4FCJA

Crystal structure of the ntf2-like domain of human g3bp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal Structures of the Human G3BP1 NTF2-Like Domain Visualize FxFG Nup Repeat Specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 128
sequence length 137
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fcjA00
1JB4A 4XBYA 2XSOB 5CXOA 3M8CA 5STDA 1HKXA 1Q40B 3KSPA 1SJWA 2QIYA 1OH0A 3EJVA 3DUKA 2BMOB 1NU3A 1W01A 3G8ZA 4CDLA 2UX0A 4H3UA 3NM2A 5CK6A 1WQLB 3F14A 1GY7A 3SOYA 4IIAA 5CF2A 3STDA 3FLJA 3VGNA 4HM5B 4XBTA 3MG2A 3NHXA 3EQQB 4R1KA 4WYKA 2JQ5A 3FF2A 8CHOA 2Z77A 2XRXB 1ISKA 5IG5A 2XSHB 3OV4A 5JPUA 2HMKB 1S5AA 5IEOA 1STDA 4HKVB 5IF6A 5EVHA 3OXAA 3S5CA 5IERA 5HGRA 5KP4A 1ZO2A 2GEXA 4HM4B 3DXOA 2RFRA 1W6YA 1UUVB 3JUOA 4HM3B 5CLKA 3GRDA 2RCDA 3RGRA 4ORLA 3ER7A 3BLZA 3EX9A 3EC9A 5DREA 4I4KA 4X2HA 1E3VA 2Z7AA 4XDWA 3K0ZA 3F7SA 4FCMA 2YFJB 3F8HA 4HM2B 3Q90A 3MYTA 3F8XA 2YFIB 3IPTA 1E3RA 1GY5A 1Z1SA 5AEWB 3NXJA 1OPYA 4L8OA 3FSDA 1NWWA 1U5OA 3FH1A 4HM7B 3MG3A 4K1VA 3F40A 5FW5A 3DZLA 1EG9B 1O7WB 1O7NB 1JN5B 4HJLB 5D81A 3H51A 3G0KA 1GYBA 4XB5A 1QMAA 3ROBA 3JUPA 3ECFA 4OVMA 3G16A 4X2OA 1E97A 5AIGA 3EBYA 1ASKA 4K1UA 2GBXB 4KVHA 4U13A 2W2CA 3OWSA 5AIFA 1Q42A 3A76A 1C7HA 4WP5A 2INXA 4XDVA 3CPOA 4J8TA 2HMOB 2XR8B 5AEUB 4STDA 4LMIA 2BNGA 3OX9A 5AI1A 3CNXA 1DMMA 1GY6A 1IDPA 1JB2A 4HM0B 1OGXA 3EF8A 3NV0A 3GZRA 4WYKB 1AR0A 4RZMA 1OUNA 2K54A 3FGYA 5IEPA 3F7XA 2HMLB 3WMDA 3FF0A 2CKFB 1O7PB 2HMMB 3SOAA 3K7CA 2BMQB 1W00A 3JUQA 1OHPA 3GZXB 3B7CA 5IG3A 1VZZA 3NUVA 2OWPA 3CU3A 3F9SA 4HZ9B 1OHSA 3LYGA 1JKGA 1QJGA 2A15A 1ZX2A 2YFLB 7STDA 4HM8B 5AIIA 5TGNA 5D83A 5KP1A 2STDA 4HVNA 3KZTA 2GXFA 1CQSA 3B4OA 3VSYA 3I0YA 5DRVA 4FCJA 3EHCA 4GB5A 3FZWA 1K41A 3FKAA 3BB9A 1JKGB 2CHCA 1NDOB 