4LYLB

Crystal structure of uracil-dna glycosylase from cod (gadus morhua) in complex with the proteinaceous inhibitor ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biophysical analysis of interactions between cod and human uracil-DNA N-glycosylase (UNG) and UNG inhibitor (Ugi).
pubmed doi rcsb
source organism Gadus morhua
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
total genus 16
structure length 82
sequence length 82
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2013-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 4lylB00
2J8XB 2UGIA 1UGIA 1UGHI 4LYLB 2ZHXB 1UUGB 1UDII 1EUIC 1LQGC 1LQMB 2UUGC
chains in the Genus database with same CATH superfamily
4U13A 2J8XB 2RNTA 3DGMA 3HIGA 3Q1CA 3G8ZA 1FGRA 3LYGA 3CCJ3 3MYTA 4RNYA 4RZMA 2BT3A 3F7SA 1QAKA 1GOVA 1B2XA 6GSPA 2CK3H 1BNRA 4N6LA 5G2GA 2BIRA 1K41A 2Q07A 3JUQA 1I0VA 4Q53A 1C54A 1Z1SA 3V92A 2GEXA 1DMMA 1X1UA 4AEQA 4EXRA 2QA43 4MMYB 1Q824 1D6ZA 1QJGA 4ZM8A 1JNQA 1V58A 3NX0A 1I70A 3CCV3 3BNDA 1LOWA 1LRAA 1W2ZA 2C10A 3GZXB 1O7GB 3MPHA 4PEJA 3HX8A 1O7WB 4HZBB 7GSPA 3VF1A 1SIHA 2UUGC 1U8CB 1AR0A 1GOYA 5D82A 2GBWB 2XFTA 3VSYA 3MKIA 1T3BA 4K61A 3MG1A 3KZTA 2KAAA 1MWUA 1BRGA 3EJVA 3EQQB 3CXC2 4L8PA 2GSPA 1N8QA 1W00A 1GY6A 2D1WA 3NBJA 3S28A 3CC73 1OCVA 2JDIH 5AIFA 4N3VA 3EF8A 2ZDJA 3GWRA 4R1KA 1AVKA 2F5WA 4N6OB 4EC6A 3SX1A 1WNHA 3Q2PA 1US1A 1T2HA 2FXTA 4J8TA 3MG2A 1BSBA 2F99A 1MOLA 1JZDA 1OACA 4STDA 4EBGA 1R4CA 5IG5A 1IVXA 1HYFA 1I2EA 5KP3A 1K734 2PZVA 1FGTA 1RGHA 1BSEA 3DGLA 4WWUC 3PCSA 1S723 1SQWA 2O3OA 3H51A 1I3FA 1UCJA 3FF2A 3PGBA 1N9EA 2CFDA 3EN8A 3DGOA 4NPBA 2JQ5A 4HKVB 5AYRB 1Q40A 1O7PB 4AKZA 1BNEA 2W04A 3AMOA 3WA3A 1FUSA 5DREA 1CQSA 2E2VA 4HM6B 3HK4A 1RGLA 5IEOA 3BNCA 2P0XA 3GZBA 1YJN3 2CH9A 4KZ1A 4DKIA 1K8A4 1FUTA 4AKYA 5AIGA 1Q814 3FLJA 1OH0A 1W6CA 2F5MA 1R4YA 1RGCA 2O9UX 3OWUA 3X3ZA 3CCR3 1NB5I 4L8OA 1RGAA 3KKGA 1LNHA 3AMOB 1OHPA 1JKGA 4KT3B 1ISKA 4H3UA 1RRLA 2OQEA 3FG1A 3F9SA 3BIRA 4RBNA 1VQ53 1MNLA 4HM3B 4OK0A 1F8NA 3BNBA 1CEWI 3FKAA 1JKGB 2BMOB 2ZA4A 3I563 2XH9A 1N5HA 1MGWA 5EVHA 4KFEA 5IW9A 3CME3 3MG3A 2XSOB 1BUJA 2HMOB 3L0RA 2W6JH 3IJEB 