9K A;  2E2M A;  3R3E A;  4ML6 A;  2CZ3 A;  2L5O A;  3C1S A;  4MZW A;  2H0I A;  3LEF A;  1S3D A;  3I9V 2;  3MYD A;  2OA7 A;  4GQC A;  1O85 A;  2IL3 A;  2YWN A;  3JCM L;  3UVT A;  3ZVJ A;  2YWI A;  1PX7 A;  3DVX A;  1PRX A;  1TTZ A;  2GVP A;  2A2P A;  3LYP A;  3SWL A;  2RM5 A;  4V1A p;  3GTU A;  1TK8 B;  1NM3 A;  4LMV A;  3F4S A;  4USS A;  1PL1 A;  1DUG A;  2M72 A;  1VF1 A;  1XW5 A;  1K0A A;  2DKH A;  5KEJ A;  2B5E A;  2I81 A;  2K6V A;  2JSZ A;  3GX8 A;  4A5P A;  5IO2 A;  2H8L A;  3P7X A;  4HU7 A;  4AJ8 A;  1SL1 B;  3TJF A;  1BQ7 A;  2FHE A;  2H66 A;  1MEK A;  1GL8 A;  4IKH A;  4L5L A;  4ZIJ A;  4JZQ A;  1FG4 A;  2AAW A;  2GZY A;  4ZL8 A;  2GTU A;  6GSW A;  1JHB A;  1YF1 A;  3DML A;  1SYX A;  2MYG A;  1TRV A;  3ZLP A;  2KUC A;  1WJK A;  3F8U A;  4NHW A;  4KB3 A;  4WF4 A;  3H1N A;  4NAX A;  2L57 A;  4F0C A;  1A2L A;  3TRX A;  5H5S A;  4O5U A;  4TXO A;  3VLN A;  4BA7 A;  3QAW A;  2B6M A;  5ECI B;  1MTC A;  3EMX A;  1SYR A;  5DQY A;  3D5J A;  2MBT A;  3QR6 A;  2H71 A;  2YV7 A;  3HJO A;  1MDJ A;  1DE1 A;  3DD3 A;  4Z2T A;  1USB A;  2KLX A;  1G7E A;  2WGR A;  5JWR B;  4TVE A;  2I9H A;  1TU7 A;  3C73 A;  4RUV A;  4MH3 A;  2RUF A;  5CRW A;  3IXR A;  4MF7 A;  5D9X A;  2BTO T;  2FA8 A;  2LQQ A;  1SJZ A;  1WIK A;  4FQU A;  2ZCT A;  3N5O A;  1YJ6 A;  5C04 A;  4IBP A;  4ZB8 A;  1WPI A;  3ERW A;  1XOB A;  4PUF C;  5G30 A;  5CRE A;  2FWE A;  3Q74 A;  6GSV A;  3HZ4 A;  4IP6 A;  3H8Q A;  4V2M A;  3GH9 A;  4EL1 A;  4WF5 A;  2GDR A;  3GHA A;  4ML1 A;  1SD9 A;  1QUW A;  3UEM A;  1WP0 A;  2YAN A;  2VL2 A;  4Q5F A;  2L4C A;  3E0U A;  3IK9 A;  3UOM A;  1A8Y A;  1GUL A;  3F3R A;  5E4W A;  3PIN A;  3RPN A;  2VCV A;  22GS A;  1AQV A;  2VL3 A;  2XPD A;  4GF0 A;  2BJX A;  2O89 A;  1J0F A;  3GST A;  5DAK A;  1XIY A;  5LD0 A;  4WR4 A;  1OC3 A;  2B1K A;  2X8C A;  3KH9 A;  2IFQ A;  5AN1 A;  2ZUP A;  4HQZ A;  3NZN A;  3IR4 A;  1MDK A;  6GSY A;  3S9F A;  2QSI A;  3G7J A;  2B7J A;  3ZTL A;  4EXJ A;  2KOK A;  5A4V