1SJWA

Structure of polyketide cyclase snoal
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
SRQTEIVRRMVSAFNTGRTDDVDEYIHPDYLNPATLEHGIHTGPKAFAQLVGWVRATFSEEARLEEVRIEERGPWVKAYLVLYGRHVGRLVGMPPTDRRFSGEQVHLMRIVDGKIRDHRDWPDFQGTLRQLGDPWPDDEGWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nogalonic acid methyl ester cyclase
publication title Structure of the polyketide cyclase SnoaL reveals a novel mechanism for enzymatic aldol condensation.
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Lyase
total genus 40
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1sjwA00
3MSOA 3F40A 3KZTA 5HGRA 3JUOA 5DRVA 3EHCA 1GY7A 5AEWB 4K1UA 5KP4A 2GBXB 2K54A 3E99A 4PEJA 4OVMA 1K41A 3FF0A 4STDA 4XBTA 1W02A 3F7SA 5CLKA 1W01A 3EBYA 3CPOA 3NV0B 1AR0A 3T8NA 1TP6A 1EA2A 4XBXA 2RGQA 3DZLA 1O7PB 3RGAA 3F8XA 3FGYA 1W6YA 2BMQB 1VZZA 4XDWA 4R9LA 4R9KA 2BMOB 3BLZA 5STDA 3OX9A 6STDA 4K1VA 4RZMA 3T8UA 4OUQA 5BXQA 2Z77A 1NU3A 3H51A 1U5OA 5AIFA 3NM2A 1O7MB 3GZBA 4X2OA 3NUVA 2GEXA 1GS3A 4L8OA 1STDA 3B8LA 4HM1B 3K7CA 2B24B 4H3UA 2UX0A 4HVNA 5JPPA 4HZ9B 1E3VA 3MHEA 3D9RA 5AIIA 3IPTA 2XR8B 1GYBA 2OWPA 5IG4A 5IENA 3F9SA 1O7GB 3M8CA 5CK6A 3EN1B 1JB2A 3EQQB 1OF5B 1O7WB 1ISKA 4WYKB 3JUMA 1OHOA 3MYTA 4X2HA 1HKXA 2BMRB 3BB9A 3EJVA 4HJLB 3DMCA 1DMQA 5TGNA 1OHPA 3GRDA 4HM5B 3VGNA 3HK4A 3SEDA 1JB4A 5DREA 1GY5A 1DMMA 3H3HA 3KKGA 4XBYA 1DMNA 3CNXA 5EVHA 1OPYA 3STDA 1O7NB 3NXJA 4HM3B 2R4IA 3UJMA 1UUVB 1JB5A 2HMLB 3S5CA 1ASKA 1OGZA 4HM7B 4FCMA 2BNGA 3ER7A 4CDLA 1S5AA 3GWRA 3FLJA 5AI1A 1EG9B 2HMOB 3CU3A 3HZPA 5AIHA 4HM0B 3DUKA 1WQLB 5AIGA 3G0KA 3K0ZA 3G16A 1OUNA 3SOAA 1ZX2A 5D82A 3KSPA 4LGQA 5KP1A 2F99A 3OXAA 1SJWA 1JN5B 2JQ5A 3NHXA 2HMJB 4I4KA 3NV0A 1BUQA 1Q40B 3ECFA 4XB5A 1E3RA 1TUHA 1UUWB 4HM4B 4ORLA 5D81A 5IG3A 3B7CA 3WMDA 2QIYA 5IERA 5IG5A 3FH1A 4KVHA 1NWWA 2HMMB 5AEUB 3JUNA 5IF6A 4J9AA 2Z7AA 5CF2A 3SOYA 4L8PA 1Q40A 3Q90A 3EBTA 3MG2A 1A2KA 2YFJB 2F86B 3MKIA 2INXA 2W2CA 5BVBA 3RGRA 3G8ZA 1ZO2A 1O7HB 3EX9A 4R1KA 2HMKB 3F8HA 2RFRA 5IEOA 3MG1A 2XSHB 4GB5A 3LZAA 1OF5A 3B4OA 4WYKA 4HKVB 3FKAA 2XSOB 5IG0A 4WWUC 3KE7A 1OGXA 4U13A 2I9WA 3FZWA 3I0YA 2YFIB 3GZRA 3VSYA 3DXOA 5CXOA 1GY6A 1QJGA 2A15A 4J8TA 2CKFB 1OHSA 4LEHA 4HZBB 4IIAA 3EF8A 5D83A 2QGUA 5JPUA 7STDA 1JKGB 1CQSA 3NBRA 1QMAA 3F7XA 2PZVA 5CF1A 4FCJA 3F14A 3FF2A 1ULIB 1E97A 3DM8A 2XRXB 1ULJB 3OWSA 4HM6B 1OCVA 3GZXB 3OWYA 3OV4A 3B4PA 2Z76A 2B1XB 3MG3A 5FW5A 1JKGA 2GXFA 2IMJA 4HM8B 4LMIA 2F98A 1Z1SA 4N3VA 3GZYB 3HX8A 1IDPA 4L7KA 5IEPA 4Q53A 1Q42A 1JN5A 1C7HA 3FSDA 5KP3A 1W00A 2CHCA 3ROBA 3JUQA 2YFLB 2GEYA 4HM2B 3JUPA 4MJDA 2STDA 3LYGA 2GBWB 4WP5A 4XM4A 1NDOB 4XDVA 3EN8A 3CNMA 3OWUA 5G2GA 3A76A 3UNLA 2HMNB 1OH0A 2RCDA 3EC9A 8CHOA
chains in the Genus database with same CATH superfamily
4EBGA 1DE3A 2C10A 2BHMA 1I2EA 3N8BA 3MSOA 2E2VA 3F40A 4MMXB 3KZTA 2OOVA 1T2HA 2AADA 1MWRA 4BU4A 5HGRA 3WOEB 3JUOA 5DRVA 1RGLA 2JDIH 3BU4A 3KCHA 3EHCA 2ZL8A 4HOHA 1UCKA 1GY7A 4BTYA 5AEWB 1IVUA 1I3IA 2D42A 1VQK3 4FCZA 1MGRA 3WOFB 1TIJA 3AGNA 1B21A 1V74A 4EXRA 1UCLA 1Q7HA 1VQ93 2F5MA 3PZWA 2FXTA 1T2IA 2LQVA 3DGLA 1QAFA 3Q2PA 4J5KA 3LOYA 1A2VA 3DGYA 1EUIC 4JF8A 3CCV3 2IUJA 4K1UA 1RGHA 5KP4A 2XGNA 4NPBA 2GBXB 2K54A 5A0OB 3E99A 4PEJA 4OVMA 1RSNA 4G1MB 4AEQA 1RGFA 3SLUA 1K41A 3FF0A 1B20A 1I70A 2KF5A 5RNTA 1A67A 3CCQ3 2H0GA 4STDA 1U8CB 2CH9A 4XBTA 1W02A 2KF4A 3PCSA 2KCDA 1BRHA 4RNTA 2W9PA 2KRTA 3JVCA 1B3SA 3F7SA 5CLKA 1N8R4 1W01A 1LQMB 3EBYA 2CWVA 1AV4A 3CPOA 3NV0B 1AVLA 1AR0A 1I2FA 1PFPA 1GD3A 2RSXA 3T8NA 4ZM8A 1BRIA 3PS8A 3I563 4BIRA 1GD4A 1BRKA 1TP6A 3CC23 1EA2A 4XBXA 1M1K4 4GSPA 2RGQA 3DZLA 2AAEA 3BNBA 1O7PB 3RGAA 3S27A 1AQZA 1YJ93 1LQGC 3F8XA 3FGYA 2WO0A 2KXGA 1W6YA 1IVVA 4QWTA 2BMQB 1VZZA 1Y4KA 2W56A 2KF6A 4R9LA 4R9KA 2C11A 4NREA 4XDWA 1DETA 3ZG5A 2K0MA 2BMOB 3DY5A 3DGNA 1VQ73 1GMQA 4TX4A 5FGOA 3U97A 3UL5A 2F56A 1IYYA 1MNLA 1N9JA 3BLZA 3OX9A 5LC7A 5STDA 6STDA 4K1VA 3LTAA 4RZMA 1NJI4 3T8UA 1RRHA 4OUQA 2OQEC 5BXQA 2W6JH 2Z77A 1NU3A 3H51A 3L0RA 3OW22 1U5OA 3ZFZA 5AIFA 3NM2A 1O7MB 4BTWA 3GZBA 3KIIA 4X2OA 1W2ZA 1RHLA 3NUVA 4EC6A 2GEXA 2ZHXB 3S67A 2J8XB 1MGWA 1GS3A 1VQ43 4L8OA 1STDA 3B8LA 2UGIA 1US1A 1BVIA 1EKMA 1RGEA 4N6OB 5ELUA 3DGOA 1UCIA 1BRNL 1YIJ3 1UCJA 1N5HA 1FUTA 1FYSA 3TDGA 1JBSA 1KSIA 1DYUA 1X1YA 3NBBA 1AVKA 3DH2A 3D4AA 