4LYLB

Crystal structure of uracil-dna glycosylase from cod (gadus morhua) in complex with the proteinaceous inhibitor ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-DNA glycosylase
publication title Structural and biophysical analysis of interactions between cod and human uracil-DNA N-glycosylase (UNG) and UNG inhibitor (Ugi).
pubmed doi rcsb
source organism Gadus morhua
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 82
sequence length 82
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2013-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 4lylB00
1UDII 1UGHI 2ZHXB 1EUIC 1UUGB 1LQGC 2UGIA 1LQMB 2UUGC 1UGIA 2J8XB 4LYLB
chains in the Genus database with same CATH superfamily
1B2XA 1UCIA 1BSEA 3JUQA 3U1WA 1N5HA 4K61A 2L1SA 4FMCA 3URPA 5IG3A 1OF5B 4HBRA 2W2CA 4K1UA 3KN4A 4OUQA 1YJN3 1IQXA 1R4CA 1WMPA 1RN1A 4KZ1A 3GZBA 3H51A 1KQS2 3N8BA 1YNVX 3PYJA 3MKIA 1RGFA 1VZZA 1BRJA 3S28A 3LH4A 3B8LA 1RJOA 1BNJA 1CEWI 2HMMB 1BUQA 1D6UA 1CQSA 1RGAA 3L0RA 4LGQA 2F4YA 2WOHA 1IQ8A 1M904 3HIIA 1O7HB 1JN5A 2Z7AA 3AGNA 1BNEA 3G0KA 3HZPA 4WHAA 2CG1A 3AHWA 3WHOA 3NQZA 5D81A 1QJGA 1LRAA 1BSDA 3ZG5A 1YJW3 2RBIA 3D4AA 2HMNB 3CC43 1BIRA 3HI7A 2E2UA 1MWTA 1V57A 3EBYA 4I4KA 4FCMA 4KFFA 2F99A 1UI7A 3CD63 2ML5A 3LTBA 1BGSA 4EXRA 2BU4A 5D82A 5HGRA 1W2ZA 3NM2A 2J8XB 5AIHA 4N6MA 2AADA 3FG1A 4NREA 4O8SA 3I553 1Q9EA 6GSPA 3WODG 2KF6A 1BANA 2XRXB 1B2UA 2CX0A 3NV0A 3O8YA 3CMA3 1BRHA 3JUNA 4GSPA 4N6V0 2A15A 3MPHA 1AY7A 1KD14 4HM7B 4H61A 3DGMA 2C11A 4BL3A 1AR0A 3B4OA 2BHMA 3GZRA 2O9UX 2Z6BA 3GRDA 3LT8A 4FMBA 2XGNA 2CFLA 1SIHA 3NQYA 2YFIB 5BIRA 2XGLA 3FG4A 1G02A 4RNYA 3CCM3 2F5WA 1IQYA 1FGRA 2STDA 3F14A 3OX9A 3ZFZA 2F56A 2XEPA 4L8OA 4CPKA 2W9QA 1RNBA 1N8QA 1STFI 3JUMA 1ZX2A 3GAXA 2CKFB 2GXFA 1O7WB 1JZDA 3SOYA 7STDA 3H3HA 3CCU3 1IDPA 2XSOB 1DVCA 5I97A 1VQ43 1OUNA 4FR9A 1N9JA 4QWTA 1R4YA 2D1WA 1M9GA 3FGYA 3CCJ3 1ROVA 4RZMA 7GSPA 1MWRA 1UW1A 1I8VA 3STDA 3KSPA 1SPUA 1NJI4 1A67A 2ZDJA 4Q53A 5AYSC 3LYGA 3M8CA 3S29A 1B20A 1IV9A 3KFQC 4HM1B 1L5GB 3D5GA 4BTYA 3EX9A 1NU3A 1N9EA 1K734 1BNRA 1FW7A 3HK4A 1HU9A 1TJDA 3IPTA 3N9HA 1X1UA 1EKMA 1V74A 2INXA 