A;  3DIE A;  1G0T A;  2MMN A;  4EUY A;  1KBN A;  3ZRE A;  4BVX B;  2H0H A;  2R0C A;  4L8E A;  4NWY A;  5ECL B;  2YWO A;  1GSS A;  3FKF A;  2OJL A;  3EVI A;  2ES7 A;  3MSZ A;  17GS A;  1R26 A;  1TK0 B;  2PN8 A;  5AIX A;  10GS A;  2H73 A;  1VGL A;  5D9V A;  1EOG A;  3FHK A;  3G7I A;  18GS A;  3W8S A;  4Z2U A;  5CYY A;  3ME7 A;  1C72 A;  3LQ7 A;  3U6V A;  3F6F A;  4O92 A;  1W4V A;  1SJI A;  4JE1 A;  5INY A;  3TCO A;  2C80 A;  4XCS A;  2MMO A;  5IMD A;  4GCI A;  5GZZ B;  1URM A;  2LUS A;  3DWV A;  4MPG A;  5HQP A;  4IVF A;  4H86 A;  2GST A;  1UVZ A;  4TN8 A;  2DIZ A;  1QMV A;  3BCI A;  3KM6 A;  3UBK A;  5D96 A;  2X64 A;  4TXV A;  2E7P A;  5DAL B;  1FOH A;  3I43 A;  1Z6M A;  4CW9 A;  4XS1 A;  1M9B A;  1GSU A;  1LJR A;  5KN3 A;  5J5N A;  4K2D A;  1V2A A;  5DCH A;  3LOR A;  2C0E A;  1G6W A;  2AUV A;  3MWH A;  3PH9 A;  5HR3 A;  3A2W A;  5ABR A;  1X5C A;  3APQ A;  2AJQ B;  2B5X A;  2LKU A;  3GL5 A;  1BAY A;  5KN1 A;  5G2Z A;  4N0Z A;  3ZML A;  1F3B A;  1JLV A;  5G31 A;  2GLR A;  1AAZ A;  1YKC A;  4GWR A;  2OE3 A;  3P90 A;  3HA9 A;  4O5R A;  2HRA A;  4OO5 A;  4XS4 B;  3FZA A;  3VPT A;  3F4T A;  4TXO B;  1EEJ A;  2EIO A;  2GT6 A;  2HLS A;  4V2L A;  4ECJ A;  2YWM A;  1THX A;  3KGK A;  1GTB A;  5D73 A;  4IQ1 A;  4DEJ A;  3LJR A;  2H74 A;  5HR2 A;  2AB6 A;  3TB2 A;  2HRN A;  2QGV A;  1AQW A;  1ML6 A;  4YAV A;  1KNG A;  3O6T A;  2GS3 A;  1TOF A;  3RDW A;  2WS2 A;  5F8B A;  1XWG A;  3O3T A;  1T4Z A;  5EVO A;  2RII A;  2JZT A;  1B9Y C;  2M80 A;  1KTE A;  2LRT A;  2DIY A;  4XHM A;  4KX4 A;  3HD5 A;  5HFI A;  1XWC A;  1EV9 A;  4TOP A;  2YOI A;  2DJ0 A;  1OKT A;  3DGQ A;  2QKE A;  3TOT A;  4N10 A;  4L5O A;  4IJI A;  5DQS A;  1PA3 A;  1AIU A;  5BMU A;  2PVQ A;  3Q19 A;  1GLQ A;  3FEU A;  1U87 A;  4BVX A;  2FNO A;  2V41 A;  2H30 A;  4XRD A;  2H70 A;  3EE2 A;  1UC7 A;  2LNS A;  5CO3 A;  5LNK e;  4OFN A;  5JCU A;  5DDL A;  3TRQ A;  3IK7 A;  4X4J A;  2IY2 A;  3DRN A;  5DAK B;  2VAF A;  3F3Q A;  4K5R