4HM1B 3K7CA 1NB3I 1EEJA 3V92A 2B24B 1I2GA 4FR9A 5G1KA 4H3UA 1M9GA 2UX0A 4HVNA 2W9QA 2E2UA 1WMNA 5JPPA 4HZ9B 1Q824 3PGBA 1E3VA 1GOVA 1TFKA 3MHEA 3CCU3 1DVCA 1OACA 3D9RA 5AIIA 3D3LA 1BSEA 4GL6A 1D6ZA 3IPTA 1IQ8A 2XR8B 1GYBA 2OWPA 1RGKA 1GOUA 3F9SA 5IG4A 4WHAA 5IENA 1FA3A 1O7GB 4AKZA 3U1WA 3M8CA 2SBLA 5CK6A 4KFDA 5BIRA 1Q814 3EN1B 1UUGB 1JB2A 3EQQB 2BO9B 1OF5B 1TFOA 3SX1A 1NNVA 1O7WB 2BIRA 3CCE3 1ISKA 4KT3B 3WODG 4WYKB 4N6NB 4N6TA 3JUMA 4BL3A 2IA7A 1OHOA 1WNHA 2M7OA 3MYTA 3N54B 4X2HA 1BGSA 1HKXA 2Y73A 4CPKA 3X3YA 2BMRB 2KF3A 2WOFA 3BB9A 3EJVA 3KN4A 1BSBA 4HJLB 7RNTA 4EV5A 2SARA 1IV9A 1DMQA 3DMCA 5TGNA 1LRAA 2WOHA 1IQXA 2L4VA 1OHPA 1LNIA 2CK3H 1IV7A 2RBIA 2ZA4A 3GRDA 4HM5B 3VGNA 1RKYA 1ZGXA 3HK4A 3NBJA 1JB4A 3LT8A 3SEDA 1IK3A 2CWUA 3AMOA 5DREA 3KFQC 3URPA 1GY5A 3WA3A 1IU7A 1VQM3 1DMMA 4WFOA 3H3HA 3KKGA 4XBYA 1WMPA 2CWTA 1IQYA 1DMNA 1JRQA 4BL2A 3CNXA 3LMLA 1OPYA 5EVHA 1BUJA 4RNZA 5G1LA 1RCLA 2XFTA 1YGWA 1RN4A 1ZS7A 3AGOA 3D79A 3D5GA 1BNIA 3STDA 2CFGA 4JRFA 1O7NB 3D5IA 2PNCA 3NXJA 1YVSA 1SARA 1STFI 4HM3B 1RLSA 1FGOA 1Q864 2BT3A 1BNGA 2R4IA 4MMYB 1UUVB 4IT7A 5LC6A 1BNFA 3UJMA 1JB5A 2HMLB 1WTHA 3S5CA 1VQL3 4LZIA 1ASKA 1M1XB 3LTDA 1OGZA 1RNTA 3IJEB 4HYZA 4HM7B 3PXMA 4FCMA 1JJ22 2OQEA 2BNGA 3X41A 3GAXA 3ER7A 4HBRA 4CDLA 1S5AA 1TTOA 3CC43 3CME3 4EYCA 4O8SA 1JZDA 1W5ZA 3GWRA 3FLJA 1K9M4 3FCSB 2CW9A 3N9HA 1RGGA 5AI1A 1EG9B 1W2B2 1R4CA 2HOHA 4H61A 1RNBA 1BRSA 2HMOB 1W6GA 2MC8A 2ML6A 3CU3A 3HZPA 5AIHA 4HM0B 4EW5A 1N8QA 1NO3A 1YGEA 3DUKA 1WQLB 5AIGA 3G0KA 5EQLA 3K0ZA 3CCL3 3G16A 3IMAB 3K9MC 1CYUA 1OUNA 1FW7A 1Q9EA 4O02B 1KC84 3SOAA 1ZX2A 1I8VA 5D82A 3SVAA 1UGIA 1T5YA 3KSED 5ELJA 3AHWA 3KSPA 3NM7A 2CX0A 3QK9A 4N6MA 4LGQA 3FG4A 1GOYA 1TU5A 5KP1A 2F99A 3OXAA 2CX1A 2W0QA 1SJWA 1JN5B 2JQ5A 3DGMA 1D6YA 3NHXA 2WGQA 2HMJB 1UI7A 1M904 4I4KA 1AY7A 3AHSA 3RDEA 2R41A 2XFSA 3ALAA 1QALA 3HOHA 3NV0A 3T0UA 1FGMA 1VQ63 1BUQA 2IUKA 3CMA3 1Q40B 1KWIA 3ECFA 4FMDA 4XB5A 1E3RA 1TUHA 1UUWB 4HM4B 4ORLA 5D81A 3UL6A 3FG1A 5IW9A 3UB1A 1G96A 1QAKA 1YVBI 1HZ1A 5IG3A 3B7CA 2P38A 4LSOA 1K28A 2F5WA 4KZ1A 3WMDA 1VQN3 2QIYA 4KFFA 4RNYA 1FGTA 5AYSC 4KFEA 1N9EA 5BU4A 5IERA 2CFKA 5IG5A 5M18A 1TRPA 2OCTA 2FNQA 1BU4A 3FH1A 4KVHA 3G6E3 1BAOA 1NWWA 2CC3A 2HMMB 1BRGA 1LVNA 5AEUB 1PY3A 3JUNA 1GSPA 4MMZB 1JNQA 2O9UX 2CG1A 5IF6A 1RN7A 1RJOA 4AKYA 3Q1CA 4J9AA 1BNJA 3WDGB 3MPHA 2Z7AA 4GHOA 1UW1A 5CF2A 4R4KA 1FZUA 1LOVA 3SOYA 1QVG2 3EC9A 3NQYA 4MEIA 2V1LA 4L8PA 3HI7A 3LH4A 1Q40A 2W03A 4O2HA 3Q90A 3EBTA 4DKIA 1UGHI 2UUGC 1TRQA 2QEX3 3MG2A 3QRDA 1A2KA 2YFJB 3FG3A 2F86B 3MKIA 1C54A 2D1WA 4LYLB 1YI23 2MF7A 1D6UA 2INXA 1F8NA 4FMCA 7GSPA 1VQP3 1RTUA 1JBTA 6RNTA 2W2CA 2GSPA 3CXC2 3WHOA 5BVBA 1V57A 3RGRA 1B27A 1YJW3 1G0TA 1IVXA 3G8ZA 9RNTA 2P05A 1ZO2A 1LNHA 3BIRA 1PYLA 1KD14 3A5EA 1O7HB 3HIGA 3SXXA 3EX9A 1B2UA 1BANA 1I0VA 3K5TA 2P0XA 3NQZA 4R1KA 5AYRB 1JBRA 1IVWA 4R80A 3CCS3 2K3DA 1NB5I 2HMKB 2Q07A 1IT8A 3K63A 3MWZA 4ILFA 3F8HA 2RFRA 3WR2A 3LXUX 3CPW2 1N5PA 5IEOA 2CFDA 3MG1A 3PYJA 2L1SA 3VF1A 2XSHB 4GB5A 1QVF2 3LZAA 1OF5A 3NX0A 3B4OA 1VQO3 1I3FA 4K61A 4WYKA 1BOXA 3CCJ3 1ROVA 4N6LA 2OTL3 4HKVB 3FKAA 3BNDA 1UI8A 2XSOB 3X3XA 1B2XA 1K734 2KAAA 1VQ83 5IG0A 5HOHA 2W04A 3RNTA 4WWUC 3X40A 3KE7A 1OGXA 2IY2A 2I9WA 1LOXA 2O3OA 4U13A 3FZWA 1L5GB 3S28A 3SYUA 1B2MA 1W4NA 4CJNA 1GMPA 3EE1A 2P0MA 1BNSA 3I0YA 2H0HA 5GSPA 1YJN3 1KQS2 3X42A 1BRJA 2YFIB 3GZRA 3VSYA 4FMAA 3Q3FA 2WGOA 3DXOA 1PU4A 3G4S3 1LXEA 1GY6A 1QJGA 5CXOA 3WA2X 1BNEA 2W56B 2A15A 2Z6BA 2XGLA 1BSCA 4J8TA 1FUWA 2CKFB 1ROAA 2OOVC 1OHSA 4LEHA 4HAAA 4HZBB 4IIAA 3EF8A 5D83A 2QGUA 3BNCA 5JPUA 7STDA 1JKGB 1CH0A 1SQWA 1CQSA 1RRLA 2ML5A 3NBRA 4I5QA 4K90B 1QMAA 2RNTA 3F7XA 3CCR3 2CFLA 2PZVA 5CF1A 5JBSA 1SIHA 2GU1A 4FCJA 1CEWI 2Y74A 2ZDJA 3F14A 3FF2A 1ULIB 1E97A 1JZOA 3DM8A 2XRXB 2F4YA 1J2BA 1ULJB 3OWSA 4HM6B 1RMSA 1SIIA 1OCVA 2GU3A 3GSPA 2E2TA 1R4YA 3GZXB 2IYJA 3OWYA 2OTJ3 3OV4A 1W6CA 3BNEA 8RNTA 3B4PA 3ZG0A 1FGRA 2Z76A 2B1XB 5M1AA 4EV2A 1FGQA 3MG3A 1BSDA 3CC73 5FW5A 1RDSA 1FUSA 1BIRA 1X1UA 2C4BA 1LOYA 1JKGA 2GXFA 3EB8A 1B2SA 4IPBA 2IMJA 4HM8B 6GSPA 4LMIA 2F98A 4O3VA 1Z1SA 2H0IA 1IT7A 5M19A 4N3VA 3GZYB 1YIT3 2CG0A 1IDPA 3HX8A 4L7KA 2CIUA 2YX9A 4RBNA 4J5GA 5IEPA 3O8YA 1BSAA 1MWTA 1Q42A 1JN5A 4NHFA 1C7HA 4Q53A 1RGCA 1WMOA 1V58A 3CCM3 1A90A 3X3ZA 5I97A 3V99A 3FSDA 1YNVX 5KP3A 1W00A 2CHCA 3V98A 3ROBA 4CCVA 3S29A 1S723 1A2PA 3J7Yd 3JUQA 2XF3A 1X1XA 2YFLB 1UDII 1LOWA 2GEYA 4HM2B 1Q7Y4 1RGAA 1DVDA 1B2ZA 1TJDA 1MWUA 3I553 1VQ53 1JV2B 3HIIA 4FMBA 4N6UA 1EQKA 3JUPA 3LTCA 3LTBA 4MJDA 2STDA 3CD63 2XH9A 1T3BA 3LYGA 4WP5A 1RCKA 2FGTA 2BU4A 4XM4A 3LT9A 1NDOB 1SPUA 2XEPA 4XDVA 1K8A4 3AMOB 3G713 3EN8A 3CNMA 1RN1A 3OWUA 4N6V0 4OK0A 4BTXA 1G02A 1W7CA 3PCRA 1CYVA 5EEOA 1GMRA 1X1WA 5G2GA 1HU9A 2P09A 3A76A 1BNRA 3UNLA 2QA43 1VQQA 2HMNB 2CFWA 1OH0A 2LYXA 1YHQ3 1HYFA 2RCDA 2GBWB 1MOLA 1MWSA 1I0XA 8CHOA
