4LYLB

Crystal structure of uracil-dna glycosylase from cod (gadus morhua) in complex with the proteinaceous inhibitor ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
publication title Structural and biophysical analysis of interactions between cod and human uracil-DNA N-glycosylase (UNG) and UNG inhibitor (Ugi).
pubmed doi rcsb
source organism Gadus morhua
total genus 16
structure length 82
sequence length 82
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2013-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 4lylB00
1LQGC 2UGIA 1UGHI 2UUGC 2ZHXB 4LYLB 1UDII 1EUIC 1LQMB 2J8XB 1UUGB 1UGIA
chains in the Genus database with same CATH superfamily
3Q90A 1K734 3EE1A 4HM2B 2Z76A 1GD3A 4LEHA 4WHAA 3URPA 5AEWB 3KSED 2OTL3 3EF8A 4N6MA 4HM0B 2C4BA 1JN5A 1QMAA 3SOYA 1OGZA 1FZUA 2RBIA 4NREA 3SYUA 1GY7A 4BL3A 1IT7A 1TRQA 4OUQA 3JUOA 3K5TA 5JPUA 4TX4A 3UL5A 1RSNA 1VZZA 5BXQA 2WGOA 1K9M4 1YIT3 3NX0A 4FR9A 3MG2A 1QJGA 2Q07A 3B4PA 3ER7A 5JPPA 1VQK3 2HMOB 2W03A 2KAAA 4KFEA 1U8CB 2RGQA 4QWTA 3FG1A 1US1A 3SX1A 3D5GA 1ULJB 1BRKA 1C54A 2P0XA 5HOHA 3UNLA 5STDA 7RNTA 2Y74A 1OF5B 1BRIA 1EA2A 2KF6A 2XRXB 2R4IA 5IF6A 4O3VA 1I2GA 1JJ22 5IG0A 3HOHA 1YJW3 5A0OB 2P38A 1B2MA 1DVDA 3MWZA 1TU5A 1BRGA 1RCKA 2CH9A 1Q7HA 1FYSA 1O7HB 1M1K4 3GRDA 1KC84 1Q40A 1BNIA 2INXA 3U1WA 1BSCA 3KFQC 1SIHA 4H3UA 4ORLA 3DGLA 5CLKA 2QGUA 2P05A 3DGOA 3V99A 4WYKB 2R41A 3RNTA 3DMCA 1DYUA 1B20A 4KVHA 4K1UA 1W00A 4BIRA 1ULIB 1FUWA 3N54B 2IMJA 4AKZA 2MF7A 1W6YA 2CFGA 1LOVA 3M8CA 1RTUA 3V92A 2B1XB 1FGTA 1IVWA 1BNGA 5M19A 1LRAA 1UI8A 1N8QA 4ZM8A 2F86B 3FGYA 1ZGXA 1UDII 2W0QA 2CK3H 1JB4A 3QRDA 2BO9B 5DREA 2UGIA 3DGMA 1GMQA 1L5GB 2WOHA 4HM7B 4J9AA 1TP6A 3KSPA 3PGBA 3AMOA 3WMDA 2OOVC 4J5GA 4HZBB 3F8XA 3PS8A 1VQO3 5DRVA 1BSDA 1I2FA 1IU7A 3L0RA 1RGAA 3I0YA 3K0ZA 3HX8A 4FMCA 4N6V0 5EVHA 1VQ53 1D6YA 1GS3A 2XSOB 4N6UA 1OH0A 1MWRA 3CNXA 3G0KA 3UB1A 3T8UA 1D6ZA 2GEXA 1LQMB 3UL6A 4AKYA 3EB8A 3U97A 5IG5A 3JUMA 4X2HA 3WA2X 2ZHXB 3VGNA 4BTYA 1LVNA 4XM4A 1FW7A 4KFDA 3N9HA 3Q3FA 3CMA3 2F5MA 3JUNA 5AIGA 3S27A 2LYXA 2C11A 3CCL3 3FKAA 4KFFA 2KXGA 2ML6A 2K3DA 1UUGB 3SEDA 5IEOA 