5CF1A 1DMNA 3D9RA 5IENA 2HMJB 3UNLA 4L7KA 1OF5A 2F86B 1EA2A 4HZBB 3T8NA 1O7HB 5IG4A 3T8UA 5BVBA 5IG0A 4XM4A 5KP3A 3GZYB 3GWRA 2BMRB 2IMJA 1O7GB 1OHOA 4XBXA 5D82A 3H3HA 4HM6B 5AIHA 3DM8A 3CNMA 2GBWB 1GS3A 3EN1B 5JPPA 4PEJA 2PZVA 1TP6A 1OF5B 3LZAA 3EN8A 4R9KA 3RGAA 1W02A 1UUWB 3JUMA 3UJMA 3MG1A 3HZPA 3DMCA 2F98A 4WWUC 4OUQA 4N3VA 2B1XB 5BXQA 2B24B 1A2KA 1ULJB 3EBTA 1OCVA 3B4PA 3NBRA 4R9LA 4LGQA 1O7MB 4HM1B 5G2GA 4Q53A 2Z76A 2I9WA 1Q40A 3MHEA 3JUNA 1DMQA 1TUHA 3HX8A 3NV0B 3MSOA 3OWYA 2HMNB 6STDA 1OGZA 1JB5A 3MKIA 3B8LA 1BUQA 4L8PA 4MJDA 4J9AA 3GZBA 4LEHA 2GEYA 2R4IA 2QGUA 3OWUA 2RGQA 3KKGA 3SEDA 1JN5A 2F99A 3E99A 3KE7A 3HK4A 1ULIB
chains in the Genus database with same CATH superfamily
3Q1CA 1YJ93 1JB4A 2YX9A 4XBYA 3ZG0A 2XSOB 4EBGA 5CXOA 3CC43 2W56B 1AVKA 3M8CA 1BRHA 1GMPA 5STDA 1HKXA 2OTJ3 3CME3 1Q40B 3KSPA 5EQLA 1KC84 1SJWA 4N6UA 3U97A 1BRIA 2QIYA 1JZOA 1OH0A 1Q7HA 3EJVA 1U8CB 1KQS2 1MNLA 1M904 5RNTA 1UI7A 2D42A 1EEJA 1LQMB 4EW5A 3PCRA 1NB5I 3DUKA 2BMOB 1A90A 1NU3A 5AYSC 3VF1A 3K9MC 2OQEC 3UL5A 2ZHXB 1W01A 3LTAA 3G8ZA 3CCV3 2UGIA 1DE3A 1I70A 3LTBA 2CFGA 2ZDJA 4CDLA 1F8NA 1DETA 1I2GA 7RNTA 1FUWA 2UX0A 2W9PA 1LOYA 1TIJA 1BNIA 1I8VA 3NM2A 4H3UA 5CK6A 1TRQA 4JRFA 2XGNA 1WQLB 1FGMA 3F14A 3FG4A 2H0IA 1IVUA 1B2SA 3LTCA 1X1UA 1GY7A 3SOYA 3JVCA 3QRDA 5JBSA 4IIAA 2BU4A 5CF2A 3STDA 3CCR3 3FLJA 2JDIH 4HM5B 2CW9A 4GHOA 3VGNA 4XBTA 1PYLA 1MGRA 3WOFB 4NHFA 1YI23 1QVG2 3MG2A 3NQZA 1IVVA 3KCHA 3NHXA 3CD63 3EQQB 4R1KA 5G1LA 2XF3A 8RNTA 5EEOA 4R4KA 5I97A 1YJN3 1FGQA 1GOYA 1UCIA 4WYKA 1KSIA 3D4AA 4MMZB 3CMA3 1GOVA 3S67A 1IQXA 5M1AA 2JQ5A 1GOUA 1X1WA 3T0UA 1LOVA 3FF2A 2WGQA 4NREA 1I0VA 8CHOA 1YGEA 1MWSA 5A0OB 2H0HA 1YGWA 1FZUA 2CWTA 1UUGB 3DGMA 3FG3A 1W6GA 4BTXA 2Z77A 3QK9A 2BO9B 2XRXB 1JBSA 