chains in the Genus database with same CATH topology
4EBGA 2C10A 2BHMA 3N8BA 3MSOA 2E2VA 3F40A 4MMXB 3KZTA 2OOVA 5HGRA 3WOEB 3JUOA 5DRVA 2JDIH 3EHCA 2ZL8A 1GY7A 4BTYA 5AEWB 1IVUA 2D42A 1VQK3 4FCZA 3WOFB 1TIJA 1V74A 4EXRA 1VQ93 3PZWA 2FXTA 2LQVA 3DGLA 1QAFA 3Q2PA 3LOYA 1A2VA 4JF8A 3CCV3 2IUJA 4K1UA 5KP4A 2XGNA 2GBXB 2K54A 5A0OB 3E99A 4PEJA 4OVMA 4G1MB 4AEQA 3SLUA 1K41A 3FF0A 1A67A 3CCQ3 4STDA 1U8CB 2CH9A 4XBTA 1W02A 3PCSA 2KCDA 2W9PA 2KRTA 3JVCA 3F7SA 5CLKA 1N8R4 1W01A 3EBYA 2CWVA 1AV4A 3CPOA 3NV0B 1AVLA 1AR0A 1PFPA 1GD3A 2RSXA 3T8NA 4ZM8A 3PS8A 3I563 1GD4A 1TP6A 3CC23 1EA2A 4XBXA 1M1K4 2RGQA 3DZLA 3S27A 3BNBA 1O7PB 3RGAA 1YJ93 1VQ43 3F8XA 3FGYA 2WO0A 2KXGA 1W6YA 1IVVA 4QWTA 2BMQB 1VZZA 1Y4KA 2W56A 4R9LA 4XDWA 4R9KA 2C11A 4NREA 2K0MA 2BMOB 3DY5A 3DGNA 1VQ73 4TX4A 5FGOA 3U97A 3UL5A 1MNLA 1N9JA 3BLZA 3OX9A 5LC7A 5STDA 6STDA 4K1VA 3LTAA 4RZMA 1NJI4 3T8UA 1RRHA 4OUQA 2OQEC 5BXQA 2W6JH 2Z77A 1NU3A 3H51A 3L0RA 3OW22 1U5OA 5AIFA 3NM2A 1O7MB 4BTWA 3GZBA 3KIIA 4X2OA 1W2ZA 3NUVA 4EC6A 2GEXA 3S67A 1GS3A 4L8OA 1STDA 3B8LA 1US1A 1EKMA 4N6OB 5ELUA 3DGOA 1YIJ3 1N5HA 3TDGA 1KSIA 1DYUA 3NBBA 1AVKA 4HM1B 3K7CA 1NB3I 3V92A 3I553 2B24B 4FR9A 4H3UA 1M9GA 2UX0A 4HVNA 2W9QA 2E2UA 1WMNA 5JPPA 4HZ9B 1Q824 3PGBA 1E3VA 1TFKA 3MHEA 3CCU3 1DVCA 1OACA 3D9RA 5AIIA 3D3LA 4GL6A 1D6ZA 3IPTA 1IQ8A 2XR8B 1GYBA 2OWPA 5IG4A 5IENA 3F9SA 1FA3A 4WHAA 1O7GB 4AKZA 3U1WA 3M8CA 2SBLA 5CK6A 4KFDA 1Q814 3EN1B 1JB2A 3EQQB 2BO9B 1OF5B 1TFOA 3SX1A 3CCE3 1O7WB 1ISKA 3WODG 4WYKB 4N6NB 4N6TA 3JUMA 2IA7A 1OHOA 1WNHA 2M7OA 3MYTA 3N54B 4X2HA 1HKXA 2Y73A 3X3YA 2BMRB 2WOFA 3BB9A 3EJVA 3KN4A 4HJLB 4EV5A 3DMCA 1IV9A 1DMQA 5TGNA 2WOHA 1IQXA 2L4VA 1OHPA 2CK3H 1IV7A 3GRDA 4HM5B 3VGNA 1RKYA 3HK4A 3NBJA 1JB4A 3LT8A 3SEDA 1IK3A 2CWUA 3AMOA 5DREA 3KFQC 1GY5A 3WA3A 1IU7A 1VQM3 1DMMA 4WFOA 3H3HA 3KKGA 4XBYA 1WMPA 2CWTA 1IQYA 1DMNA 1JRQA 3CNXA 3LMLA 1OPYA 5EVHA 4RNZA 2XFTA 3STDA 2CFGA 4JRFA 1O7NB 2PNCA 3NXJA 1STFI 4HM3B 1FGOA 1Q864 2BT3A 2R4IA 3UJMA 4MMYB 1UUVB 4IT7A 5LC6A 1JB5A 2HMLB 1WTHA 3S5CA 1VQL3 4LZIA 1ASKA 1M1XB 3LTDA 1OGZA 3IJEB 4HYZA 4HM7B 3PXMA 4FCMA 1JJ22 2OQEA 2BNGA 3X41A 3GAXA 3ER7A 4HBRA 4CDLA 1S5AA 3CC43 3CME3 4EYCA 4O8SA 1W5ZA 1K9M4 3GWRA 3FLJA 3FCSB 2CW9A 3N9HA 5AI1A 1W2B2 1EG9B 1R4CA 4H61A 2HMOB 1W6GA 2MC8A 2ML6A 3CU3A 3HZPA 5AIHA 4HM0B 1N8QA 1NO3A 1YGEA 3DUKA 1WQLB 5AIGA 3G0KA 5EQLA 3K0ZA 3CCL3 3G16A 3IMAB 3K9MC 1CYUA 1OUNA 4O02B 1KC84 3SOAA 1ZX2A 5D82A 3SVAA 1T5YA 3KSED 5ELJA 3KSPA 3NM7A 3QK9A 4N6MA 4LGQA 3FG4A 1TU5A 5KP1A 2F99A 3OXAA 2W0QA 1SJWA 1JN5B 2JQ5A 3DGMA 1D6YA 3NHXA 2WGQA 2HMJB 1UI7A 1M904 4I4KA 3RDEA 3ALAA 2XFSA 1QALA 3NV0A 3T0UA 1FGMA 1VQ63 1BUQA 2IUKA 3CMA3 1Q40B 1KWIA 3ECFA 4FMDA 4XB5A 1E3RA 1TUHA 1UUWB 4HM4B 4ORLA 5D81A 3UL6A 3FG1A 5IW9A 3UB1A 1G96A 1QAKA 1YVBI 5IG3A 3B7CA 2P38A 4LSOA 1K28A 3WMDA 4KZ1A 1VQN3 2QIYA 4KFFA 4RNYA 1FGTA 5AYSC 4KFEA 1N9EA 5IERA 2CFKA 5IG5A 2OCTA 2FNQA 3FH1A 4KVHA 3G6E3 1NWWA 2CC3A 2HMMB 1LVNA 5AEUB 2CG1A 3JUNA 4MMZB 5IF6A 1JNQA 2O9UX 1RN7A 1RJOA 4AKYA 3Q1CA 4J9AA 3WDGB 3MPHA 2Z7AA 5CF2A 1UW1A 4R4KA 3SOYA 1QVG2 3EC9A 3NQYA 4MEIA 2V1LA 4L8PA 3HI7A 3LH4A 1Q40A 2W03A 4O2HA 3Q90A 3EBTA 2QEX3 3MG2A 3QRDA 1A2KA 2YFJB 3FG3A 2F86B 3MKIA 2D1WA 1YI23 2MF7A 1D6UA 2INXA 1F8NA 4FMCA 1VQP3 2W2CA 3CXC2 5BVBA 3RGRA 1YJW3 1IVXA 3G8ZA 2P05A 1ZO2A 1LNHA 1KD14 1O7HB 3HIGA 3SXXA 3EX9A 4R1KA 3K5TA 2P0XA 3NQZA 5AYRB 1IVWA 4R80A 3CCS3 1NB5I 2HMKB 2Q07A 1IT8A 3K63A 3MWZA 3F8HA 2RFRA 3LXUX 3CPW2 1N5PA 5IEOA 2CFDA 3MG1A 3PYJA 1QVF2 3VF1A 2XSHB 4GB5A 3LZAA 1OF5A 3NX0A 3B4OA 1VQO3 4K61A 4WYKA 3CCJ3 1ROVA 4N6LA 2OTL3 4HKVB 3FKAA 3BNDA 1UI8A 2XSOB 3X3XA 1K734 1VQ83 5IG0A 2W04A 3X40A 4WWUC 3KE7A 1OGXA 2O3OA 2I9WA 1LOXA 4U13A 