3QK9A 2CC3A 3D9RA 5AEUB 1BRSA 4BIRA 2R4IA 3BNCA 1A2KA 1CYUA 2K54A 2BMOB 1E3VA 3PGBA 4HM4B 1YI23 2Y73A 2GEXA 5DRVA 3X42A 2KF5A 1Q7Y4 3ROBA 1U5OA 1RN7A 1UUWB 3SLUA 3X41A 3EQQB 2F98A 1AVLA 1RNTA 7RNTA 1W01A 4HM6B 1BSBA 1NB3I 2CIUA 4I5QA 3K0ZA 1B2ZA 2JDIH 3RNTA 3WOEB 4MMYB 1TRQA 1JJ22 1GMQA 1UDII 3DH2A 4HVNA 3F7XA 5G1KA 2IYJA 1RRHA 2P09A 3OWUA 4EC6A 3IJEB 2F86B 2XFTA 1W5ZA 1Q42A 1W00A 1I2GA 2YX9A 3NBRA 1K28A 1ULJB 2Y74A 1I2EA 2Z76A 3DGNA 3K5TA 5M18A 1JN5B 2H0IA 2ZA4A 3Q1CA 1YIJ3 1CH0A 3WDGB 4XM4A 1EG9B 3I563 3KCHA 2OQEA 1Q7HA 4GL6A 4XDWA 1VQO3 1C7HA 3HOHA 4CDLA 1LOWA 1I70A 3OWSA 4G1MB 5ELUA 3CCE3 1W4NA 4J8TA 1G0TA 1E3RA 1UCLA 2FXTA 1J2BA 1OHOA 2BT3A 3KE7A 5EEOA 4RBNA 1RSNA 2MF7A 3D3LA 1NB5I 4HKVB 1GY5A 1ISKA 1FUTA 3WA2X 3CPW2 3DGYA 3EN1B 3A76A 2KF4A 4FCZA 1US1A 1JNQA 3CNXA 3DXOA 4GB5A 3LTAA 3MG3A 1VQL3 2QEX3 1LVNA 2D42A 3NV0B 4HM5B 4JRFA 5G2GA 3MWZA 3F40A 4X2HA 1W6CA 3EN8A 1BVIA 4X2OA 5IEPA 3Q2PA 3DGLA 5IENA 1Q40B 1T2HA 2W03A 3K63A 4MMXB 1STDA 3F8HA 2UGIA 4MJDA 3Q3FA 2WGQA 1GMPA 1JRQA 5STDA 2KF3A 3UJMA 4N6OB 1T3BA 5JBSA 3BLZA 1SARA 4R9KA 2W56B 1PU4A 4J9AA 4FMDA 1BNGA 2IA7A 3MHEA 1BUJA 3KZTA 3CPOA 1JBTA 4L7KA 2E2VA 1G96A 2OOVC 4XDVA 3PXMA 1FGMA 1MGWA 4R1KA 3NM7A 3FCSB 3K7CA 4K90B 1A2VA 3JUOA 3CCQ3 2M7OA 2CHCA 4OK0A 1FGOA 1RTUA 3DUKA 9RNTA 3F9SA 3FZWA 5CF1A 1GD4A 1Q40A 1YIT3 5AI1A 2RNTA 4K1VA 4J5KA 1RGGA 1GMRA 1K8A4 1EQKA 1JB4A 1TU5A 3OW22 5IW9A 1SJWA 5CF2A 1Y4KA 2HMOB 1GOVA 1OCVA 2CX1A 3B4PA 1M1XB 4RNTA 3ECFA 2W56A 2IUJA 3VF1A 1VQ53 3BB9A 1FA3A 5G1LA 4N6LA 1T2IA 1Q864 1DVDA 1D6ZA 3EBTA 1ULIB 2GU1A 3VGNA 2Z77A 4HM0B 4R4KA 3CCR3 2IUKA 1FZUA 1GSPA 3BNEA 1BRGA 3V98A 1WMOA 3VSYA 1X1WA 3RGAA 3LXUX 1RCKA 1OGZA 3NXJA 2GEYA 1W2B2 1I0XA 2UUGC 1RLSA 2P0MA 5IG4A 3CCS3 1K9M4 4KFDA 1VQ83 1OH0A 4R80A 1OHSA 3NHXA 3I0YA 1IV7A 1I0VA 2YFJB 1OGXA 1GD3A 1S723 2Q07A 4R9LA 5IERA 3EJVA 1B21A 1KC84 3JVCA 3FF0A 3G16A 5EVHA 5IF6A 1ASKA 2CW9A 2CWVA 1RMSA 1FGTA 1HYFA 3BIRA 4XBXA 3CXC2 4CCVA 1GY6A 4J5GA 1B27A 2XH9A 3CC23 3PZWA 5IG5A 1NDOB 1SIIA 3ALAA 3LTCA 2IY2A 1DMNA 4FCJA 3KSED 3BNDA 2CFGA 1AV4A 3A5EA 3SX1A 1BSAA 3SEDA 4WWUC 2CK3H 5JPUA 1FGQA 1IVWA 1GYBA 