1ULIB 1WMPA 2Z6BA 2P05A 3PZWA 1VQQA 1MGRA 2QGUA 3D4AA 4JRFA 1I2FA 2HMNB 5IG3A 1JBRA 1RCKA 1NB3I 2BMQB 2AADA 1GSPA 1EUIC 3ECFA 1YIT3 1LQMB 2Y74A 4XB5A 3X3XA 3CCU3 4JF8A 3AGOA 3K5TA 3PS8A 1YVSA 1GS3A 3WODG 2XSHB 4EYCA 1VQO3 1VQ73 2FGTA 1M904 4H61A 1OF5B 2YFLB 1BANA 2AAEA 4TX4A 5DRVA 2R4IA 3OW22 2K0MA 1GYBA 4NREA 1AY7A 1BRKA 3S5CA 3LTAA 5CLKA 1Q7Y4 1OUNA 3M8CA 5EQLA 2IYJA 3S67A 2KF4A 2Z7AA 3OWYA 1W5ZA 2H0GA 3EN1B 4FR9A 4HVNA 1WQLB 1YJW3 1FA3A 1IVWA 2W9PA 1FGMA 2H0HA 2OOVA 2XGNA 1C7HA 1FGQA 2STDA 1Y4KA 1RN7A 2Y73A 2HMLB 3CNXA 5BVBA 3IMAB 3UL6A 1BUQA 2W56B 3DY5A 3OXAA 4X2OA 2F4YA 1RGEA 3E99A 1LOVA 4IPBA 3QRDA 2WOHA 5BU4A 4HM7B 3CPW2 2GU3A 2BO9B 3RGRA 1ROVA 1JB4A 1A90A 5GSPA 2LYXA 3S29A 2CX1A 2FNQA 6RNTA 5I97A 4FMCA 3DMCA 4IT7A 4FMAA 2ZHXB 1JBTA 1BSAA 2INXA 3B4OA 3AHWA 3GZYB 4ILFA 3SVAA 3SYUA 1KQS2 1LVNA 1VQL3 1DE3A 1TU5A 5AIHA 2I9WA 3NQYA 3SOYA 3X3YA 1W6GA 4MJDA 3NUVA 1NNVA 4QWTA 4XBTA 2XF3A 3BNEA 4HZ9B 1LOXA 1AVLA 5KP4A 1D6UA 3DGYA 4O02B 3O8YA 5FGOA 1D6YA 1ZS7A 1FUWA 1NDOB 2QIYA 2B1XB 4HOHA 1X1YA 1UI8A 1ZO2A 5EEOA 1RKYA 1J2BA 4LZIA 4R80A 3NXJA 3FCSB 3F8HA 3S27A 1RNBA 3CCE3 4XM4A 3KSED 2CW9A 2F56A 1LQGC 2OTJ3 1UUVB 1CYUA 2OWPA 3F8XA 4BTXA 4HM1B 3FZWA 1BU4A 1RDSA 2PNCA 3KN4A 1UCIA 1E97A 1EEJA 2LQVA 3JUPA 3K63A 1AQZA 3LMLA 3N8BA 1YI23 2CHCA 1BNGA 3J7Yd 3CCL3 1VQ43 4HYZA 1IK3A 2SBLA 1O7HB 3ROBA 1X1XA 3LTCA 3EB8A 1DETA 1SARA 3DZLA 2WOFA 3TDGA 4XDWA 4BTYA 2F98A 2CFKA 3A76A 9RNTA 1TRPA 3K7CA 1DMQA 1JJ22 4BL3A 3Q3FA 2W0QA 1W7CA 2OCTA 3K0ZA 3NV0A 1RRHA 1RN4A 3G6E3 1NWWA 3N9HA 1K9M4 1G0TA 1W02A 1S5AA 3D3LA 3PYJA 2UGIA 1UGHI 5IG4A 1VQK3 3EBTA 5TGNA 1Q864 1ULJB 3LT8A 4LSOA 4XBYA 1IVVA 1JZOA 2WGOA 1B2MA 1IQYA 1JB2A 2IY2A 1YVBI 2WGQA 1MWRA 3X41A 5KP1A 4G1MB 4LYLB 4R4KA 1OHSA 1STFI 1UDII 2KF3A 1YGWA 3CNMA 3F14A 3KE7A 4K90B 1HZ1A 3T8UA 2CWUA 3B7CA 3A5EA 3CCS3 1PFPA 1EQKA 3I0YA 3CPOA 1NU3A 1QVG2 3HIIA 5CF2A 1WMOA 3NM7A 3WMDA 1A2KA 1Q42A 1BNIA 4HAAA 1A2PA 1JN5B 4FCMA 1TJDA 2P09A 3U97A 4HM8B 2RGQA 4BU4A 1BNSA 1B3SA 1B20A 1GY7A 1IT8A 1TIJA 4GSPA 1OF5A 3X40A 1RGGA 4N6NB 1RSNA 5ELJA 3DUKA 3G4S3 5HGRA 1T5YA 2L1SA 2W56A 1FGOA 2XFSA 4J5KA 1W6YA 