A;  4I2T A;  2CT6 A;  2HYX A;  2JAD A;  1TRW A;  1ZZY A;  1M2A A;  2NBS A;  4AF2 A;  2GQM A;  2FUG 2;  1Z9H A;  2X8G A;  1GSF A;  1GP1 A;  5JCW A;  3BCK A;  1YQ1 A;  3VI5 A;  3L4N A;  3TJG A;  1V58 A;  3LXT A;  1V98 A;  2PWJ A;  4Q5R A;  2FY6 A;  3UBL A;  1LBK A;  4K0G A;  3VWU A;  3IHG A;  2LNT A;  2B1L A;  3LSZ A;  4QL7 A;  4KF9 A;  5IQY A;  4JU5 A;  4BVY B;  1TK5 B;  4FH8 A;  3WD6 A;  2C3T A;  2HZE A;  4KDY A;  4MJB A;  1M99 A;  5B6M A;  5CAX A;  1F3A A;  1TU8 A;  1A2M A;  3IC4 A;  5F07 A;  1IYI A;  4O5Q A;  2YJH A;  4CY6 A;  2FWG A;  1ON4 A;  5ECN B;  6GSX A;  4KCE A;  4BL7 B;  3FMW A;  1K0C A;  2HI7 A;  4X1U A;  3F63 A;  2VIM A;  1HQO A;  2B3S A;  4KDU A;  2DC5 A;  1PGT A;  3TKS A;  4PQH A;  2YV9 A;  1TW9 A;  2C8U A;  2Z9S A;  4F82 A;  5CNW A;  1U3A A;  2WRT A;  1YEX A;  2G0F A;  3RAZ A;  4HEA 2;  4MH2 A;  2RM6 A;  4GQF A;  3E3E A;  2V6O A;  5B8A A;  2OBK A;  4POB A;  1N2A A;  1XPV A;  1ZCP A;  3ZMK A;  1BX9 A;  2YN1 A;  1RK4 A;  3I69 A;  5IMV A;  3D21 A;  6GST A;  2L6C A;  1EOH A;  4GSS A;  1S3A A;  4ZB9 A;  1K0B A;  3FRC A;  3UAP A;  4I6X A;  4HZ4 A;  4FIW A;  3GRX A;  2O87 A;  1GUH A;  1R4W A;  3CRU A;  2H75 A;  3WT2 A;  5KOX A;  2EC4 A;  1EWX A;  2VCW A;  1OE8 A;  4WR5 A;  3TKS E;  3A3T A;  3TKR A;  4KCA A;  2IN3 A;  2GSS A;  3TJK A;  1XWB A;  4L0W A;  2A4V A;  3HY2 A;  4PNG A;  2V32 A;  5JCG A;  3G7Y A;  1K0M A;  4HZ2 A;  5IOW A;  4EE0 A;  4K0N A;  4PNF A;  4NPB A;  3SBC A;  3HVS A;  3MDK A;  4EC0 A;  1XVQ A;  2KHP A;  1FOV A;  3GKK A;  20GS A;  4MJA A;  3IV4 A;  2VM1 A;  1T4Y A;  3OR5 A;  1OKD A;  3LGC A;  4NXI A;  1K3Y A;  1GTI A;  4CY8 A;  1SK0 A;  2R0G A;  3TOU A;  1XFL A;  3GUR A;  3UL3 A;  14GS A;  1BJX A;  4ZBB A;  3ZIJ A;  1GH2 A;  2NPB A;  1I9D A;  2C0D A;  1YZX A;  3M1G A;  2IME A;  3TUE A;  2MMA A;  5J9C A;  4HQS A;  5IMZ A;  5F05 A;  1ERT A;  1GNE A;  3HZ8 A;  1PN9 A;  1O73 A;  3FY7 A;  3GKN A;  5IMC A;  3KTL A;  4IGJ A;  3D22 A;  3HXS A;  5B8B A;  1ZYP A;  