5KP3A 2GBWB 1UUGB 1M1K4 1JV2B 1CYVA 3S27A 3LT9A 3LMLA 3OWYA 4HM8B 2K3DA 1MWSA 1ROAA 1BNSA 1JKGA 2ML6A 3CME3 4OVMA 1EA2A 3N54B 3V99A 3AMOB 1N8R4 4XBTA 2RFRA 5FGOA 2W6JH 2UX0A 1AVKA 8RNTA 3AGOA 3D79A 2SARA 4KT3B 1TP6A 2BNGA 5IG0A 4LEHA 2WO0A 3FKAA 3DMCA 4HOHA 1YVSA 3HX8A 2MC8A 3X40A 4WYKA 3EF8A 1BNIA 5LC6A 3RDEA 3FF2A 3MSOA 1IVUA 4EV2A 3GZYB 4RNZA 2CFDA 1VQ93 5DREA 1LOVA 2K0MA 4ZM8A 1IT7A 5M19A 1KWIA 3UNLA 3LZAA 1YVBI 1ZS7A 1JZOA 6RNTA 2O3OA 1VQQA 3WOFB 5KP1A 3AMOA 1W6GA 5KP4A 3CCV3 3X3YA 4IPBA 1QAKA 3FLJA 1WMNA 3T8NA 4HYZA 1BRNL 2HMLB 1I3FA 1UGHI 2LQVA 1QVG2 2BO9B 1JBRA 1O7PB 1SQWA 3NX0A 1Q814 2HMKB 2R41A 4O02B 1YGEA 4BTXA 3CC73 1TFKA 1HZ1A 1GY7A 3AHSA 1O7GB 4LZIA 1BRKA 1TRPA 2SBLA 4NHFA 1X1YA 2XFSA 3DGOA 3B7CA 2OOVA 1B2MA 1RGCA 2H0HA 2OTL3 4IIAA 3WMDA 4JF8A 4WFOA 2CWUA 1RRLA 3DZLA 1DMQA 2F5MA 3G8ZA 1BNFA 1TUHA 2I9WA 5RNTA 2E2TA 2XSHB 2RCDA 3ER7A 1VQ73 1B3SA 1ZO2A 5IEOA 2OTJ3 4HZBB 3UL6A 1NNVA 3DM8A 2GSPA 8CHOA 4U13A 3FH1A 2P05A 3EC9A 1Z1SA 1U8CB 2KRTA 1DE3A 1RHLA 2C10A 1FYSA 1UCJA 1QVF2 3OV4A 2B1XB 2QIYA 5M1AA 2XR8B 2CFWA 2C4BA 1IVVA 1BAOA 1JB2A 2GU3A 3CU3A 2OQEC 3QRDA 1OF5A 1A2PA 1MOLA 3IMAB 3D5IA 4TX4A 2W04A 4LYLB 4BU4A 1KSIA 4EBGA 4N6NB 3J7Yd 1I2FA 2W9PA 1NO3A 1RKYA 1WNHA 2KAAA 4O3VA 2CH9A 3V92A 3X3XA 1IVXA 1LNIA 3EE1A 3PS8A 3K9MC 1RCLA 4NPBA 1IU7A 5TGNA 4HJLB 3NBJA 5LC7A 1BRIA 1NWWA 1RDSA 4KFEA 4HZ9B 4STDA 1VQM3 3S5CA 3CCL3 2YFLB 3KKGA 3KIIA 1DMMA 1RN4A 3SYUA 4AKZA 3F8XA 3FG3A 1GS3A 1BSCA 1W6YA 1WTHA 3RGRA 4AEQA 4H3UA 3ZG0A 1I3IA 5FW5A 2HOHA 1F8NA 4GHOA 1YHQ3 4XBYA 5GSPA 2XF3A 1TFOA 1MGRA 5CLKA 1C54A 4N3VA 3DY5A 2CFKA 2CWTA 1QALA 1W7CA 3SXXA 1YJ93 1PFPA 2PNCA 2RGQA 1RGHA 3WR2A 5AIIA 1JKGB 6STDA 4HM3B 4IT7A 3OXAA 3Q90A 5AYRB 1UI8A 1E97A 3G6E3 1LOYA 3MG2A 1BOXA 1YGWA 2W0QA 4WP5A 3FSDA 3BNBA 3LTDA 4BL2A 5CK6A 2OWPA 5BXQA 1LQMB 3BU4A 4EYCA 1Q824 1JBSA 1N5PA 3UB1A 1OPYA 5D83A 2ZHXB 3T0UA 3MYTA 3S67A 5A0OB 1QMAA 2RSXA 4WYKB 3G4S3 1FUSA 2BMRB 3SOAA 3U97A 3X3ZA 3PCSA 2QA43 5AIFA 4EV5A 5BU4A 2KCDA 4FMAA 2ZL8A 4N6UA 4ORLA 4CJNA 5EQLA 4PEJA 2CG0A 1EUIC 3NBBA 1VQN3 5BVBA 1IYYA 5JPPA 1VQK3 1MWUA 1DYUA 2WOFA 1IK3A 3E99A 1RGEA 4MEIA 