3FZWA 1L5GB 3S28A 1W4NA 3EE1A 2P0MA 3I0YA 1YJN3 1KQS2 3X42A 2YFIB 3GZRA 3VSYA 4FMAA 2WGOA 3DXOA 1PU4A 3G4S3 1LXEA 1GY6A 1QJGA 5CXOA 3WA2X 2W56B 2A15A 2Z6BA 2XGLA 4J8TA 1FUWA 2CKFB 1ROAA 2OOVC 1OHSA 4LEHA 4HZBB 4IIAA 3EF8A 5D83A 2QGUA 3BNCA 5JPUA 7STDA 1JKGB 1SQWA 1CQSA 1RRLA 2ML5A 3NBRA 4K90B 1QMAA 3F7XA 3CCR3 2CFLA 2PZVA 5CF1A 5JBSA 1SIHA 2GU1A 4FCJA 1CEWI 2Y74A 2ZDJA 3F14A 3FF2A 1ULIB 1E97A 3DM8A 2XRXB 1J2BA 1ULJB 3OWSA 4HM6B 1SIIA 1OCVA 2GU3A 2E2TA 3GZXB 3OWYA 2OTJ3 3OV4A 1W6CA 3BNEA 3B4PA 1FGRA 2Z76A 2B1XB 4EV2A 1FGQA 3MG3A 3CC73 5FW5A 1JKGA 2GXFA 3EB8A 4IPBA 2IMJA 4HM8B 4LMIA 2F98A 4O3VA 1Z1SA 1IT7A 4N3VA 3GZYB 1YIT3 2CG0A 1IDPA 3HX8A 4L7KA 2CIUA 2YX9A 4RBNA 5IEPA 3O8YA 4Q53A 1Q42A 4NHFA 1JN5A 3CCM3 1C7HA 1WMOA 1A90A 3X3ZA 5I97A 3V99A 3FSDA 5KP3A 1W00A 2CHCA 3V98A 3ROBA 4CCVA 3S29A 1S723 3J7Yd 3JUQA 2XF3A 2YFLB 2GEYA 4HM2B 1Q7Y4 1DVDA 1VQ53 1JV2B 3HIIA 4FMBA 4N6UA 1EQKA 3JUPA 3LTCA 3LTBA 4MJDA 2STDA 3CD63 2XH9A 3LYGA 4WP5A 2FGTA 4XM4A 3LT9A 1NDOB 1SPUA 2XEPA 4XDVA 1K8A4 3AMOB 3G713 3EN8A 3CNMA 3OWUA 4N6V0 4OK0A 4BTXA 1W7CA 3PCRA 1CYVA 5EEOA 5G2GA 1HU9A 2P09A 3A76A 3UNLA 2QA43 2HMNB 2CFWA 1OH0A 2LYXA 1YHQ3 2RCDA 2GBWB 1MOLA 8CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSO A;  3F40 A;  3KZT A;  5HGR A;  3JUO A;  5DRV A;  3EHC A;  1GY7 A;  5AEW B;  4K1U A;  5KP4 A;  2GBX B;  2K54 A;  3E99 A;  4PEJ A;  4OVM A;  1K41 A;  3FF0 A;  4STD A;  4XBT A;  1W02 A;  3F7S A;  5CLK A;  1W01 A;  3EBY A;  3CPO A;  3NV0 B;  1AR0 A;  3T8N A;  1TP6 A;  1EA2 A;  4XBX A;  2RGQ A;  3DZL A;  1O7P B;  3RGA A;  3F8X A;  3FGY A;  1W6Y A;  2BMQ B;  1VZZ A;  4XDW A;  4R9L A;  4R9K A;  2BMO B;  3BLZ A;  5STD A;  3OX9 A;  6STD A;  4K1V A;  4RZM A;  3T8U A;  4OUQ A;  5BXQ A;  2Z77 A;  1NU3 A;  3H51 A;  1U5O A;  5AIF A;  3NM2 A;  1O7M B;  3GZB A;  4X2O A;  3NUV A;  2GEX A;  1GS3 A;  4L8O A;  1STD A;  3B8L A;  4HM1 B;  3K7C A;  2B24 B;  4H3U A;  2UX0 A;  4HVN A;  5JPP A;  4HZ9 B;  1E3V A;  3MHE A;  3D9R A;  5AII A;  3IPT A;  2XR8 B;  1GYB A;  2OWP A;  5IG4 A;  5IEN A;  3F9S A;  1O7G B;  3M8C A;  5CK6 A;  3EN1 B;  1JB2 A;  3EQQ B;  1OF5 B;  1O7W B;  1ISK A;  4WYK B;  3JUM A;  1OHO A;  3MYT A;  4X2H A;  1HKX A;  2BMR B;  3BB9 A;  3EJV A;  4HJL B;  3DMC A;  1DMQ A;  5TGN A;  1OHP A;  3GRD A;  4HM5 B;  3VGN A;  3HK4 A;  3SED A;  1JB4 A;  5DRE A;  1GY5 A;  1DMM A;  3H3H A;  3KKG A;  4XBY A;  1DMN A;  3CNX A;  5EVH A;  1OPY A;  3STD A;  1O7N B;  3NXJ A;  4HM3 B;  2R4I A;  3UJM A;  1UUV B;  1JB5 A;  2HML B;  3S5C A;  1ASK A;  1OGZ A;  4HM7 B;  4FCM A;  2BNG A;  3ER7 A;  4CDL A;  1S5A A;  3GWR A;  3FLJ A;  5AI1 A;  1EG9 B;  2HMO B;  3CU3 A;  3HZP A;  5AIH A;  4HM0 B;  3DUK A;  1WQL B;  5AIG A;  3G0K A;  3K0Z A;  3G16 A;  1OUN A;  3SOA A;  1ZX2 A;  5D82 A;  3KSP A;  4LGQ A;  5KP1 A;  2F99 A;  3OXA A;  1SJW A;  1JN5 B;  2JQ5 A;  3NHX A;  2HMJ B;  4I4K A;  3NV0 A;  1BUQ A;  1Q40 B;  3ECF A;  4XB5 A;  1E3R A;  1TUH A;  1UUW B;  4HM4 B;  4ORL A;  5D81 A;  5IG3 A;  3B7C A;  3WMD A;  2QIY A;  5IER A;  5IG5 A;  3FH1 A;  4KVH A;  1NWW A;  2HMM B;  5AEU B;  3JUN A;  5IF6 A;  4J9A A;  2Z7A A;  5CF2 A;  3SOY A;  4L8P A;  1Q40 A;  3Q90 A;  3EBT A;  3MG2 A;  1A2K A;  2YFJ B;  2F86 B;  3MKI A;  2INX A;  2W2C A;  5BVB A;  3RGR A;  3G8Z A;  1ZO2 A;  1O7H B;  3EX9 A;  4R1K A;  2HMK B;  3F8H A;  2RFR A;  5IEO A;  3MG1 A;  2XSH B;  4GB5 A;  3LZA A;  1OF5 A;  3B4O A;  4WYK A;  4HKV B;  3FKA A;  2XSO B;  5IG0 A;  4WWU C;  3KE7 A;  1OGX A;  4U13 A;  2I9W A;  3FZW A;  3I0Y A;  2YFI B;  3GZR A;  3VSY A;  3DXO A;  5CXO A;  1GY6 A;  1QJG A;  2A15 A;  4J8T A;  2CKF B;  1OHS A;  4LEH A;  4HZB B;  4IIA A;  3EF8 A;  5D83 A;  2QGU A;  5JPU A;  7STD A;  1JKG B;  1CQS A;  3NBR A;  1QMA A;  3F7X A;  2PZV A;  5CF1 A;  4FCJ A;  3F14 A;  3FF2 A;  1ULI B;  1E97 A;  3DM8 A;  2XRX B;  1ULJ B;  3OWS A;  4HM6 B;  1OCV A;  3GZX B;  3OWY A;  3OV4 A;  3B4P A;  2Z76 A;  2B1X B;  3MG3 A;  5FW5 A;  1JKG A;  2GXF A;  2IMJ A;  4HM8 B;  4LMI A;  2F98 A;  1Z1S A;  4N3V A;  3GZY B;  3HX8 A;  1IDP A;  4L7K A;  5IEP A;  4Q53 A;  1Q42 A;  1JN5 A;  1C7H A;  3FSD A;  5KP3 A;  1W00 A;  2CHC A;  3ROB A;  3JUQ A;  2YFL B;  2GEY A;  4HM2 B;  3JUP A;  4MJD A;  2STD A;  3LYG A;  2GBW B;  4WP5 A;  4XM4 A;  1NDO B;  4XDV A;  3EN8 A;  3CNM A;  3OWU A;  5G2G A;  3A76 A;  3UNL A;  2HMN B;  1OH0 A;  2RCD A;  3EC9 A;  8CHO A; 