4GL6A 1KD14 3WA2X 1GY5A 4MEIA 2R41A 1BGSA 2HMJB 3MWZA 2BHMA 3DH2A 1Q40B 1YNVX 3KFQC 4O8SA 5IG0A 2BU4A 5IF6A 4ORLA 4FMBA 2V1LA 5LC7A 3D5IA 3PCRA 3QK9A 1SIIA 1RLSA 1W01A 5STDA 1L5GB 4CPKA 3NHXA 5JBSA 2XEPA 1N8R4 1BNJA 6STDA 1VQP3 4N6TA 2CG0A 1PY3A 2P38A 1Q9EA 2BMRB 3FSDA 2B24B 5JPUA 1B2UA 2IMJA 4HM4B 3NBBA 1TRQA 5JPPA 2KRTA 3DXOA 5G1KA 1QALA 1KC84 1BNFA 4CCVA 4WYKA 4HJLB 2YFJB 2M7OA 3X42A 1BRIA 3OX9A 3ZG0A 2CIUA 3KSPA 1IQXA 3BU4A 1BRSA 1CYVA 1GD3A 2YX9A 3D79A 3JVCA 4MMZB 3K9MC 2E2TA 2UX0A 1QAFA 3NQZA 3T0UA 5AI1A 1LNIA 1UCKA 2CFGA 4OVMA 3RGAA 1BRJA 7STDA 3FH1A 1CH0A 1B27A 1I8VA 3MHEA 1T2IA 3EBYA 2Z77A 4WFOA 1IV7A 3CC23 5M18A 1RN1A 1UUGB 4XDVA 3LOYA 2XGLA 3LZAA 1DYUA 2CFLA 2KCDA 3BLZA 1YGEA 4FCJA 1RJOA 1UGIA 1DVCA 4CJNA 4XBXA 1I0XA 1WMNA 3AGNA 3KCHA 1U5OA 2HMKB 1B21A 3IPTA 1VQM3 1WTHA 1OPYA 1I3IA 1GOUA 4LMIA 1RCLA 1N5PA 2GBXB 3AHSA 2W9QA 2CKFB 3CCQ3 3LTBA 1OGXA 1IYYA 1BAOA 1VQ83 5ELUA 3Q90A 1G96A 3MSOA 1UI7A 5LC6A 3CC43 1RMSA 1MWTA 1A2VA 4L7KA 3GRDA 1BSCA 3CD63 2BNGA 2ML6A 1ROAA 2RCDA 3RDEA 4LEHA 1BVIA 1NJI4 4I4KA 2KF5A 1V57A 2CWTA 1Q7HA 3SXXA 1O7MB 1BRHA 1GMRA 1RHLA 2IUKA 2CWVA 1FZUA 1ZGXA 1SPUA 1YHQ3 1VZZA 3NM2A 4R9LA 2GEYA 3OV4A 3GZRA 3LXUX 4BL2A 3DGNA 3ZG5A 1MWSA 1SJWA 1JRQA 1IV9A 1M1K4 2RSXA 1TFKA 3DM8A 4X2HA 2ML5A 1QVF2 3G713 1RTUA 3LH4A 3OWSA 3UL5A 5A0OB 1YJ93 4CDLA 1JB5A 2C11A 3V98A 2L4VA 2RFRA 2IUJA 3U1WA 1VQN3 3UNLA 1QMAA 4O3VA 3CCM3 3JUMA 2OOVC 3B8LA 4OUQA 4N6UA 4KVHA 4I5QA 1HU9A 2CX0A 4RNTA 3SEDA 2XRXB 1BIRA 1EKMA 1TFOA 2ZL8A 4IIAA 5BIRA 1FW7A 1NO3A 3FG3A 4WYKB 3SOAA 1LOYA 3FG4A 2KF6A 4MMXB 3RNTA 4K1UA 2KXGA 3CU3A 3G0KA 4R9KA 5AEWB 5IERA 3GAXA 3PXMA 3GSPA 3D9RA 1DVDA 1RGFA 1E3VA 1IVUA 5CK6A 3LTDA 1OGZA 2P0MA 1FYSA 2GU1A 1PYLA 5FW5A 1ASKA 3WOFB 3JUOA 3NBRA 5D81A 2MC8A 1VQ63 2CFWA 3WOEB 3JUNA 1X1WA 3G16A 8RNTA 1HKXA 1TUHA 4KFFA 1I2GA 1GMPA 1V74A 1M9GA 3WR2A 1KWIA 3VGNA 1TTOA 3ER7A 5CXOA 1RGKA 1IU7A 3HZPA 1OHOA 1N9JA 2IA7A 2K54A 5M1AA 5BXQA 3BB9A 3CMA3 3WDGB 1BRNL 4J5GA 1EG9B 2HOHA 5AYSC 4HM2B 4BIRA 4EV5A 3WHOA 3HOHA 1JN5A 1IT7A 5AEUB 2E2UA 3KIIA 4GB5A 4LGQA 5CF1A 2CG1A 1K28A 2OQEC 3B4PA 1UCLA 3FF0A 3ZFZA 3I553 