4EC6A 4CPKA 5M18A 4WP5A 5AI1A 1C7HA 1RHLA 1V74A 3GZXB 1A2PA 1RGGA 5IEPA 4HBRA 3KIIA 1HYFA 5G1LA 1V58A 7STDA 2JDIH 1WQLB 1RKYA 4NPBA 1B2XA 1JKGA 4MMXB 3X3YA 3FH1A 3NHXA 4LZIA 1RGKA 8RNTA 3GWRA 4Q53A 3CCQ3 3BNDA 1OPYA 2RFRA 2SBLA 1MGRA 3GZRA 3OV4A 3PCSA 1RN1A 2IY2A 2XEPA 3D79A 3FF0A 4MEIA 4BL2A 3LYGA 5CF2A 1JB2A 1GY5A 2YFJB 3AGOA 1PY3A 3CXC2 3X42A 1TTOA 3I563 2STDA 1DVCA 2W9QA 1YI23 1IVUA 3MG3A 2MC8A 3LT8A 1Z1SA 1GD4A 3HIGA 1I3FA 2HMKB 4R9LA 5KP1A 1UI7A 3FZWA 3BU4A 4HM3B 1I70A 1MOLA 2O3OA 2OWPA 5D82A 1FGMA 2KCDA 2CG0A 1BU4A 1O7PB 3D9RA 3DM8A 3GZYB 2UUGC 1Q9EA 1FGOA 5RNTA 3LT9A 2QA43 1JBSA 1Q824 3SOAA 1VQ93 2ZL8A 4IPBA 1PYLA 2CX0A 3NM7A 4HM4B 4BU4A 4WWUC 1IQYA 4GL6A 5EEOA 1RMSA 4HVNA 3WHOA 1D6UA 4R80A 1RGLA 3CC23 1N5HA 4XBXA 2PNCA 4KT3B 1O7GB 2Z77A 1YVBI 4STDA 1OHPA 3I553 2OQEC 3NBBA 3RGRA 1A2VA 4XB5A 1KD14 4N3VA 1KWIA 3NBJA 4DKIA 1G96A 4H61A 4XBTA 3JVCA 1K8A4 1BNFA 4R1KA 3VSYA 1GOUA 3NBRA 1M9GA 2HMLB 2GU1A 1OUNA 2YX9A 5BU4A 1VQM3 1IYYA 1Q40B 1JBRA 4I5QA 1B2UA 5IW9A 3LTAA 3DH2A 3DXOA 5CXOA 3CD63 2CIUA 1Q42A 4NHFA 4CDLA 2W6JH 2HMNB 1DMNA 3MKIA 1KSIA 1A2KA 2FXTA 3LTDA 3NM2A 4K1VA 3WR2A 3S67A 1QALA 3KKGA 3K9MC 3LXUX 1BSAA 4J8TA 1B27A 2HMMB 1ROVA 3A5EA 3NUVA 2CX1A 1Q814 3FG4A 3EN8A 1CYVA 1FGQA 1ZO2A 2CWUA 1LOWA 4RBNA 3WOFB 1V57A 3F9SA 1JZOA 1BRNL 3IMAB 1W7CA 4I4KA 5AIFA 2IUJA 3CME3 3CPW2 1OHSA 3IPTA 1BNSA 1OF5A 2KF3A 2PZVA 2Y73A 3NV0B 5EQLA 1UUVB 5ELUA 1AVLA 1G02A 1CYUA 2RNTA 2K0MA 3F7XA 4MMZB 5M1AA 3LTBA 1RLSA 2XR8B 3G6E3 3OWYA 1NNVA 1Y4KA 2O9UX 4L8PA 3CCV3 3IJEB 1Q7Y4 1I0XA 3CC73 1GMRA 3DUKA 1U5OA 1BNEA 4RNZA 5KP4A 1EEJA 3B7CA 2CWVA 4FCMA 1M904 4FCJA 2H0HA 1B21A 1VQL3 1E3VA 1E3RA 1NU3A 3KN4A 1BGSA 1MNLA 3A76A 2RSXA 2WOFA 3LZAA 1JV2B 1S723 1S5AA 1RNTA 4HM8B 4N6TA 1X1XA 2OOVA 3FF2A 1RDSA 4EW5A 1A67A 2IYJA 2H0IA 3Q1CA 3AHWA 5FW5A 1B2ZA 5IG3A 3T8NA 1W5ZA 1AY7A 1MWTA 3LTCA 1GSPA 2ML5A 2M7OA 1WMNA 1NO3A 3KCHA 3MG1A 2XFSA 1IV7A 1PFPA 5G1KA 1T5YA 3ROBA 5HGRA 2CC3A 2F99A 1JB5A 1TJDA 3FCSB 2AAEA 5FGOA 5D81A 1HU9A 2CHCA 2I9WA 5G2GA 2QEX3 1JZDA 3UJMA 1X1YA 4N6LA 4FMDA 2F98A 3WOEB 3HZPA 3WODG 2WO0A 2AADA 2W04A 1GOVA 1SJWA 3EJVA 3F8HA 