1SJWA

Structure of polyketide cyclase snoal
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
SRQTEIVRRMVSAFNTGRTDDVDEYIHPDYLNPATLEHGIHTGPKAFAQLVGWVRATFSEEARLEEVRIEERGPWVKAYLVLYGRHVGRLVGMPPTDRRFSGEQVHLMRIVDGKIRDHRDWPDFQGTLRQLGDPWPDDEGWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords nogalonic acid methyl ester cyclase
publication title Structure of the polyketide cyclase SnoaL reveals a novel mechanism for enzymatic aldol condensation.
pubmed doi rcsb
source organism Streptomyces nogalater
total genus 40
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1sjwA00
5DRVA 1O7WB 4XDVA 1NDOB 2XSHB 4CDLA 1IDPA 4LEHA 1U5OA 2OWPA 5KP4A 1Q40B 4XBXA 2XSOB 3FKAA 5AEWB 1QMAA 3OWSA 4LMIA 3BB9A 4XB5A 1STDA 2F98A 5IG4A 1NU3A 3NHXA 1VZZA 1W6YA 3GZYB 3JUNA 3K7CA 5BVBA 3DM8A 4WYKB 3EN1B 3EC9A 2CKFB 3EQQB 5JPUA 2XR8B 3D9RA 5IEOA 3RGAA 3K0ZA 3F7SA 3NV0B 3FH1A 4K1VA 3EBTA 3GZBA 7STDA 1NWWA 3NUVA 4X2HA 4HM8B 1OCVA 3MHEA 5IERA 4R9LA 2GEXA 3H51A 3JUQA 5CK6A 3DXOA 2K54A 5D81A 5JPPA 1GS3A 3KSPA 2GBXB 2B1XB 3FSDA 3CU3A 3HK4A 4ORLA 5IG0A 2A15A 4Q53A 3GRDA 1OHPA 4LGQA 3LZAA 4OUQA 1ZO2A 3F14A 4J9AA 1E3RA 2F99A 4R1KA 2INXA 1JN5A 4J8TA 3MG3A 3NBRA 2HMLB 1OHOA 3OXAA 5HGRA 1O7NB 2GBWB 4HM7B 3IPTA 4HM6B 4GB5A 5TGNA 4X2OA 1OH0A 2RGQA 5DREA 3JUMA 2HMJB 5G2GA 3UNLA 3KE7A 1A2KA 1JKGB 1ULJB 3OWYA 4WP5A 1K41A 4MJDA 1S5AA 1O7GB 5AIGA 1C7HA 1O7HB 3F9SA 4HVNA 5KP1A 4OVMA 3S5CA 5FW5A 1JB2A 4PEJA 1W02A 2JQ5A 5CF2A 3FZWA 3ECFA 1DMNA 4HZBB 1OF5B 3EN8A 4HKVB 2B24B 1E97A 3G8ZA 1GYBA 3DMCA 4HJLB 4XM4A 2QIYA 4RZMA 3CNMA 4U13A 3NM2A 3OWUA 2YFLB 1DMMA 4XBYA 3FF0A 2R4IA 1JKGA 3FGYA 2F86B 2HMOB 3LYGA 3HZPA 2QGUA 2YFJB 1Q40A 2Z77A 2XRXB 2IMJA 1OGZA 2UX0A 1JB5A 4XDWA 4HM5B 4I4KA 1Q42A 2W2CA 3NXJA 3GZXB 5CXOA 1SJWA 1O7MB 4WYKA 3EJVA 2BMOB 1Z1SA 1QJGA 1WQLB 3A76A 5KP3A 5BXQA 3B7CA 3VSYA 1UUWB 3MSOA 3NV0A 3OX9A 3DUKA 2I9WA 3BLZA 4STDA 3H3HA 2Z7AA 3F8HA 4L8PA 3M8CA 3EX9A 3MYTA 1CQSA 3JUPA 3OV4A 1OPYA 2HMNB 1GY7A 3E99A 3GZRA 3B8LA 5CF1A 1E3VA 5AEUB 1ZX2A 1GY6A 2GEYA 1W00A 3CNXA 4HZ9B 1JB4A 4FCJA 3EHCA 3F7XA 3T8NA 6STDA 4HM2B 4K1UA 1W01A 4IIAA 5IF6A 4KVHA 2YFIB 1GY5A 3HX8A 5AIHA 3JUOA 4HM4B 3CPOA 1UUVB 3SOYA 3F40A 1AR0A 1EA2A 3Q90A 3WMDA 3G16A 3SOAA 5EVHA 4WWUC 2RCDA 5D83A 5STDA 3MKIA 2RFRA 4FCMA 2BNGA 5AIFA 3I0YA 3FLJA 4N3VA 5CLKA 2STDA 1OUNA 1ASKA 2BMRB 3UJMA 1ULIB 1TP6A 1JN5B 3EBYA 1ISKA 1TUHA 5IG3A 5D82A 3EF8A 1BUQA 3B4PA 3T8UA 3B4OA 3KKGA 4H3UA 4HM1B 1O7PB 4L8OA 3G0KA 1HKXA 2Z76A 3GWRA 5AIIA 5IENA 4XBTA 1OF5A 1EG9B 3MG1A 5AI1A 3RGRA 1OGXA 3KZTA 2GXFA 3SEDA 5IEPA 8CHOA 2HMMB 2CHCA 4HM0B 2PZVA 3VGNA 3MG2A 4L7KA 4HM3B 1DMQA 4R9KA 3F8XA 2HMKB 3ROBA 3ER7A 3FF2A 3STDA 2BMQB 5IG5A 3DZLA 1OHSA
chains in the Genus database with same CATH superfamily
1SIIA 5DRVA 1MOLA 1O7WB 4XDVA 1NDOB 2GSPA 3CC73 2W03A 4N6V0 2XSHB 2JDIH 5FGOA 1N9JA 1RCKA 1BUJA 4FR9A 4N6UA 1W6CA 4CDLA 1IDPA 4LEHA 5EEOA 1U5OA 2OWPA 1QAFA 1HYFA 1VQ63 1T2IA 2J8XB 5KP4A 5I97A 1Q40B 4MMXB 1I70A 3NX0A 4XBXA 2XSOB 1LOYA 3FKAA 2WGOA 5AEWB 1B2UA 1BOXA 1QMAA 3OWSA 1I0XA 4LMIA 3URPA 1CH0A 2W9PA 3BB9A 4XB5A 3U1WA 2O3OA 1IV7A 2H0IA 4K90B 1YGWA 1STDA 1BIRA 1W2ZA 3ALAA 4GHOA 2F98A 2CFKA 1VQO3 3FG1A 3CCM3 1KWIA 1V57A 1YNVX 3UL6A 5IG4A 1NU3A 4H61A 1M1XB 1QVG2 1RN7A 1KC84 1UCLA 3NHXA 1IK3A 4WHAA 1FUTA 4ZM8A 1VZZA 1W6YA 1FGQA 2RSXA 3GZYB 3JUNA 1C54A 1RGLA 1Y4KA 3K7CA 5BVBA 2IUKA 3DM8A 3N54B 4WYKB 2Y74A 1YVBI 3EN1B 3EC9A 1A2PA 1S723 3J7Yd 2CKFB 3EQQB 3WDGB 3CME3 1FA3A 1Q824 5JPUA 2XR8B 3CD63 1YJ93 3D9RA 1IVWA 1UI8A 5IEOA 3RGAA 1B3SA 3K0ZA 1B21A 1RGCA 3A5EA 4IPBA 4NHFA 3CMA3 4I5QA 2W6JH 3D5GA 3F7SA 3NV0B 4EBGA 3FH1A 4K1VA 3OW22 2Q07A 1TFOA 3EBTA 1QALA 1B2MA 3GZBA 7STDA 1YHQ3 3LTBA 4GL6A 2KF3A 5AYRB 3X41A 1A67A 3PGBA 1NWWA 1UGIA 4HOHA 2BHMA 3DGMA 3K5TA 1GD3A 2WOHA 4QWTA 3NUVA 4X2HA 1ROVA 4HM8B 4KFFA 1OCVA 1BRIA 1BRSA 2H0GA 3MHEA 5IERA 4R9LA 1M1K4 2CG0A 2GEXA 3FG4A 1JBRA 3U97A 1D6UA 3H51A 3PCSA 4NREA 1LVNA 1YIJ3 1K734 1TU5A 3JUQA 2XEPA 2CFLA 1RTUA 5CK6A 1IQYA 3WOEB 3DXOA 2RBIA 4WFOA 4BU4A 2K54A 5D81A 1G0TA 3IJEB 3KCHA 4EXRA 5JPPA 1UDII 1RRHA 1GS3A 3KSPA 1JV2B 2GBXB 1MNLA 2C11A 2B1XB 3FSDA 3CU3A 1LNIA 1NB5I 3HK4A 3CCU3 1YJW3 1JBSA 1W4NA 1I2FA 1VQM3 4ORLA 5IG0A 1VQQA 1FGOA 1MWTA 2OOVA 2A15A 4O8SA 3CCV3 4Q53A 1STFI 1GMPA 1T2HA 