1JBSA 4BTWA 1GD4A 2H0IA 1B2SA 2C4BA 4GHOA 1IQ8A 4HBRA 5AIIA 5IEPA 2XR8B 3T8NA 2HMMB 4J9AA 1LXEA 1IDPA 2RBIA 3SLUA 3STDA 4N6MA 3V99A 2SARA 1W2B2 3UB1A 4RNZA 3UJMA 4WP5A 3F7XA 3N54B 4O2HA 8CHOA 5RNTA 7RNTA 5D83A 1YIJ3 4NHFA 3NV0B 1BSDA 1EA2A 3ALAA 2MF7A 1ZX2A 1VQ93 1O7NB 4FCZA 3EHCA 1STDA 4EW5A 2W03A 3EE1A 3URPA 5M19A 1BOXA 3EC9A 3H3HA 4KFDA 2WO0A 2D42A 1UUWB 2A15A 1UW1A 4N6V0 2GXFA 2Z76A 1AV4A 1KSIA 3F40A 2F86B 4WHAA 5IENA 1B2ZA 2W2CA 1G02A 5HOHA 4HM0B 3FGYA 4K1VA 1A67A 1E3RA 1PU4A 1M1XB 2OTL3 1TP6A 2K3DA 2YFIB 3HI7A 1GMQA 1W4NA 4HM5B 1DMNA 3D5GA 2QEX3 4EV2A 3LT9A 3EX9A 2CC3A 1RNTA 5G1LA 1JV2B 4FMDA
chains in the Genus database with same CATH topology
2J8XB 2UGIA 1UGIA 1UGHI 4LYLB 2ZHXB 1UUGB 1UDII 1EUIC 1LQGC 1LQMB 2UUGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8X B;  2UGI A;  1UGI A;  1UGH I;  4LYL B;  2ZHX B;  1UUG B;  1UDI I;  1EUI C;  1LQG C;  1LQM B;  2UUG C; 
#chains in the Genus database with same CATH topology
 4U13 A;  2J8X B;  2RNT A;  3DGM A;  3HIG A;  3Q1C A;  3G8Z A;  1FGR A;  3LYG A;  3CCJ 3;  3MYT A;  4RNY A;  4RZM A;  2BT3 A;  3F7S A;  1QAK A;  1GOV A;  1B2X A;  6GSP A;  2CK3 H;  1BNR A;  4N6L A;  5G2G A;  2BIR A;  1K41 A;  2Q07 A;  3JUQ A;  1I0V A;  4Q53 A;  1C54 A;  1Z1S A;  3V92 A;  2GEX A;  1DMM A;  1X1U A;  4AEQ A;  4EXR A;  2QA4 3;  4MMY B;  1Q82 4;  1D6Z A;  1QJG A;  4ZM8 A;  1JNQ A;  1V58 A;  3NX0 A;  1I70 A;  3CCV 3;  3BND A;  1LOW A;  1LRA A;  1W2Z A;  2C10 A;  3GZX B;  1O7G B;  3MPH A;  4PEJ A;  3HX8 A;  1O7W B;  4HZB B;  7GSP A;  3VF1 A;  1SIH A;  2UUG C;  1U8C B;  1AR0 A;  1GOY A;  5D82 A;  2GBW B;  2XFT A;  3VSY A;  3MKI A;  1T3B A;  4K61 A;  3MG1 A;  3KZT A;  2KAA A;  1MWU A;  1BRG A;  3EJV A;  3EQQ B;  3CXC 2;  4L8P A;  2GSP A;  1N8Q A;  1W00 A;  1GY6 A;  2D1W A;  3NBJ A;  3S28 A;  3CC7 3;  1OCV A;  2JDI H;  5AIF A;  4N3V A;  3EF8 A;  2ZDJ A;  3GWR A;  4R1K A;  1AVK A;  2F5W A;  4N6O B;  4EC6 A;  3SX1 A;  1WNH A;  3Q2P A;  1US1 A;  1T2H A;  2FXT A;  4J8T A;  3MG2 A;  1BSB A;  2F99 A;  1MOL A;  1JZD A;  1OAC A;  4STD A;  4EBG A;  1R4C A;  5IG5 A;  1IVX A;  1HYF A;  1I2E A;  5KP3 