3UL5A 1RGKA 4O2HA 3EHCA 4KVHA 4EW5A 1JB5A 2FNQA 2IMJA 2OCTA 4LMIA 3MG1A 5AEWB 1QAFA 1FUWA 2QGUA 1RGLA 4DKIA 1S5AA 4L8PA 1K41A 1LQGC 1TTOA 5HOHA 1TIJA 1VQP3 3GWRA 1IT8A 3LOYA 3JUPA 2V1LA 1AQZA 1T5YA 4MMZB 4ILFA 1LXEA 4N6TA 1UUVB 2HMJB 2L4VA 4HAAA 1LOXA 2GBXB 1PYLA 1DETA 2PZVA 4AKYA 1X1XA 1V58A 3F7SA 2BIRA 5CXOA 2JQ5A 1A90A 4LSOA 4BTWA 1PY3A 1EEJA 1W02A 3EB8A 1WQLB 3GSPA 2LYXA 3G713 2BMQB 1LNHA 1D6YA 3NUVA 3T8UA 3GZXB 2AAEA 1O7NB 2H0GA 5ELJA 2FGTA 5AIGA 3TDGA 3HIGA 4HM2B 1BU4A 1O7MB 1UGIA 2P0XA 1B2SA 1MNLA 2P38A 3PCRA 4XB5A 3SVAA 1UCKA 2B24B 1OHPA 1GOYA 2KXGA 1HKXA 1VQ63 1GOUA 3CNMA 3WA3A 1ZGXA 2WGOA 1OACA
chains in the Genus database with same CATH topology
1UDII 1UGHI 2ZHXB 1EUIC 1UUGB 1LQGC 2UGIA 1LQMB 2UUGC 1UGIA 2J8XB 4LYLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDI I;  1UGH I;  2ZHX B;  1EUI C;  1UUG B;  1LQG C;  2UGI A;  1LQM B;  2UUG C;  1UGI A;  2J8X B;  4LYL B; 
#chains in the Genus database with same CATH topology
 1B2X A;  1UCI A;  1BSE A;  3JUQ A;  3U1W A;  1N5H A;  4K61 A;  2L1S A;  4FMC A;  3URP A;  5IG3 A;  1OF5 B;  4HBR A;  2W2C A;  4K1U A;  3KN4 A;  4OUQ A;  1YJN 3;  1IQX A;  1R4C A;  1WMP A;  1RN1 A;  4KZ1 A;  3GZB A;  3H51 A;  1KQS 2;  3N8B A;  1YNV X;  3PYJ A;  3MKI A;  1RGF A;  1VZZ A;  1BRJ A;  3S28 A;  3LH4 A;  3B8L A;  1RJO A;  1BNJ A;  1CEW I;  2HMM B;  1BUQ A;  1D6U A;  1CQS A;  1RGA A;  3L0R A;  4LGQ A;  2F4Y A;  2WOH A;  1IQ8 A;  1M90 4;  3HII A;  1O7H B;  1JN5 A;  2Z7A A;  3AGN A;  1BNE A;  3G0K A;  3HZP A;  4WHA A;  2CG1 A;  3AHW A;  3WHO A;  3NQZ A;  5D81 A;  1QJG A;  1LRA A;  1BSD A;  3ZG5 A;  1YJW 3;  2RBI A;  3D4A A;  2HMN B;  3CC4 3;  1BIR A;  3HI7 A;  2E2U A;  1MWT A;  1V57 A;  3EBY A;  4I4K A;  4FCM A;  4KFF A;  2F99 A;  1UI7 A;  3CD6 3;  2ML5 A;  3LTB A;  1BGS A;  4EXR A;  2BU4 A;  5D82 A;  5HGR A;  1W2Z A;  3NM2 A;  2J8X B;  5AIH A;  4N6M A;  2AAD A;  3FG1 A;  4NRE A;  4O8S A;  3I55 3;  1Q9E A;  6GSP A;  3WOD G;  2KF6 A;  1BAN A;  2XRX B;  1B2U A;  2CX0 A;  3NV0 A;  3O8Y A;  3CMA 3;  1BRH A;  3JUN A;  4GSP A;  4N6V 0;  2A15 A;  3MPH A;  1AY7 A;  1KD1 4;  4HM7 B;  4H61 