2CH9A 1QAKA 6RNTA 3CXC2 1EKMA 2UUGC 1G02A 1MWRA 3L0RA 4K61A 1B2XA 3GRDA 1RKYA 1OHPA 4O02B 1FZUA 1BNRA 3AHSA 4LGQA 3LZAA 4OUQA 1ZO2A 3F14A 4O3VA 1K8A4 4J9AA 4MMZB 3DY5A 1E3RA 2F99A 2LQVA 4N6NB 4R1KA 2INXA 1KQS2 1RGEA 1JN5A 4J8TA 3MG3A 3NBRA 2HMLB 4EYCA 1B2ZA 2GU1A 1OHOA 3OXAA 3CC23 5HGRA 1TRPA 1O7NB 2GBWB 1UCJA 3S67A 4HM7B 3IPTA 4HM6B 1VQ93 2IA7A 2CIUA 2BIRA 2CWVA 4GB5A 2OCTA 1BRJA 3CCL3 2XFSA 5TGNA 1I0VA 3X3ZA 1RNBA 4X2OA 3RDEA 1F8NA 3SYUA 1OH0A 2RGQA 4AKYA 4BTWA 1L5GB 1AQZA 5DREA 3JUMA 2HMJB 2F56A 5G2GA 1FYSA 3UNLA 1BRKA 1W2B2 3KE7A 1A2KA 1JNQA 4FMBA 3X42A 1JKGB 1I2EA 1RDSA 1ULJB 2XGNA 2OOVC 2ZA4A 1RRLA 1BNSA 1TTOA 4WP5A 1K41A 1ZS7A 4MJDA 1IV9A 1TFKA 1W7CA 1RGGA 1S5AA 4N6OB 4HBRA 1UUGB 1BNFA 1MGWA 3LT8A 3Q2PA 2CX1A 1O7GB 2RNTA 4RNZA 1B20A 2KF5A 1DVDA 1G96A 3PXMA 5AIGA 1C7HA 2W04A 3UB1A 1DE3A 1O7HB 2ZDJA 3F9SA 2KCDA 4HVNA 2PNCA 1VQ53 5KP1A 1T3BA 3WODG 1VQN3 2C10A 3LT9A 4OVMA 3S5CA 2CW9A 5FW5A 1BGSA 4FMAA 3SLUA 1JB2A 1MWUA 4PEJA 1W02A 2V1LA 2JQ5A 2W56B 5CF2A 1GSPA 2FGTA 3FZWA 7GSPA 2XH9A 3DH2A 3DGNA 3ECFA 3LMLA 1DMNA 1BSCA 1UW1A 4HZBB 1YGEA 4RNYA 1OF5B 3EN8A 1I3FA 4HKVB 3ZG5A 1CYVA 3AMOA 3WA2X 4HAAA 2B24B 4LZIA 1E97A 3G8ZA 1A90A 3NBBA 1D6ZA 1GYBA 3DMCA 4HJLB 1DVCA 3X3XA 3CCE3 3CCQ3 1QVF2 3JVCA 4O2HA 1N9EA 5G1LA 1Q814 4XM4A 1OACA 2E2TA 1WMNA 2QIYA 2AADA 4RZMA 3CNMA 1VQL3 1BSDA 3QRDA 1DETA 3Q1CA 1GMRA 4U13A 3NM2A 3OWUA 2YFLB 1DMMA 1M904 3LXUX 4XBYA 3FF0A 3HIIA 2R4IA 1VQ73 1X1UA 2CG1A 1JKGA 3FGYA 2F86B 2HMOB 3V99A 3LYGA 2FXTA 3HZPA 2QGUA 4BTXA 2O9UX 5A0OB 2YFJB 1Q40A 2Z77A 4FMCA 2F5WA 3TDGA 3UL5A 4EC6A 1JBTA 2BT3A 2E2UA 1SQWA 2XRXB 3GSPA 3X40A 2IMJA 2P05A 1SARA 1MWSA 1OGZA 2UX0A 3PZWA 1IT7A 1JB5A 2WO0A 3HOHA 4KZ1A 4XDWA 1WMPA 4MEIA 4HM5B 1MGRA 4N6LA 7RNTA 1BVIA 2CFGA 4MMYB 1VQ43 4I4KA 1Q42A 3SX1A 2XGLA 1V58A 2ML5A 1EUIC 4BL3A 4JF8A 2W2CA 5EQLA 3WOFB 2CWTA 3NXJA 1N5HA 1WMOA 3GZXB 5CXOA 1YI23 4N6MA 1SJWA 1N5PA 1O7MB 1RMSA 5ELJA 4WYKA 3EB8A 3DZLA 3EJVA 2Y73A 2L4VA 2BMOB 1DYUA 1N8QA 1QJGA 1Z1SA 1RGFA 1WQLB 3A76A 1HZ1A 1ROAA 3I563 5KP3A 5BXQA 1LOWA 3B7CA 3VSYA 1UUWB 1FGRA 2CFDA 3MSOA 3NV0A 5ELUA 5GSPA 5LC7A 3S27A 2GU3A 3OX9A 3T0UA 3ZFZA 1JJ22 3AGNA 2WOFA 1KSIA 3MPHA 3DUKA 1R4CA 2I9WA 3S29A 3BLZA 3D4AA 4STDA 1ZGXA 4KFDA 3H3HA 1BSBA 3D3LA 2XFTA 1RN4A 1SPUA 1NJI4 3BNCA 3G713 2Z7AA 2CWUA 1PFPA 4RBNA 1TIJA 3F8HA 4KFEA 4L8PA 4AKZA 1HU9A 3M8CA 1BNJA 1BANA 2F4YA 3EX9A 3MYTA 1CYUA 1CQSA 1UCKA 2ML6A 2OTL3 3JUPA 3K63A 3OV4A 1A2VA 1V74A 1OPYA 2HMNB 1GY7A 3E99A 3SVAA 1U8CB 3GZRA 3B8LA 1AV4A 1X1WA 2CK3H 1RGHA 1E3VA 3QK9A 2L1SA 5CF1A 5IW9A 3PYJA 1BRHA 3D5IA 2IYJA 1M9GA 1RCLA 4IT7A 5AEUB 5M19A 1ZX2A 3D79A 1GY6A 3S28A 2GEYA 1W00A 3CNXA 2C4BA 1NNVA 4HZ9B 4RNTA 1JB4A 1BNIA 1AVKA 1NO3A 3EHCA 3F7XA 4FCJA 4HM2B 3T8NA 6STDA 1RGKA 1VQK3 4BTYA 3BNDA 5BIRA 1CEWI 4K1UA 1WNHA 3FCSB 1AY7A 3I553 2CX0A 4G1MB 1EQKA 3LTDA 3ZG0A 1W01A 3PS8A 1YIT3 4EV5A 1K28A 1RHLA 4IIAA 5IF6A 2YX9A 1GMQA 1BSAA 4KVHA 5G1KA 1IVVA 1N8R4 2YFIB 1GY5A 1B2SA 3HX8A 1SIHA 1LXEA 5AIHA 1IQXA 4CJNA 3GAXA 3JUOA 3O8YA 2BO9B 3AHWA 4HM4B 4TX4A 3X3YA 3CPOA 1UUVB 3SOYA 1T5YA 3F40A 1AR0A 1TRQA 1UI7A 3WA3A 1UCIA 1J2BA 1IT8A 1EA2A 1PU4A 3FG3A 9RNTA 3OWYA 3PCRA 1BNEA 3CPW2 3NQYA 3Q90A 4LSOA 2OTJ3 3VF1A 3AGOA 1FGMA 3G16A 3WMDA 4DKIA 6GSPA 4OK0A 2KRTA 1RGAA 2R41A 3SOAA 5EVHA 4WWUC 2K0MA 1FW7A 5LC6A 2RCDA 5D83A 1WTHA 5STDA 1BRGA 2H0HA 3KSED 5AYSC 3MKIA 2RFRA 1GD4A 4FCMA 1Q7Y4 3Q3FA 2LYXA 2BNGA 2W0QA 3RNTA 3G6E3 2QEX3 5AIFA 2K3DA 2KF6A 5M1AA 4BL2A 2F5MA 3FLJA 3I0YA 3IMAB 1US1A 3BNBA 4N3VA 5CLKA 1PYLA 4AEQA 2ZL8A 3V98A 1IYYA 1GOUA 2STDA 1OUNA 3MWZA 1B27A 2D42A 8RNTA 1ASKA 2BMRB 2ZHXB 3UJMA 3LTAA 1ULIB 1TP6A 1NB3I 1Q864 1IVXA 1JN5B 3EBYA 1ISKA 1LQGC 1TUHA 2M7OA 1I2GA 2OQEA 2FNQA 2P38A 4J5KA 1LOXA 1GOYA 1LOVA 1X1XA 4ILFA 1Q9EA 5IG3A 5D82A 4R80A 4HYZA 4EW5A 1I8VA 1JZOA 1D6YA 3EF8A 4FCZA 3V92A 2IY2A 2BU4A 2SBLA 1BUQA 1JZDA 3B4PA 3T8UA 2W56A 3B4OA 3K9MC 1LNHA 3KKGA 3BNEA 3LOYA 4GSPA 1O7PB 4H3UA 3G0KA 2XF3A 3EE1A 4HM1B 3LTCA 1HKXA 3N9HA 4L8OA 4CPKA 3DGYA 2P09A 2Z76A 3GWRA 2KF4A 1YVSA 3KIIA 5AIIA 3CC43 1R4YA 4J5GA 5IENA 4XBTA 1OF5A 4FMDA 1EG9B 3MG1A 1RN1A 2Z6BA 1IU7A 1LQMB 1BNGA 3KFQC 3WHOA 3CCJ3 3NQZA 2CC3A 5HOHA 1IQ8A 5AI1A 2HOHA 3RGRA 1PY3A 1BAOA 1OGXA 3KZTA 3NM7A 2GXFA 4EV2A 3G4S3 1W5ZA 3SEDA 1Q7HA 1TJDA 5IEPA 3BU4A 1W6GA 2CFWA 5RNTA 3DGLA 8CHOA 3CCR3 2QA43 2UGIA 1JRQA 2AAEA 2IUJA 1X1YA 1BRNL 2HMMB 2CHCA 3HIGA 1RSNA 3HI7A 5BU4A 1UGHI 1RNTA 4HM0B 2MC8A 3N8BA 3WR2A 2PZVA 1FUWA 2KXGA 2OQEC 3VGNA 2E2VA 1KD14 5JBSA 3SXXA 1K9M4 3LH4A 3CCS3 1IVUA 1FGTA 1RJOA 3DGOA 3MG2A 1YJN3 4L7KA 1FUSA 1LRAA 4HM3B 1DMQA 1GOVA 3NBJA 1RLSA 2D1WA 1BU4A 3F8XA 4R9KA 3AMOB 1BSEA 3BIRA 4KT3B 4CCVA 2SARA 3KN4A 2HMKB 3ROBA 4JRFA 2MF7A 3ER7A 3FF2A 2W9QA 3STDA 1AVLA 2BMQB 5M18A 1I3IA 1VQ83 2KAAA 4BIRA 2P0MA 1VQP3 2WGQA 5IG5A 4NPBA 4R4KA 4LYLB 4N6TA 1EEJA 2P0XA 1OHSA