3CCS3 1I3IA 1SQWA 2BU4A 2XGLA 1W6CA 3JUQA 4HKVB 2CG1A 1PU4A 1WMPA 2RCDA 1W4NA 3D4AA 1BRHA 1SIIA 1T3BA 4RZMA 3HIIA 2CWTA 2A15A 5IENA 2XH9A 5BVBA 1B2SA 2FGTA 1ZS7A 4IT7A 1VQN3 3X3ZA 2W56A 2W9PA 1AR0A 2UX0A 4ILFA 1GMPA 4OVMA 4GB5A 2BIRA 1FGRA 4K61A 5AYSC 1BSEA 1RCLA 2KRTA 1MWSA 4LSOA 6GSPA 1UCKA 2GU3A 3CCJ3 1STFI 1YVSA 5CF1A 3B8LA 1VQ73 4FMBA 1TFOA 3G16A 1MGWA 3G8ZA 3OWUA 4N6OB 1FUTA 1UCJA 1UUWB 1JN5B 1RGCA 2E2TA 1B3SA 2GBWB 1BIRA 1JBTA 1VQ63 1F8NA 2BMRB 1WNHA 3BIRA 3PXMA 2BT3A 3F14A 3MPHA 3CC43 3J7Yd 1BSBA 1HKXA 3K7CA 1E97A 3EN1B 3QK9A 2W2CA 1VQ83 1LQGC 2HMJB 1YNVX 1X1UA 2GSPA 1DMQA 1W02A 3ECFA 3OWSA 1BNRA 1JNQA 2YFIB 4O2HA 4JF8A 1CQSA 1EKMA 3CNMA 1RGEA 1STDA 2P0MA 3ZG5A 5AEUB 3CCR3 1WMOA 4RNTA 1YJN3 4HM6B 3CCU3 1BOXA 1BAOA 1RGHA 3DGNA 1G0TA 1O7MB 1KQS2 1N9EA 1N8R4 3EHCA 4EYCA 1IQ8A 7GSPA 3T0UA 1QAFA 1ZX2A 1M1XB 2ZA4A 3VF1A 1LXEA 2KF4A 4X2OA 1YGWA 3H51A 4N6NB 3NXJA 3KZTA 1JRQA 1RJOA 1DETA 1YJ93 4MMYB 4XBYA 2OQEA 2BNGA 3D3LA 5LC6A 3SVAA 1ASKA 1CH0A 3EX9A 1IV9A 2IUKA 3PCRA 4LGQA 4MJDA 4XDWA 5IERA 3CU3A 1GOYA 4EXRA 1X1WA 1TUHA 3ZG0A 1BUQA 2SARA 6STDA 3STDA 3BLZA 3H3HA 1UGHI 2L1SA 1QVF2 5AIIA 5GSPA 1RGFA 4J5KA 2V1LA 2H0GA 3D5IA 1I0VA 4HYZA 2D42A 1BNJA 2YFLB 4LYLB 3HK4A 2HOHA 9RNTA 3N8BA 1W2B2 4BTWA 3G4S3 4HM5B 4IIAA 5AYRB 4CJNA 1IK3A 1CEWI 1I2EA 3AMOB 3BNEA 2QIYA 1IT8A 1RN7A 4EBGA 3RGAA 1TRPA 4HAAA 3FLJA 1QVG2 4EV2A 1DMMA 1BVIA 2C10A 5AIHA 2JQ5A 2XGNA 1DE3A 2GXFA 2F5WA 1UW1A 4K90B 4WYKA 1LOYA 4AEQA 1VQ43 2BMOB 1UCIA 3EBTA 1OCVA 5ELJA 3SXXA 1R4YA 2D1WA 2OCTA 1SARA 3O8YA 3DGYA 3BNCA 3GSPA 3S29A 1OHOA 3PYJA 4G1MB 4HJLB 4JRFA 1LOXA 2XFTA 3TDGA 1IVXA 3KE7A 3BB9A 4PEJA 2B24B 2CFWA 1W6GA 4O8SA 1K41A 3NV0A 1YHQ3 2P09A 1HZ1A 1YGEA 3V98A 1EQKA 2F4YA 1LNIA 3HI7A 1ROAA 3S5CA 3LMLA 4CCVA 5CK6A 1Q864 3DY5A 2CFDA 5LC7A 3CPOA 3JUPA 4FMAA 1IVVA 2GEYA 2Z7AA 1LNHA 3LH4A 4R9KA 4WFOA 1N5PA 1NWWA 3G713 1VQP3 1T2IA 1QAKA 1OGXA 1RN4A 2BHMA 2E2VA 3NQYA 3BNBA 3OXAA 1EG9B 2WGQA 2CKFB 1JKGB 1OACA 3ALAA 4FCZA 4RNYA 4HM1B 3MHEA 1O7NB 1SPUA 5I97A 3AHSA 2CFLA 5BIRA 3B4OA 1FA3A 1O7WB 1K28A 1BRJA 1W2ZA 2LQVA 1WTHA 3WA3A 4O02B 1NB3I 3AGNA 5TGNA 3FG3A 