A;  3DGM A;  2C11 A;  4BL3 A;  1AR0 A;  3B4O A;  2BHM A;  3GZR A;  2O9U X;  2Z6B A;  3GRD A;  3LT8 A;  4FMB A;  2XGN A;  2CFL A;  1SIH A;  3NQY A;  2YFI B;  5BIR A;  2XGL A;  3FG4 A;  1G02 A;  4RNY A;  3CCM 3;  2F5W A;  1IQY A;  1FGR A;  2STD A;  3F14 A;  3OX9 A;  3ZFZ A;  2F56 A;  2XEP A;  4L8O A;  4CPK A;  2W9Q A;  1RNB A;  1N8Q A;  1STF I;  3JUM A;  1ZX2 A;  3GAX A;  2CKF B;  2GXF A;  1O7W B;  1JZD A;  3SOY A;  7STD A;  3H3H A;  3CCU 3;  1IDP A;  2XSO B;  1DVC A;  5I97 A;  1VQ4 3;  1OUN A;  4FR9 A;  1N9J A;  4QWT A;  1R4Y A;  2D1W A;  1M9G A;  3FGY A;  3CCJ 3;  1ROV A;  4RZM A;  7GSP A;  1MWR A;  1UW1 A;  1I8V A;  3STD A;  3KSP A;  1SPU A;  1NJI 4;  1A67 A;  2ZDJ A;  4Q53 A;  5AYS C;  3LYG A;  3M8C A;  3S29 A;  1B20 A;  1IV9 A;  3KFQ C;  4HM1 B;  1L5G B;  3D5G A;  4BTY A;  3EX9 A;  1NU3 A;  1N9E A;  1K73 4;  1BNR A;  1FW7 A;  3HK4 A;  1HU9 A;  1TJD A;  3IPT A;  3N9H A;  1X1U A;  1EKM A;  1V74 A;  2INX A;  3QK9 A;  2CC3 A;  3D9R A;  5AEU B;  1BRS A;  4BIR A;  2R4I A;  3BNC A;  1A2K A;  1CYU A;  2K54 A;  2BMO B;  1E3V A;  3PGB A;  4HM4 B;  1YI2 3;  2Y73 A;  2GEX A;  5DRV A;  3X42 A;  2KF5 A;  1Q7Y 4;  3ROB A;  1U5O A;  1RN7 A;  1UUW B;  3SLU A;  3X41 A;  3EQQ B;  2F98 A;  1AVL A;  1RNT A;  7RNT A;  1W01 A;  4HM6 B;  1BSB A;  1NB3 I;  2CIU A;  4I5Q A;  3K0Z A;  1B2Z A;  2JDI H;  3RNT A;  3WOE B;  4MMY B;  1TRQ A;  1JJ2 2;  1GMQ A;  1UDI I;  3DH2 A;  4HVN A;  3F7X A;  5G1K A;  2IYJ A;  1RRH A;  2P09 A;  3OWU A;  4EC6 A;  3IJE B;  2F86 B;  2XFT A;  1W5Z A;  1Q42 A;  1W00 A;  1I2G A;  2YX9 A;  3NBR A;  1K28 A;  1ULJ B;  2Y74 A;  1I2E A;  2Z76 A;  3DGN A;  3K5T A;  5M18 A;  1JN5 B;  2H0I A;  2ZA4 A;  3Q1C A;  1YIJ 3;  1CH0 A;  3WDG B;  4XM4 A;  1EG9 B;  3I56 3;  3KCH A;  2OQE A;  1Q7H A;  4GL6 A;  4XDW A;  1VQO 3;  1C7H A;  3HOH A;  4CDL A;  1LOW A;  1I70 A;  3OWS A;  4G1M B;  5ELU A;  3CCE 3;  1W4N A;  4J8T A;  1G0T A;  1E3R A;  1UCL A;  2FXT A;  1J2B A;  1OHO A;  2BT3 A;  3KE7 A;  5EEO A;  4RBN A;  1RSN A;  2MF7 A;  3D3L A;  1NB5 I;  4HKV B;  1GY5 A;  1ISK A;  1FUT A;  3WA2 X;  3CPW 2;  3DGY A;  3EN1 B;  3A76 A;  2KF4 A;  