1O81 A;  4DSQ A;  2H6Y A;  4Z7X A;  2AHE A;  4GST A;  2F51 A;  3RHC A;  5G5F A;  1XWK A;  1WWJ A;  2CAI A;  2H1A A;  2BMX A;  2LS5 A;  4P3Y B;  1X9W B;  4Z2R A;  2O85 A;  3GYK A;  3J7Y k;  1S3C A;  3BOA A;  4DSS B;  2CVB A;  1U88 A;  2JZS A;  1K3O A;  4IEL A;  3EMP A;  3IPZ A;  2DJ2 A;  4PQI A;  4OWY A;  2REM A;  4QQ7 A;  2RUE A;  3EU4 A;  2JL4 A;  1R5P A;  1FW1 A;  2IFQ B;  3LYK A;  3L0H A;  1QGV A;  1GSD A;  4KA0 A;  4OO4 A;  4PXO A;  2V6K A;  3FR9 A;  4EF0 A;  4G10 A;  2VLT A;  4TKY A;  1SJ6 A;  1B4Q A;  3C8E A;  3IHQ A;  1JZR A;  5G1L A;  4IQA A;  2PMT A;  3FK8 A;  2CVK A;  3HVV A;  3GX0 A;  2TIR A;  3HKR A;  5ECM B;  1CQH A;  4DSR A;  3VWV A;  1QK8 A;  2IIY A;  3L9U A;  3US3 A;  4ZB6 A;  3GIX A;  3HJP A;  2LJA A;  2LRN A;  2L6D A;  3UJ1 A;  3LWA A;  5EY6 A;  3KEB A;  2R37 A;  2DSA A;  4N0V A;  1BG5 A;  3KD0 A;  2P31 A;  2L4Q A;  2CZ2 A;  1ZYN A;  3GN3 A;  2YZH A;  4MNN A;  2IWT A;  4LA1 A;  4E8H A;  2H19 A;  2HFD A;  3UIW A;  1HD2 A;  4NMU A;  2L59 A;  1EGR A;  4GRF A;  1TJD A;  3I6A A;  6GSU A;  1V9W A;  2GQK A;  3BD2 A;  3J7Y b;  1FHE A;  3IRA A;  4K5S A;  2FLS A;  2M46 A;  3QMX A;  4GXZ A;  5KOW A;  5G1K A;  3HCZ A;  4MF5 A;  5F0G A;  4BVY A;  2DKI A;  2L5L A;  2VUP A;  4MJE A;  4PX1 A;  3G9B A;  1ZYQ B;  4NV5 A;  1GTU A;  1F37 A;  4K9Z A;  1O8W A;  2QA2 A;  2HT9 A;  4G0I A;  2FWF A;  4BL7 A;  4TR3 A;  3FR6 A;  1Q4J A;  2X8H A;  4K8M A;  4BWQ A;  5ELG A;  2WFC A;  1OC8 A;  3TKQ A;  4WXT A;  3RPP A;  4E8E A;  1OVN A;  5ID2 A;  4OFT A;  3A5W A;  1Z6N A;  4K6X A;  3IE3 A;  4KND A;  4ZIL A;  2K8V A;  1T00 A;  1M2D A;  1RQM A;  3VFI A;  4XIH A;  3N9J A;  2YNX A;  4XS4 A;  2VO4 A;  5DJM A;  5ECP B;  3PGT A;  3ZFL A;  5ENU A;  4ECB A;  4F9Z A;  1E2Y A;  1PQN A;  2F8A A;  3KH7 A;  1RW1 A;  2B7K A;  1X5E A;  2OAC A;  2O8V B;  2PPT A;  4IN0 A;  1ERV A;  4HUA A;  4RQR A;  2F9S A;  11GS A;  3TKP A;  4MF6 A;  1A2J A;  4BWS A;  3D6I A;  2VLV A;  2C1Y A;  2CX3 A;  5ELA A;  3ISO A;  