1EEJA

Crystal structure of the protein disulfide bond isomerase, dsbc, from escherichia coli
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
216
Chain Sequence
b'DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1eejA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eejA02
4TR4A 3GKKA 3IV4A 3IC4A 2JZTA 1TKDB 5KN2A 4MJCA 3VPTA 2FA4A 1SL0B 3EWLA 1TP9A 5IPGA 1YF0A 1OC3A 4GTUA 1Z7PA 4TXVA 2H01A 3F6FA 3VWVA 3SBCA 3UJ1A 3D22A 4XS4A 4MMMA 4Q5FA 2H8LA 5JCGA 3TKSA 4LLRA 6GSWA 2IFQB 1XWBA 2CAQA 2VOCA 2YN1A 3CTFA 2L4CA 1O8WA 1SKWB 3H8QA 12GSA 1F3BA 2IMFA 1VF1A 1UC7A 5DJLA 1WOUA 2HE3A 5AN1A 4TXOA 5HFIA 2FWFA 1M7TA 2GDRA 3E9JB 4NHZA 4KW6A 3IE3A 1RK4A 3FYGA 3WT2A 1M99A 3KCMA 3DWVA 1AAZA 2TIRA 1EZKA 5DCGA 3LSZA 3KTLA 1JFUA 4XIHA 1O85A 3EMXA 2QKEA 4GSTA 2H66A 4GF0A 3E3EA 2B7KA 3LQ7A 1ABAA 3IOSA 4KCAA 3TKSE 1GH2A 2X64A 2MMAA 1GWCA 3MWHA 5D9VA 1WPIA 4P3YB 4LL4B 3C7MA 2H76A 2LUSA 3CXGA 2VIMA 5L71A 1SYXA 2LS5A 1PL2A 5ECSA 3FKFA 5KN3A 1R5PA 3DD3A 3KH7A 3TCOA 4DSSA 2L6DA 1PRXA 1TOFA 2A2SA 4EE0A 1PKZA 2YWMA 3VWUA 2IN3A 4NXIA 5IMVA 2A2RA 2F8AA 3ZYWA 3VURA 3HY2A 1F6MC 5AISA 1HYUA 3F63A 2AHEA 3O3TA 4JZQA 3BBYA 2G0FA 1M2AA 4E8EA 4FIWA 2YOIA 3H4KA 4N0ZA 2L6CA 1G6WA 3IR4A 4EKZA 5DCHA 4ZL9A 4KB3A 3ZMLA 1F9MA 3DXBA 3KMNA 1T7PB 3QR6A 2H19A 3HVSA 3BCIA 1FO5A 3IBHA 1X9WB 4OO5A 3UAPA 2WJUA 1A2LA 1IYHA 1B9XC 2D2ZA 3GA4A 5ECQB 4TRXA 3D21A 1OE8A 4HEA2 5ECPB 3IDVA 4EL1A 4MP4A 1YQ1A 5FWGA 3Q6OA 1MTCA 3GMFA 1TRWA 14GSA 3QAVA 4KSOA 1BX9A 1FAAA 1QMVA 4ZL8A 2F8FA 1J0FA 1O73A 3DYRA 2EC4A 4NAXA 2JL4A 1WWJA 5LNKe 2NPBA 1DSBA 2WDUA 4V2NA 3US3A 1FVKA 2YP6A 2Z9SA 3HXSA 1AIUA 4KDYA 3FZ5A 2B6MA 2FLSA 4JEDA 2DLXA 2GZPA 2XPDA 2OKAA 2MBSA 4NHWA 5IQYA 4ZXGA 4XRDA 2J23A 3ZLPA 5DALB 4K2DA 1K0DA 2TRCP 5CYYA 3TJKA 1URMA 1ZGNA 2CVBA 1ON4A 2C4JA 1GUHA 2JACA 1XWKA 2CV4A 1XW6A 1ZYEA 5D96A 4WR4A 1GTBA 5H5SA 1EV4A 4HUAA 4KGIA 2R4VA 3PH9A 3HA9A 2LTKA 4F03A 1THXA 2K18A 3QPMA 4DVCA 3I43A 2PWJA 3M9JA 3EU3A 6GSVA 4ECCA 2CA8A 1X5EA 4HDEA 2HZFA 2N5FA 1GP1A 4MF7A 4MDCA 2OA7A 2B1KA 4GXZA 2IMDA 4K0GA 4LL1B 1YF1A 4PNGA 2H0HA 3GH6A 4IN0A 1TI1A 2GQMA 3KP8A 4KH7A 3D5JA 1AW9A 3A2VA 4XS1A 4OCFA 2P31A 2DBCA 3U6VA 4EC0A 3EC3A 5B6NA 5GZZB 1WIKA 2IJYA 3W8SA 5CRGA 4QL9A 2OADA 1XPVA 2RM6A 1VF4A 1HNBA 3ZVJA 4XRAA 3NZNA 4TKYA 4F9ZA 1Z6MA 3BOAA 4OFMA 2NDOA 3FZ9A 2VM1A 2XC2A 4BA7A 1SK0A 1LJRA 3IAM2 2DJJA 2WRTA 4KUNA 3GURA 1EEMA 4FO5A 1SKRB 3G7JA 3Q74A 5HQPA 3DVWA 2FWEA 3LWAA 3M9KA 3QOUA 3WT1A 3DIEA 3HZ8A 2L5OA 1K3OA 4K1FA 1AXDA 5LD0A 1IYIA 2GGTA 3S9FA 1ERTA 2CX4A 4XS4B 18GSA 5GAPD 1EP7A 2FHEA 3P8WA 2REMA 1EGRA 2H1GA 1J08A 1V98A 2M46A 5D9TA 3GHAA 4L5LA 1SYRA 3BCKA 4AF2A 1GSDA 2O87A 2P5RA 3HVXA 4ZBAA 2C80A 4G19A 2OE0A 1MDKA 4NMUA 1YEXA 1X9SB 1G6YA 2IMEA 3F4SA 2DIZA 3IXRA 3FR6A 2YJ7A 3N5OA 2AV4A 4L5OA 4N10A 1R5AA 4K7IA 5HFKA 2H75A 4V2MA 3E0UA 1M9BA 5ECRB 1TK8B 4TN8A 3GX8A 3D0ZA 1A23A 2EIRA 4EXJA 3A5WA 4ML1A 1KNGA 1FB6A 1WJKA 2GSTA 2A4VA 1I9DA 3EVIA 3ZTLA 2GTUA 2H72A 2JSZA 3K8NA 2C0GA 3ZVJD 1T00A 3W8JA 2BMXA 5J4UA 2VL2A 5INYA 2GS3A 5G5FA 2IMIA 3FR9A 3HKRA 2PGTA 3KGKA 3TUEA 4TR1A 1XVWA 13GSA 1XOAA 1E6BA 1JLWA 3IPZA 3P2AA 1U87A 1O81A 2YV9A 1XBSA 3F4RA 1J9BA 5IOXA 1ZYQB 4MH3A 5G30A 3FHKA 1EOGA 1B4PA 4EDZA 4PQ1A 3F3QA 3WGEA 4TVEA 3VI5A 3GL3A 2WULA 3C1RA 4AJ8A 1XW5A 2J9HA 4K9ZA 1U88A 3TKQA 1GL8A 3IK7A 4GRFA 1EEJA 1SU9A 2LRTA 3DEXA 2DJKA 4XHMA 2OBKA 3IA1A 3KTBA 2VCZA 1QQ2A 3APSA 3IRAA 3I6AA 3H79A 3QAGA 1PN9A 2R2JA 3GYKA 1PA3A 3ERGA 4MPFA 3P7XA 1TK0B 3RPPA 4YQMA 5ECKB 1TK5B 4PX1A 3CYNA 3NIVA 2G2QA 5HR0A 1HNAA 2R6KA 5IIZA 5ID2A 2KP1A 5JWOB 4J57E 4MA9A 4HI7A 2E0QA 4MJBA 1Z9HA 2I81A 1MD3A 2CVKA 5HFGA 5HR2A 2KUCA 2B1LA 4J56E 2GT5A 4POMA 1UN2A 2E2MA 4K6XA 3QFBC 1QGVA 3APQA 1SD9A 2LSTA 5ECOB 4MK3A 3LXTA 4OWYA 5B6MA 3FK8A 5EY6A 5AIVA 1K0CA 1GTIA 5DQYA 1BJXA 2B3SA 5AGYA 4HZ4A 1B4QA 2O7KA 2DJ3A 2C8UA 2OE1A 3MDKA 2AUVA 1GNWA 4NWYA 4IP6A 8GSSA 3G7IA 2FNOA 4TR0A 1W4VA 1TU8A 4L8EA 4KAEA 3HJPA 2NTOA 1Z5YE 3MNGA 2F3MA 1X5DA 2V6OA 4ZIJA 4OFTA 1ZOFA 1OKDA 2NVLA 3VWWA 2LV3A 22GSA 5ECMB 5G31A 3L0HA 5D9WA 3UOMA 3LYPA 2PMTA 4MLYA 4WR5A 5F06A 1GTAA 2FWGA 4D73A 1V58A 4YQUA 2B7JA 4BPYA 1T4ZA 1NW2A 1OYJA 2CAIA 4KSMA 1XW9A 2H1AA 6GSSA 2RUFA 3HZ4A 3KMOA 2IWTA 1DUGA 3OR5A 3RHBA 2YJHA 5F05A 1BEDA 3D4MA 3M0FA 4POLA 3HJOA 1MDJA 2L4QA 1VF3A 2GLRA 3UBLA 4MCUA 3CBUA 3A2WA 3CRUA 2FUG2 4ZB6A 1M2DA 4LA1A 1JHBA 1VGLA 3FZ4A 1JZOA 2X99A 2V1MA 2PBJA 2KHPA 2LQQA 2MZCA 1S3DA 3KZQA 1C72A 2EIQA 1M0UA 1Z6NA 1SL2B 3DMLA 4CHSA 4Q5QA 2O85A 3G7YA 1PSQA 3ED3A 1K0OA 4BL7A 2ZUPA 4Q5RA 1TRUA 2K8VA 4O7HA 1PQNA 1HNCA 3VFIA 5IMDA 3LGCA 1GTUA 4ZBDA 3CSHA 1GSUA 2XPEA 4YAPA 2LNSA 2YZHA 1X0RA 1WRYA 5DAKA 1SJIA 3RAZA 2HNLA 4YQVA 3V1WA 1ZMAA 1AQWA 5D8IA 2XBQA 1JZRA 2X8GA 2P5QA 3HDCA 4DSQA 2GQLA 3TKPA 4MJEA 1GSFA 1V2AA 2AJQB 5ELAA 2O8VB 1V40A 4I5QA 3TJBA 2HZEA 4PUFC 4RI7A 4JU5A 2K9FA 1X5CA 2YNXA 1TU7A 5COHA 4HJMA 4DSRA 3I69A 3KP9A 3TB2A 4I8BA 3DRNA 4HOJA 3G9BA 1A8LA 2NBSA 2O89A 1U3IA 1QFNA 3ISOA 2H1BA 2N5BA 4HS1A 5D93A 4V1Ag 1YJ6A 4IQAA 2WFCA 11GSA 2WCIA 2HI7A 4I97A 3LORA 4XS6A 3WYWA 1FB0A 1K0MA 4IQ1A 2VCTA 4MZCA 5A5KA 1B48A 1TXXA 3FW2A 3CMIA 3GH9A 4OMVA 3D6IA 3TJFA 2LQOA 1OC9B 3GTUB 2GSRA 3M8NA 4PUAA 3KIJA 1TI3A 4KE3A 2YWOA 6GSYA 3J7Yb 4POBA 3GNJA 4IGJA 4I6XA 4ILFA 1LU4A 2HXKA 3QDNA 4GSSA 5J9CA 5CP1A 1H75A 4L0WA 1JLVA 4O92A 5GSTA 1NHYA 3W6GA 1F2EA 1Z3EA 3GIXA 3F3RA 1PMTA 1EWXA 4F0BA 2R3XA 4HQSA 4GQFA 5H5QA 3R2QA 2X8HA 2QGVA 4PQHA 4MF5A 1GSQA 4OD7A 2H1DA 1K0AA 5A4WA 1K0BA 1ZL9A 1GRXA 5FHIA 5ECHB 4GQCA 2FY6A 3QAWA 3C71A 4V1Ap 3HHVA 2PERA 4WBRD 4MABA 3GX0A 2M80A 2IIYA 4EO3A 1JZDA 2WS2A 4PGTA 4K7OA 2YWNA 3ZFBA 2PN8A 1USBA 3TKSC 1G7EA 4X1UA 2GZZA 5G2ZA 2PPTA 4MJAA 4HZ2A 4BVYA 3PGTA 5CRWA 2YWIA 3ZITA 4TW5A 1G7OA 5C04A 3QD9A 4PNFA 5J3RA 1UA5A 2IY2A 4BVXA 1AQVA 4O32A 1BG5A 5EVOA 1V57A 4NPBA 3FY7A 4TXOB 3TJGA 1XVQA 4G9HA 4KA0A 1GSYA 2XBIA 2VM2A 5IMAA 3RBTA 2HRNA 2VD1A 3UVTA 3EURA 4RQRA 3WGXA 2JZRA 4CW9A 5C00A 2LNTA 3GKMA 3HYPA 4ID0A 1MD4A 3GKXA 4E8HA 3L4NA 1OE7A 3EMPA 4G10A 4DEJA 2FCHA 1R26A 4IS0A 2V2GA 5EPFA 1TRSA 2V41A 2FD3A 1AQXA 3VWXA 2GT6A 4OCEA 1R4WA 1YKAA 3LG6A 1ACVA 1GUKA 3FR3A 2ON5A 3M3MA 1T3BA 3O6TA 3P90A 4IELA 2C0FA 2V32A 3ZREA 4ZILA 5IMFA 3N9JA 1YDKA 4DSSB 1OKTA 2DC5A 1TDIA 5B8BA 4IJIA 4V2LA 1OAZA 3ZIJA 4MZBA 4D73B 4RI6A 3D4TA 3C1SA 2C3QA 4F82A 3GN3A 2M72A 4EDYA 9GSSA 1SK2A 4NV2A 3VK9A 5B8AA 2H74A 2HT9A 2CZ2A 2I4AA 1GNEA 4TOPA 5CREA 4IVFA 1B8XA 3KEBA 3TKRA 1DE2A 4JRRA 2FGXA 3ZZXA 1FW1A 1O6JA 2HYXA 3L78A 3UEMA 1O7UA 4WEYA 3GV1A 4X0XA 4N11A 1PD21 2MMOA 3TRPA 2GVPA 5F0GA 5CRDA 1A8YA 5JWRB 2P0GA 1SKSB 2MMNA 2JADA 5AIXA 4WF4A 2GSSA 2C0DA 2L59A 2IPAA 4ECJA 1A0RP 3TRXA 4EUYA 3KXOA 1N2AA 3GUSA 2GQKA 2OJLA 5DQSA 1X9MB 3DVXA 4K0NA 4JBBA 4ISDA 5EL8A 2BJXA 3VPQA 2LRCA 3EYTA 5IM9A 3M1GA 3MSZA 2HFDA 2KLXA 4JR6A 2MMZA 1A2MA 5J9BA 3RDWA 1XCCA 3ERFA 3KD0A 2IMKA 5DAKB 2CQ9A 2LJKA 1U3AA 3QMXA 5IMZA 1TJDA 3BD2A 5IPHA 1WP0A 2HSHA 3PINA 3KJYA 5KEJA 3VI7A 3I9V2 5CAXA 3DGQA 1VF2A 3ZFLA 1Y6EA 2YANA 1ZZYA 3MAKA 2ON7A 1MEKA 3QFAC 3GRXA 1W89A 3GL5A 4FYCA 5DBQA 4GCIA 1AUCA 2C1YA 2HZEB 3PR8A 4QL7A 3VLNA 3ZIVA 4ZB9A 1GLQA 2VD0A 2RUEA 4XCSA 2F51A 2PVQA 4HQZA 4ECIA 1CQGA 5G1LA 4I2UA 1F37A 1XWCA 1U6TA 3IK9A 1JZWA 2YPMA 3H1NA 1Q4JA 2TRXA 4KX4A 19GSA 4N30A 4KDXA 1UVZA 2VAFA 1EP8A 1MDIA 2VLVA 4RQXA 1TW9A 1KBNA 3CSIA 3WD6A 5LCZA 4CDOA 4G2EA 4MZWA 2WB9A 2VCWA 4L0UA 4GLTA 4POKA 2VCQA 2YZUA 1BYEA 1GSSA 2RIIA 2HRFA 2ALBA 2IL3A 3DKSA 4WXTA 2VUPA 2H6YA 2LJAA 3C8EA 1G0TA 1OC8A 2L57A 3ME8A 4ACSA 2EIOA 1DE1A 3RHCA 4XTSA 1T1VA 2DJ1A 1NM3A 1E2YA 5GAND 1ST9A 2RLIA 2L5LA 5H5RA 5JCWA 5A4UA 2VCVA 2VL3A 2CT6A 4N0VA 2C3TA 3F6DA 4X43A 2BTOT 3CTGA 3Q18A 3RPNA 2N5AA 3L9UA 1HD2A 1RW1A 2MBTA 3FZAA 3LJRA 2DMLA 1BAYA 2K6VA 1M9AA 3UL3A 3ZRDA 1XFLA 1BQ7A 5IMCA 4RUVA 3TRQA 4EVMA 2IFQA 4BWQA 4H86A 1A24A 2GSQA 2ZNMA 2DJ2A 4JE1A 5IO0A 4Z7XA 2VLUA 2FWHA 4ZBBA 5HR3A 1S3AA 4IHUA 1AC1A 1EOHA 4ML6A 3O76A 2AYTA 3NOFA 2PU9C 3BJ5A 4WF5A 4HU7A 3FRCA 1VRSD 2B5XA 2H30A 2I9HA 3LXZA 5B7CA 4I2TA 3TOTA 5IO2A 5FT3A 3H93A 2DIYA 1FHEA 5DVBA 4FYBA 3KH9A 6GSTA 3HCZA 4MF6A 5ENUA 5DJMA 2X8CA 3ZMKA 2LEGA 2HLSA 2R5GA 3UARA 2H6ZA 4KNDA 1A2JA 3LYKA 2CX3A 2OE3A 2PVOC 2AAWA 1XIYA 4GWRA 3ZL5A 4IP1A 2I1UA 1PGTA 1Y25A 1SK1A 7GSSA 2I3YA 3F0IA 2JSYA 3HD5A 3EU4A 1M2BA 4FH8A 1CQHA 1SL1B 3JCML 3C73A 5D9XA 5ABRA 3UVHA 1GUMA 1S3CA 2MYGA 4KDUA 3GKNA 3HVVA 5CO3A 1Q98A 3F9UA 4FYUA 2VL2C 2GZYA 4F2IA 2VLTA 3F4TA 4JR4A 4TR1B 3A2XA 5KN0A 1KTEA 4ULXA 3CSJA 2H73A 2YCDA 1SD8A 2V6KA 3IAS2 1THOA 4YAVA 1FVJA 5F07A 2HSYA 1ERVA 5JWQB 1WE0A 2H0IA 1A0FA 2QSIA 2WGRA 1V9WA 1PX6A 4AGSA 4LMVA 4ZL7A 3F8UA 1SJZA 1DBYA 1FOVA 2FA8A 4J2FA 3TOUA 4HJ2A 3UBKA 2LRNA 1SJ6A 4IJ3A 4OFNA 1EV9A 3LEFA 6GSXA 3TGZA 2VL9A 3A3TA 1O8XA 5KN1A 3WGDA 4BWSA 1YY7A 1YZXA 3Q19A 1GLPA 4OO4A 5F8BA 4IBPA 2YV7A 3AY8A 2IYJA 1WMJA 3U5RE 4EF0A 4PQIA 1T4YA 4K7NA 2ZCTA 1NHOA 2OACA 5CNWA 2ES7A 5ID2B 4GSNA 4Q5NA 5CRHA 3EINA 2DJ0A 2E7PA 2E2GA 4WBJA 5J5NA 1EGOA 1XWAA 3L9SA 6GSUA 5ECNB 2CZ3A 5IOWA 3ME7A 5HR1A 1H4OA 1YEPA 1GULA 5DALA 5E4WA 5ELGA 1NSWA 1XWGA 4F0CA 2JU5A 5E59A 3CRTA 3HJMA 5GSSA 1K0NA 4AJ7A 4IW9A 2DMMA 4LMWA 1R7HA 16GSA 1QK8A 2VCXA 1I5GA 2KOKA 10GSA 2WZ9A 1XXUA 4YH2A 2KP2A 1KEBA 2QC7A 4K8MA 2H71A 4MH2A 2JZSA 2C0EA 2H6XA 1T8EB 5G1KA 1OVNA 3UIWA 3J7Yk 3GSTA 5J41A 5ECIB 3UMAA 4QQ7A 4NV5A 1XZOA 1ZCPA 1K3YA 1SENA 2VO4A 3APOA 5D73A 4AJ6A 3KM6A 3TJJA 3LFLA 4PURA 3L9VA 4ECBA 3GSSA 1N8JA 2RM5A 2F9SA 3IHQA 4KCEA 2H0GA 1TTZA 4IKHA 1OC9A 3SWLA 3GTUA 2R37A 2DSAA 1ILOA 1ERWA 17GSA 1ERUA 3FEUA 1RQMA 5DDLA 2H70A 1GSEA 1ML6A 4HU9A 2B5YA 2OBIA 1PKWA 1PX7A 3ERWA 5G5EA 2B5EA 4O5RA 2LKUA 2XHFA 1HQOA 1Z7RA 4ZB8A 3GFKA 1K3LA 2CVDA 1YKCA 2LJRA 1B9YC 20GSA 5JCUA 5A4VA 1FG4A 3TDGA 1PL1A 2AB6A 1F3AA 4MPGA 3EE2A 4TR3A 1TRVA 2C3NA 2PUKC 3QCPA 1QUWA 1LBKA 5ECLB 4WETA 1XOBA 4PXOA 2K8SA 1QXHA 4WKWA
chains in the Genus database with same CATH superfamily