1ISKA 1RGFA 5IG5A 1AV4A 1V58A 1IU7A 2OOVC 3IMAB 3GSPA 2IY2A 2R41A 2XSHB 1RGGA 3OV4A 2OCTA 5JPUA 2HMKB 1S5AA 5IEOA 1STDA 2CFWA 4HKVB 1B2MA 1SQWA 2W6JH 1NNVA 2CC3A 5IF6A 3OW22 4HOHA 1QVF2 1V57A 5EVHA 3BU4A 3S27A 2QA43 1BOXA 1BRGA 3OXAA 1G0TA 1BSEA 4O2HA 3S5CA 4WFOA 5HOHA 1EUIC 4J5GA 5IERA 2Q07A 3ZFZA 3NX0A 2IYJA 1UCKA 5HGRA 5KP4A 1ZO2A 2GEXA 4HM4B 2MC8A 3DXOA 2RFRA 3BNBA 1W6YA 1SPUA 3ALAA 3CCJ3 1UUVB 3JUOA 1FUSA 4HM3B 1VQM3 1FGRA 5CLKA 1MOLA 3FG1A 3LXUX 3GRDA 3PXMA 2RCDA 3Q3FA 4DKIA 1JBTA 3SLUA 4N6LA 3SXXA 2SARA 3PS8A 3CXC2 2GSPA 5IW9A 1BANA 1TJDA 3RGRA 3D79A 2GU1A 3BLZA 3ER7A 4ORLA 3V99A 1YIJ3 1V74A 1RNTA 1KD14 4J5KA 3EX9A 1A67A 3EC9A 1UGIA 5DREA 4I4KA 2E2VA 1UI8A 4X2HA 1Q7Y4 1RGHA 1E3VA 1LOXA 2F5WA 2O3OA 2Z7AA 4JF8A 4XDWA 3K0ZA 5LC7A 3F7SA 2OQEA 3LTDA 6GSPA 4EV5A 1G02A 4FCMA 2YFJB 4H61A 4O8SA 2V1LA 4KFFA 3F8HA 2KCDA 1RHLA 4HM2B 3Q90A 2BT3A 3KN4A 3MYTA 3F8XA 2YFIB 3IPTA 4GL6A 3WOEB 1E3RA 3WR2A 1C54A 1GY5A 1Z1SA 2KXGA 3AGOA 3S28A 1BNEA 1BRJA 1TU5A 2J8XB 4FMAA 3CCM3 1WMOA 3I553 1JV2B 2HOHA 2KF6A 5AEWB 1RCLA 3NXJA 4HAAA 3KE7A 3BNDA 1BUJA 1OPYA 4L8OA 1IVXA 3WHOA 3FSDA 4KZ1A 1YIT3 1NWWA 2WO0A 1VQP3 1U5OA 5LC6A 1I3FA 1B2ZA 3Q2PA 2L1SA 2CFKA 2LQVA 1R4YA 3FH1A 4FMCA 3L0RA 1T2IA 1VQK3 1VQN3 4HM7B 1N8QA 1AVLA 1I0XA 3KFQC 2WGOA 1FW7A 3MG3A 2AAEA 3ZG5A 1K8A4 4K1VA 3F40A 3HIGA 3S29A 1UDII 3G6E3 4HBRA 1X1YA 1N9EA 1UW1A 3DZLA 5FW5A 1K734 1EG9B 3WA3A 2C10A 3BNEA 3LOYA 1O7WB 2ML5A 4KFDA 1O7NB 5BIRA 5M19A 1JN5B 1NB3I 4HJLB 1PFPA 3WDGB 5D81A 1BAOA 1IVWA 2E2UA 2XFSA 3AHWA 3D5GA 3FCSB 3G0KA 3H51A 1GYBA 2CWUA 2FGTA 4EXRA 3N54B 2CIUA 1D6YA 1W4NA 4XB5A 1VQO3 3DGNA 2UUGC 1VQ83 1LXEA 1QMAA 2K0MA 3WA2X 3ROBA 3JUPA 3ECFA 3DGYA 2RSXA 3LMLA 2D1WA 4OVMA 3G16A 3NQYA 4X2OA 1E97A 1N9JA 3LT8A 2ML6A 1RRLA 