4FCZ A;  1US1 A;  1JNQ A;  3CNX A;  3DXO A;  4GB5 A;  3LTA A;  3MG3 A;  1VQL 3;  2QEX 3;  1LVN A;  2D42 A;  3NV0 B;  4HM5 B;  4JRF A;  5G2G A;  3MWZ A;  3F40 A;  4X2H A;  1W6C A;  3EN8 A;  1BVI A;  4X2O A;  5IEP A;  3Q2P A;  3DGL A;  5IEN A;  1Q40 B;  1T2H A;  2W03 A;  3K63 A;  4MMX B;  1STD A;  3F8H A;  2UGI A;  4MJD A;  3Q3F A;  2WGQ A;  1GMP A;  1JRQ A;  5STD A;  2KF3 A;  3UJM A;  4N6O B;  1T3B A;  5JBS A;  3BLZ A;  1SAR A;  4R9K A;  2W56 B;  1PU4 A;  4J9A A;  4FMD A;  1BNG A;  2IA7 A;  3MHE A;  1BUJ A;  3KZT A;  3CPO A;  1JBT A;  4L7K A;  2E2V A;  1G96 A;  2OOV C;  4XDV A;  3PXM A;  1FGM A;  1MGW A;  4R1K A;  3NM7 A;  3FCS B;  3K7C A;  4K90 B;  1A2V A;  3JUO A;  3CCQ 3;  2M7O A;  2CHC A;  4OK0 A;  1FGO A;  1RTU A;  3DUK A;  9RNT A;  3F9S A;  3FZW A;  5CF1 A;  1GD4 A;  1Q40 A;  1YIT 3;  5AI1 A;  2RNT A;  4K1V A;  4J5K A;  1RGG A;  1GMR A;  1K8A 4;  1EQK A;  1JB4 A;  1TU5 A;  3OW2 2;  5IW9 A;  1SJW A;  5CF2 A;  1Y4K A;  2HMO B;  1GOV A;  1OCV A;  2CX1 A;  3B4P A;  1M1X B;  4RNT A;  3ECF A;  2W56 A;  2IUJ A;  3VF1 A;  1VQ5 3;  3BB9 A;  1FA3 A;  5G1L A;  4N6L A;  1T2I A;  1Q86 4;  1DVD A;  1D6Z A;  3EBT A;  1ULI B;  2GU1 A;  3VGN A;  2Z77 A;  4HM0 B;  4R4K A;  3CCR 3;  2IUK A;  1FZU A;  1GSP A;  3BNE A;  1BRG A;  3V98 A;  1WMO A;  3VSY A;  1X1W A;  3RGA A;  3LXU X;  1RCK A;  1OGZ A;  3NXJ A;  2GEY A;  1W2B 2;  1I0X A;  2UUG C;  1RLS A;  2P0M A;  5IG4 A;  3CCS 3;  1K9M 4;  4KFD A;  1VQ8 3;  1OH0 A;  4R80 A;  1OHS A;  3NHX A;  3I0Y A;  1IV7 A;  1I0V A;  2YFJ B;  1OGX A;  1GD3 A;  1S72 3;  2Q07 A;  4R9L A;  5IER A;  3EJV A;  1B21 A;  1KC8 4;  3JVC A;  3FF0 A;  3G16 A;  5EVH A;  5IF6 A;  1ASK A;  2CW9 A;  2CWV A;  1RMS A;  1FGT A;  1HYF A;  3BIR A;  4XBX A;  3CXC 2;  4CCV A;  1GY6 A;  4J5G A;  1B27 A;  2XH9 A;  3CC2 3;  3PZW A;  5IG5 A;  1NDO B;  1SII A;  3ALA A;  3LTC A;  2IY2 A;  1DMN A;  4FCJ A;  3KSE D;  3BND A;  2CFG A;  1AV4 A;  3A5E A;  3SX1 A;  1BSA A;  3SED A;  4WWU C;  2CK3 H;  5JPU A;  1FGQ A;  1IVW A;  1GYB A;  5KP3 A;  2GBW B;  1UUG B;  1M1K 4;  1JV2 B;  1CYV A;  3S27 A;  3LT9 A;  3LML A;  3OWY A;  4HM8 B;  2K3D