3DGOA 4BTXA 4TR4A 5IG0A 3GKKA 3IV4A 3IC4A 3CCJ3 2JZTA 3RNTA 5KN2A 4MJCA 1VQM3 1TKDB 4BL3A 3VPTA 2FA4A 1FGOA 1SL0B 5BVBA 3EWLA 3SYUA 3CCM3 1TP9A 1YF0A 5IPGA 1OC3A 4GTUA 1Z7PA 3K63A 4TXVA 2H01A 3F6FA 3VWVA 3SBCA 5IG4A 3UJ1A 1WTHA 3D22A 3Q90A 2KF3A 3FG1A 4XS4A 4MMMA 4Q5FA 5AIFA 1CH0A 2H8LA 2GEXA 4BL7B 2I9WA 5JCGA 1BNEA 4HZ9B 4FCZA 1VQ43 1OHOA 2XRXB 3TKSA 3WR2A 4KFDA 4LLRA 4HSCX 6GSWA 2IFQB 4USSA 1XWBA 2CAQA 2VOCA 2XSHB 2YN1A 3CTFA 2L4CA 1O8WA 3DGNA 1SKWB 3H8QA 12GSA 5BMUA 1GYBA 1F3BA 2IMFA 1VF1A 1K734 1UC7A 1YGEA 1MWRA 5DJLA 1WOUA 3VF1A 2HE3A 5AN1A 3F8XA 4TXOA 4N6OB 3KZTA 2FWFA 5HFIA 1M7TA 2GDRA 3E9JB 4NHZA 4KW6A 3IE3A 1JB5A 1RK4A 3FYGA 5IENA 1GOUA 3WT2A 3OXAA 3FZWA 1M99A 4R9KA 4EC6A 3KCMA 2YFJB 2CH9A 3EBTA 3DWVA 1AAZA 2TIRA 1EZKA 2PZVA 5DCGA 3LSZA 4N3VA 1T5YA 3PGBA 1DVDA 1JFUA 3KTLA 4XIHA 1O85A 3EMXA 2QKEA 4GSTA 2BT3A 2H66A 3E3EA 1IV9A 4GF0A 2B7KA 2BO9B 3K7CA 3LQ7A 1ABAA 3IOSA 4KCAA 3DGLA 3TKSE 5AYSC 3VGNA 1E97A 1GH2A 4CCVA 2X64A 2MMAA 1VQK3 1GWCA 4R4KA 3MWHA 5D9VA 1WPIA 4P3YB 4LL4B 3C7MA 2H76A 1TUHA 1QAFA 2LUSA 3CXGA 2VIMA 5L71A 2P0MA 1OF5B 3UB1A 1SYXA 2LS5A 1PL2A 5ECSA 4GB5A 4PEJA 4J5GA 1CYUA 3FKFA 5KN3A 1BUJA 5DREA 1R5PA 5BIRA 3DD3A 3KH7A 3TCOA 1VQ53 1OH0A 4DSSA 3LH4A 3FG3A 2L6DA 1PRXA 2C10A 1TOFA 3DGMA 2A2SA 3LTDA 4EE0A 1PKZA 2YWMA 3VWUA 2IN3A 3MYDA 4NXIA 5IMVA 2A2RA 2F8AA 3ZYWA 3VURA 3HY2A 3CCS3 1STDA 1F6MC 5AISA 1VQ83 1HYUA 3F63A 2AHEA 3MPHA 3O3TA 5AIGA 4JZQA 3BBYA 2G0FA 1M2AA 1R4CA 4E8EA 4FIWA 1UCJA 3ZFZA 2YOIA 5IERA 5JPPA 3H4KA 2O9UX 3GAXA 4N0ZA 2L6CA 5BU4A 1G6WA 3IR4A 4EKZA 5DCHA 4ZL9A 3KSED 2HMJB 4KB3A 3ZMLA 1F9MA 1OPYA 3DXBA 3KMNA 1T7PB 3QR6A 5KOWA 2H19A 3IPTA 3PZWA 3HVSA 3DMCA 2UGIA 3BCIA 1FO5A 1K41A 3IBHA 4STDA 3PYJA 1LOXA 2OTL3 1X9WB 1Q40A 4OO5A 4OVMA 3EQQB 2HMLB 4O02B 3UAPA 1O7NB 2X4AA 2WJUA 1G96A 1A2LA 1KWIA 1IYHA 1B9XC 2D2ZA 1FUWA 3GA4A 4A5PA 2WO0A 5ECQB 3SVAA 5AIHA 2OOVA 4WKWA 4TRXA 3UJMA 2KF5A 3URPA 3D21A 1OE8A 1GOYA 4HEA2 3IDVA 5ECPB 4EL1A 4MP4A 3OWSA 1YQ1A 1TFKA 5FWGA 3Q6OA 1RN4A 1MTCA 1Q7Y4 3GMFA 1TRWA 2CWTA 14GSA 1N8R4 3QAVA 1RGKA 4KSOA 3FF0A 1Z1SA 1DMMA 3AMOA 1BX9A 1FAAA 1QMVA 4ZL8A 2F8FA 4WYKB 1J0FA 1O73A 3G713 5BXQA 3DYRA 2EC4A 4NAXA 2JL4A 1WWJA 5LNKe 2NPBA 4NREA 1DSBA 3T0UA 2WDUA 4V2NA 3US3A 1FVKA 2YP6A 2Z9SA 4BVYB 3HXSA 3WHOA 1AIUA 1RCKA 5BRTA 4KDYA 3FZ5A 2B6MA 2FLSA 4JEDA 2DLXA 3CME3 2GZPA 2XPDA 2OKAA 2MBSA 1IQYA 5CXOA 4NHWA 4N6MA 1HU9A 5IQYA 4ZXGA 4XRDA 2J23A 4XB5A 3ZLPA 2V1LA 1IYYA 5DALB 3JUQA 4K2DA 1K0DA 3D3LA 2TRCP 1BNSA 4LZIA 3AHSA 5CYYA 3TJKA 2CKFB 1GMQA 4RNZA 5IEOA 1GD4A 1URMA 1ZGNA 1PY3A 1TP6A 1X1WA 2CVBA 1ON4A 2C4JA 1N9JA 2O3OA 1ZX2A 1GUHA 2JACA 1XWKA 2CV4A 1XW6A 1ZYEA 4O2HA 2XR8B 5D96A 2XF3A 3GZBA 1JBTA 4K61A 4WR4A 1NJI4 1IVXA 1GTBA 1BRGA 5H5SA 1EV4A 3LZAA 4HUAA 1HYFA 3DY5A 1GOVA 2E2TA 3E99A 4KGIA 2CWVA 2R4VA 1BRJA 1ROAA 1AV4A 2Z77A 3PH9A 3F8HA 3HA9A 2LTKA 1MGWA 4MNNA 1THXA 4F03A 1FGTA 3FF2A 2K18A 3QPMA 4FCJA 4DVCA 3I43A 2PWJA 4KVHA 3M9JA 3EU3A 6GSVA 4ECCA 2CA8A 2HRAA 1X5EA 4FMCA 3S29A 3CC43 4HDEA 2HZFA 5G2GA 2N5FA 3OX9A 1GP1A 4MF7A 4MDCA 2OA7A 3X40A 2B1KA 4GXZA 5AI1A 2IMDA 4CY8A 3MYTA 3ER7A 1A2VA 2RGQA 1GD3A 4K0GA 4LL1B 1YF1A 4PNGA 2H0HA 2BMRB 3GH6A 1R4YA 4IN0A 2R4IA 1TI1A 2GQMA 3KP8A 4KH7A 3D5JA 1AW9A 4G0KA 3A2VA 1BU4A 5A0OB 4XS1A 4OCFA 2P31A 3MHEA 2DBCA 3MWZA 3U6VA 3ALAA 2GSPA 4EC0A 3EC3A 1NDOB 1U8CB 5B6NA 5GZZB 1WIKA 2IJYA 5M18A 3W8SA 4ORLA 1D6YA 3K0ZA 3CPW2 5CRGA 4K1UA 4QL9A 1O7PB 1XPVA 2OADA 3OWYA 2RM6A 2CX0A 1VF4A 1HNBA 2QIYA 3ZVJA 4XRAA 3GRDA 3NZNA 4TKYA 4F9ZA 1Z6MA 3BOAA 2CW9A 4LYLB 2BMOB 4OFMA 4EW5A 2NDOA 3JUPA 3FZ9A 5ELJA 3MG1A 1OACA 2VM1A 4DKIA 2XC2A 1B20A 4BA7A 1VQQA 1SK0A 1LJRA 2R0PA 3IAM2 2DJJA 2WRTA 4KUNA 3GURA 1B2SA 1EEMA 4FO5A 1SKRB 3MG3A 3G7JA 3Q74A 5HQPA 3DVWA 2FWEA 2MF7A 3LWAA 3M9KA 3QOUA 3WT1A 4Z2UA 2FNQA 3X3XA 3DIEA 1YI23 2L5OA 1K3OA 3HZ8A 4K1FA 1AXDA 5LD0A 1IYIA 1Y4KA 2GGTA 2RNTA 3S9FA 1ERTA 2Z7AA 5IEPA 4AKYA 2CX4A 4XS4B 4HJLB 18GSA 5GAPD 1EP7A 1HZ1A 2FHEA 3MG2A 3P8WA 2REMA 3CC73 1EGRA 1J08A 2H1GA 1V98A 2M46A 5D9TA 1M1K4 3GHAA 1BOXA 4L5LA 1SYRA 3B8LA 3BCKA 3I0YA 1DYUA 4AF2A 1GSDA 2O87A 1W2ZA 2P5RA 3HVXA 4ZBAA 4WHAA 1RRHA 2C80A 4IT7A 4G19A 2OE0A 1MDKA 4NMUA 1YEXA 1X9SB 1BGSA 1G6YA 2IMEA 3F4SA 2DIZA 1LXEA 8CHOA 1I0VA 3IXRA 3FR6A 3NUVA 2YJ7A 3N5OA 1S723 2AV4A 4L5OA 2ZHXB 4N10A 1GMRA 1R5AA 4K7IA 4TX4A 5HFKA 1RGCA 2H75A 4V2MA 1MWSA 6RNTA 4G1MB 4GHOA 3E0UA 1M9BA 1YJ93 3GZRA 5ECRB 4FMDA 2GXFA 1TK8B 1QAKA 4TN8A 3GX8A 3D0ZA 1A23A 1I0XA 1EQKA 1B2XA 3HI7A 4FMBA 2EIRA 4O8SA 4EXJA 3A5WA 2CFDA 1YJW3 4ML1A 1KNGA 1FB6A 1WJKA 2GSTA 1QJGA 2A4VA 1I9DA 3EVIA 2HMNB 3ZTLA 2GTUA 2H72A 1W6YA 2JSZA 3K8NA 4Z2RA 1TRQA 2C0GA 3ZVJD 1T00A 3FCSB 3W8JA 2BMXA 5J4UA 2VL2A 5INYA 3KFQC 3HX8A 2GS3A 1W6CA 5G5FA 2IMIA 3FR9A 1VQP3 3HKRA 2PGTA 3KGKA 3TUEA 4TR1A 1XVWA 13GSA 1XOAA 1BAOA 2BMQB 1E6BA 1JLWA 3KCHA 3IPZA 1PFOA 1TFOA 3P2AA 1U87A 1O81A 3GZYB 2YV9A 1XBSA 3F4RA 1J9BA 5IOXA 1BSBA 1ZYQB 3B4PA 4MH3A 1I8VA 3NV0B 5G30A 2OQEA 4EYCA 3FHKA 1EOGA 3K9MC 1B4PA 4EDZA 4PQ1A 3F3QA 1W6GA 3WGEA 3NHXA 3A5IA 4TVEA 3VI5A 3GL3A 2WULA 3C1RA 2W6JH 4AJ8A 1B21A 1UDII 1XW5A 2W04A 2J9HA 4K9ZA 1U88A 5I97A 3TKQA 1GL8A 4BTWA 3IK7A 4GRFA 1EEJA 2F4YA 3DXOA 1SU9A 2W03A 2LRTA 1ULJB 2CK3H 3DEXA 2DJKA 4XHMA 3CNMA 1DMQA 4YKGA 2OBKA 1WMOA 3IA1A 3KTBA 2VCZA 3X41A 1QQ2A 3APSA 3IRAA 4Q53A 1IVVA 3I6AA 3H79A 3QAGA 1PN9A 2R2JA 3GYKA 1PA3A 3ERGA 4MPFA 3P7XA 1FUSA 3RGAA 1TK0B 3RPPA 1LOYA 4YQMA 5ECKB 1JKGA 1TK5B 2K3DA 4PX1A 3CYNA 3BB9A 1Q7HA 3NIVA 1NU3A 2Z76A 1AY7A 2G2QA 5HR0A 5KP3A 1HNAA 3G6E3 2R6KA 5IIZA 5ID2A 2KP1A 4K1VA 3CNXA 3HZPA 5JWOB 4XDVA 4J57E 4MA9A 1I70A 1LOWA 3BNCA 2E0QA 4HI7A 4MJBA 1Z9HA 2I81A 1MD3A 4Z2TA 1YIJ3 2CVKA 5RNTA 1FZUA 5HFGA 2XFTA 5HR2A 2KUCA 2B1LA 4J56E 3D9RA 2GT5A 2Z6BA 4POMA 2K0MA 1UN2A 2E2MA 5AIIA 4K6XA 3QFBC 1QGVA 3APQA 1SD9A 4BIRA 4WWUC 2LSTA 5ECOB 4MK3A 3BIRA 3LXTA 1LNIA 2A2PA 4OWYA 5B6MA 4JRFA 3FK8A 5EY6A 3WOFB 5AIVA 3A76A 4L7KA 1MGRA 1K0CA 1GS3A 2W2CA 2E2VA 1GTIA 3IC8A 5DQYA 1BJXA 3PCRA 3LXUX 3OWUA 1W00A 5DRVA 2B3SA 5AGYA 4HZ4A 2C11A 4I4KA 1B4QA 2O7KA 2DJ3A 5STDA 2C8UA 2OE1A 3MDKA 1BRIA 2AUVA 1GNWA 4HM4B 2YFIB 4NWYA 4IP6A 8GSSA 3G7IA 2YX9A 2FNOA 4TR0A 1W4VA 1TU8A 4L8EA 4FCMA 4KAEA 3HJPA 2NTOA 3N54B 3DZLA 1Z5YE 2QA1A 1ZO2A 3MNGA 2F3MA 1GY6A 1X5DA 4J9AA 2V6OA 4ZIJA 1JN5B 4OFTA 4HAAA 1ZOFA 1OKDA 1I2FA 2NVLA 3VWWA 2LV3A 5JPUA 22GSA 3HK4A 5ECMB 1I3FA 1A67A 1E3RA 5G31A 3L0HA 1GSPA 1OGZA 5D9WA 3UOMA 3LYPA 2PMTA 4MLYA 4O3VA 4HBRA 4WR5A 5F06A 1GTAA 1BNRA 2FWGA 4D73A 1V58A 3NBBA 4YQUA 1DE3A 2B7JA 4BPYA 1T4ZA 2F99A 1NW2A 1OYJA 3PS8A 2CAIA 5KOXA 4KSMA 3WMDA 1RNTA 1L5GB 1ZYNA 5EQLA 1XW9A 4HKVB 2IMJA 2H1AA 6GSSA 3H51A 2RUFA 2WOFA 3HZ4A 4LEHA 3KMOA 2IWTA 5TGNA 1O7GB 1DUGA 3OR5A 3RHBA 3WOEB 2YJHA 5F05A 1BEDA 2HSMA 3D4MA 3M0FA 4POLA 1OUNA 1FA3A 3HJOA 1MDJA 2L4QA 2R0GA 1VF3A 1TU5A 2GLRA 3UBLA 4MCUA 3CBUA 3EPTA 2J8XB 3A2WA 3PCSA 3CRUA 3U97A 2FUG2 4ZB6A 3UL6A 1NB5I 1M2DA 4LA1A 2HRKA 4K5SA 1JN5A 3O8YA 1VGLA 1JHBA 4N6NB 1BIRA 1QMAA 3FZ4A 1JZOA 2X99A 2V1MA 4KT3B 2PBJA 1BNIA 2KHPA 2LQQA 2MZCA 1S3DA 3LTCA 1C72A 3KZQA 2EIQA 4H61A 4N6UA 1M0UA 3VSYA 1Z6NA 3CXC2 1SL2B 2F5WA 3DMLA 1Q9EA 4CHSA 4Q5QA 2O85A 3G7YA 1PSQA 3ED3A 3V92A 1K0OA 2HMKB 4BL7A 2ZUPA 4Q5RA 1TRUA 2K8VA 1SJWA 4O7HA 2W56A 1PQNA 1HNCA 3VFIA 5IMDA 3LGCA 1GTUA 4ZBDA 3CSHA 2IA7A 2A4HA 1GSUA 1SIHA 3AGNA 2XPEA 4NHFA 4YAPA 2LNSA 2YZHA 3L0RA 3V98A 1WRYA 1X0RA 2DKHA 4XDWA 1RMSA 1ROVA 5DAKA 1LQMB 1SJIA 3RAZA 2HNLA 4YQVA 3V1WA 3EX9A 1ZMAA 4HM3B 1AQWA 5D8IA 2XBQA 2L1SA 1JZRA 4FR9A 2X8GA 1UW1A 1A90A 2P5QA 3OW22 3HDCA 4DSQA 2GQLA 3EBYA 3TKPA 4HM1B 3CU3A 3PXMA 4MJEA 2GU3A 2CFKA 1US1A 3RDEA 1GSFA 1V2AA 2AJQB 5ELAA 3KKGA 2O8VB 5KP1A 1V40A 1YVSA 4I5QA 3TJBA 3WA2X 2LQVA 2HZEA 4PUFC 4RI7A 4JU5A 2K9FA 1X5CA 1QXHA 1RGLA 3M8CA 3I553 1TU7A 2YNXA 5COHA 2KAAA 4HJMA 1I3IA 4DSRA 4H3UA 3I69A 1IT8A 3KP9A 3TB2A 4I8BA 1W2B2 1MOLA 3DRNA 3CC23 3LOYA 3JUNA 3CMA3 1BNGA 4HOJA 2UUGC 4XM4A 3G9BA 4HM5B 1A8LA 2NBSA 3FGYA 1U3IA 2O89A 1SIIA 1QFNA 3ISOA 2ZDJA 2BU4A 1RTUA 2H1BA 2N5BA 3Q2PA 4KF9A 4HS1A 2BIRA 1LVNA 5D93A 2CG1A 1OF5A 4V1Ag 3G4S3 1YJ6A 4IQAA 2WFCA 11GSA 2WCIA 2HI7A 4I97A 3LORA 4XS6A 3WYWA 1FB0A 1W7CA 1K0MA 4KFEA 4IQ1A 1A2PA 3B4OA 3CCV3 2XEPA 2VCTA 4MZCA 5A5KA 1TTOA 1MWUA 3EC9A 1B48A 2IUKA 1TXXA 3FW2A 3CMIA 3GH9A 4OMVA 1A2KA 1IV7A 3D6IA 3TJFA 2LQOA 1OC9B 3GTUB 2MC8A 2GSRA 3M8NA 4PUAA 1JBSA 1TI3A 3KIJA 4KE3A 4RBNA 2YWOA 6GSYA 3CQFA 1OCVA 3J7Yb 4POBA 4OUQA 3X3YA 1VQ93 3GNJA 4IGJA 4XBYA 4I6XA 4K90B 4ILFA 1LU4A 2HXKA 2R41A 3KE7A 3QDNA 3KN4A 1B27A 4GSSA 1YVBI 2W9QA 5J9CA 3S27A 3FH1A 5CP1A 1ZGXA 1H75A 4L0WA 3I563 1I2EA 1JRQA 5LC6A 1JLVA 4O92A 1ISKA 5GSTA 1NHYA 1GY7A 4KFFA 3W6GA 1F2EA 1Z3EA 3IMAB 1KD14 2F98A 3GIXA 3SEDA 3F3RA 1PMTA 1EWXA 5AYRB 4F0BA 3N9HA 4G0LA 5M19A 2R3XA 4HQSA 7STDA 1BSEA 4GQFA 1ZYPA 1O7MB 4EXRA 5H5QA 3R2QA 2AADA 2X8HA 2QGVA 3D5GA 4PQHA 2HMOB 4MF5A 3Q3FA 1GSQA 1JBRA 4OD7A 2H1DA 1K0AA 5A4WA 1K0BA 1ZL9A 1GRXA 5FHIA 2QEX3 5ECHB 1YNVX 1RHLA 4GQCA 2FY6A 3QAWA 3C71A 4V1Ap 1BSCA 3HHVA 2PERA 3DGYA 4MABA 3NXJA 3LT9A 4GL6A 5AEUB 4WBRD 3GX0A 2M80A 2IIYA 2XFSA 2QA2A 4L8PA 4EO3A 4O5UA 1JZDA 2WS2A 2P0XA 2QGUA 2KCDA 4PGTA 4K7OA 1HKXA 2Q07A 4N6LA 2YWNA 1JKGB 2D1WA 3PPUA 4WYKA 1RGHA 3ZFBA 2PN8A 1USBA 3IJEB 4EIPA 1IQXA 3TKSC 2RFRA 1G7EA 4X1UA 1EA2A 2GZZA 2P05A 5G2ZA 2PPTA 1IU7A 4MJAA 4HZ2A 4BVYA 3PGTA 5CRWA 2YWIA 3ZITA 3CCU3 1J2BA 4TW5A 1G7OA 5C04A 3FG4A 4FMAA 3STDA 3QD9A 4PNFA 5J3RA 1UA5A 2IY2A 5FGOA 4BVXA 1AQVA 4O32A 1BG5A 2OCTA 5EVOA 1V57A 4NPBA 3FY7A 3WDGB 4TXOB 3T8UA 3TJGA 1XVQA 4G9HA 2CFWA 4KA0A 1GSYA 4HOHA 4X4JA 2XBIA 2B1XB 1G02A 2VM2A 3RBTA 5KP4A 2GU1A 3NBRA 5IMAA 1C7HA 2HRNA 2VD1A 3UVTA 3EURA 5IW9A 1MNLA 4RQRA 3WGXA 1Q42A 2JZRA 1N5HA 4CW9A 5C00A 2LNTA 3GKMA 1U5OA 3HOHA 3HYPA 2GBWB 4ID0A 2RSXA 2IUJA 1MD4A 3GKXA 1UUWB 4LMIA 2UZ8A 4E8HA 3U1WA 1NO3A 1N8QA 3L4NA 1OE7A 1IQ8A 3EMPA 4G10A 4DEJA 2FCHA 1YGWA 1R26A 3GSPA 4IS0A 2V2GA 5IF6A 4K5RA 3S5CA 5EPFA 4ICYA 1BSDA 1TRSA 2V41A 2FD3A 1CYVA 3MKIA 1AQXA 1M9GA 5CK6A 4AEQA 3VWXA 2GT6A 4OCEA 1R4WA 1WQLB 1EUIC 1YKAA 1ACVA 1GUKA 3LG6A 3EB8A 3FR3A 2ON5A 6GSPA 1UGHI 3M3MA 1T3BA 2CHCA 5LC7A 3O6TA 3P90A 4IELA 3LYGA 2CIUA 2C0FA 2V32A 4KZ1A 3ZREA 4ZILA 5IMFA 3N9JA 1YDKA 3SLUA 4DSSB 1OKTA 2DC5A 4RZMA 1TDIA 5B8BA 4IJIA 1BVIA 4V2LA 1OAZA 1BUQA 3ZIJA 4MZBA 3OV4A 4HM2B 1Q814 4D73B 4RI6A 1IDPA 3D4TA 3C1SA 2C3QA 4F82A 3GN3A 2M72A 4EDYA 1VQ63 3ROBA 9GSSA 1SK2A 4NV2A 2A15A 3VK9A 1I2GA 2HMMB 5B8AA 2H74A 2HT9A 3S67A 2CZ2A 2I4AA 1GNEA 4TOPA 5CREA 3F9SA 2CFLA 1SARA 4IVFA 1B8XA 1BNJA 3KEBA 3TKRA 1DE2A 4JRRA 4R80A 5M1AA 2CWUA 2FGXA 2P38A 3ZZXA 3ZG5A 1FW1A 1O6JA 2HYXA 3L78A 1BSAA 3UEMA 1O7UA 4WEYA 3GV1A 1RDSA 4X0XA 4N11A 1PD21 2P09A 1LNHA 2MMOA 3TRPA 4BTYA 2GVPA 5F0GA 5CRDA 1A8YA 3WODG 5JWRB 2P0GA 1SKSB 2W0QA 2MMNA 1Q40B 2JADA 2ZA4A 5AIXA 4WF4A 4RNTA 2GSSA 1STFI 1RSNA 4U13A 2C0DA 2L59A 2IPAA 1GMPA 4ECJA 1A0RP 3TRXA 1JJ22 5CLKA 4L8OA 3KXOA 4EUYA 1WMNA 1N2AA 4GSPA 3GUSA 1AR0A 2OOVC 3EN1B 2GQKA 2OJLA 5DQSA 1X9MB 3DVXA 4WFOA 1WNHA 4K0NA 4JBBA 4ISDA 5EL8A 3J7Yd 2BJXA 3X3ZA 2ZL8A 3VPQA 2LRCA 1DMNA 3EYTA 5IM9A 1T2HA 3AMOB 4N6TA 2W56B 2HFDA 3M1GA 2KLXA 3MSZA 4JR6A 2MMZA 1A2MA 5J9BA 1F8NA 4BU4A 1UI7A 3RDWA 1XCCA 3Q1CA 3ERFA 3KD0A 2JDIH 2IMKA 5DAKB 2CQ9A 2LJKA 1U3AA 3QMXA 5IMZA 1CQSA 2FXTA 4R1KA 1RKYA 1TJDA 1LOVA 3BD2A 5IPHA 1WP0A 2HSHA 3PINA 3KJYA 5KEJA 3VI7A 4XBTA 2LYXA 3I9V2 5CAXA 3G8ZA 3DGQA 3BNBA 1FGRA 1VF2A 3ZFLA 1Y6EA 2YANA 1ZZYA 1M1XB 3MAKA 1PYLA 2ON7A 1MEKA 1SPUA 2CC3A 3QFAC 3EE1A 3GRXA 1W89A 3GL5A 3LW9A 2ML6A 1OHPA 4FYCA 5DBQA 4GCIA 1AUCA 2C1YA 2HZEB 3PR8A 4QL7A 3VLNA 3F40A 3ZIVA 1NNVA 4ZB9A 1GLQA 2VD0A 1OHSA 5JBSA 3RGRA 2RUEA 4XCSA 2F51A 2PVQA 4HQZA 1RGAA 4ECIA 1CQGA 5G1LA 4I2UA 1F37A 1XWCA 1U6TA 3IK9A 1JZWA 2YPMA 1UUVB 2CX1A 1PU4A 1Q4JA 2TRXA 3H1NA 1YHQ3 19GSA 4KX4A 4N30A 4KDXA 1UVZA 2VAFA 4CDLA 3DH2A 4JF8A 1EP8A 1MDIA 1T2IA 2VLVA 4RQXA 3JUOA 1TW9A 1KBNA 3CSIA 3WD6A 5LCZA 4CDOA 1B2UA 3N8BA 2INXA 3BNEA 4G2EA 4MZWA 2WB9A 1RJOA 3BLZA 2VCWA 1QALA 4L0UA 4GLTA 4POKA 2VCQA 2B24B 2YZUA 1RN7A 1BYEA 1GSSA 4X2OA 2HRFA 2RIIA 1XG8A 2ALBA 1K9M4 2F86B 1EG9B 2IL3A 3DKSA 4WXTA 2VUPA 2H6YA 2LJAA 1BRHA 3C8EA 1G0TA 1OC8A 2L57A 3ME8A 4ACSA 3NV0A 2EIOA 1W5ZA 4FQUA 1DE1A 1RGEA 3RHCA 4XTSA 1T1VA 2M7OA 3H3HA 2DJ1A 2SARA 3FMWA 5CF2A 1ZS7A 1W01A 1NM3A 1UI8A 1LQGC 4CJNA 1E2YA 5GAND 1ST9A 2RLIA 2L5LA 5H5RA 2C4BA 5JCWA 3AGOA 5A4UA 2VCVA 2VL3A 3MSOA 4LSOA 2WGOA 2CT6A 4N0VA 4CY6A 2C3TA 2E2UA 3F6DA 4X43A 2BTOT 3CTGA 3Q18A 2D42A 3CCL3 3RPNA 1IVWA 4OK0A 3IHGA 2N5AA 3QRDA 1WMPA 3L9UA 3SX1A 5EVHA 1RGFA 1KC84 1HD2A 1RW1A 3JVCA 