5AIGA 1BGSA 3EBYA 1ASKA 1YVSA 3U1WA 2AADA 4RNTA 4K1UA 2GBXB 4KVHA 1SARA 2P0XA 4U13A 2W2CA 1T2HA 3NBBA 2RBIA 3OWSA 5AIFA 1Q42A 3A76A 1A2PA 2O9UX 3PCSA 1C7HA 1YHQ3 1BSCA 1B3SA 4WP5A 1VQ63 2INXA 4XDVA 3CPOA 4OK0A 2CG1A 4J8TA 1WTHA 2LYXA 2HMOB 1YVBI 2XR8B 4STDA 2CX1A 1TFOA 2BNGA 4LMIA 5G1KA 5AEUB 3J7Yd 3OX9A 5AI1A 3CNXA 3SX1A 2QEX3 4TX4A 1NJI4 1BRNL 4N6TA 2C11A 1RN7A 2E2TA 1BSBA 1DMMA 1GY6A 1IDPA 4O3VA 1JB2A 4HM0B 1OGXA 5M18A 1I3IA 4RNZA 3N8BA 3EF8A 3NV0A 3UL6A 3GZRA 2CFDA 3DGLA 1AR0A 1EKMA 4WYKB 1HZ1A 1RGEA 1VQQA 3D3LA 4RZMA 2IUJA 1OUNA 1Q864 4NPBA 1M1K4 2F56A 2K54A 3FGYA 4LYLB 3F7XA 2F5MA 5IEPA 1SIIA 1G96A 3DY5A 1Y4KA 1BNFA 4BTYA 2C4BA 1LVNA 2HMLB 2KRTA 3WMDA 4AEQA 1BSDA 2CKFB 3FF0A 3UB1A 1O7PB 2HMMB 2KF4A 3K5TA 3SOAA 2BHMA 3K7CA 2BMQB 1MWUA 1W00A 1B27A 2XEPA 4FMDA 1T5YA 4RNYA 5BU4A 3CCL3 1UGHI 1JBRA 3JUQA 1OHPA 4MMXB 3GZXB 1LNHA 1ZS7A 3IJEB 3HIIA 3B7CA 5IG3A 1VZZA 2W56A 1CEWI 4KFEA 2PNCA 1DVCA 1I2EA 3NUVA 2P05A 3AHSA 1BVIA 1MWTA 2OWPA 1DYUA 3AMOA 1TRPA 3CU3A 4QWTA 4EC6A 1WMPA 3F9SA 4BL3A 4HZ9B 1OHSA 2Y73A 4KT3B 3G4S3 3LYGA 1JKGA 1QAFA 1US1A 4CJNA 3KSED 4G1MB 4O02B 7GSPA 1QJGA 4MMYB 4AKZA 2A15A 1ZX2A 1W6CA 2YFLB 1RMSA 1T3BA 4N6V0 4EYCA 1IV9A 2IUKA 2CH9A 2F4YA 1D6UA 1BNGA 2GU3A 3I563 2ZL8A 2WOFA 7STDA 1DVDA 4GSPA 4HM8B 5AIIA 5TGNA 4FMBA 4RBNA 1BRSA 5D83A 4ZM8A 5KP1A 3G713 2STDA 3HI7A 1QALA 1M1XB 2XFTA 4HVNA 1GD4A 5ELUA 3KZTA 1RLSA 1VQ53 2P09A 1FGOA 1CQSA 1CYVA 2GXFA 3B4OA 3MWZA 4FCZA 1LNIA 3VSYA 2CFLA 3RDEA 1RN1A 3I0YA 5DRVA 4CPKA 3NM7A 4FCJA 1IT7A 3X3YA 1PU4A 3A5EA 3EHCA 4GB5A 4CCVA 3FZWA 1STFI 2OTL3 1K41A 2OOVA 3AMOB 3FKAA 3HOHA 3KIIA 3BB9A 1JKGB 3EE1A 3NBJA 1BU4A 2XGLA 1GSPA 3CCQ3 2CHCA 1NDOB 1TFKA 1IQYA 3CCE3 5CF1A 1DMNA 4BTWA 3D9RA 4ILFA 3HK4A 1LRAA 5IENA 1K9M4 1W7CA 