A;  1MWS A;  1ROA A;  1BNS A;  1JKG A;  2ML6 A;  3CME 3;  4OVM A;  1EA2 A;  3N54 B;  3V99 A;  3AMO B;  1N8R 4;  4XBT A;  2RFR A;  5FGO A;  2W6J H;  2UX0 A;  1AVK A;  8RNT A;  3AGO A;  3D79 A;  2SAR A;  4KT3 B;  1TP6 A;  2BNG A;  5IG0 A;  4LEH A;  2WO0 A;  3FKA A;  3DMC A;  4HOH A;  1YVS A;  3HX8 A;  2MC8 A;  3X40 A;  4WYK A;  3EF8 A;  1BNI A;  5LC6 A;  3RDE A;  3FF2 A;  3MSO A;  1IVU A;  4EV2 A;  3GZY B;  4RNZ A;  2CFD A;  1VQ9 3;  5DRE A;  1LOV A;  2K0M A;  4ZM8 A;  1IT7 A;  5M19 A;  1KWI A;  3UNL A;  3LZA A;  1YVB I;  1ZS7 A;  1JZO A;  6RNT A;  2O3O A;  1VQQ A;  3WOF B;  5KP1 A;  3AMO A;  1W6G A;  5KP4 A;  3CCV 3;  3X3Y A;  4IPB A;  1QAK A;  3FLJ A;  1WMN A;  3T8N A;  4HYZ A;  1BRN L;  2HML B;  1I3F A;  1UGH I;  2LQV A;  1QVG 2;  2BO9 B;  1JBR A;  1O7P B;  1SQW A;  3NX0 A;  1Q81 4;  2HMK B;  2R41 A;  4O02 B;  1YGE A;  4BTX A;  3CC7 3;  1TFK A;  1HZ1 A;  1GY7 A;  3AHS A;  1O7G B;  4LZI A;  1BRK A;  1TRP A;  2SBL A;  4NHF A;  1X1Y A;  2XFS A;  3DGO A;  3B7C A;  2OOV A;  1B2M A;  1RGC A;  2H0H A;  2OTL 3;  4IIA A;  3WMD A;  4JF8 A;  4WFO A;  2CWU A;  1RRL A;  3DZL A;  1DMQ A;  2F5M A;  3G8Z A;  1BNF A;  1TUH A;  2I9W A;  5RNT A;  2E2T A;  2XSH B;  2RCD A;  3ER7 A;  1VQ7 3;  1B3S A;  1ZO2 A;  5IEO A;  2OTJ 3;  4HZB B;  3UL6 A;  1NNV A;  3DM8 A;  2GSP A;  8CHO A;  4U13 A;  3FH1 A;  2P05 A;  3EC9 A;  1Z1S A;  1U8C B;  2KRT A;  1DE3 A;  1RHL A;  2C10 A;  1FYS A;  1UCJ A;  1QVF 2;  3OV4 A;  2B1X B;  2QIY A;  5M1A A;  2XR8 B;  2CFW A;  2C4B A;  1IVV A;  1BAO A;  1JB2 A;  2GU3 A;  3CU3 A;  2OQE C;  3QRD A;  1OF5 A;  1A2P A;  1MOL A;  3IMA B;  3D5I A;  4TX4 A;  2W04 A;  4LYL B;  4BU4 A;  1KSI A;  4EBG A;  4N6N B;  3J7Y d;  1I2F A;  2W9P A;  1NO3 A;  1RKY A;  1WNH A;  2KAA A;  4O3V A;  2CH9 A;  3V92 A;  3X3X A;  1IVX A;  1LNI A;  3EE1 A;  3PS8 A;  3K9M C;  1RCL A;  4NPB A;  1IU7 A;  5TGN A;  4HJL B;  3NBJ A;  5LC7 A;  1BRI A;  1NWW A;  1RDS A;  4KFE A;  4HZ9 B;  4STD A;  1VQM 3;  3S5C A;  3CCL 3;  2YFL B;  3KKG A;  3KII A;  1DMM A;  1RN4 A;  3SYU A;  4AKZ A;  3F8X A;  3FG3 A;  1GS3 A;  1BSC A;  1W6Y A;  1WTH A;  3RGR A;  4AEQ A;  