1FVJ A;  1A8L A;  2HZF A;  1JZD A;  4FYU A;  1OYJ A;  4J57 E;  3TDG A;  5DCG A;  1A24 A;  2HZE B;  3VUR A;  3L78 A;  4YAP A;  1ILO A;  3QOU A;  4K2X A;  4KSM A;  5GSS A;  1YY7 A;  3CBU A;  2YPM A;  3LG6 A;  3K8N A;  4ICY A;  3KCM A;  1Y25 A;  3TJJ A;  1X9M B;  2C3N A;  4F0B A;  4CDO A;  4TR4 A;  5GAN D;  4ECC A;  1Z5Y E;  3EPT A;  4MZB A;  4NV2 A;  2TRC P;  5DJL A;  2F3M A;  2GGT A;  1GUK A;  3A2X A;  3CSJ A;  2E0Q A;  2RLI A;  3C7M A;  3GL3 A;  4TR1 B;  1WRY A;  1EP8 A;  3D0Z A;  5CRG A;  1J08 A;  5ECH B;  1OAZ A;  2HRK A;  1PSQ A;  2CQ9 A;  1R5A A;  4MK3 A;  2TRX A;  3LW9 A;  2H0G A;  4TRX A;  1DBY A;  5C00 A;  5IIZ A;  2ZNM A;  4HOJ A;  5EL8 A;  2FGX A;  3EC3 A;  2R3X A;  2J9H A;  2KP2 A;  4HU9 A;  4Q5Q A;  1MD4 A;  1SEN A;  2LTK A;  2JZR A;  1B8X A;  2H6X A;  1SKW B;  4PGT A;  4YQV A;  1PMT A;  1XBS A;  2R4V A;  2NDO A;  3H79 A;  4ACS A;  5HR1 A;  2K18 A;  3ZIT A;  5IOX A;  3TJB A;  4V1A g;  3EIN A;  2C0F A;  1NSW A;  3KMN A;  1NHO A;  1I5G A;  2IJY A;  1GSY A;  3QD9 A;  1M2B A;  2GZP A;  3NIV A;  3DVW A;  4F2I A;  4POL A;  3MNG A;  2X49 A;  2DLX A;  1FO5 A;  1MDI A;  4J2F A;  4KH7 A;  2HSY A;  2QC7 A;  5CP1 A;  2QA1 A;  4O32 A;  2B5Y A;  5CRD A;  3VWX A;  1H4O A;  2MBS A;  2LJR A;  2YJ7 A;  1TXX A;  2WZ9 A;  3HVX A;  2K9F A;  3CYN A;  5AIV A;  4HJM A;  4OMV A;  4KAE A;  5LCZ A;  4IP1 A;  3F9U A;  8GSS A;  2X99 A;  1VF4 A;  3H93 A;  3ZIV A;  4FYC A;  2R2J A;  5L71 A;  5DVB A;  4ZBD A;  2A2S A;  2PER A;  5A4U A;  5H5R A;  3RHB A;  3ZFB A;  4LMW A;  2G2Q A;  3VK9 A;  3R2Q A;  2X4A A;  2YZU A;  1ERW A;  2GZZ A;  4I97 A;  1HYU A;  1GLP A;  4OD7 A;  1VRS D;  3GKM A;  4KGI A;  2XHF A;  4JR6 A;  2DJJ A;  3E9J B;  3CSI A;  4HJ2 A;  2DMM A;  3QFB C;  3ZYW A;  3IA1 A;  4DSS A;  2CV4 A;  4EIQ A;  6GSS A;  4Q5N A;  5ID2 B;  1XW6 A;  1ZGN A;  3KJY A;  3HDC A;  2WB9 A;  9GSS A;  5A5K A;  7GSS A;  4XS6 A;  2HSM A;  5GST A;  1SD8 A;  4JR4 A;  3GSS A;  5J41 A;  5FWG A;  4RI7 A;  4MCU A;  2CA8 