2MBTA 3FZAA 3LJRA 2DMLA 1BAYA 1JNQA 3NX0A 1S3RA 1FUTA 1JV2B 2K6VA 1ULIB 1M9AA 2XGNA 4BIKA 2RCDA 3FLJA 3UL3A 4BL2A 3ZRDA 1XFLA 1BQ7A 4WP5A 4HM0B 4MMXB 5IMCA 1UCIA 3NM2A 4RUVA 3TRQA 4EVMA 5IG3A 3KSPA 4G0IA 3NM7A 2IFQA 4BWQA 4H86A 1YJN3 3F14A 1A24A 2XSOB 2GSQA 2ZNMA 2DJ2A 1AVKA 4JE1A 5IO0A 4LGQA 1JB4A 4R9LA 2DKIA 4Z7XA 4EIQA 1BRNL 3WA3A 3QK9A 2VLUA 2FWHA 4ZBBA 4ZM8A 3R3EA 5HR3A 1S3AA 4IHUA 1AC1A 1IVUA 1EOHA 4ML6A 1NWWA 1FW7A 3O76A 2AYTA 3NOFA 2PU9C 1EKMA 3G0KA 3BJ5A 4WF5A 4HU7A 7RNTA 1VRSD 2B5XA 2H30A 3HIIA 2I9HA 3EN8A 1BNFA 3FRCA 4MJDA 3LXZA 5B7CA 1X1YA 3CCQ3 4I2TA 4BVXB 3TOTA 2OWPA 5IO2A 5FT3A 3H93A 1B2ZA 3UNLA 2DIYA 1FHEA 5DVBA 4FYBA 3KH9A 2BNGA 3LTAA 6GSTA 3HCZA 3SXXA 3CCR3 4MF6A 2BHMA 3EF8A 5ENUA 5DJMA 2CG0A 2X8CA 3ZMKA 1K28A 1RGGA 3X42A 2LEGA 3DUKA 2HLSA 2R5GA 3UARA 2H6ZA 4KNDA 1A2JA 3GWRA 5D81A 3LYKA 3F7SA 1W02A 4J8TA 2CX3A 2OE3A 2PVOC 1FGMA 3GZXB 2AAWA 1XIYA 1B3SA 1D6ZA 4GWRA 3ZL5A 3MIXA 4IP1A 1LRAA 2I1UA 3ZG0A 4K2XA 1Q864 1PGTA 1X1XA 5D83A 1Y25A 1SK1A 7GSSA 2I3YA 3F0IA 2JSYA 3D4AA 3EU4A 1M2BA 3HD5A 4FH8A 1CQHA 1SL1B 3JCML 1UCKA 1KSIA 3K5TA 6STDA 3C73A 5D9XA 5ABRA 3UVHA 1GUMA 1S3CA 2MYGA 3NQYA 1FGQA 1VQN3 4KDUA 3GKNA 4EBGA 3HVVA 1K8A4 2OTJ3 5CO3A 1Q98A 3F9UA 4FYUA 2VL2C 2GZYA 1DVCA 1PFPA 1VQ73 4O5QA 4F2IA 2VLTA 2HOHA 3F4TA 4JR4A 4TR1B 3A2XA 5KN0A 1RLSA 1FOHA 1KTEA 3F7XA 4ULXA 3CSJA 1SQWA 2H73A 1RCLA 1QVG2 2L4VA 2YCDA 1SD8A 4EV2A 2V6KA 3IAS2 1N9EA 5EEOA 1THOA 1RN1A 4YAVA 1FVJA 4RNYA 5F07A 4CPKA 2HSYA 1ERVA 1BRKA 2OQEC 4IW9A 5JWQB 1O7WB 2STDA 1WE0A 2H0IA 1A0FA 2QSIA 2WGRA 4HM7B 3SOYA 1V9WA 2AAEA 1PX6A 4AGSA 5HGRA 4LMVA 2KRTA 3LMLA 1RNBA 4ZL7A 3F8UA 3JUMA 1SJZA 1DBYA 1TRPA 4QWTA 1FOVA 5HOHA 2FA8A 1ASKA 3DM8A 3AHWA 1OGXA 3HIGA 4J2FA 3TOUA 1FYSA 4HJ2A 3UBKA 5CF1A 2LRNA 3HVNA 1SJ6A 4IJ3A 4OFNA 1EV9A 3NQZA 4HZBB 1C54A 3LEFA 6GSXA 4MMZB 3TGZA 2VL9A 2SBLA 3A3TA 1O8XA 5KN1A 3WGDA 4BWSA 1YY7A 1YZXA 3CD63 2UX0A 4IIAA 3Q19A 1GLPA 4OO4A 4J5KA 1VQL3 2WOHA 3D79A 5F8BA 3ECFA 5IG5A 2X49A 9RNTA 4AKZA 4IBPA 2F56A 2YV7A 3AY8A 2IYJA 1WMJA 3U5RE 1S5AA 4EF0A 4PQIA 1T4YA 3CCE3 4K7NA 2F5MA 1B2MA 1NHOA 2OACA 2ZCTA 5CNWA 2ES7A 5ID2B 4GSNA 4Q5NA 1QVF2 2Y73A 3FSDA 5CRHA 1V74A 3EINA 2QA43 2DJ0A 2E7PA 2E2GA 4WBJA 4HM8B 5J5NA 1EGOA 2GEYA 1XWAA 3L9SA 6GSUA 3UL5A 5ECNB 2CZ3A 5IOWA 3CPOA 3ME7A 5HR1A 1IK3A 1H4OA 3FKAA 4MMYB 1GULA 1YEPA 5DALA 5E4WA 5ELGA 1NSWA 1XWGA 2K54A 1UGIA 3NBJA 4F0CA 2JU5A 5E59A 3B7CA 3CRTA 3S28A 3HJMA 5GSSA 1O7HB 3SOAA 1K0NA 4AJ7A 4HM6B 1MWTA 2DMMA 2GBXB 1X1UA 1IT7A 16GSA 4IPBA 1QK8A 1I5GA 1R7HA 2VCXA 4LMWA 2KOKA 2FGTA 4PTSA 10GSA 2WZ9A 1M3JA 1XXUA 1GY5A 1DETA 2XH9A 4YH2A 3G16A 2KP2A 1KEBA 3LT8A 2QC7A 4K8MA 2H71A 4MH2A 2JZSA 2RBIA 2KF6A 2C0EA 2H6XA 1T8EB 5G1KA 5AEWB 1OVNA 3UIWA 3J7Yk 3GSTA 5J41A 5ECIB 3UMAA 2JQ5A 1M3IA 4QQ7A 2CFGA 1BANA 4NV5A 1VQO3 1XZOA 1ZCPA 1K3YA 1SENA 3LTBA 2VO4A 3APOA 5D73A 2PNCA 2YFLB 4AJ6A 5FW5A 7GSPA 1VZZA 3KM6A 4YKFA 3TJJA 1KQS2 2WGQA 3LFLA 4PURA 3L9VA 4ECBA 3GSSA 3EHCA 4X2HA 1YIT3 1N8JA 2RM5A 2F9SA 5ELUA 1E3VA 3IHQA 4KCEA 1CEWI 2H0GA 1TTZA 4IKHA 1Q824 1OC9A 3SWLA 3GTUA 2R37A 2DSAA 1ILOA 3T8NA 1ERWA 3A5EA 17GSA 1W4NA 1ERUA 1RRLA 3FEUA 1RQMA 1JB2A 5GSPA 1BRSA 3V99A 5DDLA 2Y74A 2H70A 1N5PA 1GSEA 1ML6A 4HU9A 3BU4A 2B5YA 3KIIA 5D82A 2OBIA 4HVNA 1PKWA 1PX7A 3ERWA 5G5EA 2ML5A 2B5EA 4HYZA 4O5RA 2W9PA 2LKUA 2XHFA 4MEIA 2R0CA 1AVLA 2KF4A 1HQOA 1Z7RA 3GFKA 4ZB8A 1K3LA 1AQZA 3EJVA 2CVDA 1M904 1YKCA 2LJRA 1B9YC 20GSA 5JCUA 5A4VA 1FG4A 3TDGA 1PL1A 2AB6A 1PN0A 1F3AA 4MPGA 2KXGA 3EE2A 4TR3A 1TRVA 1NB3I 8RNTA 2C3NA 2PUKC 3QCPA 1TIJA 1UUGB 1D6UA 1QUWA 1LBKA 4N6V0 4XBXA 5ECLB 4WETA 1UCLA 3D5IA 3BNDA 4PXOA 2K8SA 2XGLA 4EV5A 1XOBA
chains in the Genus database with same CATH topology
4TR4A 3GKKA 3IV4A 3IC4A 2JZTA 1TKDB 5KN2A 4MJCA 3VPTA 2FA4A 1SL0B 3EWLA 1TP9A 5IPGA 1YF0A 1OC3A 4GTUA 1Z7PA 4TXVA 2H01A 3F6FA 3VWVA 3SBCA 3UJ1A 3D22A 4XS4A 4MMMA 4Q5FA 2H8LA 4BL7B 5JCGA 3TKSA 4LLRA 6GSWA 2IFQB 4USSA 1XWBA 2CAQA 2VOCA 2YN1A 3CTFA 2L4CA 1O8WA 1SKWB 3H8QA 12GSA 5BMUA 1F3BA 2IMFA 1VF1A 1UC7A 5DJLA 1WOUA 2HE3A 5AN1A 4TXOA 5HFIA 2FWFA 1M7TA 2GDRA 3E9JB 4NHZA 4KW6A 3IE3A 1RK4A 3FYGA 3WT2A 1M99A 3KCMA 3DWVA 1AAZA 2TIRA 1EZKA 5DCGA 3LSZA 3KTLA 1JFUA 4XIHA 1O85A 3EMXA 2QKEA 4GSTA 2H66A 4GF0A 3E3EA 2B7KA 3LQ7A 1ABAA 3IOSA 4KCAA 3TKSE 1GH2A 2X64A 2MMAA 1GWCA 3MWHA 5D9VA 1WPIA 4P3YB 4LL4B 3C7MA 2H76A 2LUSA 3CXGA 2VIMA 5L71A 1SYXA 2LS5A 1PL2A 5ECSA 3FKFA 5KN3A 1R5PA 3DD3A 3KH7A 3TCOA 4DSSA 2L6DA 1PRXA 1TOFA 2A2SA 4EE0A 1PKZA 2YWMA 3VWUA 2IN3A 3MYDA 4NXIA 5IMVA 2A2RA 2F8AA 3ZYWA 3VURA 3HY2A 1F6MC 5AISA 1HYUA 3F63A 2AHEA 3O3TA 4JZQA 3BBYA 2G0FA 1M2AA 4E8EA 4FIWA 2YOIA 3H4KA 4N0ZA 2L6CA 1G6WA 3IR4A 4EKZA 5DCHA 4ZL9A 4KB3A 3ZMLA 1F9MA 3DXBA 3KMNA 1T7PB 3QR6A 5KOWA 2H19A 3HVSA 3BCIA 1FO5A 3IBHA 1X9WB 4OO5A 3UAPA 2X4AA 2WJUA 1A2LA 1IYHA 1B9XC 2D2ZA 4A5PA 3GA4A 5ECQB 4TRXA 3D21A 1OE8A 4HEA2 5ECPB 3IDVA 4EL1A 4MP4A 1YQ1A 5FWGA 3Q6OA 1MTCA 3GMFA 1TRWA 14GSA 3QAVA 4KSOA 1BX9A 1FAAA 1QMVA 4ZL8A 2F8FA 1J0FA 1O73A 3DYRA 2EC4A 4NAXA 2JL4A 1WWJA 5LNKe 2NPBA 1DSBA 2WDUA 4V2NA 3US3A 1FVKA 2YP6A 2Z9SA 4BVYB 3HXSA 1AIUA 5BRTA 4KDYA 3FZ5A 2B6MA 2FLSA 4JEDA 2DLXA 2GZPA 2XPDA 2OKAA 2MBSA 4NHWA 5IQYA 4ZXGA 4XRDA 2J23A 3ZLPA 5DALB 4K2DA 1K0DA 2TRCP 5CYYA 3TJKA 1URMA 1ZGNA 2CVBA 1ON4A 2C4JA 1GUHA 2JACA 1XWKA 2CV4A 1XW6A 1ZYEA 5D96A 4WR4A 1GTBA 5H5SA 1EV4A 4HUAA 4KGIA 2R4VA 3PH9A 3HA9A 2LTKA 4MNNA 4F03A 1THXA 2K18A 3QPMA 4DVCA 3I43A 2PWJA 3M9JA 3EU3A 6GSVA 4ECCA 2CA8A 2HRAA 1X5EA 4HDEA 2HZFA 2N5FA 1GP1A 4MF7A 4MDCA 2OA7A 2B1KA 4GXZA 2IMDA 4CY8A 4K0GA 4LL1B 1YF1A 4PNGA 2H0HA 3GH6A 4IN0A 1TI1A 2GQMA 3KP8A 4KH7A 3D5JA 1AW9A 4G0KA 3A2VA 4XS1A 4OCFA 2P31A 2DBCA 3U6VA 4EC0A 3EC3A 5B6NA 5GZZB 1WIKA 2IJYA 3W8SA 5CRGA 4QL9A 2OADA 1XPVA 2RM6A 1VF4A 1HNBA 3ZVJA 4XRAA 3NZNA 4TKYA 4F9ZA 1Z6MA 3BOAA 4OFMA 2NDOA 3FZ9A 2VM1A 2XC2A 4BA7A 1SK0A 1LJRA 2R0PA 3IAM2 2DJJA 2WRTA 4KUNA 3GURA 1EEMA 4FO5A 1SKRB 3G7JA 3Q74A 5HQPA 3DVWA 2FWEA 3LWAA 3M9KA 3QOUA 4Z2UA 3WT1A 3DIEA 3HZ8A 2L5OA 1K3OA 4K1FA 1AXDA 5LD0A 1IYIA 2GGTA 3S9FA 1ERTA 2CX4A 4XS4B 18GSA 5GAPD 1EP7A 2FHEA 3P8WA 2REMA 1EGRA 2H1GA 1J08A 1V98A 2M46A 5D9TA 3GHAA 4L5LA 1SYRA 3BCKA 4AF2A 1GSDA 2O87A 2P5RA 3HVXA 4ZBAA 2C80A 4G19A 2OE0A 1MDKA 4NMUA 1YEXA 1X9SB 1G6YA 2IMEA 3F4SA 2DIZA 3IXRA 3FR6A 2YJ7A 3N5OA 2AV4A 4L5OA 4N10A 1R5AA 4K7IA 5HFKA 2H75A 4V2MA 3E0UA 1M9BA 5ECRB 1TK8B 4TN8A 3GX8A 3D0ZA 1A23A 2EIRA 4EXJA 3A5WA 4ML1A 1KNGA 1FB6A 1WJKA 2GSTA 2A4VA 1I9DA 3EVIA 3ZTLA 2GTUA 2H72A 2JSZA 3K8NA 4Z2RA 2C0GA 3ZVJD 1T00A 3W8JA 2BMXA 5J4UA 2VL2A 5INYA 2GS3A 5G5FA 2IMIA 3FR9A 3HKRA 2PGTA 3KGKA 3TUEA 4TR1A 1XVWA 13GSA 1XOAA 1E6BA 1JLWA 3IPZA 3P2AA 1U87A 1O81A 2YV9A 1XBSA 3F4RA 1J9BA 5IOXA 1ZYQB 4MH3A 5G30A 3FHKA 1EOGA 1B4PA 4EDZA 4PQ1A 3F3QA 3WGEA 3A5IA 4TVEA 3VI5A 3GL3A 2WULA 3C1RA 4AJ8A 1XW5A 2J9HA 4K9ZA 1U88A 3TKQA 1GL8A 3IK7A 4GRFA 1EEJA 1SU9A 2LRTA 3DEXA 2DJKA 4XHMA 4YKGA 2OBKA 3IA1A 3KTBA 2VCZA 1QQ2A 3APSA 3IRAA 3I6AA 3H79A 3QAGA 1PN9A 2R2JA 3GYKA 1PA3A 3ERGA 4MPFA 3P7XA 1TK0B 3RPPA 4YQMA 5ECKB 1TK5B 4PX1A 3CYNA 3NIVA 2G2QA 5HR0A 1HNAA 2R6KA 5IIZA 5ID2A 2KP1A 5JWOB 4J57E 4MA9A 4HI7A 2E0QA 4MJBA 1Z9HA 2I81A 1MD3A 4Z2TA 2CVKA 5HFGA 5HR2A 2KUCA 2B1LA 4J56E 2GT5A 4POMA 1UN2A 2E2MA 4K6XA 3QFBC 1QGVA 3APQA 1SD9A 2LSTA 5ECOB 4MK3A 3LXTA 2A2PA 4OWYA 5B6MA 3FK8A 5EY6A 5AIVA 1K0CA 1GTIA 3IC8A 5DQYA 1BJXA 2B3SA 5AGYA 4HZ4A 1B4QA 2O7KA 2DJ3A 2C8UA 2OE1A 3MDKA 2AUVA 1GNWA 4NWYA 4IP6A 8GSSA 3G7IA 2FNOA 4TR0A 1W4VA 1TU8A 4L8EA 4KAEA 3HJPA 2NTOA 1Z5YE 2QA1A 3MNGA 2F3MA 1X5DA 2V6OA 4ZIJA 4OFTA 1ZOFA 1OKDA 2NVLA 3VWWA 2LV3A 22GSA 5ECMB 5G31A 3L0HA 5D9WA 3UOMA 3LYPA 2PMTA 4MLYA 4WR5A 5F06A 1GTAA 2FWGA 4D73A 1V58A 4YQUA 2B7JA 4BPYA 1T4ZA 1NW2A 1OYJA 2CAIA 5KOXA 4KSMA 1ZYNA 1XW9A 2H1AA 6GSSA 2RUFA 3HZ4A 3KMOA 2IWTA 1DUGA 3OR5A 3RHBA 2YJHA 5F05A 1BEDA 2HSMA 3D4MA 3M0FA 4POLA 3HJOA 1MDJA 2L4QA 2R0GA 1VF3A 2GLRA 3UBLA 4MCUA 3CBUA 3EPTA 3A2WA 3CRUA 2FUG2 4ZB6A 1M2DA 4LA1A 2HRKA 4K5SA 1JHBA 1VGLA 3FZ4A 1JZOA 2X99A 2V1MA 2PBJA 2KHPA 2LQQA 2MZCA 1S3DA 3KZQA 1C72A 2EIQA 1M0UA 1Z6NA 1SL2B 3DMLA 4CHSA 4Q5QA 2O85A 3G7YA 1PSQA 3ED3A 1K0OA 4BL7A 2ZUPA 4Q5RA 1TRUA 2K8VA 4O7HA 1PQNA 1HNCA 3VFIA 5IMDA 3LGCA 1GTUA 4ZBDA 3CSHA 2A4HA 1GSUA 2XPEA 4YAPA 2LNSA 2YZHA 1X0RA 1WRYA 2DKHA 5DAKA 1SJIA 3RAZA 2HNLA 4YQVA 3V1WA 1ZMAA 1AQWA 5D8IA 2XBQA 1JZRA 2X8GA 2P5QA 3HDCA 4DSQA 2GQLA 3TKPA 4MJEA 1GSFA 1V2AA 2AJQB 5ELAA 2O8VB 1V40A 4I5QA 3TJBA 2HZEA 4PUFC 4RI7A 4JU5A 2K9FA 1X5CA 2YNXA 1TU7A 5COHA 4HJMA 4DSRA 3I69A 3KP9A 3TB2A 4I8BA 3DRNA 4HOJA 3G9BA 1A8LA 2NBSA 2O89A 1U3IA 1QFNA 3ISOA 2H1BA 2N5BA 4KF9A 4HS1A 5D93A 4V1Ag 1YJ6A 4IQAA 2WFCA 11GSA 2WCIA 2HI7A 4I97A 3LORA 4XS6A 3WYWA 1FB0A 1K0MA 4IQ1A 2VCTA 4MZCA 5A5KA 1B48A 1TXXA 3FW2A 3CMIA 3GH9A 4OMVA 3D6IA 3TJFA 2LQOA 1OC9B 3GTUB 2GSRA 3M8NA 4PUAA 3KIJA 1TI3A 4KE3A 2YWOA 6GSYA 3J7Yb 4POBA 3GNJA 4IGJA 4I6XA 4ILFA 1LU4A 2HXKA 3QDNA 4GSSA 5J9CA 5CP1A 1H75A 4L0WA 1JLVA 4O92A 5GSTA 1NHYA 3W6GA 1F2EA 1Z3EA 3GIXA 3F3RA 1PMTA 1EWXA 4F0BA 4G0LA 2R3XA 4HQSA 4GQFA 1ZYPA 5H5QA 3R2QA 2X8HA 2QGVA 4PQHA 4MF5A 1GSQA 4OD7A 2H1DA 1K0AA 5A4WA 1K0BA 1ZL9A 1GRXA 5FHIA 5ECHB 4GQCA 2FY6A 3QAWA 3C71A 4V1Ap 3HHVA 2PERA 4WBRD 4MABA 3GX0A 2M80A 2IIYA 2QA2A 4EO3A 4O5UA 1JZDA 2WS2A 4PGTA 4K7OA 2YWNA 3PPUA 3ZFBA 2PN8A 1USBA 4EIPA 3TKSC 1G7EA 4X1UA 2GZZA 5G2ZA 2PPTA 4MJAA 4HZ2A 4BVYA 3PGTA 5CRWA 2YWIA 3ZITA 4TW5A 1G7OA 5C04A 3QD9A 4PNFA 5J3RA 1UA5A 2IY2A 4BVXA 1AQVA 4O32A 1BG5A 5EVOA 1V57A 4NPBA 3FY7A 4TXOB 3TJGA 1XVQA 4G9HA 4KA0A 1GSYA 4X4JA 2XBIA 2VM2A 5IMAA 3RBTA 2HRNA 2VD1A 3UVTA 3EURA 4RQRA 3WGXA 2JZRA 4CW9A 5C00A 2LNTA 3GKMA 3HYPA 4ID0A 1MD4A 3GKXA 2UZ8A 4E8HA 3L4NA 1OE7A 3EMPA 4G10A 4DEJA 2FCHA 1R26A 4IS0A 2V2GA 4K5RA 5EPFA 4ICYA 1TRSA 2V41A 2FD3A 1AQXA 3VWXA 2GT6A 4OCEA 1R4WA 1YKAA 3LG6A 1ACVA 1GUKA 3FR3A 2ON5A 3M3MA 1T3BA 3O6TA 3P90A 4IELA 2C0FA 2V32A 3ZREA 4ZILA 5IMFA 3N9JA 1YDKA 4DSSB 1OKTA 2DC5A 1TDIA 5B8BA 4IJIA 4V2LA 1OAZA 3ZIJA 4MZBA 4D73B 4RI6A 3D4TA 3C1SA 2C3QA 4F82A 3GN3A 2M72A 4EDYA 9GSSA 1SK2A 4NV2A 3VK9A 5B8AA 2H74A 2HT9A 2CZ2A 2I4AA 1GNEA 4TOPA 5CREA 4IVFA 1B8XA 3KEBA 3TKRA 1DE2A 4JRRA 2FGXA 3ZZXA 1FW1A 1O6JA 2HYXA 3L78A 3UEMA 1O7UA 4WEYA 3GV1A 4X0XA 4N11A 1PD21 2MMOA 3TRPA 2GVPA 5F0GA 5CRDA 1A8YA 5JWRB 2P0GA 1SKSB 2MMNA 2JADA 5AIXA 4WF4A 2GSSA 2C0DA 2L59A 2IPAA 4ECJA 1A0RP 3TRXA 4EUYA 3KXOA 1N2AA 3GUSA 2GQKA 2OJLA 5DQSA 1X9MB 3DVXA 4K0NA 4JBBA 4ISDA 5EL8A 2BJXA 3VPQA 2LRCA 3EYTA 5IM9A 3M1GA 3MSZA 2HFDA 2KLXA 4JR6A 2MMZA 1A2MA 5J9BA 3RDWA 1XCCA 3ERFA 3KD0A 2IMKA 5DAKB 2CQ9A 2LJKA 1U3AA 3QMXA 5IMZA 1TJDA 3BD2A 5IPHA 1WP0A 2HSHA 3PINA 3KJYA 5KEJA 3VI7A 3I9V2 5CAXA 3DGQA 1VF2A 3ZFLA 1Y6EA 2YANA 1ZZYA 3MAKA 2ON7A 1MEKA 3QFAC 3GRXA 1W89A 3GL5A 3LW9A 4FYCA 5DBQA 4GCIA 1AUCA 2C1YA 2HZEB 3PR8A 4QL7A 3VLNA 3ZIVA 4ZB9A 1GLQA 2VD0A 2RUEA 4XCSA 2F51A 2PVQA 4HQZA 4ECIA 1CQGA 5G1LA 4I2UA 1F37A 1XWCA 1U6TA 3IK9A 1JZWA 2YPMA 3H1NA 1Q4JA 2TRXA 4KX4A 19GSA 4N30A 4KDXA 1UVZA 2VAFA 1EP8A 1MDIA 2VLVA 4RQXA 1TW9A 1KBNA 3CSIA 3WD6A 5LCZA 4CDOA 4G2EA 4MZWA 2WB9A 2VCWA 4L0UA 4GLTA 4POKA 2VCQA 2YZUA 1BYEA 1GSSA 2RIIA 2HRFA 2ALBA 2IL3A 3DKSA 4WXTA 2VUPA 2H6YA 2LJAA 3C8EA 1G0TA 1OC8A 2L57A 3ME8A 4ACSA 2EIOA 4FQUA 1DE1A 3RHCA 