1TFKA 2W56B 3DZLA 3NQZA 5KP3A 3WDGB 4LMIA 3X41A 1YIJ3 2ZDJA 1NJI4 3MYTA 1RRLA 3SLUA 8CHOA 2F56A 3K63A 4L8OA 4KZ1A 3RDEA 3X40A 1RNBA 3PZWA 1MWUA 1ISKA 1NB5I 1NDOB 4HOHA 1BANA 3X3XA 1BRSA 1GYBA 1IQXA 1AQZA 2CW9A 1IDPA 1FUSA 2XSHB 3OW22 3ZFZA 3EQQB 4R4KA 3FSDA 4OK0A 4L7KA 1VQQA 3GZBA 3S28A 1J2BA 1W01A 3CCE3 3Q2PA 4HZ9B 3CCM3 1I8VA 3F7SA 3MSOA 4BTXA 2K54A 2J8XB 1TIJA 3E99A 2GBXB 2FNQA 1RRHA 3EC9A 1UGIA 4GHOA 2OTJ3 5D83A 1A90A 3LOYA 1UCLA 6RNTA 3OX9A 1GY6A 2BMQB 2L4VA 2E2UA 3EBYA 3GAXA 1BUJA 5JBSA 4XDVA 2XF3A 1AV4A 1N9JA 1R4CA 3F40A 5IG4A 1AVKA 1EUIC 4EV5A 2CFKA 2KF5A 4GSPA 4U13A 2IA7A 1T2HA 2Z6BA
chains in the Genus database with same CATH topology
1LQGC 2UGIA 1UGHI 2UUGC 2ZHXB 4LYLB 1UDII 1EUIC 1LQMB 2J8XB 1UUGB 1UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQG C;  2UGI A;  1UGH I;  2UUG C;  2ZHX B;  4LYL B;  1UDI I;  1EUI C;  1LQM B;  2J8X B;  1UUG B;  1UGI A; 
#chains in the Genus database with same CATH topology
 3Q90 A;  1K73 4;  3EE1 A;  4HM2 B;  2Z76 A;  1GD3 A;  4LEH A;  4WHA A;  3URP A;  5AEW B;  3KSE D;  2OTL 3;  3EF8 A;  4N6M A;  4HM0 B;  2C4B A;  1JN5 A;  1QMA A;  3SOY A;  1OGZ A;  1FZU A;  2RBI A;  4NRE A;  3SYU A;  1GY7 A;  4BL3 A;  1IT7 A;  1TRQ A;  4OUQ A;  3JUO A;  3K5T A;  5JPU A;  4TX4 A;  3UL5 A;  1RSN A;  1VZZ A;  5BXQ A;  2WGO A;  1K9M 4;  1YIT 3;  3NX0 A;  4FR9 A;  3MG2 A;  1QJG A;  2Q07 A;  3B4P A;  3ER7 A;  5JPP A;  1VQK 3;  2HMO B;  2W03 A;  2KAA A;  4KFE A;  1U8C B;  2RGQ A;  4QWT A;  3FG1 A;  1US1 A;  3SX1 A;  3D5G A;  1ULJ B;  1BRK A;  1C54 A;  2P0X A;  5HOH A;  3UNL A;  5STD A;  7RNT A;  2Y74 A;  1OF5 B;  1BRI A;  1EA2 A;  2KF6 A;  2XRX B;  2R4I A;  5IF6 A;  4O3V A;  1I2G A;  1JJ2 2;  5IG0 A;  3HOH A;  1YJW 3;  5A0O B;  2P38 A;  1B2M A;  1DVD A;  3MWZ A;  1TU5 A;  1BRG A;  1RCK A;  2CH9 A;  1Q7H A;  1FYS A;  1O7H B;  1M1K 4;  3GRD A;  1KC8 4;  1Q40 A;  1BNI A;  2INX A;  3U1W A;  1BSC A;  3KFQ C;  1SIH A;  4H3U A;  4ORL A;  3DGL A;  5CLK A;  2QGU A;  2P05 A;  3DGO A;  3V99 A;  4WYK B;  2R41 A;  3RNT A;  3DMC A;  1DYU A;  1B20 A;  4KVH A;  4K1U A;  1W00 A;  4BIR A;  1ULI B;  1FUW A;  