#chains in the Genus database with same CATH topology
 4EBG A;  1DE3 A;  2C10 A;  2BHM A;  1I2E A;  3N8B A;  3MSO A;  2E2V A;  3F40 A;  4MMX B;  3KZT A;  2OOV A;  1T2H A;  2AAD A;  1MWR A;  4BU4 A;  5HGR A;  3WOE B;  3JUO A;  5DRV A;  1RGL A;  2JDI H;  3BU4 A;  3KCH A;  3EHC A;  2ZL8 A;  4HOH A;  1UCK A;  1GY7 A;  4BTY A;  5AEW B;  1IVU A;  1I3I A;  2D42 A;  1VQK 3;  4FCZ A;  1MGR A;  3WOF B;  1TIJ A;  3AGN A;  1B21 A;  1V74 A;  4EXR A;  1UCL A;  1Q7H A;  1VQ9 3;  2F5M A;  3PZW A;  2FXT A;  1T2I A;  2LQV A;  3DGL A;  1QAF A;  3Q2P A;  4J5K A;  3LOY A;  1A2V A;  3DGY A;  1EUI C;  4JF8 A;  3CCV 3;  2IUJ A;  4K1U A;  1RGH A;  5KP4 A;  2XGN A;  4NPB A;  2GBX B;  2K54 A;  5A0O B;  3E99 A;  4PEJ A;  4OVM A;  1RSN A;  4G1M B;  4AEQ A;  1RGF A;  3SLU A;  1K41 A;  3FF0 A;  1B20 A;  1I70 A;  2KF5 A;  5RNT A;  1A67 A;  3CCQ 3;  2H0G A;  4STD A;  1U8C B;  2CH9 A;  4XBT A;  1W02 A;  2KF4 A;  3PCS A;  2KCD A;  1BRH A;  4RNT A;  2W9P A;  2KRT A;  3JVC A;  1B3S A;  3F7S A;  5CLK A;  1N8R 4;  1W01 A;  1LQM B;  3EBY A;  2CWV A;  1AV4 A;  3CPO A;  3NV0 B;  1AVL A;  1AR0 A;  1I2F A;  1PFP A;  1GD3 A;  2RSX A;  3T8N A;  4ZM8 A;  1BRI A;  3PS8 A;  3I56 3;  4BIR A;  1GD4 A;  1BRK A;  1TP6 A;  3CC2 3;  1EA2 A;  4XBX A;  1M1K 4;  4GSP A;  2RGQ A;  3DZL A;  2AAE A;  3BNB A;  1O7P B;  3RGA A;  3S27 A;  1AQZ A;  1YJ9 3;  1LQG C;  3F8X A;  3FGY A;  2WO0 A;  2KXG A;  1W6Y A;  1IVV A;  4QWT A;  2BMQ B;  1VZZ A;  1Y4K A;  2W56 A;  2KF6 A;  4R9L A;  4R9K A;  2C11 A;  4NRE A;  4XDW A;  1DET A;  3ZG5 A;  2K0M A;  2BMO B;  3DY5 A;  3DGN A;  1VQ7 3;  1GMQ A;  4TX4 A;  5FGO A;  3U97 A;  3UL5 A;  2F56 A;  1IYY A;  1MNL A;  1N9J A;  3BLZ A;  3OX9 A;  5LC7 A;  5STD A;  6STD A;  4K1V A;  3LTA A;  4RZM A;  1NJI 4;  3T8U A;  1RRH A;  4OUQ A;  2OQE C;  5BXQ A;  2W6J H;  2Z77 A;  1NU3 A;  3H51 A;  3L0R A;  3OW2 2;  1U5O A;  3ZFZ A;  5AIF A;  3NM2 A;  1O7M B;  4BTW A;  3GZB A;  3KII A;  4X2O A;  1W2Z A;  1RHL A;  3NUV A;  4EC6 A;  2GEX A;  2ZHX B;  3S67 A;  2J8X B;  1MGW A;  1GS3 A;  1VQ4 3;  4L8O A;  1STD A;  3B8L A;  2UGI A;  1US1 A;  1BVI A;  1EKM A;  1RGE A;  4N6O B;  5ELU A;  3DGO A;  1UCI A;  1BRN L;  1YIJ 3;  1UCJ A;  1N5H A;  1FUT A;  1FYS A;  3TDG A;  1JBS A;  1KSI A;  1DYU A;  1X1Y A;  3NBB A;  1AVK A;  3DH2 A;  3D4A A;  4HM1 B;  3K7C A;  1NB3 I;  1EEJ A;  3V92 A;  2B24 B;  1I2G A;  4FR9 A;  5G1K A;  4H3U A;  1M9G A;  2UX0 A;  4HVN A;  2W9Q A;  2E2U A;  1WMN A;  5JPP A;  4HZ9 B;  1Q82 4;  3PGB A;  1E3V A;  1GOV A;  1TFK A;  3MHE A;  3CCU 3;  1DVC A;  1OAC A;  3D9R A;  5AII A;  3D3L A;  1BSE A;  4GL6 A;  1D6Z A;  3IPT A;  1IQ8 A;  2XR8 B;  1GYB A;  2OWP A;  1RGK A;  1GOU A;  3F9S A;  5IG4 A;  4WHA A;  5IEN A;  1FA3 A;  1O7G B;  4AKZ A;  3U1W A;  3M8C A;  2SBL A;  5CK6 A;  4KFD A;  5BIR A;  1Q81 4;  3EN1 B;  1UUG B;  1JB2 A;  3EQQ B;  2BO9 B;  1OF5 B;  1TFO A;  3SX1 A;  1NNV A;  1O7W B;  2BIR A;  3CCE 3;  1ISK A;  4KT3 B;  3WOD G;  4WYK B;  4N6N B;  4N6T A;  3JUM A;  4BL3 A;  2IA7 A;  1OHO A;  1WNH A;  2M7O A;  3MYT A;  3N54 B;  4X2H A;  1BGS A;  1HKX A;  2Y73 A;  4CPK A;  3X3Y A;  2BMR B;  2KF3 A;  2WOF A;  3BB9 A;  3EJV A;  3KN4 A;  1BSB A;  4HJL B;  7RNT A;  4EV5 A;  2SAR A;  1IV9 A;  1DMQ A;  3DMC A;  5TGN A;  1LRA A;  2WOH A;  1IQX A;  2L4V A;  1OHP A;  1LNI A;  2CK3 H;  1IV7 A;  2RBI A;  2ZA4 A;  3GRD A;  4HM5 B;  3VGN A;  1RKY A;  1ZGX A;  3HK4 A;  3NBJ A;  1JB4 A;  3LT8 A;  3SED A;  1IK3 A;  2CWU A;  3AMO A;  5DRE A;  3KFQ C;  3URP A;  1GY5 A;  3WA3 A;  1IU7 A;  1VQM 3;  1DMM A;  4WFO A;  3H3H A;  3KKG A;  4XBY A;  1WMP A;  2CWT A;  1IQY A;  1DMN A;  1JRQ A;  4BL2 A;  3CNX A;  3LML A;  1OPY A;  5EVH A;  1BUJ A;  4RNZ A;  5G1L A;  1RCL A;  2XFT A;  1YGW A;  1RN4 A;  1ZS7 A;  3AGO A;  3D79 A;  3D5G A;  1BNI A;  3STD A;  2CFG A;  4JRF A;  1O7N B;  3D5I A;  2PNC A;  3NXJ A;  1YVS A;  1SAR A;  1STF I;  4HM3 B;  1RLS A;  1FGO A;  1Q86 4;  2BT3 A;  1BNG A;  2R4I A;  4MMY B;  1UUV B;  4IT7 A;  5LC6 A;  1BNF A;  3UJM A;  1JB5 A;  2HML B;  1WTH A;  3S5C A;  1VQL 3;  4LZI A;  1ASK A;  1M1X B;  3LTD A;  1OGZ A;  1RNT A;  3IJE B;  4HYZ A;  4HM7 B;  