chains in the Genus database with same CATH topology
1SIIA 5DRVA 1MOLA 1O7WB 4XDVA 1NDOB 3CC73 2W03A 4N6V0 2XSHB 2JDIH 5FGOA 1N9JA 4FR9A 4N6UA 1W6CA 4CDLA 1IDPA 4LEHA 5EEOA 1U5OA 2OWPA 1QAFA 1VQ63 5KP4A 5I97A 1Q40B 4MMXB 4XBXA 3NX0A 2XSOB 3FKAA 2WGOA 5AEWB 1QMAA 3OWSA 4LMIA 2W9PA 3BB9A 4XB5A 3U1WA 2O3OA 1IV7A 4K90B 1STDA 1W2ZA 3ALAA 2F98A 2CFKA 1VQO3 3FG1A 3CCM3 1KWIA 3UL6A 5IG4A 1NU3A 4H61A 1M1XB 1QVG2 1RN7A 1KC84 3NHXA 1IK3A 4WHAA 4ZM8A 1VZZA 1W6YA 1FGQA 2RSXA 3GZYB 3JUNA 1Y4KA 3K7CA 5BVBA 2IUKA 3DM8A 3N54B 4WYKB 2Y74A 1YVBI 3EN1B 3EC9A 1S723 3J7Yd 2CKFB 3EQQB 3WDGB 3CME3 1FA3A 1Q824 5JPUA 2XR8B 3CD63 1YJ93 3D9RA 1IVWA 1UI8A 5IEOA 3RGAA 3K0ZA 4NHFA 4IPBA 3CMA3 2W6JH 3F7SA 3NV0B 4EBGA 3FH1A 4K1VA 3OW22 2Q07A 1TFOA 3EBTA 1QALA 3GZBA 7STDA 1YHQ3 3LTBA 4GL6A 5AYRB 3X41A 1A67A 3PGBA 1NWWA 2BHMA 3DGMA 3K5TA 1GD3A 2WOHA 4QWTA 3NUVA 4X2HA 1ROVA 4HM8B 4KFFA 1OCVA 3MHEA 5IERA 1M1K4 4R9LA 2CG0A 2GEXA 3FG4A 3U97A 1D6UA 3H51A 3PCSA 4NREA 1LVNA 1YIJ3 1K734 1TU5A 3JUQA 2XEPA 2CFLA 5CK6A 1IQYA 3WOEB 3DXOA 4WFOA 2K54A 5D81A 3IJEB 4EXRA 5JPPA 1RRHA 1GS3A 3KSPA 1JV2B 2GBXB 1MNLA 2C11A 2B1XB 3FSDA 3CU3A 1NB5I 3HK4A 3CCU3 1YJW3 1W4NA 1VQM3 4ORLA 5IG0A 2OOVA 1FGOA 2A15A 4O8SA 3CCV3 4Q53A 1STFI 3CXC2 2CH9A 1QAKA 1EKMA 3L0RA 4K61A 3GRDA 1RKYA 1OHPA 4O02B 4LGQA 3LZAA 4OUQA 1ZO2A 3F14A 4O3VA 1K8A4 4J9AA 4MMZB 3DY5A 1E3RA 2F99A 2LQVA 4N6NB 4R1KA 2INXA 1KQS2 1JN5A 4J8TA 3MG3A 3NBRA 2HMLB 4EYCA 2GU1A 1OHOA 3OXAA 3CC23 5HGRA 1O7NB 2GBWB 3S67A 4HM7B 3IPTA 4HM6B 1VQ93 2IA7A 2CIUA 2CWVA 4GB5A 2OCTA 3CCL3 2XFSA 5TGNA 3X3ZA 4X2OA 3RDEA 1F8NA 4AKYA 1OH0A 2RGQA 4BTWA 1L5GB 5DREA 3JUMA 2HMJB 5G2GA 3UNLA 1W2B2 3KE7A 1A2KA 1JNQA 4FMBA 3X42A 1JKGB 1ULJB 2XGNA 3OWYA 2OOVC 1RRLA 4WP5A 1K41A 4MJDA 1IV9A 1TFKA 1W7CA 1S5AA 4N6OB 4HBRA 3Q2PA 3LT8A 1O7GB 4RNZA 1DVDA 1G96A 3PXMA 5AIGA 1C7HA 2W04A 3UB1A 1O7HB 2ZDJA 3F9SA 2KCDA 4HVNA 2PNCA 1VQ53 5KP1A 3WODG 1VQN3 2C10A 3LT9A 4OVMA 3S5CA 2CW9A 5FW5A 4FMAA 3SLUA 1JB2A 4PEJA 1W02A 2V1LA 2JQ5A 2W56B 5CF2A 2FGTA 3FZWA 2XH9A 3DGNA 3ECFA 3LMLA 1DMNA 1UW1A 4HZBB 1YGEA 4RNYA 1OF5B 3EN8A 4HKVB 1CYVA 3AMOA 3WA2X 2B24B 4LZIA 1E97A 3G8ZA 1A90A 3NBBA 1GYBA 1D6ZA 3DMCA 4HJLB 1DVCA 3X3XA 3CCE3 3CCQ3 1QVF2 3JVCA 4O2HA 1N9EA 1Q814 4XM4A 1OACA 2E2TA 1WMNA 2QIYA 4RZMA 3CNMA 1VQL3 3QRDA 3Q1CA 4U13A 3NM2A 3OWUA 2YFLB 1DMMA 1M904 3LXUX 4XBYA 3FF0A 3HIIA 2R4IA 2CG1A 1JKGA 3FGYA 2F86B 2HMOB 3V99A 3LYGA 2FXTA 3HZPA 2QGUA 4BTXA 2O9UX 5A0OB 2YFJB 1Q40A 2Z77A 4FMCA 3TDGA 3UL5A 4EC6A 2BT3A 2E2UA 1SQWA 2XRXB 3X40A 2P05A 2IMJA 1OGZA 2UX0A 3PZWA 1IT7A 1JB5A 2WO0A 4KZ1A 4XDWA 1WMPA 4MEIA 4HM5B 4N6LA 2CFGA 4MMYB 1VQ43 4I4KA 1Q42A 3SX1A 2XGLA 2ML5A 4JF8A 2W2CA 5EQLA 3WOFB 2CWTA 3NXJA 1N5HA 1WMOA 3GZXB 5CXOA 1YI23 4N6MA 1SJWA 1N5PA 1O7MB 5ELJA 4WYKA 3EB8A 3DZLA 3EJVA 2Y73A 2L4VA 2BMOB 1DYUA 1N8QA 1QJGA 1Z1SA 1WQLB 3A76A 1ROAA 3I563 5KP3A 5BXQA 3B7CA 3VSYA 1UUWB 1FGRA 2CFDA 3MSOA 3NV0A 5ELUA 5LC7A 3S27A 3T0UA 2GU3A 3OX9A 1JJ22 2WOFA 1KSIA 3MPHA 3DUKA 1R4CA 2I9WA 3S29A 3BLZA 4STDA 4KFDA 3H3HA 3D3LA 2XFTA 1SPUA 1NJI4 3BNCA 3G713 2Z7AA 2CWUA 1PFPA 4RBNA 1TIJA 3F8HA 4KFEA 4L8PA 4AKZA 1HU9A 3M8CA 3EX9A 3MYTA 1CYUA 1CQSA 2ML6A 2OTL3 3JUPA 3K63A 3OV4A 1A2VA 1V74A 1OPYA 2HMNB 1GY7A 3E99A 3SVAA 1U8CB 3GZRA 3B8LA 1AV4A 3QK9A 2CK3H 5CF1A 1E3VA 5IW9A 3PYJA 4IT7A 1M9GA 5AEUB 1ZX2A 1GY6A 3S28A 2GEYA 1W00A 3CNXA 4HZ9B 1JB4A 1NO3A 1AVKA 3EHCA 3F7XA 4FCJA 4HM2B 3T8NA 6STDA 1VQK3 4BTYA 3BNDA 1CEWI 4K1UA 1WNHA 3FCSB 3I553 4G1MB 1EQKA 3LTDA 1W01A 3PS8A 1YIT3 4EV5A 1K28A 4IIAA 5IF6A 2YX9A 4KVHA 1IVVA 1N8R4 2YFIB 1GY5A 3HX8A 1SIHA 1LXEA 5AIHA 1IQXA 3GAXA 3JUOA 3O8YA 2BO9B 4HM4B 4TX4A 3X3YA 3CPOA 1UUVB 3SOYA 1T5YA 3F40A 1AR0A 1UI7A 3WA3A 1J2BA 