3N54 B;  2IMJ A;  4AKZ A;  2MF7 A;  1W6Y A;  2CFG A;  1LOV A;  3M8C A;  1RTU A;  3V92 A;  2B1X B;  1FGT A;  1IVW A;  1BNG A;  5M19 A;  1LRA A;  1UI8 A;  1N8Q A;  4ZM8 A;  2F86 B;  3FGY A;  1ZGX A;  1UDI I;  2W0Q A;  2CK3 H;  1JB4 A;  3QRD A;  2BO9 B;  5DRE A;  2UGI A;  3DGM A;  1GMQ A;  1L5G B;  2WOH A;  4HM7 B;  4J9A A;  1TP6 A;  3KSP A;  3PGB A;  3AMO A;  3WMD A;  2OOV C;  4J5G A;  4HZB B;  3F8X A;  3PS8 A;  1VQO 3;  5DRV A;  1BSD A;  1I2F A;  1IU7 A;  3L0R A;  1RGA A;  3I0Y A;  3K0Z A;  3HX8 A;  4FMC A;  4N6V 0;  5EVH A;  1VQ5 3;  1D6Y A;  1GS3 A;  2XSO B;  4N6U A;  1OH0 A;  1MWR A;  3CNX A;  3G0K A;  3UB1 A;  3T8U A;  1D6Z A;  2GEX A;  1LQM B;  3UL6 A;  4AKY A;  3EB8 A;  3U97 A;  5IG5 A;  3JUM A;  4X2H A;  3WA2 X;  2ZHX B;  3VGN A;  4BTY A;  1LVN A;  4XM4 A;  1FW7 A;  4KFD A;  3N9H A;  3Q3F A;  3CMA 3;  2F5M A;  3JUN A;  5AIG A;  3S27 A;  2LYX A;  2C11 A;  3CCL 3;  3FKA A;  4KFF A;  2KXG A;  2ML6 A;  2K3D A;  1UUG B;  3SED A;  5IEO A;  4EC6 A;  4CPK A;  5M18 A;  4WP5 A;  5AI1 A;  1C7H A;  1RHL A;  1V74 A;  3GZX B;  1A2P A;  1RGG A;  5IEP A;  4HBR A;  3KII A;  1HYF A;  5G1L A;  1V58 A;  7STD A;  2JDI H;  1WQL B;  1RKY A;  4NPB A;  1B2X A;  1JKG A;  4MMX B;  3X3Y A;  3FH1 A;  3NHX A;  4LZI A;  1RGK A;  8RNT A;  3GWR A;  4Q53 A;  3CCQ 3;  3BND A;  1OPY A;  2RFR A;  2SBL A;  1MGR A;  3GZR A;  3OV4 A;  3PCS A;  1RN1 A;  2IY2 A;  2XEP A;  3D79 A;  3FF0 A;  4MEI A;  4BL2 A;  3LYG A;  5CF2 A;  1JB2 A;  1GY5 A;  2YFJ B;  3AGO A;  1PY3 A;  3CXC 2;  3X42 A;  1TTO A;  3I56 3;  2STD A;  1DVC A;  2W9Q A;  1YI2 3;  1IVU A;  3MG3 A;  2MC8 A;  3LT8 A;  1Z1S A;  1GD4 A;  3HIG A;  1I3F A;  2HMK B;  4R9L A;  5KP1 A;  1UI7 A;  3FZW A;  3BU4 A;  4HM3 B;  1I70 A;  1MOL A;  2O3O A;  2OWP A;  5D82 A;  1FGM A;  2KCD A;  2CG0 A;  1BU4 A;  1O7P B;  3D9R A;  3DM8 A;  3GZY B;  2UUG C;  1Q9E A;  1FGO A;  5RNT A;  3LT9 A;  2QA4 3;  1JBS A;  1Q82 4;  3SOA A;  1VQ9 3;  2ZL8 A;  4IPB A;  1PYL A;  2CX0 A;  3NM7 A;  4HM4 B;  4BU4 A;  4WWU C;  1IQY A;  4GL6 A;  5EEO A;  1RMS A;  4HVN A;  3WHO A;  1D6U A;  4R80 A;  1RGL A;  3CC2 3;  1N5H A;  4XBX A;  