4XTSA 1T1VA 2DJ1A 3FMWA 1NM3A 1E2YA 5GAND 1ST9A 2RLIA 2L5LA 5H5RA 5JCWA 5A4UA 2VCVA 2VL3A 2CT6A 4N0VA 4CY6A 2C3TA 3F6DA 4X43A 2BTOT 3CTGA 3Q18A 3RPNA 3IHGA 2N5AA 3L9UA 1HD2A 1RW1A 2MBTA 3FZAA 3LJRA 2DMLA 1BAYA 2K6VA 1M9AA 3UL3A 3ZRDA 1XFLA 1BQ7A 5IMCA 4RUVA 3TRQA 4EVMA 4G0IA 2IFQA 4BWQA 4H86A 1A24A 2GSQA 2ZNMA 2DJ2A 4JE1A 5IO0A 2DKIA 4Z7XA 4EIQA 2VLUA 2FWHA 4ZBBA 3R3EA 5HR3A 1S3AA 4IHUA 1AC1A 1EOHA 4ML6A 3O76A 2AYTA 3NOFA 2PU9C 3BJ5A 4WF5A 4HU7A 3FRCA 1VRSD 2B5XA 2H30A 2I9HA 3LXZA 5B7CA 4I2TA 4BVXB 3TOTA 5IO2A 5FT3A 3H93A 2DIYA 1FHEA 5DVBA 4FYBA 3KH9A 6GSTA 3HCZA 4MF6A 5ENUA 5DJMA 2X8CA 3ZMKA 2LEGA 2HLSA 2R5GA 3UARA 2H6ZA 4KNDA 1A2JA 3LYKA 2CX3A 2OE3A 2PVOC 2AAWA 1XIYA 4GWRA 3ZL5A 3MIXA 4IP1A 4K2XA 2I1UA 1PGTA 1Y25A 1SK1A 7GSSA 2I3YA 3F0IA 2JSYA 3HD5A 3EU4A 1M2BA 4FH8A 1CQHA 1SL1B 3JCML 3C73A 5D9XA 5ABRA 3UVHA 1GUMA 1S3CA 2MYGA 4KDUA 3GKNA 3HVVA 5CO3A 1Q98A 3F9UA 4FYUA 2VL2C 2GZYA 4O5QA 4F2IA 2VLTA 3F4TA 4JR4A 4TR1B 3A2XA 5KN0A 1FOHA 1KTEA 4ULXA 3CSJA 2H73A 2YCDA 1SD8A 2V6KA 3IAS2 1THOA 4YAVA 1FVJA 5F07A 2HSYA 1ERVA 5JWQB 1WE0A 2H0IA 1A0FA 2QSIA 2WGRA 1V9WA 1PX6A 4AGSA 4LMVA 4ZL7A 3F8UA 1SJZA 1DBYA 1FOVA 2FA8A 4J2FA 3TOUA 4HJ2A 3UBKA 2LRNA 1SJ6A 4IJ3A 4OFNA 1EV9A 3LEFA 6GSXA 3TGZA 2VL9A 3A3TA 1O8XA 5KN1A 3WGDA 4BWSA 1YY7A 1YZXA 3Q19A 1GLPA 4OO4A 5F8BA 2X49A 4IBPA 2YV7A 3AY8A 2IYJA 1WMJA 3U5RE 4EF0A 4PQIA 1T4YA 4K7NA 2ZCTA 1NHOA 2OACA 5CNWA 2ES7A 5ID2B 4GSNA 4Q5NA 5CRHA 3EINA 2DJ0A 2E7PA 2E2GA 4WBJA 5J5NA 1EGOA 1XWAA 3L9SA 6GSUA 5ECNB 2CZ3A 5IOWA 3ME7A 5HR1A 1H4OA 1YEPA 1GULA 5DALA 5E4WA 5ELGA 1NSWA 1XWGA 4F0CA 2JU5A 5E59A 3CRTA 3HJMA 5GSSA 1K0NA 4AJ7A 4IW9A 2DMMA 4LMWA 1R7HA 16GSA 1QK8A 2VCXA 1I5GA 2KOKA 4PTSA 10GSA 2WZ9A 1XXUA 4YH2A 2KP2A 1KEBA 2QC7A 4K8MA 2H71A 4MH2A 2JZSA 2C0EA 2H6XA 1T8EB 5G1KA 1OVNA 3UIWA 3J7Yk 3GSTA 5J41A 5ECIB 3UMAA 4QQ7A 4NV5A 1XZOA 1ZCPA 1K3YA 1SENA 2VO4A 3APOA 5D73A 4AJ6A 3KM6A 4YKFA 3TJJA 3LFLA 4PURA 3L9VA 4ECBA 3GSSA 1N8JA 2RM5A 2F9SA 3IHQA 4KCEA 2H0GA 1TTZA 4IKHA 1OC9A 3SWLA 3GTUA 2R37A 2DSAA 1ILOA 1ERWA 17GSA 1ERUA 3FEUA 1RQMA 5DDLA 2H70A 1GSEA 1ML6A 4HU9A 2B5YA 2OBIA 1PKWA 1PX7A 3ERWA 5G5EA 2B5EA 4O5RA 2LKUA 2XHFA 2R0CA 1HQOA 1Z7RA 4ZB8A 3GFKA 1K3LA 2CVDA 1YKCA 2LJRA 1B9YC 20GSA 5JCUA 5A4VA 1FG4A 3TDGA 1PL1A 2AB6A 1PN0A 1F3AA 4MPGA 3EE2A 4TR3A 1TRVA 2C3NA 2PUKC 3QCPA 1QUWA 1LBKA 5ECLB 4WETA 1XOBA 4PXOA 2K8SA 1QXHA 4WKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TR4 A;  3GKK A;  3IV4 A;  3IC4 A;  2JZT A;  1TKD B;  5KN2 A;  4MJC A;  3VPT A;  2FA4 A;  1SL0 B;  3EWL A;  1TP9 A;  5IPG A;  1YF0 A;  1OC3 A;  4GTU A;  1Z7P A;  4TXV A;  2H01 A;  3F6F A;  3VWV A;  3SBC A;  3UJ1 A;  3D22 A;  4XS4 A;  4MMM A;  4Q5F A;  2H8L A;  5JCG A;  3TKS A;  4LLR A;  6GSW A;  2IFQ B;  1XWB A;  2CAQ A;  2VOC A;  2YN1 A;  3CTF A;  2L4C A;  1O8W A;  1SKW B;  3H8Q A;  12GS A;  1F3B A;  2IMF A;  1VF1 A;  1UC7 A;  5DJL A;  1WOU A;  2HE3 A;  5AN1 A;  4TXO A;  5HFI A;  2FWF A;  1M7T A;  2GDR A;  3E9J B;  4NHZ A;  4KW6 A;  3IE3 A;  1RK4 A;  3FYG A;  3WT2 A;  1M99 A;  3KCM A;  3DWV A;  1AAZ A;  2TIR A;  1EZK A;  5DCG A;  3LSZ A;  3KTL A;  1JFU A;  4XIH A;  1O85 A;  3EMX A;  2QKE A;  4GST A;  2H66 A;  4GF0 A;  3E3E A;  2B7K A;  3LQ7 A;  1ABA A;  3IOS A;  4KCA A;  3TKS E;  1GH2 A;  2X64 A;  2MMA A;  1GWC A;  3MWH A;  5D9V A;  1WPI A;  4P3Y B;  4LL4 B;  3C7M A;  2H76 A;  2LUS A;  3CXG A;  2VIM A;  5L71 A;  1SYX A;  2LS5 A;  1PL2 A;  5ECS A;  3FKF A;  5KN3 A;  1R5P A;  3DD3 A;  3KH7 A;  3TCO A;  4DSS A;  2L6D A;  1PRX A;  1TOF A;  2A2S A;  4EE0 A;  1PKZ A;  2YWM A;  3VWU A;  2IN3 A;  4NXI A;  5IMV A;  2A2R A;  2F8A A;  3ZYW A;  3VUR A;  3HY2 A;  1F6M C;  5AIS A;  1HYU A;  3F63 A;  2AHE A;  3O3T A;  4JZQ A;  3BBY A;  2G0F A;  1M2A A;  4E8E A;  4FIW A;  2YOI A;  3H4K A;  4N0Z A;  2L6C A;  1G6W A;  3IR4 A;  4EKZ A;  5DCH A;  4ZL9 A;  4KB3 A;  3ZML A;  1F9M A;  3DXB A;  3KMN A;  1T7P B;  3QR6 A;  2H19 A;  3HVS A;  3BCI A;  1FO5 A;  3IBH A;  1X9W B;  4OO5 A;  3UAP A;  2WJU A;  1A2L A;  1IYH A;  1B9X C;  2D2Z A;  3GA4 A;  5ECQ B;  4TRX A;  3D21 A;  1OE8 A;  4HEA 2;  5ECP B;  3IDV A;  4EL1 A;  4MP4 A;  1YQ1 A;  5FWG A;  3Q6O A;  1MTC A;  3GMF A;  1TRW A;  14GS A;  3QAV A;  4KSO A;  1BX9 A;  1FAA A;  1QMV A;  4ZL8 A;  2F8F A;  1J0F A;  1O73 A;  3DYR A;  2EC4 A;  4NAX A;  2JL4 A;  1WWJ A;  5LNK e;  2NPB A;  1DSB A;  2WDU A;  4V2N A;  3US3 A;  1FVK A;  2YP6 A;  2Z9S A;  3HXS A;  1AIU A;  4KDY A;  3FZ5 A;  2B6M A;  2FLS A;  4JED A;  2DLX A;  2GZP A;  2XPD A;  2OKA A;  2MBS A;  4NHW A;  5IQY A;  4ZXG A;  4XRD A;  2J23 A;  3ZLP A;  5DAL B;  4K2D A;  1K0D A;  2TRC P;  5CYY A;  3TJK A;  1URM A;  1ZGN A;  2CVB A;  1ON4 A;  2C4J A;  1GUH A;  2JAC A;  1XWK A;  2CV4 A;  1XW6 A;  1ZYE A;  5D96 A;  4WR4 A;  1GTB A;  5H5S A;  1EV4 A;  4HUA A;  4KGI A;  2R4V A;  3PH9 A;  3HA9 A;  2LTK A;  4F03 A;  1THX A;  2K18 A;  3QPM A;  4DVC A;  3I43 A;  2PWJ A;  3M9J A;  3EU3 A;  6GSV A;  4ECC A;  2CA8 A;  1X5E A;  4HDE A;  2HZF A;  2N5F A;  1GP1 A;  4MF7 A;  4MDC A;  2OA7 A;  2B1K A;  4GXZ A;  2IMD A;  4K0G A;  4LL1 B;  1YF1 A;  4PNG A;  2H0H A;  3GH6 A;  4IN0 A;  1TI1 A;  2GQM A;  3KP8 A;  4KH7 A;  3D5J A;  1AW9 A;  3A2V A;  4XS1 A;  4OCF A;  2P31 A;  2DBC A;  3U6V A;  4EC0 A;  3EC3 A;  5B6N A;  5GZZ B;  1WIK A;  2IJY A;  3W8S A;  5CRG A;  4QL9 A;  2OAD A;  1XPV A;  2RM6 A;  1VF4 A;  1HNB A;  3ZVJ A;  4XRA A;  3NZN A;  4TKY A;  4F9Z A;  1Z6M A;  3BOA A;  4OFM A;  2NDO A;  3FZ9 A;  2VM1 A;  2XC2 A;  4BA7 A;  1SK0 A;  1LJR A;  3IAM 2;  2DJJ A;  2WRT A;  4KUN A;  3GUR A;  1EEM A;  4FO5 A;  1SKR B;  3G7J A;  3Q74 A;  5HQP A;  3DVW A;  2FWE A;  3LWA A;  3M9K A;  3QOU A;  3WT1 A;  3DIE A;  3HZ8 A;  2L5O A;  1K3O A;  4K1F A;  1AXD A;  5LD0 A;  1IYI A;  2GGT A;  3S9F A;  1ERT A;  2CX4 A;  4XS4 B;  18GS A;  5GAP D;  1EP7 A;  2FHE A;  3P8W A;  2REM A;  1EGR A;  2H1G A;  1J08 A;  1V98 A;  2M46 A;  5D9T A;  3GHA A;  4L5L A;  1SYR A;  3BCK A;  4AF2 A;  1GSD A;  2O87 A;  2P5R A;  3HVX A;  4ZBA A;  2C80 A;  4G19 A;  2OE0 A;  1MDK A;  4NMU A;  1YEX A;  1X9S B;  1G6Y A;  2IME A;  3F4S A;  2DIZ A;  3IXR A;  3FR6 A;  2YJ7 A;  3N5O A;  2AV4 A;  4L5O A;  4N10 A;  1R5A A;  4K7I A;  5HFK A;  2H75 A;  4V2M A;  3E0U A;  1M9B A;  5ECR B;  1TK8 B;  4TN8 A;  3GX8 A;  3D0Z A;  1A23 A;  2EIR A;  4EXJ A;  3A5W A;  4ML1 A;  1KNG A;  1FB6 A;  1WJK A;  2GST A;  2A4V A;  1I9D A;  3EVI A;  3ZTL A;  2GTU A;  2H72 A;  2JSZ A;  3K8N A;  2C0G A;  3ZVJ D;  1T00 A;  3W8J A;  2BMX A;  5J4U A;  2VL2 A;  5INY A;  2GS3 A;  5G5F A;  2IMI A;  3FR9 A;  3HKR A;  2PGT A;  3KGK A;  3TUE A;  4TR1 A;  1XVW A;  13GS A;  1XOA A;  1E6B A;  1JLW A;  3IPZ A;  3P2A A;  1U87 A;  1O81 A;  2YV9 A;  1XBS A;  3F4R A;  1J9B A;  5IOX A;  1ZYQ B;  4MH3 A;  5G30 A;  3FHK A;  1EOG A;  1B4P A;  4EDZ A;  4PQ1 A;  3F3Q A;  3WGE A;  4TVE A;  3VI5 A;  3GL3 A;  2WUL A;  3C1R A;  4AJ8 A;  1XW5 A;  2J9H A;  4K9Z A;  1U88 A;  3TKQ A;  1GL8 A;  3IK7 A;  4GRF A;  1EEJ A;  1SU9 A;  2LRT A;  3DEX A;  2DJK A;  4XHM A;  2OBK A;  3IA1 A;  3KTB A;  2VCZ A;  1QQ2 A;  3APS A;  3IRA A;  3I6A A;  3H79 A;  3QAG A;  1PN9 A;  2R2J A;  3GYK A;  1PA3 A;  3ERG A;  4MPF A;  3P7X A;  1TK0 B;  3RPP A;  4YQM A;  5ECK B;  1TK5 B;  4PX1 A;  3CYN A;  3NIV A;  2G2Q A;  5HR0 A;  1HNA A;  2R6K A;  5IIZ A;  5ID2 A;  2KP1 A;  5JWO B;  4J57 E;  4MA9 A;  4HI7 A;  2E0Q A;  4MJB A;  1Z9H A;  2I81 A;  1MD3 A;  2CVK A;  5HFG A;  5HR2 A;  2KUC A;  2B1L A;  4J56 E;  2GT5 A;  4POM A;  1UN2 A;  2E2M A;  4K6X A;  3QFB C;  1QGV A;  3APQ A;  1SD9 A;  2LST A;  5ECO B;  4MK3 A;  3LXT A;  4OWY A;  5B6M A;  3FK8 A;  5EY6 A;  5AIV A;  1K0C A;  1GTI A;  5DQY A;  1BJX A;  2B3S A;  5AGY A;  4HZ4 A;  1B4Q A;  2O7K A;  2DJ3 A;  2C8U A;  2OE1 A;  3MDK A;  2AUV A;  1GNW A;  4NWY A;  4IP6 A;  8GSS A;  3G7I A;  2FNO A;  4TR0 A;  1W4V A;  1TU8 A;  4L8E A;  4KAE A;  3HJP A;  2NTO A;  1Z5Y E;  3MNG A;  2F3M A;  1X5D A;  2V6O A;  4ZIJ A;  4OFT A;  1ZOF A;  1OKD A;  2NVL A;  3VWW A;  2LV3 A;  22GS A;  5ECM B;  5G31 A;  3L0H A;  5D9W A;  3UOM A;  3LYP A;  2PMT A;  4MLY A;  4WR5 A;  5F06 A;  1GTA A;  2FWG A;  4D73 A;  1V58 A;  4YQU A;  2B7J A;  4BPY A;  1T4Z A;  1NW2 A;  1OYJ A;  2CAI A;  4KSM A;  1XW9 A;  2H1A A;  6GSS A;  2RUF A;  3HZ4 A;  3KMO A;  2IWT A;  1DUG A;  3OR5 A;  3RHB A;  2YJH A;  5F05 A;  1BED A;  3D4M A;  3M0F A;  4POL A;  3HJO A;  1MDJ A;  2L4Q A;  1VF3 A;  2GLR A;  3UBL A;  4MCU A;  3CBU A;  3A2W A;  3CRU A;  2FUG 2;  4ZB6 A;  1M2D A;  4LA1 A;  1JHB A;  1VGL A;  3FZ4 A;  1JZO A;  2X99 A;  2V1M A;  2PBJ A;  2KHP A;  2LQQ A;  2MZC A;  1S3D A;  3KZQ A;  1C72 A;  2EIQ A;  1M0U A;  1Z6N A;  1SL2 B;  3DML A;  4CHS A;  4Q5Q A;  2O85 A;  3G7Y A;  1PSQ A;  3ED3 A;  1K0O A;  4BL7 A;  2ZUP A;  4Q5R A;  1TRU A;  2K8V A;  4O7H A;  1PQN A;  1HNC A;  3VFI A;  5IMD A;  3LGC A;  1GTU A;  4ZBD A;  3CSH A;  1GSU A;  2XPE A;  4YAP A;  2LNS A;  2YZH A;  1X0R A;  1WRY A;  5DAK A;  1SJI A;  3RAZ A;  2HNL A;  4YQV A;  3V1W A;  1ZMA A;  1AQW A;  5D8I A;  2XBQ A;  1JZR A;  2X8G A;  2P5Q A;  3HDC A;  4DSQ A;  2GQL A;  3TKP A;  4MJE A;  1GSF A;  1V2A A;  2AJQ B;  5ELA A;  2O8V B;  1V40 A;  4I5Q A;  3TJB A;  2HZE A;  4PUF C;  4RI7 A;  4JU5 A;  2K9F A;  1X5C A;  2YNX A;  1TU7 A;  5COH A;  4HJM A;  4DSR A;  3I69 A;  3KP9 A;  3TB2 A;  4I8B A;  3DRN A;  4HOJ A;  3G9B A;  1A8L A;  2NBS A;  2O89 A;  1U3I A;  1QFN A;  3ISO A;  2H1B A;  2N5B A;  4HS1 A;  5D93 A;  4V1A g;  1YJ6 A;  4IQA A;  2WFC A;  11GS A;  2WCI A;  2HI7 A;  4I97 A;  3LOR A;  4XS6 A;  3WYW A;  1FB0 A;  1K0M A;  4IQ1 A;  2VCT A;  4MZC A;  5A5K A;  1B48 A;  1TXX A;  3FW2 A;  3CMI A;  3GH9 A;  4OMV A;  3D6I A;  3TJF A;  2LQO A;  1OC9 B;  3GTU B;  2GSR A;  3M8N A;  4PUA A;  3KIJ A;  1TI3 A;  4KE3 A;  2YWO A;  6GSY A;  3J7Y b;  4POB A;  3GNJ A;  4IGJ A;  4I6X A;  4ILF A;  1LU4 A;  2HXK A;  3QDN A;  4GSS A;  5J9C A;  5CP1 A;  1H75 A;  4L0W A;  1JLV A;  4O92 A;  5GST A;  1NHY A;  3W6G A;  1F2E A;  1Z3E A;  3GIX A;  3F3R A;  1PMT A;  1EWX A;  4F0B A;  2R3X A;  4HQS A;  4GQF A;  5H5Q A;  3R2Q A;  2X8H A;  2QGV A;  4PQH A;  4MF5 A;  1GSQ A;  4OD7 A;  2H1D A;  1K0A A;  5A4W A;  1K0B A;  1ZL9 A;  1GRX A;  5FHI A;  5ECH B;  4GQC A;  2FY6 A;  3QAW A;  3C71 A;  4V1A p;  3HHV A;  2PER A;  4WBR D;  4MAB A;  3GX0 A;  2M80 A;  2IIY A;  4EO3 A;  1JZD A;  2WS2 A;  4PGT A;  4K7O A;  2YWN A;  3ZFB A;  2PN8 A;  1USB A;  3TKS C;  1G7E A;  4X1U A;  2GZZ A;  5G2Z A;  2PPT A;  4MJA A;  4HZ2 A;  4BVY A;  3PGT A;  5CRW A;  2YWI A;  3ZIT A;  4TW5 A;  1G7O A;  5C04 A;  3QD9 A;  4PNF A;  5J3R A;  1UA5 A;  2IY2 A;  4BVX A;  1AQV A;  4O32 A;  1BG5 A;  5EVO A;  1V57 A;  4NPB A;  3FY7 A;  4TXO B;  3TJG A;  1XVQ A;  4G9H A;  4KA0 A;  1GSY A;  2XBI A;  2VM2 A;  5IMA A;  3RBT A;  2HRN A;  2VD1 A;  3UVT A;  3EUR A;  4RQR A;  3WGX A;  2JZR A;  4CW9 A;  5C00 A;  2LNT A;  3GKM A;  3HYP A;  4ID0 A;  1MD4 A;  3GKX A;  4E8H A;  3L4N A;  1OE7 A;  3EMP A;  4G10 A;  4DEJ A;  2FCH A;  1R26 A;  4IS0 A;  2V2G A;  5EPF A;  1TRS A;  2V41 A;  2FD3 A;  1AQX A;  3VWX A;  2GT6 A;  4OCE A;  1R4W A;  1YKA A;  3LG6 A;  1ACV A;  1GUK A;  3FR3 A;  2ON5 A;  3M3M