3PXM A;  4FCM A;  1JJ2 2;  2OQE A;  2BNG A;  3X41 A;  3GAX A;  3ER7 A;  4HBR A;  4CDL A;  1S5A A;  1TTO A;  3CC4 3;  3CME 3;  4EYC A;  4O8S A;  1JZD A;  1W5Z A;  3GWR A;  3FLJ A;  1K9M 4;  3FCS B;  2CW9 A;  3N9H A;  1RGG A;  5AI1 A;  1EG9 B;  1W2B 2;  1R4C A;  2HOH A;  4H61 A;  1RNB A;  1BRS A;  2HMO B;  1W6G A;  2MC8 A;  2ML6 A;  3CU3 A;  3HZP A;  5AIH A;  4HM0 B;  4EW5 A;  1N8Q A;  1NO3 A;  1YGE A;  3DUK A;  1WQL B;  5AIG A;  3G0K A;  5EQL A;  3K0Z A;  3CCL 3;  3G16 A;  3IMA B;  3K9M C;  1CYU A;  1OUN A;  1FW7 A;  1Q9E A;  4O02 B;  1KC8 4;  3SOA A;  1ZX2 A;  1I8V A;  5D82 A;  3SVA A;  1UGI A;  1T5Y A;  3KSE D;  5ELJ A;  3AHW A;  3KSP A;  3NM7 A;  2CX0 A;  3QK9 A;  4N6M A;  4LGQ A;  3FG4 A;  1GOY A;  1TU5 A;  5KP1 A;  2F99 A;  3OXA A;  2CX1 A;  2W0Q A;  1SJW A;  1JN5 B;  2JQ5 A;  3DGM A;  1D6Y A;  3NHX A;  2WGQ A;  2HMJ B;  1UI7 A;  1M90 4;  4I4K A;  1AY7 A;  3AHS A;  3RDE A;  2R41 A;  2XFS A;  3ALA A;  1QAL A;  3HOH A;  3NV0 A;  3T0U A;  1FGM A;  1VQ6 3;  1BUQ A;  2IUK A;  3CMA 3;  1Q40 B;  1KWI A;  3ECF A;  4FMD A;  4XB5 A;  1E3R A;  1TUH A;  1UUW B;  4HM4 B;  4ORL A;  5D81 A;  3UL6 A;  3FG1 A;  5IW9 A;  3UB1 A;  1G96 A;  1QAK A;  1YVB I;  1HZ1 A;  5IG3 A;  3B7C A;  2P38 A;  4LSO A;  1K28 A;  2F5W A;  4KZ1 A;  3WMD A;  1VQN 3;  2QIY A;  4KFF A;  4RNY A;  1FGT A;  5AYS C;  4KFE A;  1N9E A;  5BU4 A;  5IER A;  2CFK A;  5IG5 A;  5M18 A;  1TRP A;  2OCT A;  2FNQ A;  1BU4 A;  3FH1 A;  4KVH A;  3G6E 3;  1BAO A;  1NWW A;  2CC3 A;  2HMM B;  1BRG A;  1LVN A;  5AEU B;  1PY3 A;  3JUN A;  1GSP A;  4MMZ B;  1JNQ A;  2O9U X;  2CG1 A;  5IF6 A;  1RN7 A;  1RJO A;  4AKY A;  3Q1C A;  4J9A A;  1BNJ A;  3WDG B;  3MPH A;  2Z7A A;  4GHO A;  1UW1 A;  5CF2 A;  4R4K A;  1FZU A;  1LOV A;  3SOY A;  1QVG 2;  3EC9 A;  3NQY A;  4MEI A;  2V1L A;  4L8P A;  3HI7 A;  3LH4 A;  1Q40 A;  2W03 A;  4O2H A;  3Q90 A;  3EBT A;  4DKI A;  1UGH I;  2UUG C;  1TRQ A;  2QEX 3;  3MG2 A;  3QRD A;  1A2K A;  2YFJ B;  3FG3 A;  2F86 B;  3MKI A;  1C54 A;  2D1W A;  4LYL B;  1YI2 3;  2MF7 A;  1D6U A;  2INX A;  1F8N A;  4FMC A;  7GSP A;  1VQP 3;  1RTU A;  1JBT A;  6RNT A;  2W2C A;  2GSP A;  3CXC 2;  3WHO A;  5BVB A;  1V57 A;  3RGR A;  1B27 A;  1YJW 3;  1G0T A;  1IVX A;  3G8Z A;  9RNT A;  2P05 A;  1ZO2 A;  1LNH A;  3BIR A;  1PYL A;  1KD1 4;  3A5E A;  1O7H B;  3HIG A;  3SXX A;  3EX9 A;  1B2U A;  1BAN A;  1I0V A;  3K5T A;  2P0X A;  3NQZ A;  4R1K A;  5AYR B;  1JBR A;  1IVW A;  4R80 A;  3CCS 3;  2K3D A;  1NB5 I;  2HMK B;  2Q07 A;  1IT8 A;  3K63 A;  3MWZ A;  4ILF A;  3F8H A;  2RFR A;  3WR2 A;  3LXU X;  3CPW 2;  1N5P A;  5IEO A;  2CFD A;  3MG1 A;  3PYJ A;  2L1S A;  3VF1 A;  2XSH B;  4GB5 A;  1QVF 2;  3LZA A;  1OF5 A;  3NX0 A;  3B4O A;  1VQO 3;  1I3F A;  4K61 A;  4WYK A;  1BOX A;  3CCJ 3;  1ROV A;  4N6L A;  2OTL 3;  4HKV B;  3FKA A;  3BND A;  1UI8 A;  2XSO B;  3X3X A;  1B2X A;  1K73 4;  2KAA A;  1VQ8 3;  5IG0 A;  5HOH A;  2W04 A;  3RNT A;  4WWU C;  3X40 A;  3KE7 A;  1OGX A;  2IY2 A;  2I9W A;  1LOX A;  2O3O A;  4U13 A;  3FZW A;  1L5G B;  3S28 A;  3SYU A;  1B2M A;  1W4N A;  4CJN A;  1GMP A;  3EE1 A;  2P0M A;  1BNS A;  3I0Y A;  2H0H A;  5GSP A;  1YJN 3;  1KQS 2;  3X42 A;  1BRJ A;  2YFI B;  3GZR A;  3VSY A;  4FMA A;  3Q3F A;  2WGO A;  3DXO A;  1PU4 A;  3G4S 3;  1LXE A;  1GY6 A;  1QJG A;  5CXO A;  3WA2 X;  1BNE A;  2W56 B;  2A15 A;  2Z6B A;  2XGL A;  1BSC A;  4J8T A;  1FUW A;  2CKF B;  1ROA A;  2OOV C;  1OHS A;  4LEH A;  4HAA A;  4HZB B;  4IIA A;  3EF8 A;  5D83 A;  2QGU A;  3BNC A;  5JPU A;  7STD A;  1JKG B;  1CH0 A;  1SQW A;  1CQS A;  1RRL A;  2ML5 A;  3NBR A;  4I5Q A;  4K90 B;  1QMA A;  2RNT A;  3F7X A;  3CCR 3;  2CFL A;  2PZV A;  5CF1 A;  5JBS A;  1SIH A;  2GU1 A;  4FCJ A;  1CEW I;  2Y74 A;  2ZDJ A;  3F14 A;  3FF2 A;  1ULI B;  1E97 A;  1JZO A;  3DM8 A;  2XRX B;  2F4Y A;  1J2B A;  1ULJ B;  3OWS A;  4HM6 B;  1RMS A;  1SII A;  1OCV A;  2GU3 A;  3GSP A;  2E2T A;  1R4Y A;  3GZX B;  2IYJ A;  3OWY A;  2OTJ 3;  3OV4 A;  1W6C A;  3BNE A;  8RNT A;  3B4P A;  3ZG0 A;  1FGR A;  2Z76 A;  2B1X B;  5M1A A;  4EV2 A;  1FGQ A;  3MG3 A;  1BSD A;  3CC7 3;  5FW5 A;  1RDS A;  1FUS A;  1BIR A;  1X1U A;  2C4B A;  1LOY A;  1JKG A;  2GXF A;  3EB8 A;  1B2S A;  4IPB A;  2IMJ A;  4HM8 B;  6GSP A;  4LMI A;  2F98 