A;  1K73 4;  2PZV A;  1FGT A;  1RGH A;  1BSE A;  3DGL A;  4WWU C;  3PCS A;  1S72 3;  1SQW A;  2O3O A;  3H51 A;  1I3F A;  1UCJ A;  3FF2 A;  3PGB A;  1N9E A;  2CFD A;  3EN8 A;  3DGO A;  4NPB A;  2JQ5 A;  4HKV B;  5AYR B;  1Q40 A;  1O7P B;  4AKZ A;  1BNE A;  2W04 A;  3AMO A;  3WA3 A;  1FUS A;  5DRE A;  1CQS A;  2E2V A;  4HM6 B;  3HK4 A;  1RGL A;  5IEO A;  3BNC A;  2P0X A;  3GZB A;  1YJN 3;  2CH9 A;  4KZ1 A;  4DKI A;  1K8A 4;  1FUT A;  4AKY A;  5AIG A;  1Q81 4;  3FLJ A;  1OH0 A;  1W6C A;  2F5M A;  1R4Y A;  1RGC A;  2O9U X;  3OWU A;  3X3Z A;  3CCR 3;  1NB5 I;  4L8O A;  1RGA A;  3KKG A;  1LNH A;  3AMO B;  1OHP A;  1JKG A;  4KT3 B;  1ISK A;  4H3U A;  1RRL A;  2OQE A;  3FG1 A;  3F9S A;  3BIR A;  4RBN A;  1VQ5 3;  1MNL A;  4HM3 B;  4OK0 A;  1F8N A;  3BNB A;  1CEW I;  3FKA A;  1JKG B;  2BMO B;  2ZA4 A;  3I56 3;  2XH9 A;  1N5H A;  1MGW A;  5EVH A;  4KFE A;  5IW9 A;  3CME 3;  3MG3 A;  2XSO B;  1BUJ A;  2HMO B;  3L0R A;  2W6J H;  3IJE B;  1ULI B;  1WMP A;  2Z6B A;  2P05 A;  3PZW A;  1VQQ A;  1MGR A;  2QGU A;  3D4A A;  4JRF A;  1I2F A;  2HMN B;  5IG3 A;  1JBR A;  1RCK A;  1NB3 I;  2BMQ B;  2AAD A;  1GSP A;  1EUI C;  3ECF A;  1YIT 3;  1LQM B;  2Y74 A;  4XB5 A;  3X3X A;  3CCU 3;  4JF8 A;  3AGO A;  3K5T A;  3PS8 A;  1YVS A;  1GS3 A;  3WOD G;  2XSH B;  4EYC A;  1VQO 3;  1VQ7 3;  2FGT A;  1M90 4;  4H61 A;  1OF5 B;  2YFL B;  1BAN A;  2AAE A;  4TX4 A;  5DRV A;  2R4I A;  3OW2 2;  2K0M A;  1GYB A;  4NRE A;  1AY7 A;  1BRK A;  3S5C A;  3LTA A;  5CLK A;  1Q7Y 4;  1OUN A;  3M8C A;  5EQL A;  2IYJ A;  3S67 A;  2KF4 A;  2Z7A A;  3OWY A;  1W5Z A;  2H0G A;  3EN1 B;  4FR9 A;  4HVN A;  1WQL B;  1YJW 3;  1FA3 A;  1IVW A;  2W9P A;  1FGM A;  2H0H A;  2OOV A;  2XGN A;  1C7H A;  1FGQ A;  2STD A;  1Y4K A;  1RN7 A;  2Y73 A;  2HML B;  3CNX A;  5BVB A;  3IMA B;  3UL6 A;  1BUQ A;  2W56 B;  3DY5 A;  3OXA A;  4X2O A;  2F4Y A;  1RGE A;  3E99 A;  1LOV A;  4IPB A;  3QRD A;  2WOH A;  5BU4 A;  4HM7 B;  3CPW 2;  2GU3 A;  2BO9 B;  3RGR A;  1ROV A;  1JB4 A;  1A90 A;  5GSP A;  2LYX A;  3S29 A;  2CX1 A;  2FNQ A;  6RNT A;  5I97 A;  4FMC A;  3DMC A;  4IT7 A;  4FMA A;  2ZHX B;  