3GAXA 2HMJB 3O8YA 2W9QA 3UNLA 1IK3A 4K90B 5ELJA 1BSAA 4BU4A 4L7KA 2W04A 1OF5A 2F86B 3X42A 3CC23 1EA2A 1GMQA 1IV7A 1GMRA 1MGWA 2P38A 3DGOA 3PGBA 2BIRA 4R80A 1EQKA 4HZBB 3X41A 1RGLA 1JZDA 3T8NA 1O7HB 1AY7A 1JRQA 5IG4A 3D5IA 2RNTA 2CG0A 1QAKA 1JNQA 3T8UA 1HU9A 1GD3A 2WOHA 5BVBA 5IG0A 4XM4A 5KP3A 3GZYB 1R4CA 2W03A 3PZWA 1RSNA 3GWRA 2P0MA 2CWVA 2BMRB 1SIHA 1CH0A 1N5PA 1O7GB 2IMJA 1OHOA 2CX0A 2KF3A 3X40A 3BNCA 4XBXA 1BIRA 4IT7A 1BNRA 1I2FA 1OACA 5D82A 3H3HA 2SBLA 1W2B2 1JJ22 3BIRA 4HM6B 5AIHA 1W2ZA 1RRHA 2H0GA 1TTOA 3CNMA 3DM8A 3X3XA 4BIRA 1VQ43 1VQ93 2GBWB 4N6MA 1GS3A 2FXTA 3EN1B 1FGTA 5FGOA 1NO3A 3LT9A 1B2UA 4PEJA 5JPPA 1D6ZA 3X3ZA 4HYZA 4WHAA 3K63A 2L4VA 2PZVA 1RTUA 4IPBA 1TP6A 6RNTA 3CCS3 1CYUA 3TDGA 1BRKA 1OF5B 3LZAA 3EN8A 4I5QA 4R9KA 1B21A 3CPW2 1ROAA 1MWRA 1BNSA 1FUTA 2Y74A 1PY3A 1WNHA 3RGAA 1RCKA 1IYYA 3LH4A 1W02A 1UUWB 3JUMA 3UJMA 3V98A 3CCU3 1AQZA 2M7OA 9RNTA 3PYJA 1IQ8A 3MG1A 3HZPA 3DMCA 1B2XA 1LQGC 2F98A 4WWUC 3CC73 4OUQA 4K61A 1Q824 1B20A 1IT8A 4N3VA 2B1XB 4N6NB 4LZIA 5BXQA 2B24B 1N5HA 1A2KA 1ULJB 3EBTA 1LOWA 1OCVA 2MF7A 3B4PA 1RN4A 5GSPA 1RJOA 1VQL3 3NBRA 4R9LA 1Q9EA 2KF5A 3MPHA 1RGKA 1YNVX 4LGQA 4LSOA 1O7MB 1A2VA 2CK3H 1BNJA 2W0QA 4HM1B 1RDSA 5G2GA 1ROVA 2FNQA 3DH2A 3RNTA 3SYUA 3V92A 1VQ73 1UCLA 4Q53A 1FA3A 2KAAA 5AYRB 1L5GB 2Z76A 1KWIA 4AKYA 1S723 2I9WA 1Q40A 3MHEA 1ZGXA 2XH9A 3JUNA 3URPA 1UCJA 1DMQA 1TUHA 3HX8A 3NV0B 1RKYA 1WMNA 2ZA4A 3MSOA 1RGCA 1RNBA 3AGNA 3OWYA 2HMNB 6STDA 1OGZA 1HYFA 4BL2A 1JB5A 2IA7A 3EB8A 1M9GA 3MKIA 3B8LA 3WODG 1BUQA 4L8PA 4MJDA 1YJW3 4J9AA 1Q814 4EV2A 3GZBA 3N9HA 4LEHA 1N8R4 1FYSA 2GEYA 2R4IA 1J2BA 2QGUA 2Z6BA 3OWUA 2RGQA 3KKGA 4MEIA 4N6OB 3SEDA 1W5ZA 1JN5A 2K3DA 4FR9A 2F99A 3E99A 3SVAA 1RGAA 1K28A 1X1XA 1ULIB