1IT8A 1EA2A 1PU4A 3FG3A 3PCRA 3CPW2 3NQYA 3Q90A 4LSOA 2OTJ3 3VF1A 1FGMA 3G16A 3WMDA 4OK0A 2KRTA 3SOAA 5EVHA 4WWUC 2K0MA 5LC6A 2RCDA 5D83A 1WTHA 5STDA 3KSED 5AYSC 3MKIA 2RFRA 1GD4A 4FCMA 1Q7Y4 2LYXA 2BNGA 2W0QA 3G6E3 2QEX3 5AIFA 3I0YA 3FLJA 3IMAB 1US1A 3BNBA 4N3VA 5CLKA 4AEQA 2ZL8A 3V98A 2STDA 1OUNA 3MWZA 2D42A 1ASKA 2BMRB 3UJMA 3LTAA 1ULIB 1TP6A 1NB3I 1Q864 1IVXA 1JN5B 3EBYA 1ISKA 2M7OA 1TUHA 2OQEA 2FNQA 2P38A 1LOXA 5IG3A 5D82A 4R80A 4HYZA 1D6YA 3EF8A 4FCZA 3V92A 2SBLA 1BUQA 1VQ73 3B4PA 3T8UA 2W56A 3B4OA 3K9MC 1LNHA 3KKGA 3BNEA 3LOYA 4H3UA 1O7PB 4HM1B 3G0KA 2XF3A 3EE1A 4L8OA 3LTCA 1HKXA 3N9HA 2P09A 2Z76A 3GWRA 3KIIA 3CC43 5AIIA 5IENA 4XBTA 1OF5A 4FMDA 1EG9B 3MG1A 2Z6BA 1IU7A 3KFQC 3CCJ3 3NQZA 2CC3A 1IQ8A 5AI1A 3RGRA 1OGXA 3KZTA 3NM7A 2GXFA 4EV2A 3G4S3 1W5ZA 3SEDA 5IEPA 1W6GA 2CFWA 3DGLA 8CHOA 3CCR3 2QA43 1JRQA 2IUJA 2HMMB 2CHCA 3HIGA 3HI7A 4HM0B 2MC8A 3N8BA 2PZVA 1FUWA 2KXGA 2OQEC 3VGNA 2E2VA 1KD14 5JBSA 3SXXA 1K9M4 3LH4A 3CCS3 1IVUA 1FGTA 1RJOA 3DGOA 3MG2A 1YJN3 4L7KA 4HM3B 1DMQA 3NBJA 2D1WA 4R9KA 3F8XA 3AMOB 4CCVA 3KN4A 2HMKB 3ROBA 4JRFA 2MF7A 3ER7A 3FF2A 2W9QA 3STDA 1AVLA 2BMQB 1VQ83 2P0MA 1VQP3 2WGQA 5IG5A 4R4KA 4N6TA 2P0XA 1OHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DRV A;  1O7W B;  4XDV A;  1NDO B;  2XSH B;  4CDL A;  1IDP A;  4LEH A;  1U5O A;  2OWP A;  5KP4 A;  1Q40 B;  4XBX A;  2XSO B;  3FKA A;  5AEW B;  1QMA A;  3OWS A;  4LMI A;  3BB9 A;  4XB5 A;  1STD A;  2F98 A;  5IG4 A;  1NU3 A;  3NHX A;  1VZZ A;  1W6Y A;  3GZY B;  3JUN A;  3K7C A;  5BVB A;  3DM8 A;  4WYK B;  3EN1 B;  3EC9 A;  2CKF B;  3EQQ B;  5JPU A;  2XR8 B;  3D9R A;  5IEO A;  3RGA A;  3K0Z A;  3F7S A;  3NV0 B;  3FH1 A;  4K1V A;  3EBT A;  3GZB A;  7STD A;  1NWW A;  3NUV A;  4X2H A;  4HM8 B;  1OCV A;  3MHE A;  5IER A;  4R9L A;  2GEX A;  3H51 A;  3JUQ A;  5CK6 A;  3DXO A;  2K54 A;  5D81 A;  5JPP A;  1GS3 A;  3KSP A;  2GBX B;  2B1X B;  3FSD A;  3CU3 A;  3HK4 A;  4ORL A;  5IG0 A;  2A15 A;  4Q53 A;  3GRD A;  1OHP A;  4LGQ A;  3LZA A;  4OUQ A;  1ZO2 A;  3F14 A;  4J9A A;  1E3R A;  2F99 A;  4R1K A;  2INX A;  1JN5 A;  4J8T A;  3MG3 A;  3NBR A;  2HML B;  1OHO A;  3OXA A;  5HGR A;  1O7N B;  2GBW B;  4HM7 B;  3IPT A;  4HM6 B;  4GB5 A;  5TGN A;  4X2O A;  1OH0 A;  2RGQ A;  5DRE A;  3JUM A;  2HMJ B;  5G2G A;  3UNL A;  3KE7 A;  1A2K A;  1JKG B;  1ULJ B;  3OWY A;  4WP5 A;  1K41 A;  4MJD A;  1S5A A;  1O7G B;  5AIG A;  1C7H A;  1O7H B;  3F9S A;  4HVN A;  5KP1 A;  4OVM A;  3S5C A;  5FW5 A;  1JB2 A;  4PEJ A;  1W02 A;  2JQ5 A;  5CF2 A;  3FZW A;  3ECF A;  1DMN A;  4HZB B;  1OF5 B;  3EN8 A;  4HKV B;  2B24 B;  1E97 A;  3G8Z A;  1GYB A;  3DMC A;  4HJL B;  4XM4 A;  2QIY A;  4RZM A;  3CNM A;  4U13 A;  3NM2 A;  3OWU A;  2YFL B;  1DMM A;  4XBY A;  3FF0 A;  2R4I A;  1JKG A;  3FGY A;  2F86 B;  2HMO B;  3LYG A;  3HZP A;  2QGU A;  2YFJ B;  1Q40 A;  2Z77 A;  2XRX B;  2IMJ A;  1OGZ A;  2UX0 A;  1JB5 A;  4XDW A;  4HM5 B;  4I4K A;  1Q42 A;  2W2C A;  3NXJ A;  3GZX B;  5CXO A;  1SJW A;  1O7M B;  4WYK A;  3EJV A;  2BMO B;  1Z1S A;  1QJG A;  1WQL B;  3A76 A;  5KP3 A;  5BXQ A;  3B7C A;  3VSY A;  1UUW B;  3MSO A;  3NV0 A;  3OX9 A;  3DUK A;  2I9W A;  3BLZ A;  4STD A;  3H3H A;  2Z7A A;  3F8H A;  4L8P A;  3M8C A;  3EX9 A;  3MYT A;  1CQS A;  3JUP A;  3OV4 A;  1OPY A;  2HMN B;  1GY7 A;  3E99 A;  3GZR A;  3B8L A;  5CF1 A;  1E3V A;  5AEU B;  1ZX2 A;  1GY6 A;  2GEY A;  1W00 A;  3CNX A;  4HZ9 B;  1JB4 A;  4FCJ A;  3EHC A;  3F7X A;  3T8N A;  6STD A;  4HM2 B;  4K1U A;  1W01 A;  4IIA A;  5IF6 A;  4KVH A;  2YFI B;  1GY5 A;  3HX8 A;  5AIH A;  3JUO A;  4HM4 B;  3CPO A;  1UUV B;  3SOY A;  3F40 A;  1AR0 A;  1EA2 A;  3Q90 A;  3WMD A;  3G16 A;  3SOA A;  5EVH A;  4WWU C;  2RCD A;  5D83 A;  5STD A;  3MKI A;  2RFR A;  4FCM A;  2BNG A;  5AIF A;  3I0Y A;  3FLJ A;  4N3V A;  5CLK A;  2STD A;  1OUN A;  1ASK A;  2BMR B;  3UJM A;  1ULI B;  1TP6 A;  1JN5 B;  3EBY A;  1ISK A;  1TUH A;  5IG3 A;  5D82 A;  3EF8 A;  1BUQ A;  3B4P A;  3T8U A;  3B4O A;  3KKG A;  4H3U A;  4HM1 B;  1O7P B;  4L8O A;  3G0K A;  1HKX A;  2Z76 A;  3GWR A;  5AII A;  5IEN A;  4XBT A;  1OF5 A;  1EG9 B;  3MG1 A;  5AI1 A;  3RGR A;  1OGX A;  3KZT A;  2GXF A;  3SED A;  5IEP A;  8CHO A;  2HMM B;  2CHC A;  4HM0 B;  2PZV A;  3VGN A;  3MG2 A;  4L7K A;  4HM3 B;  1DMQ A;  4R9K A;  3F8X A;  2HMK B;  3ROB A;  3ER7 A;  3FF2 A;  3STD A;  2BMQ B;  5IG5 A;  3DZL A;  1OHS A; 