A;  1T3B A;  3O6T A;  3P90 A;  4IEL A;  2C0F A;  2V32 A;  3ZRE A;  4ZIL A;  5IMF A;  3N9J A;  1YDK A;  4DSS B;  1OKT A;  2DC5 A;  1TDI A;  5B8B A;  4IJI A;  4V2L A;  1OAZ A;  3ZIJ A;  4MZB A;  4D73 B;  4RI6 A;  3D4T A;  3C1S A;  2C3Q A;  4F82 A;  3GN3 A;  2M72 A;  4EDY A;  9GSS A;  1SK2 A;  4NV2 A;  3VK9 A;  5B8A A;  2H74 A;  2HT9 A;  2CZ2 A;  2I4A A;  1GNE A;  4TOP A;  5CRE A;  4IVF A;  1B8X A;  3KEB A;  3TKR A;  1DE2 A;  4JRR A;  2FGX A;  3ZZX A;  1FW1 A;  1O6J A;  2HYX A;  3L78 A;  3UEM A;  1O7U A;  4WEY A;  3GV1 A;  4X0X A;  4N11 A;  1PD2 1;  2MMO A;  3TRP A;  2GVP A;  5F0G A;  5CRD A;  1A8Y A;  5JWR B;  2P0G A;  1SKS B;  2MMN A;  2JAD A;  5AIX A;  4WF4 A;  2GSS A;  2C0D A;  2L59 A;  2IPA A;  4ECJ A;  1A0R P;  3TRX A;  4EUY A;  3KXO A;  1N2A A;  3GUS A;  2GQK A;  2OJL A;  5DQS A;  1X9M B;  3DVX A;  4K0N A;  4JBB A;  4ISD A;  5EL8 A;  2BJX A;  3VPQ A;  2LRC A;  3EYT A;  5IM9 A;  3M1G A;  3MSZ A;  2HFD A;  2KLX A;  4JR6 A;  2MMZ A;  1A2M A;  5J9B A;  3RDW A;  1XCC A;  3ERF A;  3KD0 A;  2IMK A;  5DAK B;  2CQ9 A;  2LJK A;  1U3A A;  3QMX A;  5IMZ A;  1TJD A;  3BD2 A;  5IPH A;  1WP0 A;  2HSH A;  3PIN A;  3KJY A;  5KEJ A;  3VI7 A;  3I9V 2;  5CAX A;  3DGQ A;  1VF2 A;  3ZFL A;  1Y6E A;  2YAN A;  1ZZY A;  3MAK A;  2ON7 A;  1MEK A;  3QFA C;  3GRX A;  1W89 A;  3GL5 A;  4FYC A;  5DBQ A;  4GCI A;  1AUC A;  2C1Y A;  2HZE B;  3PR8 A;  4QL7 A;  3VLN A;  3ZIV A;  4ZB9 A;  1GLQ A;  2VD0 A;  2RUE A;  4XCS A;  2F51 A;  2PVQ A;  4HQZ A;  4ECI A;  1CQG A;  5G1L A;  4I2U A;  1F37 A;  1XWC A;  1U6T A;  3IK9 A;  1JZW A;  2YPM A;  3H1N A;  1Q4J A;  2TRX A;  4KX4 A;  19GS A;  4N30 A;  4KDX A;  1UVZ A;  2VAF A;  1EP8 A;  1MDI A;  2VLV A;  4RQX A;  1TW9 A;  1KBN A;  3CSI A;  3WD6 A;  5LCZ A;  4CDO A;  4G2E A;  4MZW A;  2WB9 A;  2VCW A;  4L0U A;  4GLT A;  4POK A;  2VCQ A;  2YZU A;  1BYE A;  1GSS A;  2RII A;  2HRF A;  2ALB A;  2IL3 A;  3DKS A;  4WXT A;  2VUP A;  2H6Y A;  2LJA A;  3C8E A;  1G0T A;  1OC8 A;  2L57 A;  3ME8 A;  4ACS A;  2EIO A;  1DE1 A;  3RHC A;  4XTS A;  1T1V A;  2DJ1 A;  1NM3 A;  1E2Y A;  5GAN D;  1ST9 A;  2RLI A;  2L5L A;  5H5R A;  5JCW A;  5A4U A;  2VCV A;  2VL3 A;  2CT6 A;  4N0V A;  2C3T A;  3F6D A;  4X43 A;  2BTO T;  3CTG A;  3Q18 A;  3RPN A;  2N5A A;  3L9U A;  1HD2 A;  1RW1 A;  2MBT A;  3FZA A;  3LJR A;  2DML A;  1BAY A;  2K6V A;  1M9A A;  3UL3 A;  3ZRD A;  1XFL A;  1BQ7 A;  5IMC A;  4RUV A;  3TRQ A;  4EVM A;  2IFQ A;  4BWQ A;  4H86 A;  1A24 A;  2GSQ A;  2ZNM A;  2DJ2 A;  4JE1 A;  5IO0 A;  4Z7X A;  2VLU A;  2FWH A;  4ZBB A;  5HR3 A;  1S3A A;  4IHU A;  1AC1 A;  1EOH A;  4ML6 A;  3O76 A;  2AYT A;  3NOF A;  2PU9 C;  3BJ5 A;  4WF5 A;  4HU7 A;  3FRC A;  1VRS D;  2B5X A;  2H30 A;  2I9H A;  3LXZ A;  5B7C A;  4I2T A;  3TOT A;  5IO2 A;  5FT3 A;  3H93 A;  2DIY A;  1FHE A;  5DVB A;  4FYB A;  3KH9 A;  6GST A;  3HCZ A;  4MF6 A;  5ENU A;  5DJM A;  2X8C A;  3ZMK A;  2LEG A;  2HLS A;  2R5G A;  3UAR A;  2H6Z A;  4KND A;  1A2J A;  3LYK A;  2CX3 A;  2OE3 A;  2PVO C;  2AAW A;  1XIY A;  4GWR A;  3ZL5 A;  4IP1 A;  2I1U A;  1PGT A;  1Y25 A;  1SK1 A;  7GSS A;  2I3Y A;  3F0I A;  2JSY A;  3HD5 A;  3EU4 A;  1M2B A;  4FH8 A;  1CQH A;  1SL1 B;  3JCM L;  3C73 A;  5D9X A;  5ABR A;  3UVH A;  1GUM A;  1S3C A;  2MYG A;  4KDU A;  3GKN A;  3HVV A;  5CO3 A;  1Q98 A;  3F9U A;  4FYU A;  2VL2 C;  2GZY A;  4F2I A;  2VLT A;  3F4T A;  4JR4 A;  4TR1 B;  3A2X A;  5KN0 A;  1KTE A;  4ULX A;  3CSJ A;  2H73 A;  2YCD A;  1SD8 A;  2V6K A;  3IAS 2;  1THO A;  4YAV A;  1FVJ A;  5F07 A;  2HSY A;  1ERV A;  5JWQ B;  1WE0 A;  2H0I A;  1A0F A;  2QSI A;  2WGR A;  1V9W A;  1PX6 A;  4AGS A;  4LMV A;  4ZL7 A;  3F8U A;  1SJZ A;  1DBY A;  1FOV A;  2FA8 A;  4J2F A;  3TOU A;  4HJ2 A;  3UBK A;  2LRN A;  1SJ6 A;  4IJ3 A;  4OFN A;  1EV9 A;  3LEF A;  6GSX A;  3TGZ A;  2VL9 A;  3A3T A;  1O8X A;  5KN1 A;  3WGD A;  4BWS A;  1YY7 A;  1YZX A;  3Q19 A;  1GLP A;  4OO4 A;  5F8B A;  4IBP A;  2YV7 A;  3AY8 A;  2IYJ A;  1WMJ A;  3U5R E;  4EF0 A;  4PQI A;  1T4Y A;  4K7N A;  2ZCT A;  1NHO A;  2OAC A;  5CNW A;  2ES7 A;  5ID2 B;  4GSN A;  4Q5N A;  5CRH A;  3EIN A;  2DJ0 A;  2E7P A;  2E2G A;  4WBJ A;  5J5N A;  1EGO A;  1XWA A;  3L9S A;  6GSU A;  5ECN B;  2CZ3 A;  5IOW A;  3ME7 A;  5HR1 A;  1H4O A;  1YEP A;  1GUL A;  5DAL A;  5E4W A;  5ELG A;  1NSW A;  1XWG A;  4F0C A;  2JU5 A;  5E59 A;  3CRT A;  3HJM A;  5GSS A;  1K0N A;  4AJ7 A;  4IW9 A;  2DMM A;  4LMW A;  1R7H A;  16GS A;  1QK8 A;  2VCX A;  1I5G A;  2KOK A;  10GS A;  2WZ9 A;  1XXU A;  4YH2 A;  2KP2 A;  1KEB A;  2QC7 A;  4K8M A;  2H71 A;  4MH2 A;  2JZS A;  2C0E A;  2H6X A;  1T8E B;  5G1K A;  1OVN A;  3UIW A;  3J7Y k;  3GST A;  5J41 A;  5ECI B;  3UMA A;  4QQ7 A;  4NV5 A;  1XZO A;  1ZCP A;  1K3Y A;  1SEN A;  2VO4 A;  3APO A;  5D73 A;  4AJ6 A;  3KM6 A;  3TJJ A;  3LFL A;  4PUR A;  3L9V A;  4ECB A;  3GSS A;  1N8J A;  2RM5 A;  2F9S A;  3IHQ A;  4KCE A;  2H0G A;  1TTZ A;  4IKH A;  1OC9 A;  3SWL A;  3GTU A;  2R37 A;  2DSA A;  1ILO A;  1ERW A;  17GS A;  1ERU A;  3FEU A;  1RQM A;  5DDL A;  2H70 A;  1GSE A;  1ML6 A;  4HU9 A;  2B5Y A;  2OBI A;  1PKW A;  1PX7 A;  3ERW A;  5G5E A;  2B5E A;  4O5R A;  2LKU A;  2XHF A;  1HQO A;  1Z7R A;  4ZB8 A;  3GFK A;  1K3L A;  2CVD A;  1YKC A;  2LJR A;  1B9Y C;  20GS A;  5JCU A;  5A4V A;  1FG4 A;  3TDG A;  1PL1 A;  2AB6 A;  1F3A A;  4MPG A;  3EE2 A;  4TR3 A;  1TRV A;  2C3N A;  2PUK C;  3QCP A;  1QUW A;  1LBK A;  5ECL B;  4WET A;  1XOB A;  4PXO A;  2K8S A;  1QXH A;  4WKW A; 
#chains in the Genus database with same CATH topology
 3DGO A;  4BTX A;  4TR4 A;  5IG0 A;  3GKK A;  3IV4 A;  3IC4 A;  3CCJ 3;  2JZT A;  3RNT A;  5KN2 A;  4MJC A;  1VQM 3;  1TKD B;  4BL3 A;  3VPT A;  2FA4 A;  1FGO A;  1SL0 B;  5BVB A;  3EWL A;  3SYU A;  3CCM 3;  1TP9 A;  1YF0 A;  5IPG A;  1OC3 A;  4GTU A;  1Z7P A;  3K63 A;  4TXV A;  2H01 A;  3F6F A;  3VWV A;  3SBC A;  5IG4 A;  3UJ1 A;  1WTH A;  3D22 A;  3Q90 A;  2KF3 A;  3FG1 A;  4XS4 A;  4MMM A;  4Q5F A;  5AIF A;  1CH0 A;  2H8L A;  2GEX A;  4BL7 B;  2I9W A;  5JCG A;  1BNE A;  4HZ9 B;  4FCZ A;  1VQ4 3;  1OHO A;  2XRX B;  3TKS A;  3WR2 A;  4KFD A;  4LLR A;  4HSC X;  6GSW A;  2IFQ B;  4USS A;  1XWB A;  2CAQ A;  2VOC A;  2XSH B;  2YN1 A;  3CTF A;  2L4C A;  1O8W A;  3DGN A;  1SKW B;  3H8Q A;  12GS A;  5BMU A;  1GYB A;  1F3B A;  2IMF A;  1VF1 A;  1K73 4;  1UC7 A;  1YGE A;  1MWR A;  5DJL A;  1WOU A;  3VF1 A;  2HE3 A;  5AN1 A;  3F8X A;  4TXO A;  4N6O B;  3KZT A;  2FWF A;  5HFI A;  1M7T A;  2GDR A;  3E9J B;  4NHZ A;  4KW6 A;  3IE3 A;  1JB5 A;  1RK4 A;  3FYG A;  5IEN A;  1GOU A;  3WT2 A;  3OXA A;  3FZW A;  1M99 A;  4R9K A;  4EC6 A;  3KCM A;  2YFJ B;  2CH9 A;  3EBT A;  3DWV A;  1AAZ A;  2TIR A;  1EZK A;  2PZV A;  5DCG A;  3LSZ A;  4N3V A;  1T5Y A;  3PGB A;  1DVD A;  1JFU A;  3KTL A;  4XIH A;  1O85 A;  3EMX A;  2QKE A;  4GST A;  2BT3 A;  2H66 A;  3E3E A;  1IV9 A;  4GF0 A;  2B7K A;  2BO9 B;  3K7C A;  3LQ7 A;  1ABA A;  3IOS A;  4KCA A;  3DGL A;  3TKS E;  5AYS C;  3VGN A;  1E97 A;  1GH2 A;  4CCV A;  2X64 A;  2MMA A;  1VQK 3;  1GWC A;  4R4K A;  3MWH A;  5D9V A;  1WPI A;  4P3Y B;  4LL4 B;  3C7M A;  2H76 A;  1TUH A;  1QAF A;  2LUS A;  3CXG A;  2VIM A;  5L71 A;  2P0M A;  1OF5 B;  3UB1 A;  1SYX A;  2LS5 A;  1PL2 A;  5ECS A;  4GB5 A;  4PEJ A;  4J5G A;  1CYU A;  3FKF A;  5KN3 A;  1BUJ A;  5DRE A;  1R5P A;  5BIR A;  3DD3 A;  3KH7 A;  3TCO A;  1VQ5 3;  1OH0 A;  4DSS A;  3LH4 A;  3FG3 A;  2L6D A;  1PRX A;  2C10 A;  1TOF A;  3DGM A;  2A2S A;  3LTD A;  4EE0 A;  1PKZ A;  2YWM A;  3VWU A;  2IN3 A;  3MYD A;  4NXI A;  5IMV A;  2A2R A;  2F8A A;  3ZYW A;  3VUR A;  3HY2 A;  3CCS 3;  1STD A;  1F6M C;  5AIS A;  1VQ8 3;  1HYU A;  3F63 A;  2AHE A;  3MPH A;  3O3T A;  5AIG A;  4JZQ A;  3BBY A;  2G0F A;  1M2A A;  1R4C A;  4E8E A;  4FIW A;  1UCJ A;  3ZFZ A;  2YOI A;  5IER A;  5JPP A;  3H4K A;  2O9U X;  3GAX A;  4N0Z A;  2L6C A;  5BU4 A;  1G6W A;  3IR4 A;  4EKZ A;  5DCH A;  4ZL9 A;  3KSE D;  2HMJ B;  4KB3 A;  3ZML A;  1F9M A;  1OPY A;  3DXB A;  3KMN A;  1T7P B;  3QR6 A;  5KOW A;  2H19 A;  3IPT A;  3PZW A;  3HVS A;  3DMC A;  2UGI A;  3BCI A;  1FO5 A;  1K41 A;  3IBH A;  4STD A;  3PYJ A;  1LOX A;  2OTL 3;  1X9W B;  1Q40 A;  4OO5 A;  4OVM A;  3EQQ B;  2HML B;  4O02 B;  3UAP A;  1O7N B;  2X4A A;  2WJU A;  1G96 A;  1A2L A;  1KWI A;  1IYH A;  1B9X C;  2D2Z A;  1FUW A;  3GA4 A;  4A5P A;  2WO0 A;  5ECQ B;  3SVA A;  5AIH A;  2OOV A;  4WKW A;  4TRX A;  3UJM A;  2KF5 A;  3URP A;  3D21 A;  1OE8 A;  1GOY A;  4HEA 2;  3IDV A;  5ECP B;  4EL1 A;  4MP4 A;  3OWS A;  1YQ1 A;  1TFK A;  5FWG A;  3Q6O A;  1RN4 A;  1MTC A;  1Q7Y 4;  3GMF A;  1TRW A;  2CWT A;  14GS A;  1N8R 4;  3QAV A;  1RGK A;  4KSO A;  3FF0 A;  1Z1S A;  1DMM A;  3AMO A;  1BX9 A;  1FAA A;  1QMV A;  4ZL8 A;  2F8F A;  4WYK B;  1J0F A;  1O73 A;  3G71 3;  5BXQ A;  3DYR A;  2EC4 A;  4NAX A;  2JL4 A;  1WWJ A;  5LNK e;  2NPB A;  4NRE A;  1DSB A;  3T0U A;  2WDU A;  4V2N A;  3US3 A;  1FVK A;  2YP6 A;  2Z9S A;  4BVY B;  3HXS A;  3WHO A;  1AIU A;  1RCK A;  5BRT A;  4KDY A;  3FZ5 A;  2B6M A;  2FLS A;  4JED A;  2DLX A;  3CME 3;  2GZP A;  2XPD A;  2OKA A;  2MBS A;  1IQY A;  5CXO A;  4NHW A;  4N6M A;  1HU9 A;  5IQY A;  4ZXG A;  4XRD A;  2J23 A;  4XB5 A;  3ZLP A;  2V1L A;  1IYY A;  5DAL B;  3JUQ A;  4K2D A;  1K0D A;  3D3L A;  2TRC P;  1BNS A;  4LZI A;  3AHS A;  5CYY A;  3TJK A;  2CKF B;  1GMQ A;  4RNZ A;  5IEO A;  1GD4 A;  1URM A;  1ZGN A;  1PY3 A;  1TP6 A;  1X1W A;  2CVB A;  1ON4 A;  2C4J A;  1N9J A;  2O3O A;  1ZX2 A;  1GUH A;  2JAC A;  1XWK A;  2CV4 A;  1XW6 A;  1ZYE A;  4O2H A;  2XR8 B;  5D96 A;  2XF3 A;  3GZB A;  1JBT A;  4K61 A;  4WR4 A;  1NJI 4;  1IVX A;  1GTB A;  1BRG A;  5H5S A;  1EV4 A;  3LZA A;  4HUA A;  1HYF A;  3DY5 A;  1GOV A;  2E2T A;  3E99 A;  4KGI A;  2CWV A;  2R4V A;  1BRJ A;  1ROA A;  1AV4 A;  2Z77 A;  3PH9 A;  3F8H A;  3HA9 A;  2LTK A;  1MGW A;  4MNN A;  1THX A;  4F03 A;  1FGT A;  3FF2 A;  2K18 A;  3QPM A;  4FCJ A;  4DVC A;  3I43 A;  2PWJ A;  4KVH A;  3M9J A;  3EU3 A;  6GSV A;  4ECC A;  2CA8 A;  2HRA A;  1X5E A;  4FMC A;  3S29 A;  3CC4 3;  4HDE A;  2HZF A;  5G2G A;  2N5F A;  3OX9 A;  1GP1 A;  4MF7 A;  4MDC A;  2OA7 A;  3X40 A;  2B1K A;  4GXZ A;  5AI1 A;  2IMD A;  4CY8 A;  3MYT A;  3ER7 A;  1A2V A;  2RGQ A;  1GD3 A;  4K0G A;  4LL1 B;  1YF1 A;  4PNG A;  2H0H A;  2BMR B;  3GH6 A;  1R4Y A;  4IN0 A;  2R4I A;  1TI1 A;  2GQM A;  3KP8 A;  4KH7 A;  3D5J A;  1AW9 A;  4G0K A;  3A2V A;  1BU4 A;  5A0O B;  4XS1 A;  4OCF A;  2P31 A;  3MHE A;  2DBC A;  3MWZ A;  3U6V A;  3ALA A;  2GSP A;  4EC0 A;  3EC3 A;  1NDO B;  1U8C B;  5B6N A;  5GZZ B;  1WIK A;  2IJY A;  5M18 A;  3W8S A;  4ORL A;  1D6Y A;  3K0Z A;  3CPW 2;  5CRG A;  4K1U A;  4QL9 A;  1O7P B;  1XPV A;  2OAD A;  3OWY A;  2RM6 A;  2CX0 A;  1VF4 A;  1HNB A;  2QIY A;  3ZVJ A;  4XRA A;  3GRD A;  3NZN A;  4TKY A;  4F9Z A;  1Z6M A;  3BOA A;  2CW9 A;  4LYL B;  2BMO B;  4OFM A;  4EW5 A;  2NDO A;  3JUP A;  3FZ9 A;  5ELJ A;  3MG1 A;  1OAC A;  2VM1 A;  4DKI A;  2XC2 A;  1B20 A;  4BA7 A;  1VQQ A;  1SK0 A;  1LJR A;  2R0P A;  3IAM 2;  2DJJ A;  2WRT A;  4KUN A;  3GUR A;  1B2S A;  1EEM A;  4FO5 A;  1SKR B;  3MG3 A;  3G7J A;  3Q74 A;  5HQP A;  3DVW A;  