A;  2H72 A;  2H1G A;  3M0F A;  1X5D A;  4ID0 A;  4ILF A;  3KP9 A;  3CXG A;  3BJ5 A;  4O7H A;  5BRT A;  2LQO A;  1F6M C;  3GNJ A;  3ED3 A;  4MZC A;  2N5F A;  1Z7P A;  5H5Q A;  1XW9 A;  3KMO A;  3IC8 A;  1ZYE A;  5HR0 A;  3TGZ A;  1ZL9 A;  4RQX A;  4N30 A;  1A0F A;  13GS A;  1AQX A;  2IMK A;  3CSH A;  4TR1 A;  5DAL A;  5GAP D;  1UA5 A;  2JSY A;  1Y6E A;  2FA4 A;  3HHV A;  3KP8 A;  3FZ9 A;  4CHS A;  2DML A;  5D8I A;  1QFN A;  3IAM 2;  4YH2 A;  1BYE A;  3C1R A;  3P8W A;  1GWC A;  2ON7 A;  2AYT A;  2JAC A;  3GTU B;  1J9B A;  4ZBA A;  4WEY A;  2JU5 A;  1WE0 A;  4WBR D;  2C3Q A;  1ZOF A;  2I1U A;  1K0N A;  4FYB A;  5ECR B;  4YQM A;  3GKX A;  3M8N A;  5ECO B;  2E2G A;  4PQ1 A;  2R5G A;  2PVO C;  3UVH A;  3QAG A;  1YDK A;  1E6B A;  4EKZ A;  2D2Z A;  5EPF A;  3ERF A;  4MLY A;  4WBJ A;  3LXZ A;  4KDX A;  4XRA A;  2H1B A;  1DE2 A;  3PPU A;  3AY8 A;  4PUR A;  5JWO B;  3IAS 2;  4LL4 B;  2I3Y A;  1ACV A;  5ECS A;  1TP9 A;  1V57 A;  1R7H A;  1VF2 A;  4TR0 A;  1T3B A;  1XZO A;  4OCF A;  1WMJ A;  1OE7 A;  2OAD A;  2XPE A;  2VCZ A;  4YQU A;  3A5I A;  4LL1 B;  3GH6 A;  4V2N A;  2EIR A;  1FB6 A;  1SU9 A;  3EUR A;  2CAQ A;  2EIQ A;  5FHI A;  3FR3 A;  3QCP A;  1B9X C;  4G0K A;  1FAA A;  1EEM A;  4ZL7 A;  1EGO A;  2C4J A;  2ALB A;  1MD3 A;  1GRX A;  2DJK A;  2OKA A;  1K0O A;  1O7U A;  3KIJ A;  1A0R P;  2GQL A;  3EU3 A;  1JLW A;  5F06 A;  1IYH A;  3UAR A;  1WOU A;  1Q98 A;  2VCT A;  1SKS B;  2CVD A;  1OC9 A;  4FO5 A;  3VI7 A;  3ZRD A;  2C0G A;  3DEX A;  4ISD A;  3EWL A;  2GSR A;  3MIX A;  1DSB A;  2V2G A;  2XC2 A;  2R0P A;  4EO3 A;  3QDN A;  5J3R A;  2GT5 A;  3U5R E;  3NOF A;  4QL9 A;  1T8E B;  1YEP A;  1AW9 A;  4MAB A;  5E59 A;  5JWQ B;  4IHU A;  1M0U A;  3F0I A;  4OCE A;  3GV1 A;  2WCI A;  2DJ1 A;  4LLR A;  4WET A;  2I4A A;  1QQ2 A;  5ECQ B;  3IBH A;  2OE1 A;  2VCQ A;  3V1W A;  3M3M A;  1GUM A;  1JZO A;  1OC9 B;  3GUS A;  5HFG A;  4K7N A;  3Q6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...