A;  4O3V A;  1Z1S A;  2H0I A;  1IT7 A;  5M19 A;  4N3V A;  3GZY B;  1YIT 3;  2CG0 A;  1IDP A;  3HX8 A;  4L7K A;  2CIU A;  2YX9 A;  4RBN A;  4J5G A;  5IEP A;  3O8Y A;  1BSA A;  1MWT A;  1Q42 A;  1JN5 A;  4NHF A;  1C7H A;  4Q53 A;  1RGC A;  1WMO A;  1V58 A;  3CCM 3;  1A90 A;  3X3Z A;  5I97 A;  3V99 A;  3FSD A;  1YNV X;  5KP3 A;  1W00 A;  2CHC A;  3V98 A;  3ROB A;  4CCV A;  3S29 A;  1S72 3;  1A2P A;  3J7Y d;  3JUQ A;  2XF3 A;  1X1X A;  2YFL B;  1UDI I;  1LOW A;  2GEY A;  4HM2 B;  1Q7Y 4;  1RGA A;  1DVD A;  1B2Z A;  1TJD A;  1MWU A;  3I55 3;  1VQ5 3;  1JV2 B;  3HII A;  4FMB A;  4N6U A;  1EQK A;  3JUP A;  3LTC A;  3LTB A;  4MJD A;  2STD A;  3CD6 3;  2XH9 A;  1T3B A;  3LYG A;  4WP5 A;  1RCK A;  2FGT A;  2BU4 A;  4XM4 A;  3LT9 A;  1NDO B;  1SPU A;  2XEP A;  4XDV A;  1K8A 4;  3AMO B;  3G71 3;  3EN8 A;  3CNM A;  1RN1 A;  3OWU A;  4N6V 0;  4OK0 A;  4BTX A;  1G02 A;  1W7C A;  3PCR A;  1CYV A;  5EEO A;  1GMR A;  1X1W A;  5G2G A;  1HU9 A;  2P09 A;  3A76 A;  1BNR A;  3UNL A;  2QA4 3;  1VQQ A;  2HMN B;  2CFW A;  1OH0 A;  2LYX A;  1YHQ 3;  1HYF A;  2RCD A;  2GBW B;  1MOL A;  1MWS A;  1I0X A;  8CHO A; 
#chains in the Genus database with same CATH homology
 4EBG A;  2C10 A;  2BHM A;  3N8B A;  3MSO A;  2E2V A;  3F40 A;  4MMX B;  3KZT A;  2OOV A;  5HGR A;  3WOE B;  3JUO A;  5DRV A;  2JDI H;  3EHC A;  2ZL8 A;  1GY7 A;  4BTY A;  5AEW B;  1IVU A;  2D42 A;  1VQK 3;  4FCZ A;  3WOF B;  1TIJ A;  1V74 A;  4EXR A;  1VQ9 3;  3PZW A;  2FXT A;  2LQV A;  3DGL A;  1QAF A;  3Q2P A;  3LOY A;  1A2V A;  4JF8 A;  3CCV 3;  2IUJ A;  4K1U A;  5KP4 A;  2XGN A;  2GBX B;  2K54 A;  5A0O B;  3E99 A;  4PEJ A;  4OVM A;  4G1M B;  4AEQ A;  3SLU A;  1K41 A;  3FF0 A;  1A67 A;  3CCQ 3;  4STD A;  1U8C B;  2CH9 A;  4XBT A;  1W02 A;  3PCS A;  2KCD A;  2W9P A;  2KRT A;  3JVC A;  3F7S A;  5CLK A;  1N8R 4;  1W01 A;  3EBY A;  2CWV A;  1AV4 A;  3CPO A;  3NV0 B;  1AVL A;  1AR0 A;  1PFP A;  1GD3 A;  2RSX A;  3T8N A;  4ZM8 A;  3PS8 A;  3I56 3;  1GD4 A;  1TP6 A;  3CC2 3;  1EA2 A;  4XBX A;  1M1K 4;  2RGQ A;  3DZL A;  3S27 A;  3BNB A;  1O7P B;  3RGA A;  1YJ9 3;  1VQ4 3;  3F8X A;  3FGY A;  2WO0 A;  2KXG A;  1W6Y A;  1IVV A;  4QWT A;  2BMQ B;  1VZZ A;  1Y4K A;  2W56 A;  4R9L A;  4XDW A;  4R9K A;  2C11 A;  4NRE A;  2K0M A;  2BMO B;  3DY5 A;  3DGN A;  1VQ7 3;  4TX4 A;  5FGO A;  3U97 A;  3UL5 A;  1MNL A;  1N9J A;  3BLZ A;  3OX9 A;  5LC7 A;  5STD A;  6STD A;  4K1V A;  3LTA A;  4RZM A;  1NJI 4;  3T8U A;  1RRH A;  4OUQ A;  2OQE C;  5BXQ A;  2W6J H;  2Z77 A;  1NU3 A;  3H51 A;  3L0R A;  3OW2 2;  1U5O A;  5AIF A;  3NM2 A;  1O7M B;  4BTW A;  3GZB A;  3KII A;  4X2O A;  1W2Z A;  3NUV A;  4EC6 A;  2GEX A;  3S67 A;  1GS3 A;  4L8O A;  1STD A;  3B8L A;  1US1 A;  1EKM A;  4N6O B;  5ELU A;  3DGO A;  1YIJ 3;  1N5H A;  3TDG A;  1KSI A;  1DYU A;  3NBB A;  1AVK A;  4HM1 B;  3K7C A;  1NB3 I;  3V92 A;  3I55 3;  2B24 B;  4FR9 A;  4H3U A;  1M9G A;  2UX0 A;  4HVN A;  2W9Q A;  2E2U A;  1WMN A;  5JPP A;  4HZ9 B;  1Q82 4;  3PGB A;  1E3V A;  1TFK A;  3MHE A;  3CCU 3;  1DVC A;  1OAC A;  3D9R A;  5AII A;  3D3L A;  4GL6 A;  1D6Z A;  3IPT A;  1IQ8 A;  2XR8 B;  1GYB A;  2OWP A;  5IG4 A;  5IEN A;  3F9S A;  1FA3 A;  4WHA A;  1O7G B;  4AKZ A;  3U1W A;  3M8C A;  2SBL A;  5CK6 A;  4KFD A;  1Q81 4;  3EN1 B;  1JB2 A;  3EQQ B;  2BO9 B;  1OF5 B;  1TFO A;  3SX1 A;  3CCE 3;  1O7W B;  1ISK A;  3WOD G;  4WYK B;  4N6N B;  4N6T A;  3JUM A;  2IA7 A;  1OHO A;  1WNH A;  2M7O A;  3MYT A;  3N54 B;  4X2H A;  1HKX A;  2Y73 A;  3X3Y A;  2BMR B;  2WOF A;  3BB9 A;  3EJV A;  3KN4 A;  4HJL B;  4EV5 A;  3DMC A;  1IV9 A;  1DMQ A;  5TGN A;  2WOH A;  1IQX A;  2L4V A;  1OHP A;  2CK3 H;  1IV7 A;  3GRD A;  4HM5 B;  3VGN A;  1RKY A;  3HK4 A;  3NBJ A;  1JB4 A;  3LT8 A;  3SED A;  1IK3 A;  2CWU A;  3AMO A;  5DRE A;  3KFQ C;  1GY5 A;  3WA3 A;  1IU7 A;  1VQM 3;  1DMM A;  4WFO A;  3H3H A;  3KKG A;  4XBY A;  1WMP A;  2CWT A;  1IQY A;  1DMN A;  1JRQ A;  3CNX A;  3LML A;  1OPY A;  5EVH A;  4RNZ A;  2XFT A;  3STD A;  2CFG A;  4JRF A;  1O7N B;  2PNC A;  3NXJ A;  1STF I;  4HM3 B;  1FGO A;  1Q86 4;  2BT3 A;  2R4I A;  3UJM A;  4MMY B;  1UUV B;  4IT7 A;  5LC6 A;  1JB5 A;  2HML B;  1WTH A;  3S5C A;  1VQL 3;  4LZI A;  1ASK A;  1M1X B;  3LTD A;  1OGZ A;  3IJE B;  4HYZ A;  