chains in the Genus database with same CATH topology
3Q1CA 1YJ93 1JB4A 2YX9A 4XBYA 2XSOB 4EBGA 5CXOA 3CC43 2W56B 1AVKA 3M8CA 5STDA 1HKXA 2OTJ3 3CME3 1Q40B 3KSPA 5EQLA 1KC84 1SJWA 4N6UA 3U97A 2QIYA 1OH0A 3EJVA 1U8CB 1KQS2 1MNLA 1M904 1UI7A 2D42A 1NB5I 3PCRA 3DUKA 2BMOB 1A90A 1NU3A 5AYSC 3VF1A 3K9MC 2OQEC 3UL5A 1W01A 3LTAA 3G8ZA 3CCV3 3LTBA 2CFGA 2ZDJA 4CDLA 1F8NA 1FUWA 2UX0A 2W9PA 1TIJA 3NM2A 4H3UA 5CK6A 1Q814 1QVF2 1CYUA 4JRFA 2XGNA 1WQLB 1FGMA 3F14A 3FG4A 1IVUA 3LTCA 1GY7A 3SOYA 3JVCA 3QRDA 5JBSA 4IIAA 5CF2A 3STDA 3CCR3 3FLJA 2JDIH 4HM5B 2CW9A 3VGNA 3WOFB 4XBTA 1YI23 1QVG2 4NHFA 3MG2A 3NQZA 1IVVA 3NHXA 3CD63 3EQQB 4R1KA 2XF3A 5EEOA 4R4KA 5I97A 1YJN3 1FGQA 4WYKA 3CMA3 1KSIA 4MMZB 3S67A 1IQXA 2JQ5A 3T0UA 3FF2A 2WGQA 4NREA 8CHOA 1YGEA 5A0OB 2CWTA 3DGMA 3FG3A 1W6GA 4BTXA 2Z77A 3QK9A 2XRXB 2BO9B 1ISKA 5IG5A 1AV4A 2OOVC 1IU7A 3IMAB 2XSHB 3OV4A 2OCTA 5JPUA 2HMKB 1S5AA 5IEOA 1STDA 2CFWA 4HKVB 1SQWA 2W6JH 3OW22 2CC3A 5IF6A 5EVHA 3S27A 2QA43 3OXAA 4O2HA 3S5CA 4WFOA 5IERA 2Q07A 3NX0A 5HGRA 5KP4A 1ZO2A 2GEXA 4HM4B 2MC8A 3DXOA 2RFRA 3BNBA 1W6YA 1SPUA 3ALAA 3CCJ3 1UUVB 3JUOA 4HM3B 1VQM3 1FGRA 5CLKA 1MOLA 3FG1A 3LXUX 3GRDA 3PXMA 2RCDA 3SLUA 4N6LA 3SXXA 3CXC2 3PS8A 5IW9A 3RGRA 4ORLA 2GU1A 3BLZA 3ER7A 3V99A 1YIJ3 1V74A 1KD14 3EX9A 1A67A 3EC9A 5DREA 4I4KA 2E2VA 1UI8A 4X2HA 1Q7Y4 1E3VA 1LOXA 2O3OA 2Z7AA 4JF8A 4XDWA 3K0ZA 5LC7A 3F7SA 2OQEA 3LTDA 4EV5A 4FCMA 2YFJB 4H61A 4O8SA 2V1LA 4KFFA 3F8HA 2KCDA 4HM2B 3Q90A 2BT3A 3KN4A 3MYTA 3F8XA 2YFIB 3IPTA 4GL6A 3WOEB 1E3RA 1GY5A 1Z1SA 2KXGA 3S28A 1TU5A 3CCM3 4FMAA 1WMOA 3I553 1JV2B 5AEWB 3NXJA 3BNDA 1OPYA 4L8OA 1IVXA 3FSDA 4KZ1A 1YIT3 1NWWA 2WO0A 1VQP3 1U5OA 5LC6A 3Q2PA 2CFKA 2LQVA 3FH1A 4FMCA 3L0RA 1VQK3 1VQN3 4HM7B 1N8QA 1AVLA 3KFQC 2WGOA 3MG3A 1K8A4 4K1VA 3F40A 3HIGA 3S29A 