4H3U A;  3ZG0 A;  1I3I A;  5FW5 A;  2HOH A;  1F8N A;  4GHO A;  1YHQ 3;  4XBY A;  5GSP A;  2XF3 A;  1TFO A;  1MGR A;  5CLK A;  1C54 A;  4N3V A;  3DY5 A;  2CFK A;  2CWT A;  1QAL A;  1W7C A;  3SXX A;  1YJ9 3;  1PFP A;  2PNC A;  2RGQ A;  1RGH A;  3WR2 A;  5AII A;  1JKG B;  6STD A;  4HM3 B;  4IT7 A;  3OXA A;  3Q90 A;  5AYR B;  1UI8 A;  1E97 A;  3G6E 3;  1LOY A;  3MG2 A;  1BOX A;  1YGW A;  2W0Q A;  4WP5 A;  3FSD A;  3BNB A;  3LTD A;  4BL2 A;  5CK6 A;  2OWP A;  5BXQ A;  1LQM B;  3BU4 A;  4EYC A;  1Q82 4;  1JBS A;  1N5P A;  3UB1 A;  1OPY A;  5D83 A;  2ZHX B;  3T0U A;  3MYT A;  3S67 A;  5A0O B;  1QMA A;  2RSX A;  4WYK B;  3G4S 3;  1FUS A;  2BMR B;  3SOA A;  3U97 A;  3X3Z A;  3PCS A;  2QA4 3;  5AIF A;  4EV5 A;  5BU4 A;  2KCD A;  4FMA A;  2ZL8 A;  4N6U A;  4ORL A;  4CJN A;  5EQL A;  4PEJ A;  2CG0 A;  1EUI C;  3NBB A;  1VQN 3;  5BVB A;  1IYY A;  5JPP A;  1VQK 3;  1MWU A;  1DYU A;  2WOF A;  1IK3 A;  3E99 A;  1RGE A;  4MEI A;  3UL5 A;  1RGK A;  4O2H A;  3EHC A;  4KVH A;  4EW5 A;  1JB5 A;  2FNQ A;  2IMJ A;  2OCT A;  4LMI A;  3MG1 A;  5AEW B;  1QAF A;  1FUW A;  2QGU A;  1RGL A;  4DKI A;  1S5A A;  4L8P A;  1K41 A;  1LQG C;  1TTO A;  5HOH A;  1TIJ A;  1VQP 3;  3GWR A;  1IT8 A;  3LOY A;  3JUP A;  2V1L A;  1AQZ A;  1T5Y A;  4MMZ B;  4ILF A;  1LXE A;  4N6T A;  1UUV B;  2HMJ B;  2L4V A;  4HAA A;  1LOX A;  2GBX B;  1PYL A;  1DET A;  2PZV A;  4AKY A;  1X1X A;  1V58 A;  3F7S A;  2BIR A;  5CXO A;  2JQ5 A;  1A90 A;  4LSO A;  4BTW A;  1PY3 A;  1EEJ A;  1W02 A;  3EB8 A;  1WQL B;  3GSP A;  2LYX A;  3G71 3;  2BMQ B;  1LNH A;  1D6Y A;  3NUV A;  3T8U A;  3GZX B;  2AAE A;  1O7N B;  2H0G A;  5ELJ A;  2FGT A;  5AIG A;  3TDG A;  3HIG A;  4HM2 B;  1BU4 A;  1O7M B;  1UGI A;  2P0X A;  1B2S A;  1MNL A;  2P38 A;  3PCR A;  4XB5 A;  3SVA A;  1UCK A;  2B24 B;  1OHP A;  1GOY A;  2KXG A;  1HKX A;  1VQ6 3;  1GOU A;  3CNM A;  3WA3 A;  1ZGX A;  2WGO A;  1OAC A; 
#chains in the Genus database with same CATH homology
 1UDI I;  1UGH I;  2ZHX B;  1EUI C;  1UUG B;  1LQG C;  2UGI A;  1LQM B;  2UUG C;  1UGI A;  2J8X B;  4LYL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...