1JBT A;  1BSA A;  2INX A;  3B4O A;  3AHW A;  3GZY B;  4ILF A;  3SVA A;  3SYU A;  1KQS 2;  1LVN A;  1VQL 3;  1DE3 A;  1TU5 A;  5AIH A;  2I9W A;  3NQY A;  3SOY A;  3X3Y A;  1W6G A;  4MJD A;  3NUV A;  1NNV A;  4QWT A;  4XBT A;  2XF3 A;  3BNE A;  4HZ9 B;  1LOX A;  1AVL A;  5KP4 A;  1D6U A;  3DGY A;  4O02 B;  3O8Y A;  5FGO A;  1D6Y A;  1ZS7 A;  1FUW A;  1NDO B;  2QIY A;  2B1X B;  4HOH A;  1X1Y A;  1UI8 A;  1ZO2 A;  5EEO A;  1RKY A;  1J2B A;  4LZI A;  4R80 A;  3NXJ A;  3FCS B;  3F8H A;  3S27 A;  1RNB A;  3CCE 3;  4XM4 A;  3KSE D;  2CW9 A;  2F56 A;  1LQG C;  2OTJ 3;  1UUV B;  1CYU A;  2OWP A;  3F8X A;  4BTX A;  4HM1 B;  3FZW A;  1BU4 A;  1RDS A;  2PNC A;  3KN4 A;  1UCI A;  1E97 A;  1EEJ A;  2LQV A;  3JUP A;  3K63 A;  1AQZ A;  3LML A;  3N8B A;  1YI2 3;  2CHC A;  1BNG A;  3J7Y d;  3CCL 3;  1VQ4 3;  4HYZ A;  1IK3 A;  2SBL A;  1O7H B;  3ROB A;  1X1X A;  3LTC A;  3EB8 A;  1DET A;  1SAR A;  3DZL A;  2WOF A;  3TDG A;  4XDW A;  4BTY A;  2F98 A;  2CFK A;  3A76 A;  9RNT A;  1TRP A;  3K7C A;  1DMQ A;  1JJ2 2;  4BL3 A;  3Q3F A;  2W0Q A;  1W7C A;  2OCT A;  3K0Z A;  3NV0 A;  1RRH A;  1RN4 A;  3G6E 3;  1NWW A;  3N9H A;  1K9M 4;  1G0T A;  1W02 A;  1S5A A;  3D3L A;  3PYJ A;  2UGI A;  1UGH I;  5IG4 A;  1VQK 3;  3EBT A;  5TGN A;  1Q86 4;  1ULJ B;  3LT8 A;  4LSO A;  4XBY A;  1IVV A;  1JZO A;  2WGO A;  1B2M A;  1IQY A;  1JB2 A;  2IY2 A;  1YVB I;  2WGQ A;  1MWR A;  3X41 A;  5KP1 A;  4G1M B;  4LYL B;  4R4K A;  1OHS A;  1STF I;  1UDI I;  2KF3 A;  1YGW A;  3CNM A;  3F14 A;  3KE7 A;  4K90 B;  1HZ1 A;  3T8U A;  2CWU A;  3B7C A;  3A5E A;  3CCS 3;  1PFP A;  1EQK A;  3I0Y A;  3CPO A;  1NU3 A;  1QVG 2;  3HII A;  5CF2 A;  1WMO A;  3NM7 A;  3WMD A;  1A2K A;  1Q42 A;  1BNI A;  4HAA A;  1A2P A;  1JN5 B;  4FCM A;  1TJD A;  2P09 A;  3U97 A;  4HM8 B;  2RGQ A;  4BU4 A;  1BNS A;  1B3S A;  1B20 A;  1GY7 A;  1IT8 A;  1TIJ A;  4GSP A;  1OF5 A;  3X40 A;  1RGG A;  4N6N B;  1RSN A;  5ELJ A;  3DUK A;  3G4S 3;  5HGR A;  1T5Y A;  2L1S A;  2W56 A;  1FGO A;  2XFS A;  4J5K A;  1W6Y A;  4GL6 A;  1KD1 4;  3WA2 X;  1GY5 A;  4MEI A;  2R41 A;  1BGS A;  2HMJ B;  3MWZ A;  2BHM A;  