3G6E3 4HBRA 1N9EA 1UW1A 3DZLA 5FW5A 1K734 1EG9B 3WA3A 2C10A 3BNEA 3LOYA 1O7WB 2ML5A 4KFDA 1O7NB 1JN5B 1NB3I 4HJLB 1PFPA 3WDGB 5D81A 1IVWA 2XFSA 2E2UA 3FCSB 3H51A 3G713 3G0KA 1GYBA 2CWUA 2FGTA 4EXRA 3N54B 2CIUA 1D6YA 1W4NA 4XB5A 1VQO3 3DGNA 1VQ83 1LXEA 1QMAA 2K0MA 3WA2X 3ROBA 3JUPA 3ECFA 2RSXA 3LMLA 2D1WA 4OVMA 3G16A 3NQYA 4X2OA 1E97A 1N9JA 3LT8A 2ML6A 1RRLA 5AIGA 3EBYA 1ASKA 3U1WA 4K1UA 2GBXB 4KVHA 2P0XA 4U13A 2W2CA 3NBBA 3OWSA 5AIFA 1Q42A 3A76A 2O9UX 3PCSA 1C7HA 1YHQ3 4WP5A 1VQ63 2INXA 4XDVA 3CPOA 4OK0A 2CG1A 4J8TA 1WTHA 2LYXA 2HMOB 1YVBI 2XR8B 4STDA 5AEUB 1TFOA 2BNGA 4LMIA 3J7Yd 2QEX3 3OX9A 5AI1A 3CNXA 3SX1A 1NJI4 4TX4A 4N6TA 2C11A 1RN7A 2E2TA 1DMMA 1GY6A 1IDPA 4O3VA 1JB2A 4HM0B 1OGXA 4RNZA 3N8BA 3EF8A 3NV0A 3UL6A 3GZRA 2CFDA 3DGLA 1AR0A 1EKMA 4WYKB 3D3LA 2IUJA 4RZMA 1OUNA 1Q864 1M1K4 2K54A 3FGYA 5IEPA 3F7XA 1SIIA 1G96A 3DY5A 1Y4KA 4BTYA 1LVNA 2HMLB 2KRTA 3WMDA 4AEQA 3FF0A 2CKFB 3UB1A 1O7PB 2HMMB 3K5TA 3SOAA 2BHMA 3K7CA 2BMQB 2XEPA 1W00A 4FMDA 4RNYA 3CCL3 1T5YA 3JUQA 1OHPA 4MMXB 3GZXB 1LNHA 3IJEB 3HIIA 3B7CA 5IG3A 1VZZA 2W56A 1CEWI 4KFEA 2PNCA 1DVCA 3NUVA 2P05A 2OWPA 1DYUA 3AMOA 3CU3A 4QWTA 4EC6A 1WMPA 3F9SA 4HZ9B 1OHSA 2Y73A 3G4S3 3LYGA 1JKGA 1QAFA 1US1A 3KSED 4G1MB 4O02B 1QJGA 4MMYB 4AKZA 2A15A 1ZX2A 1W6CA 2YFLB 4N6V0 4EYCA 1IV9A 2IUKA 2CH9A 1D6UA 2GU3A 3I563 2ZL8A 2WOFA 7STDA 1DVDA 4HM8B 5AIIA 5TGNA 4FMBA 4RBNA 5D83A 4ZM8A 1FA3A 5KP1A 2STDA 3HI7A 1QALA 1M1XB 2XFTA 4HVNA 1GD4A 5ELUA 3KZTA 1VQ53 2P09A 1FGOA 1CQSA 1CYVA 2GXFA 3B4OA 3MWZA 4FCZA 3VSYA 2CFLA 3RDEA 3I0YA 5DRVA 3NM7A 4FCJA 1IT7A 3X3YA 1PU4A 3EHCA 4GB5A 4CCVA 3FZWA 1STFI 2OTL3 1K41A 2OOVA 3AMOB 3FKAA 3KIIA 3BB9A 1JKGB 3EE1A 3NBJA 2XGLA 3CCQ3 2CHCA 1NDOB 1TFKA 1IQYA 3CCE3 5CF1A 1DMNA 4BTWA 3D9RA 3HK4A 5IENA 