#chains in the Genus database with same CATH topology
 1SII A;  5DRV A;  1MOL A;  1O7W B;  4XDV A;  1NDO B;  2GSP A;  3CC7 3;  2W03 A;  4N6V 0;  2XSH B;  2JDI H;  5FGO A;  1N9J A;  1RCK A;  1BUJ A;  4FR9 A;  4N6U A;  1W6C A;  4CDL A;  1IDP A;  4LEH A;  5EEO A;  1U5O A;  2OWP A;  1QAF A;  1HYF A;  1VQ6 3;  1T2I A;  2J8X B;  5KP4 A;  5I97 A;  1Q40 B;  4MMX B;  1I70 A;  3NX0 A;  4XBX A;  2XSO B;  1LOY A;  3FKA A;  2WGO A;  5AEW B;  1B2U A;  1BOX A;  1QMA A;  3OWS A;  1I0X A;  4LMI A;  3URP A;  1CH0 A;  2W9P A;  3BB9 A;  4XB5 A;  3U1W A;  2O3O A;  1IV7 A;  2H0I A;  4K90 B;  1YGW A;  1STD A;  1BIR A;  1W2Z A;  3ALA A;  4GHO A;  2F98 A;  2CFK A;  1VQO 3;  3FG1 A;  3CCM 3;  1KWI A;  1V57 A;  1YNV X;  3UL6 A;  5IG4 A;  1NU3 A;  4H61 A;  1M1X B;  1QVG 2;  1RN7 A;  1KC8 4;  1UCL A;  3NHX A;  1IK3 A;  4WHA A;  1FUT A;  4ZM8 A;  1VZZ A;  1W6Y A;  1FGQ A;  2RSX A;  3GZY B;  3JUN A;  1C54 A;  1RGL A;  1Y4K A;  3K7C A;  5BVB A;  2IUK A;  3DM8 A;  3N54 B;  4WYK B;  2Y74 A;  1YVB I;  3EN1 B;  3EC9 A;  1A2P A;  1S72 3;  3J7Y d;  2CKF B;  3EQQ B;  3WDG B;  3CME 3;  1FA3 A;  1Q82 4;  5JPU A;  2XR8 B;  3CD6 3;  1YJ9 3;  3D9R A;  1IVW A;  1UI8 A;  5IEO A;  3RGA A;  1B3S A;  3K0Z A;  1B21 A;  1RGC A;  3A5E A;  4IPB A;  4NHF A;  3CMA 3;  4I5Q A;  2W6J H;  3D5G A;  3F7S A;  3NV0 B;  4EBG A;  3FH1 A;  4K1V A;  3OW2 2;  2Q07 A;  1TFO A;  3EBT A;  1QAL A;  1B2M A;  3GZB A;  7STD A;  1YHQ 3;  3LTB A;  4GL6 A;  2KF3 A;  5AYR B;  3X41 A;  1A67 A;  3PGB A;  1NWW A;  1UGI A;  4HOH A;  2BHM A;  3DGM A;  3K5T A;  1GD3 A;  2WOH A;  4QWT A;  3NUV A;  4X2H A;  1ROV A;  4HM8 B;  4KFF A;  1OCV A;  1BRI A;  1BRS A;  2H0G A;  3MHE A;  5IER A;  4R9L A;  1M1K 4;  2CG0 A;  2GEX A;  3FG4 A;  1JBR A;  3U97 A;  1D6U A;  3H51 A;  3PCS A;  4NRE A;  1LVN A;  1YIJ 3;  1K73 4;  1TU5 A;  3JUQ A;  2XEP A;  2CFL A;  1RTU A;  5CK6 A;  1IQY A;  3WOE B;  3DXO A;  2RBI A;  4WFO A;  4BU4 A;  2K54 A;  5D81 A;  1G0T A;  3IJE B;  3KCH A;  4EXR A;  5JPP A;  1UDI I;  1RRH A;  1GS3 A;  3KSP A;  1JV2 B;  2GBX B;  1MNL A;  2C11 A;  2B1X B;  3FSD A;  3CU3 A;  1LNI A;  1NB5 I;  3HK4 A;  3CCU 3;  1YJW 3;  1JBS A;  1W4N A;  1I2F A;  1VQM 3;  4ORL A;  5IG0 A;  1VQQ A;  1FGO A;  1MWT A;  2OOV A;  2A15 A;  4O8S A;  3CCV 3;  4Q53 A;  1STF I;  1GMP A;  1T2H A;  2CH9 A;  1QAK A;  6RNT A;  3CXC 2;  1EKM A;  2UUG C;  1G02 A;  1MWR A;  3L0R A;  4K61 A;  1B2X A;  3GRD A;  1RKY A;  1OHP A;  4O02 B;  1FZU A;  1BNR A;  3AHS A;  4LGQ A;  3LZA A;  4OUQ A;  1ZO2 A;  3F14 A;  4O3V A;  1K8A 4;  4J9A A;  4MMZ B;  3DY5 A;  1E3R A;  2F99 A;  2LQV A;  4N6N B;  4R1K A;  2INX A;  1KQS 2;  1RGE A;  1JN5 A;  4J8T A;  3MG3 A;  3NBR A;  2HML B;  4EYC A;  1B2Z A;  2GU1 A;  1OHO A;  3OXA A;  3CC2 3;  5HGR A;  1TRP A;  1O7N B;  2GBW B;  1UCJ A;  3S67 A;  4HM7 B;  3IPT A;  4HM6 B;  1VQ9 3;  2IA7 A;  2CIU A;  2BIR A;  2CWV A;  4GB5 A;  2OCT A;  1BRJ A;  3CCL 3;  2XFS A;  5TGN A;  1I0V A;  3X3Z A;  1RNB A;  4X2O A;  3RDE A;  1F8N A;  3SYU A;  1OH0 A;  2RGQ A;  4AKY A;  4BTW A;  1L5G B;  1AQZ A;  5DRE A;  3JUM A;  2HMJ B;  2F56 A;  5G2G A;  1FYS A;  3UNL A;  1BRK A;  1W2B 2;  3KE7 A;  1A2K A;  1JNQ A;  4FMB A;  3X42 A;  1JKG B;  1I2E A;  1RDS A;  1ULJ B;  2XGN A;  2OOV C;  2ZA4 A;  1RRL A;  1BNS A;  1TTO A;  4WP5 A;  1K41 A;  1ZS7 A;  4MJD A;  1IV9 A;  1TFK A;  1W7C A;  1RGG A;  1S5A A;  4N6O B;  4HBR A;  1UUG B;  1BNF A;  1MGW A;  3LT8 A;  3Q2P A;  2CX1 A;  1O7G B;  2RNT A;  4RNZ A;  1B20 A;  2KF5 A;  1DVD A;  1G96 A;  3PXM A;  5AIG A;  1C7H A;  2W04 A;  3UB1 A;  1DE3 A;  1O7H B;  2ZDJ A;  3F9S A;  2KCD A;  4HVN A;  2PNC A;  1VQ5 3;  5KP1 A;  1T3B A;  3WOD G;  1VQN 3;  2C10 A;  3LT9 A;  4OVM A;  3S5C A;  2CW9 A;  5FW5 A;  1BGS A;  4FMA A;  3SLU A;  1JB2 A;  1MWU A;  4PEJ A;  1W02 A;  2V1L A;  2JQ5 A;  2W56 B;  5CF2 A;  1GSP A;  2FGT A;  3FZW A;  7GSP A;  2XH9 A;  3DH2 A;  3DGN A;  3ECF A;  3LML A;  1DMN A;  1BSC A;  1UW1 A;  4HZB B;  1YGE A;  4RNY A;  1OF5 B;  3EN8 A;  1I3F A;  4HKV B;  3ZG5 A;  1CYV A;  3AMO A;  3WA2 X;  4HAA A;  2B24 B;  4LZI A;  1E97 A;  3G8Z A;  1A90 A;  3NBB A;  1D6Z A;  1GYB A;  3DMC A;  4HJL B;  1DVC A;  3X3X A;  3CCE 3;  3CCQ 3;  1QVF 2;  3JVC A;  4O2H A;  1N9E A;  5G1L A;  1Q81 4;  4XM4 A;  1OAC A;  2E2T A;  1WMN A;  2QIY A;  2AAD A;  4RZM A;  3CNM A;  1VQL 3;  1BSD A;  3QRD A;  1DET A;  3Q1C A;  1GMR A;  4U13 A;  3NM2 A;  3OWU A;  2YFL B;  1DMM A;  1M90 4;  3LXU X;  4XBY A;  3FF0 A;  3HII A;  2R4I A;  1VQ7 3;  1X1U A;  2CG1 A;  1JKG A;  3FGY A;  2F86 B;  2HMO B;  3V99 A;  3LYG A;  2FXT A;  3HZP A;  2QGU A;  4BTX A;  2O9U X;  5A0O B;  2YFJ B;  1Q40 A;  2Z77 A;  4FMC A;  2F5W A;  3TDG A;  3UL5 A;  4EC6 A;  1JBT A;  2BT3 A;  2E2U A;  1SQW A;  2XRX B;  3GSP A;  3X40 A;  2IMJ A;  2P05 A;  1SAR A;  1MWS A;  1OGZ A;  2UX0 A;  3PZW A;  1IT7 A;  1JB5 A;  2WO0 A;  3HOH A;  4KZ1 A;  4XDW A;  1WMP A;  4MEI A;  4HM5 B;  1MGR A;  4N6L A;  7RNT A;  1BVI A;  2CFG A;  4MMY B;  1VQ4 3;  4I4K A;  1Q42 A;  3SX1 A;  2XGL A;  1V58 A;  2ML5 A;  1EUI C;  4BL3 A;  4JF8 A;  2W2C A;  5EQL A;  3WOF B;  2CWT A;  3NXJ A;  1N5H A;  1WMO A;  3GZX B;  5CXO A;  1YI2 3;  4N6M A;  1SJW A;  1N5P A;  1O7M B;  1RMS A;  5ELJ A;  4WYK A;  3EB8 A;  3DZL A;  3EJV A;  2Y73 A;  2L4V A;  2BMO B;  1DYU A;  1N8Q A;  1QJG A;  1Z1S A;  1RGF A;  1WQL B;  3A76 A;  1HZ1 A;  1ROA A;  3I56 3;  5KP3 A;  5BXQ A;  1LOW A;  3B7C A;  3VSY A;  1UUW B;  1FGR A;  2CFD A;  3MSO A;  3NV0 A;  5ELU A;  5GSP A;  5LC7 A;  3S27 A;  2GU3 A;  3OX9 A;  3T0U A;  3ZFZ A;  1JJ2 2;  3AGN A;  2WOF A;  1KSI A;  3MPH A;  3DUK A;  1R4C A;  2I9W A;  3S29 A;  3BLZ A;  3D4A A;  4STD A;  1ZGX A;  4KFD A;  3H3H A;  1BSB A;  3D3L A;  2XFT A;  1RN4 A;  1SPU A;  1NJI 4;  3BNC A;  3G71 3;  2Z7A A;  2CWU A;  1PFP A;  4RBN A;  1TIJ A;  3F8H A;  4KFE A;  4L8P A;  4AKZ A;  1HU9 A;  3M8C A;  1BNJ A;  1BAN A;  2F4Y A;  3EX9 A;  3MYT A;  1CYU A;  1CQS A;  1UCK A;  2ML6 A;  2OTL 3;  3JUP A;  3K63 A;  3OV4 A;  1A2V A;  1V74 A;  1OPY A;  2HMN B;  1GY7 A;  3E99 A;  3SVA A;  1U8C B;  3GZR A;  3B8L A;  1AV4 A;  1X1W A;  2CK3 H;  1RGH A;  1E3V A;  3QK9 A;  2L1S A;  5CF1 A;  5IW9 A;  3PYJ A;  1BRH A;  3D5I A;  2IYJ A;  1M9G A;  1RCL A;  4IT7 A;  5AEU B;  5M19 A;  1ZX2 A;  3D79 A;  1GY6 A;  3S28 A;  2GEY A;  1W00 A;  3CNX A;  2C4B A;  1NNV A;  4HZ9 B;  4RNT A;  1JB4 A;  1BNI A;  1AVK A;  1NO3 A;  3EHC A;  3F7X A;  4FCJ A;  4HM2 B;  3T8N A;  6STD A;  1RGK A;  1VQK 3;  4BTY A;  3BND A;  5BIR A;  1CEW I;  4K1U A;  1WNH A;  3FCS B;  1AY7 A;  3I55 3;  2CX0 A;  4G1M B;  1EQK A;  3LTD A;  3ZG0 A;  1W01 A;  3PS8 A;  1YIT 3;  4EV5 A;  1K28 A;  1RHL A;  4IIA A;  5IF6 A;  2YX9 A;  1GMQ A;  1BSA A;  4KVH A;  5G1K A;  1IVV A;  1N8R 4;  2YFI B;  1GY5 A;  1B2S A;  3HX8 A;  1SIH A;  1LXE A;  5AIH A;  1IQX A;  4CJN A;  3GAX A;  3JUO A;  3O8Y A;  2BO9 B;  3AHW A;  4HM4 B;  4TX4 A;  3X3Y A;  3CPO A;  1UUV B;  3SOY A;  1T5Y A;  3F40 A;  1AR0 A;  1TRQ A;  1UI7 A;  3WA3 A;  1UCI A;  1J2B A;  1IT8 A;  1EA2 A;  1PU4 A;  3FG3 A;  9RNT A;  3OWY A;  3PCR A;  1BNE A;  3CPW 2;  3NQY A;  3Q90 A;  4LSO A;  2OTJ 3;  3VF1 A;  3AGO A;  1FGM A;  3G16 A;  3WMD A;  4DKI A;  6GSP A;  4OK0 A;  2KRT A;  1RGA A;  2R41 A;  3SOA A;  5EVH A;  4WWU C;  2K0M A;  1FW7 A;  5LC6 A;  2RCD A;  5D83 A;  1WTH A;  5STD A;  1BRG A;  2H0H A;  3KSE D;  5AYS C;  3MKI A;  2RFR A;  1GD4 A;  4FCM A;  1Q7Y 4;  3Q3F A;  2LYX A;  2BNG A;  2W0Q A;  3RNT A;  3G6E 3;  2QEX 3;  5AIF A;  2K3D A;  2KF6 A;  5M1A A;  4BL2 A;  2F5M A;  3FLJ A;  3I0Y A;  3IMA B;  1US1 A;  3BNB A;  4N3V A;  5CLK A;  1PYL A;  4AEQ A;  2ZL8 A;  3V98 A;  1IYY A;  1GOU A;  2STD A;  1OUN A;  3MWZ A;  1B27 A;  2D42 A;  8RNT A;  1ASK A;  2BMR B;  2ZHX B;  3UJM A;  3LTA A;  1ULI B;  1TP6 A;  1NB3 I;  1Q86 4;  1IVX A;  1JN5 B;  3EBY A;  1ISK A;  1LQG C;  1TUH A;  2M7O A;  1I2G A;  2OQE A;  2FNQ A;  2P38 A;  4J5K A;  1LOX A;  1GOY A;  1LOV A;  1X1X A;  4ILF A;  1Q9E A;  5IG3 A;  5D82 A;  4R80 A;  4HYZ A;  4EW5 A;  1I8V A;  1JZO A;  1D6Y A;  3EF8 A;  4FCZ A;  3V92 A;  2IY2 A;  2BU4 A;  2SBL A;  1BUQ A;  1JZD A;  3B4P A;  3T8U A;  2W56 A;  3B4O A;  3K9M C;  1LNH A;  3KKG A;  3BNE A;  3LOY A;  4GSP A;  1O7P B;  4H3U A;  3G0K A;  2XF3 A;  3EE1 A;  4HM1 B;  3LTC A;  1HKX A;  3N9H A;  4L8O A;  4CPK A;  3DGY A;  2P09 A;  2Z76 A;  3GWR A;  2KF4 A;  1YVS A;  3KII A;  5AII A;  3CC4 3;  1R4Y A;  4J5G A;  5IEN