3DH2 A;  1Q40 B;  1YNV X;  3KFQ C;  4O8S A;  5IG0 A;  2BU4 A;  5IF6 A;  4ORL A;  4FMB A;  2V1L A;  5LC7 A;  3D5I A;  3PCR A;  3QK9 A;  1SII A;  1RLS A;  1W01 A;  5STD A;  1L5G B;  4CPK A;  3NHX A;  5JBS A;  2XEP A;  1N8R 4;  1BNJ A;  6STD A;  1VQP 3;  4N6T A;  2CG0 A;  1PY3 A;  2P38 A;  1Q9E A;  2BMR B;  3FSD A;  2B24 B;  5JPU A;  1B2U A;  2IMJ A;  4HM4 B;  3NBB A;  1TRQ A;  5JPP A;  2KRT A;  3DXO A;  5G1K A;  1QAL A;  1KC8 4;  1BNF A;  4CCV A;  4WYK A;  4HJL B;  2YFJ B;  2M7O A;  3X42 A;  1BRI A;  3OX9 A;  3ZG0 A;  2CIU A;  3KSP A;  1IQX A;  3BU4 A;  1BRS A;  1CYV A;  1GD3 A;  2YX9 A;  3D79 A;  3JVC A;  4MMZ B;  3K9M C;  2E2T A;  2UX0 A;  1QAF A;  3NQZ A;  3T0U A;  5AI1 A;  1LNI A;  1UCK A;  2CFG A;  4OVM A;  3RGA A;  1BRJ A;  7STD A;  3FH1 A;  1CH0 A;  1B27 A;  1I8V A;  3MHE A;  1T2I A;  3EBY A;  2Z77 A;  4WFO A;  1IV7 A;  3CC2 3;  5M18 A;  1RN1 A;  1UUG B;  4XDV A;  3LOY A;  2XGL A;  3LZA A;  1DYU A;  2CFL A;  2KCD A;  3BLZ A;  1YGE A;  4FCJ A;  1RJO A;  1UGI A;  1DVC A;  4CJN A;  4XBX A;  1I0X A;  1WMN A;  3AGN A;  3KCH A;  1U5O A;  2HMK B;  1B21 A;  3IPT A;  1VQM 3;  1WTH A;  1OPY A;  1I3I A;  1GOU A;  4LMI A;  1RCL A;  1N5P A;  2GBX B;  3AHS A;  2W9Q A;  2CKF B;  3CCQ 3;  3LTB A;  1OGX A;  1IYY A;  1BAO A;  1VQ8 3;  5ELU A;  3Q90 A;  1G96 A;  3MSO A;  1UI7 A;  5LC6 A;  3CC4 3;  1RMS A;  1MWT A;  1A2V A;  4L7K A;  3GRD A;  1BSC A;  3CD6 3;  2BNG A;  2ML6 A;  1ROA A;  2RCD A;  3RDE A;  4LEH A;  1BVI A;  1NJI 4;  4I4K A;  2KF5 A;  1V57 A;  2CWT A;  1Q7H A;  3SXX A;  1O7M B;  1BRH A;  1GMR A;  1RHL A;  2IUK A;  2CWV A;  1FZU A;  1ZGX A;  1SPU A;  1YHQ 3;  1VZZ A;  3NM2 A;  4R9L A;  2GEY A;  3OV4 A;  3GZR A;  3LXU X;  4BL2 A;  3DGN A;  3ZG5 A;  1MWS A;  1SJW A;  1JRQ A;  1IV9 A;  1M1K 4;  2RSX A;  1TFK A;  3DM8 A;  4X2H A;  2ML5 A;  1QVF 2;  3G71 3;  1RTU A;  3LH4 A;  3OWS A;  3UL5 A;  5A0O B;  1YJ9 3;  4CDL A;  1JB5 A;  2C11 A;  3V98 A;  2L4V A;  2RFR A;  2IUJ A;  3U1W A;  1VQN 3;  3UNL A;  1QMA A;  4O3V A;  3CCM 3;  3JUM A;  2OOV C;  3B8L A;  4OUQ A;  4N6U A;  4KVH A;  4I5Q A;  1HU9 A;  2CX0 A;  4RNT A;  3SED A;  2XRX