4HM7 B;  3PXM A;  4FCM A;  1JJ2 2;  2OQE A;  2BNG A;  3X41 A;  3GAX A;  3ER7 A;  4HBR A;  4CDL A;  1S5A A;  3CC4 3;  3CME 3;  4EYC A;  4O8S A;  1W5Z A;  1K9M 4;  3GWR A;  3FLJ A;  3FCS B;  2CW9 A;  3N9H A;  5AI1 A;  1W2B 2;  1EG9 B;  1R4C A;  4H61 A;  2HMO B;  1W6G A;  2MC8 A;  2ML6 A;  3CU3 A;  3HZP A;  5AIH A;  4HM0 B;  1N8Q A;  1NO3 A;  1YGE A;  3DUK A;  1WQL B;  5AIG A;  3G0K A;  5EQL A;  3K0Z A;  3CCL 3;  3G16 A;  3IMA B;  3K9M C;  1CYU A;  1OUN A;  4O02 B;  1KC8 4;  3SOA A;  1ZX2 A;  5D82 A;  3SVA A;  1T5Y A;  3KSE D;  5ELJ A;  3KSP A;  3NM7 A;  3QK9 A;  4N6M A;  4LGQ A;  3FG4 A;  1TU5 A;  5KP1 A;  2F99 A;  3OXA A;  2W0Q A;  1SJW A;  1JN5 B;  2JQ5 A;  3DGM A;  1D6Y A;  3NHX A;  2WGQ A;  2HMJ B;  1UI7 A;  1M90 4;  4I4K A;  3RDE A;  3ALA A;  2XFS A;  1QAL A;  3NV0 A;  3T0U A;  1FGM A;  1VQ6 3;  1BUQ A;  2IUK A;  3CMA 3;  1Q40 B;  1KWI A;  3ECF A;  4FMD A;  4XB5 A;  1E3R A;  1TUH A;  1UUW B;  4HM4 B;  4ORL A;  5D81 A;  3UL6 A;  3FG1 A;  5IW9 A;  3UB1 A;  1G96 A;  1QAK A;  1YVB I;  5IG3 A;  3B7C A;  2P38 A;  4LSO A;  1K28 A;  3WMD A;  4KZ1 A;  1VQN 3;  2QIY A;  4KFF A;  4RNY A;  1FGT A;  5AYS C;  4KFE A;  1N9E A;  5IER A;  2CFK A;  5IG5 A;  2OCT A;  2FNQ A;  3FH1 A;  4KVH A;  3G6E 3;  1NWW A;  2CC3 A;  2HMM B;  1LVN A;  5AEU B;  2CG1 A;  3JUN A;  4MMZ B;  5IF6 A;  1JNQ A;  2O9U X;  1RN7 A;  1RJO A;  4AKY A;  3Q1C A;  4J9A A;  3WDG B;  3MPH A;  2Z7A A;  5CF2 A;  1UW1 A;  4R4K A;  3SOY A;  1QVG 2;  3EC9 A;  3NQY A;  4MEI A;  2V1L A;  4L8P A;  3HI7 A;  3LH4 A;  1Q40 A;  2W03 A;  4O2H A;  3Q90 A;  3EBT A;  2QEX 3;  3MG2 A;  3QRD A;  1A2K A;  2YFJ B;  3FG3 A;  2F86 B;  3MKI A;  2D1W A;  1YI2 3;  2MF7 A;  1D6U A;  2INX A;  1F8N A;  4FMC A;  1VQP 3;  2W2C A;  3CXC 2;  5BVB A;  3RGR A;  1YJW 3;  1IVX A;  3G8Z A;  2P05 A;  1ZO2 A;  1LNH A;  1KD1 4;  1O7H B;  3HIG A;  3SXX A;  3EX9 A;  4R1K A;  3K5T A;  2P0X A;  3NQZ A;  5AYR B;  1IVW A;  4R80 A;  3CCS 3;  1NB5 I;  2HMK B;  2Q07 A;  1IT8 A;  3K63 A;  3MWZ A;  3F8H A;  2RFR A;  3LXU X;  3CPW 2;  1N5P A;  5IEO A;  2CFD A;  3MG1 A;  3PYJ A;  1QVF 2;  3VF1 A;  2XSH B;  4GB5 A;  3LZA A;  1OF5 A;  3NX0 A;  3B4O A;  1VQO 3;  4K61 A;  4WYK A;  3CCJ 3;  1ROV A;  4N6L A;  2OTL 3;  4HKV B;  3FKA A;  3BND A;  1UI8 A;  2XSO B;  3X3X A;  1K73 4;  1VQ8 3;  5IG0 A;  2W04 A;  3X40 A;  4WWU C;  3KE7 A;  1OGX A;  2O3O A;  2I9W A;  1LOX A;  4U13 A;  3FZW A;  1L5G B;  3S28 A;  1W4N A;  3EE1 A;  2P0M A;  3I0Y A;  1YJN 3;  1KQS 2;  3X42 A;  2YFI B;  3GZR A;  3VSY A;  4FMA A;  2WGO A;  3DXO A;  1PU4 A;  3G4S 3;  1LXE A;  1GY6 A;  1QJG A;  5CXO A;  3WA2 X;  2W56 B;  2A15 A;  2Z6B A;  2XGL A;  4J8T A;  1FUW A;  2CKF B;  1ROA A;  2OOV C;  1OHS A;  4LEH A;  4HZB B;  4IIA A;  3EF8 A;  5D83 A;  2QGU A;  3BNC A;  5JPU A;  7STD A;  1JKG B;  1SQW A;  1CQS A;  1RRL A;  2ML5 A;  3NBR A;  4K90 B;  1QMA A;  3F7X A;  3CCR 3;  2CFL A;  2PZV A;  5CF1 A;  5JBS A;  1SIH A;  2GU1 A;  4FCJ A;  1CEW I;  2Y74 A;  2ZDJ A;  3F14 A;  3FF2 A;  1ULI B;  1E97 A;  3DM8 A;  2XRX B;  1J2B A;  1ULJ B;  3OWS A;  4HM6 B;  1SII A;  1OCV A;  2GU3 A;  2E2T A;  3GZX B;  3OWY A;  2OTJ 3;  3OV4 A;  1W6C A;  3BNE A;  3B4P A;  1FGR A;  2Z76 A;  2B1X B;  4EV2 A;  1FGQ A;  3MG3 A;  3CC7 3;  5FW5 A;  1JKG A;  2GXF A;  3EB8 A;  4IPB A;  2IMJ A;  4HM8 B;  4LMI A;  2F98 A;  4O3V A;  1Z1S A;  1IT7 A;  4N3V A;  3GZY B;  1YIT 3;  2CG0 A;  1IDP A;  3HX8 A;  4L7K A;  2CIU A;  2YX9 A;  4RBN A;  5IEP A;  3O8Y A;  4Q53 A;  1Q42 A;  4NHF A;  1JN5 A;  3CCM 3;  1C7H A;  1WMO A;  1A90 A;  3X3Z A;  5I97 A;  3V99 A;  3FSD A;  5KP3 A;  1W00 A;  2CHC A;  3V98 A;  3ROB A;  4CCV A;  3S29 A;  1S72 3;  3J7Y d;  3JUQ A;  2XF3 A;  2YFL B;  2GEY A;  4HM2 B;  1Q7Y 4;  1DVD A;  1VQ5 3;  1JV2 B;  3HII A;  4FMB A;  4N6U A;  1EQK A;  3JUP A;  3LTC A;  3LTB A;  4MJD A;  2STD A;  3CD6 3;  2XH9 A;  3LYG A;  4WP5 A;  2FGT A;  4XM4 A;  3LT9 A;  1NDO B;  1SPU A;  2XEP A;  4XDV A;  1K8A 4;  3AMO B;  3G71 3;  3EN8 A;  3CNM A;  3OWU A;  4N6V 0;  4OK0 A;  4BTX A;  1W7C A;  3PCR A;  1CYV A;  5EEO A;  5G2G A;  1HU9 A;  2P09 A;  3A76 A;  3UNL A;  2QA4 3;  2HMN B;  2CFW A;  1OH0 A;  2LYX A;  1YHQ 3;  2RCD A;  2GBW B;  1MOL A;  8CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...