A;  4XBT A;  1OF5 A;  4FMD A;  1EG9 B;  3MG1 A;  1RN1 A;  2Z6B A;  1IU7 A;  1LQM B;  1BNG A;  3KFQ C;  3WHO A;  3CCJ 3;  3NQZ A;  2CC3 A;  5HOH A;  1IQ8 A;  5AI1 A;  2HOH A;  3RGR A;  1PY3 A;  1BAO A;  1OGX A;  3KZT A;  3NM7 A;  2GXF A;  4EV2 A;  3G4S 3;  1W5Z A;  3SED A;  1Q7H A;  1TJD A;  5IEP A;  3BU4 A;  1W6G A;  2CFW A;  5RNT A;  3DGL A;  8CHO A;  3CCR 3;  2QA4 3;  2UGI A;  1JRQ A;  2AAE A;  2IUJ A;  1X1Y A;  1BRN L;  2HMM B;  2CHC A;  3HIG A;  1RSN A;  3HI7 A;  5BU4 A;  1UGH I;  1RNT A;  4HM0 B;  2MC8 A;  3N8B A;  3WR2 A;  2PZV A;  1FUW A;  2KXG A;  2OQE C;  3VGN A;  2E2V A;  1KD1 4;  5JBS A;  3SXX A;  1K9M 4;  3LH4 A;  3CCS 3;  1IVU A;  1FGT A;  1RJO A;  3DGO A;  3MG2 A;  1YJN 3;  4L7K A;  1FUS A;  1LRA A;  4HM3 B;  1DMQ A;  1GOV A;  3NBJ A;  1RLS A;  2D1W A;  1BU4 A;  3F8X A;  4R9K A;  3AMO B;  1BSE A;  3BIR A;  4KT3 B;  4CCV A;  2SAR A;  3KN4 A;  2HMK B;  3ROB A;  4JRF A;  2MF7 A;  3ER7 A;  3FF2 A;  2W9Q A;  3STD A;  1AVL A;  2BMQ B;  5M18 A;  1I3I A;  1VQ8 3;  2KAA A;  4BIR A;  2P0M A;  1VQP 3;  2WGQ A;  5IG5 A;  4NPB A;  4R4K A;  4LYL B;  4N6T A;  1EEJ A;  2P0X A;  1OHS A; 
#chains in the Genus database with same CATH homology
 1SII A;  5DRV A;  1MOL A;  1O7W B;  4XDV A;  1NDO B;  3CC7 3;  2W03 A;  4N6V 0;  2XSH B;  2JDI H;  5FGO A;  1N9J A;  4FR9 A;  4N6U A;  1W6C A;  4CDL A;  1IDP A;  4LEH A;  5EEO A;  1U5O A;  2OWP A;  1QAF A;  1VQ6 3;  5KP4 A;  5I97 A;  1Q40 B;  4MMX B;  4XBX A;  3NX0 A;  2XSO B;  3FKA A;  2WGO A;  5AEW B;  1QMA A;  3OWS A;  4LMI A;  2W9P A;  3BB9 A;  4XB5 A;  3U1W A;  2O3O A;  1IV7 A;  4K90 B;  1STD A;  1W2Z A;  3ALA A;  2F98 A;  2CFK A;  1VQO 3;  3FG1 A;  3CCM 3;  1KWI A;  3UL6 A;  5IG4 A;  1NU3 A;  4H61 A;  1M1X B;  1QVG 2;  1RN7 A;  1KC8 4;  3NHX A;  1IK3 A;  4WHA A;  4ZM8 A;  1VZZ A;  1W6Y A;  1FGQ A;  2RSX A;  3GZY B;  3JUN A;  1Y4K A;  3K7C A;  5BVB A;  2IUK A;  3DM8 A;  3N54 B;  4WYK B;  2Y74 A;  1YVB I;  3EN1 B;  3EC9 A;  1S72 3;  3J7Y d;  2CKF B;  3EQQ B;  3WDG B;  3CME 3;  1FA3 A;  1Q82 4;  5JPU A;  2XR8 B;  3CD6 3;  1YJ9 3;  3D9R A;  1IVW A;  1UI8 A;  5IEO A;  3RGA A;  3K0Z A;  4NHF A;  4IPB A;  3CMA 3;  2W6J H;  3F7S A;  3NV0 B;  4EBG A;  3FH1 A;  4K1V A;  3OW2 2;  2Q07 A;  1TFO A;  3EBT A;  1QAL A;  3GZB A;  7STD A;  1YHQ 3;  3LTB A;  4GL6 A;  5AYR B;  3X41 A;  1A67 A;  3PGB A;  1NWW A;  2BHM A;  3DGM A;  3K5T A;  1GD3 A;  2WOH A;  4QWT A;  3NUV A;  4X2H A;  1ROV A;  4HM8 B;  4KFF A;  1OCV A;  3MHE A;  5IER A;  1M1K 4;  4R9L A;  2CG0 A;  2GEX A;  3FG4 A;  3U97 A;  1D6U A;  3H51 A;  3PCS A;  4NRE A;  1LVN A;  1YIJ 3;  1K73 4;  1TU5 A;  3JUQ A;  2XEP A;  2CFL A;  5CK6 A;  1IQY A;  3WOE B;  3DXO A;  4WFO A;  2K54 A;  5D81 A;  3IJE B;  4EXR A;  5JPP A;  1RRH A;  1GS3 A;  3KSP A;  1JV2 B;  2GBX B;  1MNL A;  2C11 A;  2B1X B;  3FSD A;  3CU3 A;  1NB5 I;  3HK4 A;  3CCU 3;  1YJW 3;  1W4N A;  1VQM 3;  4ORL A;  5IG0 A;  2OOV A;  1FGO A;  2A15 A;  4O8S A;  3CCV 3;  4Q53 A;  1STF I;  3CXC 2;  2CH9 A;  1QAK A;  1EKM A;  3L0R A;  4K61 A;  3GRD A;  1RKY A;  1OHP A;  4O02 B;  4LGQ A;  3LZA A;  4OUQ A;  1ZO2 A;  3F14 A;  4O3V A;  1K8A 4;  4J9A A;  4MMZ B;  3DY5 A;  1E3R A;  2F99 A;  2LQV A;  4N6N B;  4R1K A;  2INX A;  1KQS 2;  1JN5 A;  4J8T A;  3MG3 A;  3NBR A;  2HML B;  4EYC A;  2GU1 A;  1OHO A;  3OXA A;  3CC2 3;  5HGR A;  1O7N B;  2GBW B;  3S67 A;  4HM7 B;  3IPT A;  4HM6 B;  1VQ9 3;  2IA7 A;  2CIU A;  2CWV A;  4GB5 A;  2OCT A;  3CCL 3;  2XFS A;  5TGN A;  3X3Z A;  4X2O A;  3RDE A;  1F8N A;  4AKY A;  1OH0 A;  2RGQ A;  4BTW A;  1L5G B;  5DRE A;  3JUM A;  2HMJ B;  5G2G A;  3UNL A;  1W2B 2;  3KE7 A;  1A2K A;  1JNQ A;  4FMB A;  3X42 A;  1JKG B;  1ULJ B;  2XGN A;  3OWY A;  2OOV C;  1RRL A;  4WP5 A;  1K41 A;  4MJD A;  1IV9 A;  1TFK A;  1W7C A;  1S5A A;  4N6O B;  4HBR A;  3Q2P A;  3LT8 A;  1O7G B;  4RNZ A;  1DVD A;  1G96 A;  3PXM A;  5AIG A;  1C7H A;  2W04 A;  3UB1 A;  1O7H B;  2ZDJ A;  3F9S A;  2KCD A;  4HVN A;  2PNC A;  1VQ5 3;  5KP1 A;  3WOD G;  1VQN 3;  2C10 A;  3LT9 A;  4OVM A;  3S5C A;  2CW9 A;  5FW5 A;  4FMA A;  3SLU A;  1JB2 A;  4PEJ A;  1W02 A;  2V1L A;  2JQ5 A;  2W56 B;  5CF2 A;  2FGT A;  3FZW A;  2XH9 A;  3DGN A;  3ECF A;  3LML A;  1DMN A;  1UW1 A;  4HZB B;  1YGE A;  4RNY A;  1OF5 B;  