B;  1BIR A;  1EKM A;  1TFO A;  2ZL8 A;  4IIA A;  5BIR A;  1FW7 A;  1NO3 A;  3FG3 A;  4WYK B;  3SOA A;  1LOY A;  3FG4 A;  2KF6 A;  4MMX B;  3RNT A;  4K1U A;  2KXG A;  3CU3 A;  3G0K A;  4R9K A;  5AEW B;  5IER A;  3GAX A;  3PXM A;  3GSP A;  3D9R A;  1DVD A;  1RGF A;  1E3V A;  1IVU A;  5CK6 A;  3LTD A;  1OGZ A;  2P0M A;  1FYS A;  2GU1 A;  1PYL A;  5FW5 A;  1ASK A;  3WOF B;  3JUO A;  3NBR A;  5D81 A;  2MC8 A;  1VQ6 3;  2CFW A;  3WOE B;  3JUN A;  1X1W A;  3G16 A;  8RNT A;  1HKX A;  1TUH A;  4KFF A;  1I2G A;  1GMP A;  1V74 A;  1M9G A;  3WR2 A;  1KWI A;  3VGN A;  1TTO A;  3ER7 A;  5CXO A;  1RGK A;  1IU7 A;  3HZP A;  1OHO A;  1N9J A;  2IA7 A;  2K54 A;  5M1A A;  5BXQ A;  3BB9 A;  3CMA 3;  3WDG B;  1BRN L;  4J5G A;  1EG9 B;  2HOH A;  5AYS C;  4HM2 B;  4BIR A;  4EV5 A;  3WHO A;  3HOH A;  1JN5 A;  1IT7 A;  5AEU B;  2E2U A;  3KII A;  4GB5 A;  4LGQ A;  5CF1 A;  2CG1 A;  1K28 A;  2OQE C;  3B4P A;  1UCL A;  3FF0 A;  3ZFZ A;  3I55 3;  1JBS A;  4BTW A;  1GD4 A;  2H0I A;  1B2S A;  2C4B A;  4GHO A;  1IQ8 A;  4HBR A;  5AII A;  5IEP A;  2XR8 B;  3T8N A;  2HMM B;  4J9A A;  1LXE A;  1IDP A;  2RBI A;  3SLU A;  3STD A;  4N6M A;  3V99 A;  2SAR A;  1W2B 2;  3UB1 A;  4RNZ A;  3UJM A;  4WP5 A;  3F7X A;  3N54 B;  4O2H A;  8CHO A;  5RNT A;  7RNT A;  5D83 A;  1YIJ 3;  4NHF A;  3NV0 B;  1BSD A;  1EA2 A;  3ALA A;  2MF7 A;  1ZX2 A;  1VQ9 3;  1O7N B;  4FCZ A;  3EHC A;  1STD A;  4EW5 A;  2W03 A;  3EE1 A;  3URP A;  5M19 A;  1BOX A;  3EC9 A;  3H3H A;  4KFD A;  2WO0 A;  2D42 A;  1UUW B;  2A15 A;  1UW1 A;  4N6V 0;  2GXF A;  2Z76 A;  1AV4 A;  1KSI A;  3F40 A;  2F86 B;  4WHA A;  5IEN A;  1B2Z A;  2W2C A;  1G02 A;  5HOH A;  4HM0 B;  3FGY A;  4K1V A;  1A67 A;  1E3R A;  1PU4 A;  1M1X B;  2OTL 3;  1TP6 A;  2K3D A;  2YFI B;  3HI7 A;  1GMQ A;  1W4N A;  4HM5 B;  1DMN A;  3D5G A;  2QEX 3;  4EV2 A;  3LT9 A;  3EX9 A;  2CC3 A;  1RNT A;  5G1L A;  1JV2 B;  4FMD A; 
#chains in the Genus database with same CATH homology
 2J8X B;  2UGI A;  1UGI A;  1UGH I;  4LYL B;  2ZHX B;  1UUG B;  1UDI I;  1EUI C;  1LQG C;  1LQM B;  2UUG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...