2PNC A;  4KT3 B;  1O7G B;  2Z77 A;  1YVB I;  4STD A;  1OHP A;  3I55 3;  2OQE C;  3NBB A;  3RGR A;  1A2V A;  4XB5 A;  1KD1 4;  4N3V A;  1KWI A;  3NBJ A;  4DKI A;  1G96 A;  4H61 A;  4XBT A;  3JVC A;  1K8A 4;  1BNF A;  4R1K A;  3VSY A;  1GOU A;  3NBR A;  1M9G A;  2HML B;  2GU1 A;  1OUN A;  2YX9 A;  5BU4 A;  1VQM 3;  1IYY A;  1Q40 B;  1JBR A;  4I5Q A;  1B2U A;  5IW9 A;  3LTA A;  3DH2 A;  3DXO A;  5CXO A;  3CD6 3;  2CIU A;  1Q42 A;  4NHF A;  4CDL A;  2W6J H;  2HMN B;  1DMN A;  3MKI A;  1KSI A;  1A2K A;  2FXT A;  3LTD A;  3NM2 A;  4K1V A;  3WR2 A;  3S67 A;  1QAL A;  3KKG A;  3K9M C;  3LXU X;  1BSA A;  4J8T A;  1B27 A;  2HMM B;  1ROV A;  3A5E A;  3NUV A;  2CX1 A;  1Q81 4;  3FG4 A;  3EN8 A;  1CYV A;  1FGQ A;  1ZO2 A;  2CWU A;  1LOW A;  4RBN A;  3WOF B;  1V57 A;  3F9S A;  1JZO A;  1BRN L;  3IMA B;  1W7C A;  4I4K A;  5AIF A;  2IUJ A;  3CME 3;  3CPW 2;  1OHS A;  3IPT A;  1BNS A;  1OF5 A;  2KF3 A;  2PZV A;  2Y73 A;  3NV0 B;  5EQL A;  1UUV B;  5ELU A;  1AVL A;  1G02 A;  1CYU A;  2RNT A;  2K0M A;  3F7X A;  4MMZ B;  5M1A A;  3LTB A;  1RLS A;  2XR8 B;  3G6E 3;  3OWY A;  1NNV A;  1Y4K A;  2O9U X;  4L8P A;  3CCV 3;  3IJE B;  1Q7Y 4;  1I0X A;  3CC7 3;  1GMR A;  3DUK A;  1U5O A;  1BNE A;  4RNZ A;  5KP4 A;  1EEJ A;  3B7C A;  2CWV A;  4FCM A;  1M90 4;  4FCJ A;  2H0H A;  1B21 A;  1VQL 3;  1E3V A;  1E3R A;  1NU3 A;  3KN4 A;  1BGS A;  1MNL A;  3A76 A;  2RSX A;  2WOF A;  3LZA A;  1JV2 B;  1S72 3;  1S5A A;  1RNT A;  4HM8 B;  4N6T A;  1X1X A;  2OOV A;  3FF2 A;  1RDS A;  4EW5 A;  1A67 A;  2IYJ A;  2H0I A;  3Q1C A;  3AHW A;  5FW5 A;  1B2Z A;  5IG3 A;  3T8N A;  1W5Z A;  1AY7 A;  1MWT A;  3LTC A;  1GSP A;  2ML5 A;  2M7O A;  1WMN A;  1NO3 A;  3KCH A;  3MG1 A;  2XFS A;  1IV7 A;  1PFP A;  5G1K A;  1T5Y A;  3ROB A;  5HGR A;  2CC3 A;  2F99 A;  1JB5 A;  1TJD A;  3FCS B;  2AAE A;  5FGO A;  5D81 A;  1HU9 A;  2CHC A;  2I9W A;  5G2G A;  2QEX 3;  1JZD A;  3UJM A;  1X1Y A;  4N6L A;  4FMD A;  2F98 A;  3WOE B;  3HZP A;  3WOD G;  2WO0 A;  2AAD A;  2W04 A;  1GOV A;  1SJW A;  3EJV A;  3F8H A;  3CCS 3;  1I3I A;  1SQW A;  2BU4 A;  2XGL A;  1W6C A;  3JUQ A;  4HKV