2FWE A;  2MF7 A;  3LWA A;  3M9K A;  3QOU A;  3WT1 A;  4Z2U A;  2FNQ A;  3X3X A;  3DIE A;  1YI2 3;  2L5O A;  1K3O A;  3HZ8 A;  4K1F A;  1AXD A;  5LD0 A;  1IYI A;  1Y4K A;  2GGT A;  2RNT A;  3S9F A;  1ERT A;  2Z7A A;  5IEP A;  4AKY A;  2CX4 A;  4XS4 B;  4HJL B;  18GS A;  5GAP D;  1EP7 A;  1HZ1 A;  2FHE A;  3MG2 A;  3P8W A;  2REM A;  3CC7 3;  1EGR A;  1J08 A;  2H1G A;  1V98 A;  2M46 A;  5D9T A;  1M1K 4;  3GHA A;  1BOX A;  4L5L A;  1SYR A;  3B8L A;  3BCK A;  3I0Y A;  1DYU A;  4AF2 A;  1GSD A;  2O87 A;  1W2Z A;  2P5R A;  3HVX A;  4ZBA A;  4WHA A;  1RRH A;  2C80 A;  4IT7 A;  4G19 A;  2OE0 A;  1MDK A;  4NMU A;  1YEX A;  1X9S B;  1BGS A;  1G6Y A;  2IME A;  3F4S A;  2DIZ A;  1LXE A;  8CHO A;  1I0V A;  3IXR A;  3FR6 A;  3NUV A;  2YJ7 A;  3N5O A;  1S72 3;  2AV4 A;  4L5O A;  2ZHX B;  4N10 A;  1GMR A;  1R5A A;  4K7I A;  4TX4 A;  5HFK A;  1RGC A;  2H75 A;  4V2M A;  1MWS A;  6RNT A;  4G1M B;  4GHO A;  3E0U A;  1M9B A;  1YJ9 3;  3GZR A;  5ECR B;  4FMD A;  2GXF A;  1TK8 B;  1QAK A;  4TN8 A;  3GX8 A;  3D0Z A;  1A23 A;  1I0X A;  1EQK A;  1B2X A;  3HI7 A;  4FMB A;  2EIR A;  4O8S A;  4EXJ A;  3A5W A;  2CFD A;  1YJW 3;  4ML1 A;  1KNG A;  1FB6 A;  1WJK A;  2GST A;  1QJG A;  2A4V A;  1I9D A;  3EVI A;  2HMN B;  3ZTL A;  2GTU A;  2H72 A;  1W6Y A;  2JSZ A;  3K8N A;  4Z2R A;  1TRQ A;  2C0G A;  3ZVJ D;  1T00 A;  3FCS B;  3W8J A;  2BMX A;  5J4U A;  2VL2 A;  5INY A;  3KFQ C;  3HX8 A;  2GS3 A;  1W6C A;  5G5F A;  2IMI A;  3FR9 A;  1VQP 3;  3HKR A;  2PGT A;  3KGK A;  3TUE A;  4TR1 A;  1XVW A;  13GS A;  1XOA A;  1BAO A;  2BMQ B;  1E6B A;  1JLW A;  3KCH A;  3IPZ A;  1PFO A;  1TFO A;  3P2A A;  1U87 A;  1O81 A;  3GZY B;  2YV9 A;  1XBS A;  3F4R A;  1J9B A;  5IOX A;  1BSB A;  1ZYQ B;  3B4P A;  4MH3 A;  1I8V A;  3NV0 B;  5G30 A;  2OQE A;  4EYC A;  3FHK A;  1EOG A;  3K9M C;  1B4P A;  4EDZ A;  4PQ1 A;  3F3Q A;  1W6G A;  3WGE A;  3NHX A;  3A5I A;  4TVE A;  3VI5 A;  3GL3 A;  2WUL A;  3C1R A;  2W6J H;  4AJ8 A;  1B21 A;  1UDI I;  1XW5 A;  2W04 A;  2J9H A;  4K9Z A;  1U88 A;  5I97 A;  3TKQ A;  1GL8 A;  4BTW A;  3IK7 A;  4GRF A;  1EEJ A;  2F4Y A;  3DXO A;  1SU9 A;  2W03 A;  2LRT A;  1ULJ B;  2CK3 H;  3DEX A;  2DJK A;  4XHM A;  3CNM A;  1DMQ A;  4YKG A;  2OBK A;  1WMO A;  3IA1 A;  3KTB A;  2VCZ A;  3X41 A;  1QQ2 A;  3APS A;  3IRA A;  4Q53 A;  1IVV A;  3I6A A;  3H79 A;  3QAG A;  1PN9 A;  2R2J A;  3GYK A;  1PA3 A;  3ERG A;  4MPF A;  3P7X A;  1FUS A;  3RGA A;  1TK0 B;  3RPP A;  1LOY A;  4YQM A;  5ECK B;  1JKG A;  1TK5 B;  2K3D A;  4PX1 A;  3CYN A;  3BB9 A;  1Q7H A;  3NIV A;  1NU3 A;  2Z76 A;  1AY7 A;  2G2Q A;  5HR0 A;  5KP3 A;  1HNA A;  3G6E 3;  2R6K A;  5IIZ A;  5ID2 A;  2KP1 A;  4K1V A;  3CNX A;  3HZP A;  5JWO B;  4XDV A;  4J57 E;  4MA9 A;  1I70 A;  1LOW A;  3BNC A;  2E0Q A;  4HI7 A;  4MJB A;  1Z9H A;  2I81 A;  1MD3 A;  4Z2T A;  1YIJ 3;  2CVK A;  5RNT A;  1FZU A;  5HFG A;  2XFT A;  5HR2 A;  2KUC A;  2B1L A;  4J56 E;  3D9R A;  2GT5 A;  2Z6B A;  4POM A;  2K0M A;  1UN2 A;  2E2M A;  5AII A;  4K6X A;  3QFB C;  1QGV A;  3APQ A;  1SD9 A;  4BIR A;  4WWU C;  2LST A;  5ECO B;  4MK3 A;  3BIR A;  3LXT A;  1LNI A;  2A2P A;  4OWY A;  5B6M A;  4JRF A;  3FK8 A;  5EY6 A;  3WOF B;  5AIV A;  3A76 A;  4L7K A;  1MGR A;  1K0C A;  1GS3 A;  2W2C A;  2E2V A;  1GTI A;  3IC8 A;  5DQY A;  1BJX A;  3PCR A;  3LXU X;  3OWU A;  1W00 A;  5DRV A;  2B3S A;  5AGY A;  4HZ4 A;  2C11 A;  4I4K A;  1B4Q A;  2O7K A;  2DJ3 A;  5STD A;  2C8U A;  2OE1 A;  3MDK A;  1BRI A;  2AUV A;  1GNW A;  4HM4 B;  2YFI B;  4NWY A;  4IP6 A;  8GSS A;  3G7I A;  2YX9 A;  2FNO A;  4TR0 A;  1W4V A;  1TU8 A;  4L8E A;  4FCM A;  4KAE A;  3HJP A;  2NTO A;  3N54 B;  3DZL A;  1Z5Y E;  2QA1 A;  1ZO2 A;  3MNG A;  2F3M A;  1GY6 A;  1X5D A;  4J9A A;  2V6O A;  4ZIJ A;  1JN5 B;  4OFT A;  4HAA A;  1ZOF A;  1OKD A;  1I2F A;  2NVL A;  3VWW A;  2LV3 A;  5JPU A;  22GS A;  3HK4 A;  5ECM B;  1I3F A;  1A67 A;  1E3R A;  5G31 A;  3L0H A;  1GSP A;  1OGZ A;  5D9W A;  3UOM A;  3LYP A;  2PMT A;  4MLY A;  4O3V A;  4HBR A;  4WR5 A;  5F06 A;  1GTA A;  1BNR A;  2FWG A;  4D73 A;  1V58 A;  3NBB A;  4YQU A;  1DE3 A;  2B7J A;  4BPY A;  1T4Z A;  2F99 A;  1NW2 A;  1OYJ A;  3PS8 A;  2CAI A;  5KOX A;  4KSM A;  3WMD A;  1RNT A;  1L5G B;  1ZYN A;  5EQL A;  1XW9 A;  4HKV B;  2IMJ A;  2H1A A;  6GSS A;  3H51 A;  2RUF A;  2WOF A;  3HZ4 A;  4LEH A;  3KMO A;  2IWT A;  5TGN A;  1O7G B;  1DUG A;  3OR5 A;  3RHB A;  3WOE B;  2YJH A;  5F05 A;  1BED A;  2HSM A;  3D4M A;  3M0F A;  4POL A;  1OUN A;  1FA3 A;  3HJO A;  1MDJ A;  2L4Q A;  2R0G A;  1VF3 A;  1TU5 A;  2GLR A;  3UBL A;  4MCU A;  3CBU A;  3EPT A;  2J8X B;  3A2W A;  3PCS A;  3CRU A;  3U97 A;  2FUG 2;  4ZB6 A;  3UL6 A;  1NB5 I;  1M2D A;  4LA1 A;  2HRK A;  4K5S A;  1JN5 A;  3O8Y A;  1VGL A;  1JHB A;  4N6N B;  1BIR A;  1QMA A;  3FZ4 A;  1JZO A;  2X99 A;  2V1M A;  4KT3 B;  2PBJ A;  1BNI A;  2KHP A;  2LQQ A;  2MZC A;  1S3D A;  3LTC A;  1C72 A;  3KZQ A;  2EIQ A;  4H61 A;  4N6U A;  1M0U A;  3VSY A;  1Z6N A;  3CXC 2;  1SL2 B;  2F5W A;  3DML A;  1Q9E A;  4CHS A;  4Q5Q A;  2O85 A;  3G7Y A;  1PSQ A;  3ED3 A;  3V92 A;  1K0O A;  2HMK B;  4BL7 A;  2ZUP A;  4Q5R A;  1TRU A;  2K8V A;  1SJW A;  4O7H A;  2W56 A;  1PQN A;  1HNC A;  3VFI A;  5IMD A;  3LGC A;  1GTU A;  4ZBD A;  3CSH A;  2IA7 A;  2A4H A;  1GSU A;  1SIH A;  3AGN A;  2XPE A;  4NHF A;  4YAP A;  2LNS A;  2YZH A;  3L0R A;  3V98 A;  1WRY A;  1X0R A;  2DKH A;  4XDW A;  1RMS A;  1ROV A;  5DAK A;  1LQM B;  1SJI A;  3RAZ A;  2HNL A;  4YQV A;  3V1W A;  3EX9 A;  1ZMA A;  4HM3 B;  1AQW A;  5D8I A;  2XBQ A;  2L1S A;  1JZR A;  4FR9 A;  2X8G A;  1UW1 A;  1A90 A;  2P5Q A;  3OW2 2;  3HDC A;  4DSQ A;  2GQL A;  3EBY A;  3TKP A;  4HM1 B;  3CU3 A;  3PXM A;  4MJE A;  2GU3 A;  2CFK A;  1US1 A;  3RDE A;  1GSF A;  1V2A A;  2AJQ B;  5ELA A;  3KKG A;  2O8V B;  5KP1 A;  1V40 A;  1YVS A;  4I5Q A;  3TJB A;  3WA2 X;  2LQV A;  2HZE A;  4PUF C;  4RI7 A;  4JU5 A;  2K9F A;  1X5C A;  1QXH A;  1RGL A;  3M8C A;  3I55 3;  1TU7 A;  2YNX A;  5COH A;  2KAA A;  4HJM A;  1I3I A;  4DSR A;  4H3U A;  3I69 A;  1IT8 A;  3KP9 A;  3TB2 A;  4I8B A;  1W2B 2;  1MOL A;  3DRN A;  3CC2 3;  3LOY A;  3JUN A;  3CMA 3;  1BNG A;  4HOJ A;  2UUG C;  4XM4 A;  3G9B A;  4HM5 B;  1A8L A;  2NBS A;  3FGY A;  1U3I A;  2O89 A;  1SII A;  1QFN A;  3ISO A;  2ZDJ A;  2BU4 A;  1RTU A;  2H1B A;  2N5B A;  3Q2P A;  4KF9 A;  4HS1 A;  2BIR A;  1LVN A;  5D93 A;  2CG1 A;  1OF5 A;  4V1A g;  3G4S 3;  1YJ6 A;  4IQA A;  2WFC A;  11GS A;  2WCI A;  2HI7 A;  4I97 A;  3LOR A;  4XS6 A;  3WYW A;  1FB0 A;  1W7C A;  1K0M A;  4KFE A;  4IQ1 A;  1A2P A;  3B4O A;  3CCV 3;  2XEP A;  2VCT A;  4MZC A;  5A5K A;  1TTO A;  1MWU A;  3EC9 A;  1B48 A;  2IUK A;  1TXX A;  3FW2 A;  3CMI A;  3GH9 A;  4OMV A;  1A2K A;  1IV7 A;  3D6I A;  3TJF A;  2LQO A;  1OC9 B;  3GTU B;  2MC8 A;  2GSR A;  3M8N A;  4PUA A;  1JBS A;  1TI3 A;  3KIJ A;  4KE3 A;  4RBN A;  2YWO A;  6GSY A;  3CQF A;  1OCV A;  3J7Y b;  4POB A;  4OUQ A;  3X3Y A;  1VQ9 3;  3GNJ A;  4IGJ A;  4XBY A;  4I6X A;  4K90 B;  4ILF A;  1LU4 A;  2HXK A;  2R41 A;  3KE7 A;  3QDN A;  3KN4 A;  1B27 A;  4GSS A;  1YVB I;  2W9Q A;  5J9C A;  3S27 A;  3FH1 A;  5CP1 A;  1ZGX A;  1H75 A;  4L0W A;  3I56 3;  1I2E A;  1JRQ A;  5LC6 A;  1JLV A;  4O92 A;  1ISK A;  5GST A;  1NHY A;  1GY7 A;  4KFF A;  3W6G A;  1F2E A;  1Z3E A;  3IMA B;  1KD1 4;  2F98 A;  3GIX A;  3SED A;  3F3R A;  1PMT A;  1EWX A;  5AYR B;  4F0B A;  3N9H A;  4G0L A;  5M19 A;  2R3X A;  4HQS A;  7STD A;  1BSE A;  4GQF A;  1ZYP A;  1O7M B;  4EXR A;  5H5Q A;  3R2Q A;  2AAD A;  2X8H A;  2QGV A;  3D5G A;  4PQH A;  2HMO B;  4MF5 A;  3Q3F A;  1GSQ A;  1JBR A;  4OD7 A;  2H1D A;  1K0A A;  5A4W A;  1K0B A;  1ZL9 A;  1GRX A;  5FHI A;  2QEX 3;  5ECH B;  1YNV X;  1RHL A;  4GQC A;  2FY6 A;  3QAW A;  3C71 A;  4V1A p;  1BSC A;  3HHV A;  2PER A;  3DGY A;  4MAB A;  3NXJ A;  3LT9 A;  4GL6 A;  5AEU B;  4WBR D;  3GX0 A;  2M80 A;  2IIY A;  2XFS A;  2QA2 A;  4L8P A;  4EO3 A;  4O5U A;  1JZD A;  2WS2 A;  2P0X A;  2QGU A;  2KCD A;  4PGT A;  4K7O A;  1HKX A;  2Q07 A;  4N6L A;  2YWN A;  1JKG B;  2D1W A;  3PPU A;  4WYK A;  1RGH A;  3ZFB A;  2PN8 A;  1USB A;  3IJE B;  4EIP A;  1IQX A;  3TKS C;  2RFR A;  1G7E A;  4X1U A;  1EA2 A;  2GZZ A;  2P05 A;  5G2Z A;  2PPT A;  1IU7 A;  4MJA A;  4HZ2 A;  4BVY A;  3PGT A;  5CRW A;  2YWI A;  3ZIT A;  3CCU 3;  1J2B A;  4TW5 A;  1G7O A;  5C04 A;  3FG4 A;  4FMA A;  3STD A;  3QD9 A;  4PNF A;  5J3R A;  1UA5 A;  2IY2 A;  5FGO A;  4BVX A;  1AQV A;  4O32 A;  1BG5 A;  2OCT A;  5EVO A;  1V57 A;  4NPB A;  3FY7 A;  3WDG B;  4TXO B;  3T8U A;  3TJG A;  1XVQ A;  4G9H A;  2CFW A;  4KA0 A;  1GSY A;  4HOH A;  4X4J A;  2XBI A;  2B1X B;  1G02 A;  2VM2 A;  3RBT A;  5KP4 A;  2GU1 A;  3NBR A;  5IMA A;  1C7H A;  2HRN A;  2VD1 A;  3UVT A;  3EUR A;  5IW9 A;  1MNL A;  4RQR A;  3WGX A;  1Q42 A;  2JZR A;  1N5H A;  4CW9 A;  5C00 A;  2LNT A;  3GKM A;  1U5O A;  3HOH A;  3HYP A;  2GBW B;  4ID0 A;  2RSX A;  2IUJ A;  1MD4 A;  3GKX A;  1UUW B;  4LMI A;  2UZ8 A;  4E8H A;  3U1W A;  1NO3 A;  1N8Q A;  3L4N A;  1OE7 A;  1IQ8 A;  3EMP A;  4G10 A;  4DEJ A;  2FCH A;  1YGW A;  1R26 A;  3GSP A;  4IS0 A;  2V2G A;  5IF6 A;  4K5R A;  3S5C A;  5EPF A;  4ICY A;  1BSD A;  1TRS A;  2V41 A;  2FD3 A;  1CYV A;  3MKI A;  1AQX A;  1M9G A;  5CK6 A;  4AEQ A;  3VWX A;  2GT6 A;  4OCE A;  1R4W A;  1WQL B;  1EUI C;  1YKA A;  1ACV A;  1GUK A;  3LG6 A;  3EB8 A;  3FR3 A;  2ON5 A;  6GSP A;  1UGH I;  3M3M A;  1T3B A;  2CHC A;  5LC7 A;  3O6T A;  3P90 A;  4IEL A;  3LYG A;  2CIU A;  2C0F A;  2V32 A;  4KZ1 A;  3ZRE A;  4ZIL A;  5IMF A;  3N9J A;  1YDK A;  3SLU A;  4DSS B;  1OKT A;  2DC5 A;  4RZM A;  1TDI A;  5B8B A;  4IJI A;  1BVI A;  4V2L A;  1OAZ A;  1BUQ A;  3ZIJ A;  4MZB A;  3OV4 A;  4HM2 B;  1Q81 4;  4D73 B;  4RI6 A;  1IDP A;  3D4T A;  3C1S A;  2C3Q A;  4F82 A;  3GN3 A;  2M72 A;  4EDY A;  1VQ6 3;  3ROB A;  9GSS A;  1SK2 A;  4NV2 A;  2A15 A;  3VK9 A;  1I2G A;  2HMM B;  5B8A A;  2H74 A;  2HT9 A;  3S67 A;  2CZ2 A;  2I4A A;  1GNE A;  4TOP A;  5CRE A;  3F9S A;  2CFL A;  1SAR A;  4IVF A;  1B8X A;  1BNJ A;  3KEB A;  3TKR A;  1DE2 A;  4JRR A;  4R80 A;  5M1A A;  2CWU A;  2FGX A;  2P38 A;  3ZZX A;  3ZG5 A;  1FW1 A;  1O6J A;  2HYX A;  3L78 A;  1BSA A;  3UEM A;  1O7U A;  4WEY A;  3GV1 A;  1RDS A;  4X0X A;  4N11 A;  1PD2 1;  2P09 A;  1LNH A;  2MMO A;  3TRP A;  4BTY A;  2GVP A;  5F0G A;  5CRD A;  1A8Y A;  3WOD G;  5JWR B;  2P0G A;  1SKS B;  2W0Q A;  2MMN A;  1Q40 B;  2JAD A;  2ZA4 A;  5AIX A;  4WF4 A;  4RNT A;  2GSS A;  1STF I;  1RSN A;  4U13 A;  2C0D A;  2L59 A;  2IPA A;  1GMP A;  4ECJ A;  1A0R P;  3TRX A;  1JJ2 2;  5CLK A;  4L8O A;  3KXO A;  4EUY A;  1WMN A;  1N2A A;  4GSP A;  3GUS A;  1AR0 A;  2OOV C;  3EN1 B;  2GQK A;  2OJL A;  5DQS A;  1X9M B;  3DVX A;  4WFO A;  1WNH A;  4K0N A;  4JBB A;  4ISD A;  5EL8 A;  3J7Y d;  2BJX A;  3X3Z A;  2ZL8 A;  3VPQ A;  2LRC A;  1DMN A;  3EYT A;  5IM9 A;  1T2H A;  3AMO B;  4N6T A;  2W56 B;  2HFD A;  3M1G A;  2KLX A;  3MSZ A;  4JR6 A;  2MMZ A;  1A2M A;  5J9B A;  1F8N A;  4BU4 A;  1UI7 A;  3RDW A;  1XCC A;  3Q1C A;  3ERF A;  3KD0 A;  2JDI H;  2IMK A;  5DAK B;  2CQ9 A;  2LJK A;  1U3A A;  3QMX A;  5IMZ A;  1CQS A;  2FXT A;  4R1K A;  1RKY A;  1TJD A;  1LOV A;  3BD2 A;  5IPH A;  1WP0 A;  2HSH A;  3PIN A;  3KJY A;  5KEJ A;  3VI7 A;  4XBT A;  2LYX A;  3I9V 2;  5CAX A;  3G8Z A;  3DGQ A;  3BNB A;  1FGR A;  1VF2 A;  3ZFL A;  1Y6E A;  2YAN A;  1ZZY A;  1M1X B;  3MAK A;  1PYL A;  2ON7 A;  1MEK A;  1SPU A;  2CC3 A;  3QFA C;  3EE1 A;  3GRX A;  1W89 A;  3GL5 A;  3LW9 A;  2ML6 A;  1OHP A;  4FYC A;  5DBQ A;  4GCI A;  1AUC A;  2C1Y A;  2HZE B;  3PR8 A;  4QL7 A;  3VLN A;  3F40 A;  3ZIV A;  1NNV A;  4ZB9 A;  1GLQ A;  2VD0 A;  1OHS A;  5JBS A;  3RGR A;  2RUE A;  4XCS A;  2F51 A;  2PVQ A;  4HQZ A;  1RGA A;  4ECI A;  1CQG A;  5G1L A;  4I2U A;  1F37 A;  1XWC A;  1U6T A;  3IK9 A;  1JZW A;  2YPM A;  1UUV B;  2CX1 A;  1PU4 A;  1Q4J A;  2TRX A;  3H1N A;  1YHQ 3;  19GS A;  4KX4 A;  4N30 A;  4KDX A;  1UVZ A;  2VAF A;  4CDL A;  3DH2 A;  4JF8 A;  1EP8 A;  1MDI A;  1T2I A;  2VLV A;  4RQX A;  3JUO A;  1TW9 A;  1KBN A;  3CSI A;  3WD6 A;  5LCZ A;  4CDO A;  1B2U A;  3N8B A;  2INX A;  3BNE A;  4G2E A;  4MZW A;  2WB9 A;  1RJO A;  3BLZ A;  2VCW A;  1QAL A;  4L0U A;  4GLT A;  4POK A;  2VCQ A;  2B24 B;  2YZU A;  1RN7 A;  1BYE A;  1GSS A;  4X2O A;  2HRF A;  2RII A;  1XG8 A;  2ALB A;  1K9M 4;  2F86 B;  1EG9 B;  2IL3 A;  3DKS A;  4WXT A;  2VUP A;  2H6Y A;  2LJA A;  1BRH A;  3C8E A;  1G0T A;  1OC8 A;  2L57 A;  3ME8 A;  4ACS A;  3NV0 A;  2EIO A;  1W5Z A;  4FQU A;  1DE1 A;  1RGE A;  3RHC A;  4XTS A;  1T1V A;  2M7O A;  3H3H A;  2DJ1 A;  2SAR A;  3FMW A;  5CF2 A;  1ZS7 A;  1W01 A;  1NM3 A;  1UI8 A;  1LQG C;  4CJN A;  1E2Y A;  5GAN D;  1ST9 A;  2RLI A;  2L5L A;  5H5R A;  2C4B A;  5JCW A;  3AGO A;  5A4U A;  2VCV A;  2VL3 A;  3MSO A;  4LSO A;  2WGO A;  2CT6 A;  4N0V A;  4CY6 A;  2C3T A;  2E2U A;  3F6D A;  4X43 A;  2BTO T;  3CTG A;  3Q18 A;  2D42 A;  3CCL 3;  3RPN A;  1IVW A;  4OK0 A;  3IHG A;  2N5A A;  3QRD A;  1WMP A;  3L9U A;  3SX1 A;  5EVH A;  1RGF A;  1KC8 4;  1HD2 A;  1RW1 A;  3JVC A;  2MBT A;  3FZA A;  3LJR A;  2DML A;  1BAY A;  1JNQ A;  3NX0 A;  1S3R A;  1FUT A;  1JV2 B;  2K6V A;  1ULI B;  1M9A A;  2XGN A;  4BIK A;  2RCD A;  3FLJ A;  3UL3 A;  4BL2 A;  3ZRD A;  1XFL A;  1BQ7 A;  4WP5 A;  4HM0 B;  4MMX B;  5IMC A;  1UCI A;  3NM2 A;  4RUV A;  3TRQ A;  4EVM A;  5IG3 A;  3KSP A;  4G0I A;  3NM7 A;  2IFQ A;  4BWQ A;  4H86 A;  1YJN 3;  3F14 A;  1A24 A;  2XSO B;  2GSQ A;  2ZNM A;  2DJ2 A;  1AVK A;  4JE1 A;  5IO0 A;  4LGQ A;  1JB4 A;  4R9L A;  2DKI A;  4Z7X A;  4EIQ A;  1BRN L;  3WA3 A;  3QK9 A;  2VLU A;  2FWH A;  4ZBB A;  4ZM8 A;  3R3E A;  5HR3 A;  1S3A A;  4IHU A;  1AC1 A;  1IVU A;  1EOH A;  4ML6 A;  1NWW A;  1FW7 A;  3O76 A;  2AYT A;  3NOF A;  2PU9 C;  1EKM A;  3G0K A;  3BJ5 A;  4WF5 A;  4HU7 A;  7RNT A;  1VRS D;  2B5X A;  2H30 A;  3HII A;  2I9H A;  3EN8 A;  1BNF A;  3FRC A;  4MJD A;  3LXZ A;  5B7C A;  1X1Y A;  3CCQ 3;  4I2T A;  4BVX B;  3TOT A;  2OWP A;  5IO2 A;  5FT3 A;  3H93 A;  1B2Z A;  3UNL A;  2DIY A;  1FHE A;  5DVB A;  4FYB A;  3KH9 A;  2BNG A;  3LTA A;  6GST A;  3HCZ A;  3SXX A;  3CCR 3;  4MF6 A;  2BHM A;  3EF8 A;  5ENU A;  5DJM A;  2CG0 A;  2X8C A;  3ZMK A;  1K28 A;  1RGG A;  3X42 A;  2LEG A;  3DUK A;  2HLS A;  2R5G A;  3UAR A;  2H6Z A;  4KND A;  1A2J A;  3GWR A;  5D81 A;  3LYK A;  3F7S A;  1W02 A;  4J8T A;  2CX3 A;  2OE3 A;  2PVO C;  1FGM A;  3GZX B;  2AAW A;  1XIY A;  1B3S A;  1D6Z A;  4GWR A;  3ZL5 A;  3MIX A;  4IP1 A;  1LRA A;  2I1U A;  3ZG0 A;  4K2X A;  1Q86 4;  1PGT A;  1X1X A;  5D83 A;  1Y25 A;  1SK1 A;  7GSS A;  2I3Y A;  3F0I A;  2JSY A;  3D4A A;  3EU4 A;  1M2B A;  3HD5 A;  4FH8 A;  1CQH A;  1SL1 B;  3JCM L;  1UCK A;  1KSI A;  3K5T A;  6STD A;  3C73 A;  5D9X A;  5ABR A;  3UVH A;  1GUM A;  1S3C A;  2MYG A;  3NQY A;  1FGQ A;  1VQN 3;  4KDU A;  3GKN A;  4EBG A;  3HVV A;  1K8A 4;  2OTJ 3;  5CO3 A;  1Q98 A;  3F9U A;  4FYU A;  2VL2 C;  2GZY A;  1DVC A;  1PFP A;  1VQ7 3;  4O5Q A;  4F2I A;  2VLT A;  2HOH A;  3F4T A;  4JR4 A;  4TR1 B;  3A2X A;  5KN0 A;  1RLS A;  1FOH A;  1KTE A;  3F7X A;  4ULX A;  3CSJ A;  1SQW A;  2H73 A;  1RCL A;  1QVG 2;  2L4V A;  2YCD A;  1SD8 A;  4EV2 A;  2V6K A;  3IAS 2;  1N9E A;  5EEO A;  1THO A;  1RN1 A;  4YAV A;  1FVJ A;  4RNY A;  5F07 A;  4CPK A;  2HSY A;  1ERV A;  1BRK A;  2OQE C;  4IW9 A;  5JWQ B;  1O7W B;  2STD A;  1WE0 A;  2H0I A;  1A0F A;  2QSI A;  2WGR A;  4HM7 B;  3SOY A;  1V9W A;  2AAE A;  1PX6 A;  4AGS A;  5HGR A;  4LMV A;  2KRT A;  3LML A;  1RNB A;  4ZL7 A;  3F8U A;  3JUM A;  1SJZ A;  1DBY A;  1TRP A;  4QWT A;  1FOV A;  5HOH A;  2FA8 A;  1ASK A;  3DM8 A;  3AHW A;  1OGX A;  3HIG A;  4J2F A;  3TOU A;  1FYS A;  4HJ2 A;  3UBK A;  5CF1 A;  2LRN A;  3HVN A;  1SJ6 A;  4IJ3 A;  4OFN A;  1EV9 A;  3NQZ A;  4HZB B;  1C54 A;  3LEF A;  6GSX A;  4MMZ B;  3TGZ A;  2VL9 A;  2SBL A;  3A3T A;  1O8X A;  5KN1 A;  3WGD A;  4BWS A;  1YY7 A;  1YZX A;  3CD6 3;  2UX0 A;  4IIA A;  3Q19 A;  1GLP A;  4OO4 A;  4J5K A;  1VQL 3;  2WOH A;  3D79 A;  5F8B A;  3ECF A;  5IG5 A;  2X49 A;  9RNT A;  4AKZ A;  4IBP A;  2F56 A;  2YV7 A;  3AY8 A;  2IYJ A;  1WMJ A;  3U5R E;  1S5A A;  4EF0 A;  4PQI A;  1T4Y A;  3CCE 3;  4K7N A;  2F5M A;  1B2M A;  1NHO A;  2OAC A;  2ZCT A;  5CNW A;  2ES7 A;  5ID2 B;  4GSN A;  4Q5N A;  1QVF 2;  2Y73 A;  3FSD A;  5CRH A;  1V74 A;  3EIN A;  2QA4 3;  2DJ0 A;  2E7P A;  2E2G A;  4WBJ A;  4HM8 B;  5J5N A;  1EGO A;  2GEY A;  1XWA A;  3L9S A;  6GSU A;  3UL5 A;  5ECN B;  2CZ3 A;  5IOW A;  3CPO A;  3ME7 A;  5HR1 A;  1IK3 A;  1H4O A;  3FKA A;  4MMY B;  1GUL A;  1YEP A;  5DAL A;  5E4W A;  5ELG A;  1NSW A;  1XWG A;  2K54 A;  1UGI A;  3NBJ A;  4F0C A;  2JU5 A;  5E59 A;  3B7C A;  3CRT A;  3S28 A;  3HJM A;  5GSS A;  1O7H B;  3SOA A;  1K0N A;  4AJ7 A;  4HM6 B;  1MWT A;  2DMM A;  2GBX B;  1X1U A;  1IT7 A;  16GS A;  4IPB A;  1QK8 A;  1I5G A;  1R7H A;  2VCX A;  4LMW A;  2KOK A;  2FGT A;  4PTS A;  10GS A;  2WZ9 A;  1M3J A;  1XXU A;  1GY5 A;  1DET A;  2XH9 A;  4YH2 A;  3G16 A;  2KP2 A;  1KEB A;  3LT8 A;  2QC7 A;  4K8M A;  2H71 A;  4MH2 A;  2JZS A;  2RBI A;  2KF6 A;  2C0E A;  2H6X A;  1T8E B;  5G1K A;  5AEW B;  1OVN A;  3UIW A;  3J7Y k;  3GST A;  5J41 A;  5ECI B;  3UMA A;  2JQ5 A;  1M3I A;  4QQ7 A;  2CFG A;  1BAN A;  4NV5 A;  1VQO 3;  1XZO A;  1ZCP A;  1K3Y A;  1SEN A;  3LTB A;  2VO4 A;  3APO A;  5D73 A;  2PNC A;  2YFL B;  4AJ6 A;  5FW5 A;  7GSP A;  1VZZ A;  3KM6 A;  4YKF A;  3TJJ A;  1KQS 2;  2WGQ A;  3LFL A;  4PUR A;  3L9V A;  4ECB A;  3GSS A;  3EHC A;  4X2H A;  1YIT 3;  1N8J A;  2RM5 A;  2F9S A;  5ELU A;  1E3V A;  3IHQ A;  4KCE A;  1CEW I;  2H0G A;  1TTZ A;  4IKH A;  1Q82 4;  1OC9 A;  3SWL A;  3GTU A;  2R37 A;  2DSA A;  1ILO A;  3T8N A;  1ERW A;  3A5E A;  17GS A;  1W4N A;  1ERU A;  1RRL A;  3FEU A;  1RQM A;  1JB2 A;  5GSP A;  1BRS A;  3V99 A;  5DDL A;  2Y74 A;  2H70 A;  1N5P A;  1GSE A;  1ML6 A;  4HU9 A;  3BU4 A;  2B5Y A;  3KII A;  5D82 A;  2OBI A;  4HVN A;  1PKW A;  1PX7 A;  3ERW A;  5G5E A;  2ML5 A;  2B5E A;  4HYZ A;  4O5R A;  2W9P A;  2LKU A;  2XHF A;  4MEI A;  2R0C A;  1AVL A;  2KF4 A;  1HQO A;  1Z7R A;  3GFK A;  4ZB8 A;  1K3L A;  1AQZ A;  3EJV A;  2CVD A;  1M90 4;  1YKC A;  2LJR A;  1B9Y C;  20GS A;  5JCU A;  5A4V A;  1FG4 A;  3TDG A;  1PL1 A;  2AB6 A;  1PN0 A;  1F3A A;  4MPG A;  2KXG A;  3EE2 A;  4TR3 A;  1TRV A;  1NB3 I;  8RNT A;  2C3N A;  2PUK C;  3QCP A;  1TIJ A;  1UUG B;  1D6U A;  1QUW A;  1LBK A;  4N6V 0;  4XBX A;  5ECL B;  4WET A;  1UCL A;  3D5I A;  3BND A;  4PXO A;  2K8S A;  2XGL A;  4EV5 A;  1XOB A; 
#chains in the Genus database with same CATH homology
 4TR4 A;  3GKK A;  3IV4 A;  3IC4 A;  2JZT A;  1TKD B;  5KN2 A;  4MJC A;  3VPT A;  2FA4 A;  1SL0 B;  3EWL A;  1TP9 A;  5IPG A;  1YF0 A;  1OC3 A;  4GTU A;  1Z7P A;  4TXV A;  2H01 A;  3F6F A;  3VWV A;  3SBC A;  3UJ1 A;  3D22 A;  4XS4 A;  4MMM A;  4Q5F A;  2H8L A;  4BL7 B;  5JCG A;  3TKS A;  4LLR A;  6GSW A;  2IFQ B;  4USS A;  1XWB A;  2CAQ A;  2VOC A;  2YN1 A;  3CTF A;  2L4C A;  1O8W A;  1SKW B;  3H8Q A;  12GS A;  5BMU A;  1F3B A;  2IMF A;  1VF1 A;  1UC7 A;  5DJL A;  1WOU A;  2HE3 A;  5AN1 A;  4TXO A;  5HFI A;  2FWF A;  1M7T A;  2GDR A;  3E9J B;  4NHZ A;  4KW6 A;  3IE3 A;  1RK4 A;  3FYG A;  3WT2 A;  1M99 A;  3KCM A;  3DWV A;  1AAZ A;  2TIR A;  1EZK A;  5DCG A;  3LSZ A;  3KTL A;  1JFU A;  4XIH A;  1O85 A;  3EMX A;  2QKE A;  4GST A;  2H66 A;  4GF0 A;  3E3E A;  2B7K A;  3LQ7 A;  1ABA A;  3IOS A;  4KCA A;  3TKS E;  1GH2 A;  2X64 A;  2MMA A;  1GWC A;  3MWH A;  5D9V A;  1WPI A;  4P3Y B;  4LL4 B;  3C7M A;  2H76 A;  2LUS A;  3CXG A;  2VIM A;  5L71 A;  1SYX A;  2LS5 A;  1PL2 A;  5ECS A;  3FKF A;  5KN3 A;  1R5P A;  3DD3 A;  3KH7 A;  3TCO A;  4DSS A;  2L6D A;  1PRX A;  1TOF A;  2A2S A;  4EE0 A;  1PKZ A;  2YWM A;  3VWU A;  2IN3 A;  3MYD A;  4NXI A;  5IMV A;  2A2R A;  2F8A A;  3ZYW A;  3VUR A;  3HY2 A;  1F6M C;  5AIS A;  1HYU A;  3F63 A;  2AHE A;  3O3T A;  4JZQ A;  3BBY A;  2G0F A;  1M2A A;  4E8E A;  4FIW A;  2YOI A;  3H4K A;  4N0Z A;  2L6C A;  1G6W A;  3IR4 A;  4EKZ A;  5DCH A;  4ZL9 A;  4KB3 A;  3ZML A;  1F9M A;  3DXB A;  3KMN A;  1T7P B;  3QR6 A;  5KOW A;  2H19 A;  3HVS A;  3BCI A;  1FO5 A;  3IBH A;  1X9W B;  4OO5 A;  3UAP A;  2X4A A;  2WJU A;  1A2L A;  1IYH A;  1B9X C;  2D2Z A;  4A5P A;  3GA4 A;  5ECQ B;  4TRX A;  3D21 A;  1OE8 A;  4HEA 2;  5ECP B;  3IDV A;  4EL1 A;  4MP4 A;  1YQ1 A;  5FWG A;  3Q6O A;  1MTC A;  3GMF A;  1TRW A;  14GS A;  3QAV A;  4KSO A;  1BX9 A;  1FAA A;  1QMV A;  4ZL8 A;  2F8F A;  1J0F A;  1O73 A;  3DYR A;  2EC4 A;  4NAX A;  2JL4 A;  1WWJ A;  5LNK e;  2NPB A;  1DSB A;  2WDU A;  4V2N A;  3US3 A;  1FVK A;  2YP6 A;  2Z9S A;  4BVY B;  3HXS A;  1AIU A;  5BRT A;  4KDY A;  3FZ5 A;  2B6M A;  2FLS A;  4JED A;  2DLX A;  2GZP A;  2XPD A;  2OKA A;  2MBS A;  4NHW A;  5IQY A;  4ZXG A;  4XRD A;  2J23 A;  3ZLP A;  5DAL B;  4K2D A;  1K0D A;  2TRC P;  5CYY A;  3TJK A;  1URM A;  1ZGN A;  2CVB A;  1ON4 A;  2C4J A;  1GUH A;  2JAC A;  1XWK A;  2CV4 A;  1XW6 A;  1ZYE A;  5D96 A;  4WR4 A;  1GTB A;  5H5S A;  1EV4 A;  4HUA A;  4KGI A;  2R4V A;  3PH9 A;  3HA9 A;  2LTK A;  4MNN A;  4F03 A;  1THX A;  2K18 A;  3QPM A;  4DVC A;  3I43 A;  2PWJ A;  3M9J A;  3EU3 A;  6GSV A;  4ECC A;  2CA8 A;  2HRA A;  1X5E A;  4HDE A;  2HZF A;  2N5F A;  1GP1 A;  4MF7 A;  4MDC A;  2OA7 A;  2B1K A;  4GXZ A;  2IMD A;  4CY8 A;  4K0G A;  4LL1 B;  1YF1 A;  4PNG A;  2H0H A;  3GH6 A;  4IN0 A;  1TI1 A;  2GQM A;  3KP8 A;  4KH7 A;  3D5J A;  1AW9 A;  4G0K A;  3A2V A;  4XS1 A;  4OCF A;  2P31 A;  2DBC A;  3U6V A;  4EC0 A;  3EC3 A;  5B6N A;  5GZZ B;  1WIK A;  2IJY A;  3W8S A;  5CRG A;  4QL9 A;  2OAD A;  1XPV A;  2RM6 A;  1VF4 A;  1HNB A;  3ZVJ A;  4XRA A;  3NZN A;  4TKY A;  4F9Z A;  1Z6M A;  3BOA A;  4OFM A;  2NDO A;  3FZ9 A;  2VM1 A;  2XC2 A;  4BA7 A;  1SK0 A;  1LJR A;  2R0P A;  3IAM 2;  2DJJ A;  2WRT A;  4KUN A;  3GUR A;  1EEM A;  4FO5 A;  1SKR B;  3G7J A;  3Q74 A;  5HQP A;  3DVW A;  2FWE A;  3LWA A;  3M9K A;  3QOU A;  4Z2U A;  3WT1 A;  3DIE A;  3HZ8 A;  2L5O A;  1K3O A;  4K1F A;  1AXD A;  5LD0 A;  1IYI A;  2GGT A;  3S9F A;  1ERT A;  2CX4 A;  4XS4 B;  18GS A;  5GAP D;  1EP7 A;  2FHE A;  3P8W A;  2REM A;  1EGR A;  2H1G A;  1J08 A;  1V98 A;  2M46 A;  5D9T A;  3GHA A;  4L5L A;  1SYR A;  3BCK A;  4AF2 A;  