3EN8 A;  4HKV B;  1CYV A;  3AMO A;  3WA2 X;  2B24 B;  4LZI A;  1E97 A;  3G8Z A;  1A90 A;  3NBB A;  1GYB A;  1D6Z A;  3DMC A;  4HJL B;  1DVC A;  3X3X A;  3CCE 3;  3CCQ 3;  1QVF 2;  3JVC A;  4O2H A;  1N9E A;  1Q81 4;  4XM4 A;  1OAC A;  2E2T A;  1WMN A;  2QIY A;  4RZM A;  3CNM A;  1VQL 3;  3QRD A;  3Q1C A;  4U13 A;  3NM2 A;  3OWU A;  2YFL B;  1DMM A;  1M90 4;  3LXU X;  4XBY A;  3FF0 A;  3HII A;  2R4I A;  2CG1 A;  1JKG A;  3FGY A;  2F86 B;  2HMO B;  3V99 A;  3LYG A;  2FXT A;  3HZP A;  2QGU A;  4BTX A;  2O9U X;  5A0O B;  2YFJ B;  1Q40 A;  2Z77 A;  4FMC A;  3TDG A;  3UL5 A;  4EC6 A;  2BT3 A;  2E2U A;  1SQW A;  2XRX B;  3X40 A;  2P05 A;  2IMJ A;  1OGZ A;  2UX0 A;  3PZW A;  1IT7 A;  1JB5 A;  2WO0 A;  4KZ1 A;  4XDW A;  1WMP A;  4MEI A;  4HM5 B;  4N6L A;  2CFG A;  4MMY B;  1VQ4 3;  4I4K A;  1Q42 A;  3SX1 A;  2XGL A;  2ML5 A;  4JF8 A;  2W2C A;  5EQL A;  3WOF B;  2CWT A;  3NXJ A;  1N5H A;  1WMO A;  3GZX B;  5CXO A;  1YI2 3;  4N6M A;  1SJW A;  1N5P A;  1O7M B;  5ELJ A;  4WYK A;  3EB8 A;  3DZL A;  3EJV A;  2Y73 A;  2L4V A;  2BMO B;  1DYU A;  1N8Q A;  1QJG A;  1Z1S A;  1WQL B;  3A76 A;  1ROA A;  3I56 3;  5KP3 A;  5BXQ A;  3B7C A;  3VSY A;  1UUW B;  1FGR A;  2CFD A;  3MSO A;  3NV0 A;  5ELU A;  5LC7 A;  3S27 A;  3T0U A;  2GU3 A;  3OX9 A;  1JJ2 2;  2WOF A;  1KSI A;  3MPH A;  3DUK A;  1R4C A;  2I9W A;  3S29 A;  3BLZ A;  4STD A;  4KFD A;  3H3H A;  3D3L A;  2XFT A;  1SPU A;  1NJI 4;  3BNC A;  3G71 3;  2Z7A A;  2CWU A;  1PFP A;  4RBN A;  1TIJ A;  3F8H A;  4KFE A;  4L8P A;  4AKZ A;  1HU9 A;  3M8C A;  3EX9 A;  3MYT A;  1CYU A;  1CQS A;  2ML6 A;  2OTL 3;  3JUP A;  3K63 A;  3OV4 A;  1A2V A;  1V74 A;  1OPY A;  2HMN B;  1GY7 A;  3E99 A;  3SVA A;  1U8C B;  3GZR A;  3B8L A;  1AV4 A;  3QK9 A;  2CK3 H;  5CF1 A;  1E3V A;  5IW9 A;  3PYJ A;  4IT7 A;  1M9G A;  5AEU B;  1ZX2 A;  1GY6 A;  3S28 A;  2GEY A;  1W00 A;  3CNX A;  4HZ9 B;  1JB4 A;  1NO3 A;  1AVK A;  3EHC A;  3F7X A;  4FCJ A;  4HM2 B;  3T8N A;  6STD A;  1VQK 3;  4BTY A;  3BND A;  1CEW I;  4K1U A;  1WNH A;  3FCS B;  3I55 3;  4G1M B;  1EQK A;  3LTD A;  1W01 A;  3PS8 A;  1YIT 3;  4EV5 A;  1K28 A;  4IIA A;  5IF6 A;  2YX9 A;  4KVH A;  1IVV A;  1N8R 4;  2YFI B;  1GY5 A;  3HX8 A;  1SIH A;  1LXE A;  5AIH A;  1IQX A;  3GAX A;  3JUO A;  3O8Y A;  2BO9 B;  4HM4 B;  4TX4 A;  3X3Y A;  3CPO A;  1UUV B;  3SOY A;  1T5Y A;  3F40 A;  1AR0 A;  1UI7 A;  3WA3 A;  1J2B A;  1IT8 A;  1EA2 A;  1PU4 A;  3FG3 A;  3PCR A;  3CPW 2;  3NQY A;  3Q90 A;  4LSO A;  2OTJ 3;  3VF1 A;  1FGM A;  3G16 A;  3WMD A;  4OK0 A;  2KRT A;  3SOA A;  5EVH A;  4WWU C;  2K0M A;  5LC6 A;  2RCD A;  5D83 A;  1WTH A;  5STD A;  3KSE D;  5AYS C;  3MKI A;  2RFR A;  1GD4 A;  4FCM A;  1Q7Y 4;  2LYX A;  2BNG A;  2W0Q A;  3G6E 3;  2QEX 3;  5AIF A;  3I0Y A;  3FLJ A;  3IMA B;  1US1 A;  3BNB A;  4N3V A;  5CLK A;  4AEQ A;  2ZL8 A;  3V98 A;  2STD A;  1OUN A;  3MWZ A;  2D42 A;  1ASK A;  2BMR B;  3UJM A;  3LTA A;  1ULI B;  1TP6 A;  1NB3 I;  1Q86 4;  1IVX A;  1JN5 B;  3EBY A;  1ISK A;  2M7O A;  1TUH A;  2OQE A;  2FNQ A;  2P38 A;  1LOX A;  5IG3 A;  5D82 A;  4R80 A;  4HYZ A;  1D6Y A;  3EF8 A;  4FCZ A;  3V92 A;  2SBL A;  1BUQ A;  1VQ7 3;  3B4P A;  3T8U A;  2W56 A;  3B4O A;  3K9M C;  1LNH A;  3KKG A;  3BNE A;  3LOY A;  4H3U A;  1O7P B;  4HM1 B;  3G0K A;  2XF3 A;  3EE1 A;  4L8O A;  3LTC A;  1HKX A;  3N9H A;  2P09 A;  2Z76 A;  3GWR A;  3KII A;  3CC4 3;  5AII A;  5IEN A;  4XBT A;  1OF5 A;  4FMD A;  1EG9 B;  3MG1 A;  2Z6B A;  1IU7 A;  3KFQ C;  3CCJ 3;  3NQZ A;  2CC3 A;  1IQ8 A;  5AI1 A;  3RGR A;  1OGX A;  3KZT A;  3NM7 A;  2GXF A;  4EV2 A;  3G4S 3;  1W5Z A;  3SED A;  5IEP A;  1W6G A;  2CFW A;  3DGL A;  8CHO A;  3CCR 3;  2QA4 3;  1JRQ A;  2IUJ A;  2HMM B;  2CHC A;  3HIG A;  3HI7 A;  4HM0 B;  2MC8 A;  3N8B A;  2PZV A;  1FUW A;  2KXG A;  2OQE C;  3VGN A;  2E2V A;  1KD1 4;  5JBS A;  3SXX A;  1K9M 4;  3LH4 A;  3CCS 3;  1IVU A;  1FGT A;  1RJO A;  3DGO A;  3MG2 A;  1YJN 3;  4L7K A;  4HM3 B;  1DMQ A;  3NBJ A;  2D1W A;  4R9K A;  3F8X A;  3AMO B;  4CCV A;  3KN4 A;  2HMK B;  3ROB A;  4JRF A;  2MF7 A;  3ER7 A;  3FF2 A;  2W9Q A;  3STD A;  1AVL A;  2BMQ B;  1VQ8 3;  2P0M A;  1VQP 3;  2WGQ A;  5IG5 A;  4R4K A;  4N6T A;  2P0X A;  1OHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...