B;  2CG1 A;  1PU4 A;  1WMP A;  2RCD A;  1W4N A;  3D4A A;  1BRH A;  1SII A;  1T3B A;  4RZM A;  3HII A;  2CWT A;  2A15 A;  5IEN A;  2XH9 A;  5BVB A;  1B2S A;  2FGT A;  1ZS7 A;  4IT7 A;  1VQN 3;  3X3Z A;  2W56 A;  2W9P A;  1AR0 A;  2UX0 A;  4ILF A;  1GMP A;  4OVM A;  4GB5 A;  2BIR A;  1FGR A;  4K61 A;  5AYS C;  1BSE A;  1RCL A;  2KRT A;  1MWS A;  4LSO A;  6GSP A;  1UCK A;  2GU3 A;  3CCJ 3;  1STF I;  1YVS A;  5CF1 A;  3B8L A;  1VQ7 3;  4FMB A;  1TFO A;  3G16 A;  1MGW A;  3G8Z A;  3OWU A;  4N6O B;  1FUT A;  1UCJ A;  1UUW B;  1JN5 B;  1RGC A;  2E2T A;  1B3S A;  2GBW B;  1BIR A;  1JBT A;  1VQ6 3;  1F8N A;  2BMR B;  1WNH A;  3BIR A;  3PXM A;  2BT3 A;  3F14 A;  3MPH A;  3CC4 3;  3J7Y d;  1BSB A;  1HKX A;  3K7C A;  1E97 A;  3EN1 B;  3QK9 A;  2W2C A;  1VQ8 3;  1LQG C;  2HMJ B;  1YNV X;  1X1U A;  2GSP A;  1DMQ A;  1W02 A;  3ECF A;  3OWS A;  1BNR A;  1JNQ A;  2YFI B;  4O2H A;  4JF8 A;  1CQS A;  1EKM A;  3CNM A;  1RGE A;  1STD A;  2P0M A;  3ZG5 A;  5AEU B;  3CCR 3;  1WMO A;  4RNT A;  1YJN 3;  4HM6 B;  3CCU 3;  1BOX A;  1BAO A;  1RGH A;  3DGN A;  1G0T A;  1O7M B;  1KQS 2;  1N9E A;  1N8R 4;  3EHC A;  4EYC A;  1IQ8 A;  7GSP A;  3T0U A;  1QAF A;  1ZX2 A;  1M1X B;  2ZA4 A;  3VF1 A;  1LXE A;  2KF4 A;  4X2O A;  1YGW A;  3H51 A;  4N6N B;  3NXJ A;  3KZT A;  1JRQ A;  1RJO A;  1DET A;  1YJ9 3;  4MMY B;  4XBY A;  2OQE A;  2BNG A;  3D3L A;  5LC6 A;  3SVA A;  1ASK A;  1CH0 A;  3EX9 A;  1IV9 A;  2IUK A;  3PCR A;  4LGQ A;  4MJD A;  4XDW A;  5IER A;  3CU3 A;  1GOY A;  4EXR A;  1X1W A;  1TUH A;  3ZG0 A;  1BUQ A;  2SAR A;  6STD A;  3STD A;  3BLZ A;  3H3H A;  1UGH I;  2L1S A;  1QVF 2;  5AII A;  5GSP A;  1RGF A;  4J5K A;  2V1L A;  2H0G A;  3D5I A;  1I0V A;  4HYZ A;  2D42 A;  1BNJ A;  2YFL B;  4LYL B;  3HK4 A;  2HOH A;  9RNT A;  3N8B A;  1W2B 2;  4BTW A;  3G4S 3;  4HM5 B;  4IIA A;  5AYR B;  4CJN A;  1IK3 A;  1CEW I;  1I2E A;  3AMO B;  3BNE A;  2QIY A;  1IT8 A;  1RN7 A;  4EBG A;  3RGA A;  1TRP A;  4HAA A;  3FLJ A;  1QVG 2;  4EV2 A;  1DMM A;  1BVI A;  2C10 A;  5AIH A;  2JQ5 A;  2XGN A;  1DE3 A;  2GXF A;  2F5W A;  1UW1 A;  4K90 B;  4WYK A;  1LOY A;  4AEQ A;  1VQ4 3;  2BMO B;  1UCI A;  3EBT A;  1OCV A;  5ELJ A;  3SXX A;  1R4Y A;  2D1W A;  2OCT A;  1SAR A;  3O8Y A;  3DGY A;  3BNC A;  3GSP A;  3S29 A;  1OHO A;  3PYJ A;  4G1M B;  4HJL B;  4JRF A;  1LOX A;  2XFT A;  3TDG A;  1IVX A;  3KE7 A;  3BB9 A;  4PEJ A;  2B24 B;  2CFW A;  1W6G A;  4O8S A;  1K41 A;  3NV0 A;  1YHQ 3;  2P09 A;  1HZ1 A;  1YGE A;  3V98 A;  1EQK A;  2F4Y A;  1LNI A;  3HI7 A;  1ROA A;  3S5C A;  3LML A;  4CCV A;  5CK6 A;  1Q86 4;  3DY5 A;  2CFD A;  5LC7 A;  3CPO A;  3JUP A;  4FMA A;  1IVV A;  2GEY A;  2Z7A A;  1LNH A;  3LH4 A;  4R9K A;  4WFO A;  1N5P A;  1NWW A;  3G71 3;  1VQP 3;  1T2I A;  1QAK A;  1OGX A;  1RN4 A;  2BHM A;  2E2V A;  3NQY A;  3BNB A;  3OXA A;  1EG9 B;  2WGQ A;  2CKF B;  1JKG B;  1OAC A;  3ALA A;  4FCZ A;  4RNY A;  4HM1 B;  3MHE A;  1O7N B;  1SPU A;  5I97 A;  3AHS A;  2CFL A;  5BIR A;  3B4O A;  1FA3 A;  1O7W B;  1K28 A;  1BRJ A;  1W2Z A;  2LQV A;  1WTH A;  3WA3 A;  4O02 B;  1NB3 I;  3AGN A;  5TGN A;  3FG3 A;  1TFK A;  2W56 B;  3DZL A;  3NQZ A;  5KP3 A;  3WDG B;  4LMI A;  3X41 A;  1YIJ 3;  2ZDJ A;  1NJI 4;  3MYT A;  1RRL A;  3SLU A;  8CHO A;  2F56 A;  3K63 A;  4L8O A;  4KZ1 A;  3RDE A;  3X40 A;  1RNB A;  3PZW A;  1MWU A;  1ISK A;  1NB5 I;  1NDO B;  4HOH A;  1BAN A;  3X3X A;  1BRS A;  1GYB A;  1IQX A;  1AQZ A;  2CW9 A;  1IDP A;  1FUS A;  2XSH B;  3OW2 2;  3ZFZ A;  3EQQ B;  4R4K A;  3FSD A;  4OK0 A;  4L7K A;  1VQQ A;  3GZB A;  3S28 A;  1J2B A;  1W01 A;  3CCE 3;  3Q2P A;  4HZ9 B;  3CCM 3;  1I8V A;  3F7S A;  3MSO A;  4BTX A;  2K54 A;  2J8X B;  1TIJ A;  3E99 A;  2GBX B;  2FNQ A;  1RRH A;  3EC9 A;  1UGI A;  4GHO A;  2OTJ 3;  5D83 A;  1A90 A;  3LOY A;  1UCL A;  6RNT A;  3OX9 A;  1GY6 A;  2BMQ B;  2L4V A;  2E2U A;  3EBY A;  3GAX A;  1BUJ A;  5JBS A;  4XDV A;  2XF3 A;  1AV4 A;  1N9J A;  1R4C A;  3F40 A;  5IG4 A;  1AVK A;  1EUI C;  4EV5 A;  2CFK A;  2KF5 A;  4GSP A;  4U13 A;  2IA7 A;  1T2H A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 1LQG C;  2UGI A;  1UGH I;  2UUG C;  2ZHX B;  4LYL B;  1UDI I;  1EUI C;  1LQM B;  2J8X B;  1UUG B;  1UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...