1GSD A;  2O87 A;  2P5R A;  3HVX A;  4ZBA A;  2C80 A;  4G19 A;  2OE0 A;  1MDK A;  4NMU A;  1YEX A;  1X9S B;  1G6Y A;  2IME A;  3F4S A;  2DIZ A;  3IXR A;  3FR6 A;  2YJ7 A;  3N5O A;  2AV4 A;  4L5O A;  4N10 A;  1R5A A;  4K7I A;  5HFK A;  2H75 A;  4V2M A;  3E0U A;  1M9B A;  5ECR B;  1TK8 B;  4TN8 A;  3GX8 A;  3D0Z A;  1A23 A;  2EIR A;  4EXJ A;  3A5W A;  4ML1 A;  1KNG A;  1FB6 A;  1WJK A;  2GST A;  2A4V A;  1I9D A;  3EVI A;  3ZTL A;  2GTU A;  2H72 A;  2JSZ A;  3K8N A;  4Z2R A;  2C0G A;  3ZVJ D;  1T00 A;  3W8J A;  2BMX A;  5J4U A;  2VL2 A;  5INY A;  2GS3 A;  5G5F A;  2IMI A;  3FR9 A;  3HKR A;  2PGT A;  3KGK A;  3TUE A;  4TR1 A;  1XVW A;  13GS A;  1XOA A;  1E6B A;  1JLW A;  3IPZ A;  3P2A A;  1U87 A;  1O81 A;  2YV9 A;  1XBS A;  3F4R A;  1J9B A;  5IOX A;  1ZYQ B;  4MH3 A;  5G30 A;  3FHK A;  1EOG A;  1B4P A;  4EDZ A;  4PQ1 A;  3F3Q A;  3WGE A;  3A5I A;  4TVE A;  3VI5 A;  3GL3 A;  2WUL A;  3C1R A;  4AJ8 A;  1XW5 A;  2J9H A;  4K9Z A;  1U88 A;  3TKQ A;  1GL8 A;  3IK7 A;  4GRF A;  1EEJ A;  1SU9 A;  2LRT A;  3DEX A;  2DJK A;  4XHM A;  4YKG A;  2OBK A;  3IA1 A;  3KTB A;  2VCZ A;  1QQ2 A;  3APS A;  3IRA A;  3I6A A;  3H79 A;  3QAG A;  1PN9 A;  2R2J A;  3GYK A;  1PA3 A;  3ERG A;  4MPF A;  3P7X A;  1TK0 B;  3RPP A;  4YQM A;  5ECK B;  1TK5 B;  4PX1 A;  3CYN A;  3NIV A;  2G2Q A;  5HR0 A;  1HNA A;  2R6K A;  5IIZ A;  5ID2 A;  2KP1 A;  5JWO B;  4J57 E;  4MA9 A;  4HI7 A;  2E0Q A;  4MJB A;  1Z9H A;  2I81 A;  1MD3 A;  4Z2T A;  2CVK A;  5HFG A;  5HR2 A;  2KUC A;  2B1L A;  4J56 E;  2GT5 A;  4POM A;  1UN2 A;  2E2M A;  4K6X A;  3QFB C;  1QGV A;  3APQ A;  1SD9 A;  2LST A;  5ECO B;  4MK3 A;  3LXT A;  2A2P A;  4OWY A;  5B6M A;  3FK8 A;  5EY6 A;  5AIV A;  1K0C A;  1GTI A;  3IC8 A;  5DQY A;  1BJX A;  2B3S A;  5AGY A;  4HZ4 A;  1B4Q A;  2O7K A;  2DJ3 A;  2C8U A;  2OE1 A;  3MDK A;  2AUV A;  1GNW A;  4NWY A;  4IP6 A;  8GSS A;  3G7I A;  2FNO A;  4TR0 A;  1W4V A;  1TU8 A;  4L8E A;  4KAE A;  3HJP A;  2NTO A;  1Z5Y E;  2QA1 A;  3MNG A;  2F3M A;  1X5D A;  2V6O A;  4ZIJ A;  4OFT A;  1ZOF A;  1OKD A;  2NVL A;  3VWW A;  2LV3 A;  22GS A;  5ECM B;  5G31 A;  3L0H A;  5D9W A;  3UOM A;  3LYP A;  2PMT A;  4MLY A;  4WR5 A;  5F06 A;  1GTA A;  2FWG A;  4D73 A;  1V58 A;  4YQU A;  2B7J A;  4BPY A;  1T4Z A;  1NW2 A;  1OYJ A;  2CAI A;  5KOX A;  4KSM A;  1ZYN A;  1XW9 A;  2H1A A;  6GSS A;  2RUF A;  3HZ4 A;  3KMO A;  2IWT A;  1DUG A;  3OR5 A;  3RHB A;  2YJH A;  5F05 A;  1BED A;  2HSM A;  3D4M A;  3M0F A;  4POL A;  3HJO A;  1MDJ A;  2L4Q A;  2R0G A;  1VF3 A;  2GLR A;  3UBL A;  4MCU A;  3CBU A;  3EPT A;  3A2W A;  3CRU A;  2FUG 2;  4ZB6 A;  1M2D A;  4LA1 A;  2HRK A;  4K5S A;  1JHB A;  1VGL A;  3FZ4 A;  1JZO A;  2X99 A;  2V1M A;  2PBJ A;  2KHP A;  2LQQ A;  2MZC A;  1S3D A;  3KZQ A;  1C72 A;  2EIQ A;  1M0U A;  1Z6N A;  1SL2 B;  3DML A;  4CHS A;  4Q5Q A;  2O85 A;  3G7Y A;  1PSQ A;  3ED3 A;  1K0O A;  4BL7 A;  2ZUP A;  4Q5R A;  1TRU A;  2K8V A;  4O7H A;  1PQN A;  1HNC A;  3VFI A;  5IMD A;  3LGC A;  1GTU A;  4ZBD A;  3CSH A;  2A4H A;  1GSU A;  2XPE A;  4YAP A;  2LNS A;  2YZH A;  1X0R A;  1WRY A;  2DKH A;  5DAK A;  1SJI A;  3RAZ A;  2HNL A;  4YQV A;  3V1W A;  1ZMA A;  1AQW A;  5D8I A;  2XBQ A;  1JZR A;  2X8G A;  2P5Q A;  3HDC A;  4DSQ A;  2GQL A;  3TKP A;  4MJE A;  1GSF A;  1V2A A;  2AJQ B;  5ELA A;  2O8V B;  1V40 A;  4I5Q A;  3TJB A;  2HZE A;  4PUF C;  4RI7 A;  4JU5 A;  2K9F A;  1X5C A;  2YNX A;  1TU7 A;  5COH A;  4HJM A;  4DSR A;  3I69 A;  3KP9 A;  3TB2 A;  4I8B A;  3DRN A;  4HOJ A;  3G9B A;  1A8L A;  2NBS A;  2O89 A;  1U3I A;  1QFN A;  3ISO A;  2H1B A;  2N5B A;  4KF9 A;  4HS1 A;  5D93 A;  4V1A g;  1YJ6 A;  4IQA A;  2WFC A;  11GS A;  2WCI A;  2HI7 A;  4I97 A;  3LOR A;  4XS6 A;  3WYW A;  1FB0 A;  1K0M A;  4IQ1 A;  2VCT A;  4MZC A;  5A5K A;  1B48 A;  1TXX A;  3FW2 A;  3CMI A;  3GH9 A;  4OMV A;  3D6I A;  3TJF A;  2LQO A;  1OC9 B;  3GTU B;  2GSR A;  3M8N A;  4PUA A;  3KIJ A;  1TI3 A;  4KE3 A;  2YWO A;  6GSY A;  3J7Y b;  4POB A;  3GNJ A;  4IGJ A;  4I6X A;  4ILF A;  1LU4 A;  2HXK A;  3QDN A;  4GSS A;  5J9C A;  5CP1 A;  1H75 A;  4L0W A;  1JLV A;  4O92 A;  5GST A;  1NHY A;  3W6G A;  1F2E A;  1Z3E A;  3GIX A;  3F3R A;  1PMT A;  1EWX A;  4F0B A;  4G0L A;  2R3X A;  4HQS A;  4GQF A;  1ZYP A;  5H5Q A;  3R2Q A;  2X8H A;  2QGV A;  4PQH A;  4MF5 A;  1GSQ A;  4OD7 A;  2H1D A;  1K0A A;  5A4W A;  1K0B A;  1ZL9 A;  1GRX A;  5FHI A;  5ECH B;  4GQC A;  2FY6 A;  3QAW A;  3C71 A;  4V1A p;  3HHV A;  2PER A;  4WBR D;  4MAB A;  3GX0 A;  2M80 A;  2IIY A;  2QA2 A;  4EO3 A;  4O5U A;  1JZD A;  2WS2 A;  4PGT A;  4K7O A;  2YWN A;  3PPU A;  3ZFB A;  2PN8 A;  1USB A;  4EIP A;  3TKS C;  1G7E A;  4X1U A;  2GZZ A;  5G2Z A;  2PPT A;  4MJA A;  4HZ2 A;  4BVY A;  3PGT A;  5CRW A;  2YWI A;  3ZIT A;  4TW5 A;  1G7O A;  5C04 A;  3QD9 A;  4PNF A;  5J3R A;  1UA5 A;  2IY2 A;  4BVX A;  1AQV A;  4O32 A;  1BG5 A;  5EVO A;  1V57 A;  4NPB A;  3FY7 A;  4TXO B;  3TJG A;  1XVQ A;  4G9H A;  4KA0 A;  1GSY A;  4X4J A;  2XBI A;  2VM2 A;  5IMA A;  3RBT A;  2HRN A;  2VD1 A;  3UVT A;  3EUR A;  4RQR A;  3WGX A;  2JZR A;  4CW9 A;  5C00 A;  2LNT A;  3GKM A;  3HYP A;  4ID0 A;  1MD4 A;  3GKX A;  2UZ8 A;  4E8H A;  3L4N A;  1OE7 A;  3EMP A;  4G10 A;  4DEJ A;  2FCH A;  1R26 A;  4IS0 A;  2V2G A;  4K5R A;  5EPF A;  4ICY A;  1TRS A;  2V41 A;  2FD3 A;  1AQX A;  3VWX A;  2GT6 A;  4OCE A;  1R4W A;  1YKA A;  3LG6 A;  1ACV A;  1GUK A;  3FR3 A;  2ON5 A;  3M3M A;  1T3B A;  3O6T A;  3P90 A;  4IEL A;  2C0F A;  2V32 A;  3ZRE A;  4ZIL A;  5IMF A;  3N9J A;  1YDK A;  4DSS B;  1OKT A;  2DC5 A;  1TDI A;  5B8B A;  4IJI A;  4V2L A;  1OAZ A;  3ZIJ A;  4MZB A;  4D73 B;  4RI6 A;  3D4T A;  3C1S A;  2C3Q A;  4F82 A;  3GN3 A;  2M72 A;  4EDY A;  9GSS A;  1SK2 A;  4NV2 A;  3VK9 A;  5B8A A;  2H74 A;  2HT9 A;  2CZ2 A;  2I4A A;  1GNE A;  4TOP A;  5CRE A;  4IVF A;  1B8X A;  3KEB A;  3TKR A;  1DE2 A;  4JRR A;  2FGX A;  3ZZX A;  1FW1 A;  1O6J A;  2HYX A;  3L78 A;  3UEM A;  1O7U A;  4WEY A;  3GV1 A;  4X0X A;  4N11 A;  1PD2 1;  2MMO A;  3TRP A;  2GVP A;  5F0G A;  5CRD A;  1A8Y A;  5JWR B;  2P0G A;  1SKS B;  2MMN A;  2JAD A;  5AIX A;  4WF4 A;  2GSS A;  2C0D A;  2L59 A;  2IPA A;  4ECJ A;  1A0R P;  3TRX A;  4EUY A;  3KXO A;  1N2A A;  3GUS A;  2GQK A;  2OJL A;  5DQS A;  1X9M B;  3DVX A;  4K0N A;  4JBB A;  4ISD A;  5EL8 A;  2BJX A;  3VPQ A;  2LRC A;  3EYT A;  5IM9 A;  3M1G A;  3MSZ A;  2HFD A;  2KLX A;  4JR6 A;  2MMZ A;  1A2M A;  5J9B A;  3RDW A;  1XCC A;  3ERF A;  3KD0 A;  2IMK A;  5DAK B;  2CQ9 A;  2LJK A;  1U3A A;  3QMX A;  5IMZ A;  1TJD A;  3BD2 A;  5IPH A;  1WP0 A;  2HSH A;  3PIN A;  3KJY A;  5KEJ A;  3VI7 A;  3I9V 2;  5CAX A;  3DGQ A;  1VF2 A;  3ZFL A;  1Y6E A;  2YAN A;  1ZZY A;  3MAK A;  2ON7 A;  1MEK A;  3QFA C;  3GRX A;  1W89 A;  3GL5 A;  3LW9 A;  4FYC A;  5DBQ A;  4GCI A;  1AUC A;  2C1Y A;  2HZE B;  3PR8 A;  4QL7 A;  3VLN A;  3ZIV A;  4ZB9 A;  1GLQ A;  2VD0 A;  2RUE A;  4XCS A;  2F51 A;  2PVQ A;  4HQZ A;  4ECI A;  1CQG A;  5G1L A;  4I2U A;  1F37 A;  1XWC A;  1U6T A;  3IK9 A;  1JZW A;  2YPM A;  3H1N A;  1Q4J A;  2TRX A;  4KX4 A;  19GS A;  4N30 A;  4KDX A;  1UVZ A;  2VAF A;  1EP8 A;  1MDI A;  2VLV A;  4RQX A;  1TW9 A;  1KBN A;  3CSI A;  3WD6 A;  5LCZ A;  4CDO A;  4G2E A;  4MZW A;  2WB9 A;  2VCW A;  4L0U A;  4GLT A;  4POK A;  2VCQ A;  2YZU A;  1BYE A;  1GSS A;  2RII A;  2HRF A;  2ALB A;  2IL3 A;  3DKS A;  4WXT A;  2VUP A;  2H6Y A;  2LJA A;  3C8E A;  1G0T A;  1OC8 A;  2L57 A;  3ME8 A;  4ACS A;  2EIO A;  4FQU A;  1DE1 A;  3RHC A;  4XTS A;  1T1V A;  2DJ1 A;  3FMW A;  1NM3 A;  1E2Y A;  5GAN D;  1ST9 A;  2RLI A;  2L5L A;  5H5R A;  5JCW A;  5A4U A;  2VCV A;  2VL3 A;  2CT6 A;  4N0V A;  4CY6 A;  2C3T A;  3F6D A;  4X43 A;  2BTO T;  3CTG A;  3Q18 A;  3RPN A;  3IHG A;  2N5A A;  3L9U A;  1HD2 A;  1RW1 A;  2MBT A;  3FZA A;  3LJR A;  2DML A;  1BAY A;  2K6V A;  1M9A A;  3UL3 A;  3ZRD A;  1XFL A;  1BQ7 A;  5IMC A;  4RUV A;  3TRQ A;  4EVM A;  4G0I A;  2IFQ A;  4BWQ A;  4H86 A;  1A24 A;  2GSQ A;  2ZNM A;  2DJ2 A;  4JE1 A;  5IO0 A;  2DKI A;  4Z7X A;  4EIQ A;  2VLU A;  2FWH A;  4ZBB A;  3R3E A;  5HR3 A;  1S3A A;  4IHU A;  1AC1 A;  1EOH A;  4ML6 A;  3O76 A;  2AYT A;  3NOF A;  2PU9 C;  3BJ5 A;  4WF5 A;  4HU7 A;  3FRC A;  1VRS D;  2B5X A;  2H30 A;  2I9H A;  3LXZ A;  5B7C A;  4I2T A;  4BVX B;  3TOT A;  5IO2 A;  5FT3 A;  3H93 A;  2DIY A;  1FHE A;  5DVB A;  4FYB A;  3KH9 A;  6GST A;  3HCZ A;  4MF6 A;  5ENU A;  5DJM A;  2X8C A;  3ZMK A;  2LEG A;  2HLS A;  2R5G A;  3UAR A;  2H6Z A;  4KND A;  1A2J A;  3LYK A;  2CX3 A;  2OE3 A;  2PVO C;  2AAW A;  1XIY A;  4GWR A;  3ZL5 A;  3MIX A;  4IP1 A;  4K2X A;  2I1U A;  1PGT A;  1Y25 A;  1SK1 A;  7GSS A;  2I3Y A;  3F0I A;  2JSY A;  3HD5 A;  3EU4 A;  1M2B A;  4FH8 A;  1CQH A;  1SL1 B;  3JCM L;  3C73 A;  5D9X A;  5ABR A;  3UVH A;  1GUM A;  1S3C A;  2MYG A;  4KDU A;  3GKN A;  3HVV A;  5CO3 A;  1Q98 A;  3F9U A;  4FYU A;  2VL2 C;  2GZY A;  4O5Q A;  4F2I A;  2VLT A;  3F4T A;  4JR4 A;  4TR1 B;  3A2X A;  5KN0 A;  1FOH A;  1KTE A;  4ULX A;  3CSJ A;  2H73 A;  2YCD A;  1SD8 A;  2V6K A;  3IAS 2;  1THO A;  4YAV A;  1FVJ A;  5F07 A;  2HSY A;  1ERV A;  5JWQ B;  1WE0 A;  2H0I A;  1A0F A;  2QSI A;  2WGR A;  1V9W A;  1PX6 A;  4AGS A;  4LMV A;  4ZL7 A;  3F8U A;  1SJZ A;  1DBY A;  1FOV A;  2FA8 A;  4J2F A;  3TOU A;  4HJ2 A;  3UBK A;  2LRN A;  1SJ6 A;  4IJ3 A;  4OFN A;  1EV9 A;  3LEF A;  6GSX A;  3TGZ A;  2VL9 A;  3A3T A;  1O8X A;  5KN1 A;  3WGD A;  4BWS A;  1YY7 A;  1YZX A;  3Q19 A;  1GLP A;  4OO4 A;  5F8B A;  2X49 A;  4IBP A;  2YV7 A;  3AY8 A;  2IYJ A;  1WMJ A;  3U5R E;  4EF0 A;  4PQI A;  1T4Y A;  4K7N A;  2ZCT A;  1NHO A;  2OAC A;  5CNW A;  2ES7 A;  5ID2 B;  4GSN A;  4Q5N A;  5CRH A;  3EIN A;  2DJ0 A;  2E7P A;  2E2G A;  4WBJ A;  5J5N A;  1EGO A;  1XWA A;  3L9S A;  6GSU A;  5ECN B;  2CZ3 A;  5IOW A;  3ME7 A;  5HR1 A;  1H4O A;  1YEP A;  1GUL A;  5DAL A;  5E4W A;  5ELG A;  1NSW A;  1XWG A;  4F0C A;  2JU5 A;  5E59 A;  3CRT A;  3HJM A;  5GSS A;  1K0N A;  4AJ7 A;  4IW9 A;  2DMM A;  4LMW A;  1R7H A;  16GS A;  1QK8 A;  2VCX A;  1I5G A;  2KOK A;  4PTS A;  10GS A;  2WZ9 A;  1XXU A;  4YH2 A;  2KP2 A;  1KEB A;  2QC7 A;  4K8M A;  2H71 A;  4MH2 A;  2JZS A;  2C0E A;  2H6X A;  1T8E B;  5G1K A;  1OVN A;  3UIW A;  3J7Y k;  3GST A;  5J41 A;  5ECI B;  3UMA A;  4QQ7 A;  4NV5 A;  1XZO A;  1ZCP A;  1K3Y A;  1SEN A;  2VO4 A;  3APO A;  5D73 A;  4AJ6 A;  3KM6 A;  4YKF A;  3TJJ A;  3LFL A;  4PUR A;  3L9V A;  4ECB A;  3GSS A;  1N8J A;  2RM5 A;  2F9S A;  3IHQ A;  4KCE A;  2H0G A;  1TTZ A;  4IKH A;  1OC9 A;  3SWL A;  3GTU A;  2R37 A;  2DSA A;  1ILO A;  1ERW A;  17GS A;  1ERU A;  3FEU A;  1RQM A;  5DDL A;  2H70 A;  1GSE A;  1ML6 A;  4HU9 A;  2B5Y A;  2OBI A;  1PKW A;  1PX7 A;  3ERW A;  5G5E A;  2B5E A;  4O5R A;  2LKU A;  2XHF A;  2R0C A;  1HQO A;  1Z7R A;  4ZB8 A;  3GFK A;  1K3L A;  2CVD A;  1YKC A;  2LJR A;  1B9Y C;  20GS A;  5JCU A;  5A4V A;  1FG4 A;  3TDG A;  1PL1 A;  2AB6 A;  1PN0 A;  1F3A A;  4MPG A;  3EE2 A;  4TR3 A;  1TRV A;  2C3N A;  2PUK C;  3QCP A;  1QUW A;  1LBK A;  5ECL B;  4WET A;  1XOB A;  4PXO A;  2K8S A;  1QXH A;  4WKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...