1K9M4 1W7CA 3GAXA 2HMJB 3O8YA 2W9QA 3UNLA 1IK3A 4K90B 5ELJA 4L7KA 2W04A 1OF5A 2F86B 3X42A 3CC23 1EA2A 3DGOA 1IV7A 2P38A 3PGBA 4R80A 1EQKA 4HZBB 3X41A 3T8NA 1O7HB 1JRQA 5IG4A 2CG0A 1QAKA 1JNQA 3T8UA 1HU9A 1GD3A 2WOHA 5BVBA 5IG0A 4XM4A 5KP3A 3GZYB 1R4CA 2W03A 3PZWA 3GWRA 2P0MA 2CWVA 2BMRB 1SIHA 2IMJA 1N5PA 1O7GB 1OHOA 3X40A 3BNCA 4XBXA 4IT7A 1OACA 5D82A 3H3HA 2SBLA 1W2B2 1JJ22 4HM6B 5AIHA 1W2ZA 1RRHA 3DM8A 3CNMA 3X3XA 1VQ43 1VQ93 2GBWB 4N6MA 1GS3A 2FXTA 3EN1B 1FGTA 5FGOA 1NO3A 3LT9A 5JPPA 4PEJA 1D6ZA 3X3ZA 4HYZA 4WHAA 3K63A 2L4VA 2PZVA 4IPBA 1TP6A 3CCS3 3TDGA 1OF5B 3LZAA 3EN8A 4R9KA 3CPW2 1ROAA 2Y74A 1WNHA 3RGAA 3LH4A 1W02A 1UUWB 3JUMA 3UJMA 3V98A 3CCU3 2M7OA 3PYJA 1IQ8A 3MG1A 3HZPA 3DMCA 2F98A 4WWUC 3CC73 4OUQA 4K61A 1Q824 1IT8A 4N3VA 2B1XB 4N6NB 4LZIA 5BXQA 2B24B 1N5HA 1A2KA 1ULJB 3EBTA 1OCVA 2MF7A 3B4PA 1RJOA 1VQL3 3NBRA 4R9LA 3MPHA 4LGQA 4LSOA 1O7MB 1A2VA 2CK3H 4HM1B 2W0QA 5G2GA 3V92A 1ROVA 2FNQA 1VQ73 4Q53A 5AYRB 1L5GB 2Z76A 1KWIA 4AKYA 1S723 2I9WA 1Q40A 3MHEA 2XH9A 3JUNA 1DMQA 1TUHA 3HX8A 3NV0B 1RKYA 1WMNA 3MSOA 3OWYA 2HMNB 6STDA 1OGZA 1JB5A 2IA7A 3EB8A 1M9GA 3MKIA 3B8LA 3WODG 1BUQA 4L8PA 4MJDA 1YJW3 4J9AA 4EV2A 3GZBA 3N9HA 4LEHA 1N8R4 2GEYA 2R4IA 1J2BA 2QGUA 2Z6BA 3OWUA 2RGQA 3KKGA 4MEIA 4N6OB 3SEDA 1W5ZA 1JN5A 4FR9A 2F99A 3E99A 3SVAA 3KE7A 1K28A 1ULIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB4 A;  4XBY A;  2XSO B;  5CXO A;  3M8C A;  5STD A;  1HKX A;  1Q40 B;  3KSP A;  1SJW A;  2QIY A;  1OH0 A;  3EJV A;  3DUK A;  2BMO B;  1NU3 A;  1W01 A;  3G8Z A;  4CDL A;  2UX0 A;  4H3U A;  3NM2 A;  5CK6 A;  1WQL B;  3F14 A;  1GY7 A;  3SOY A;  4IIA A;  5CF2 A;  3STD A;  3FLJ A;  3VGN A;  4HM5 B;  4XBT A;  3MG2 A;  3NHX A;  3EQQ B;  4R1K A;  4WYK A;  2JQ5 A;  3FF2 A;  8CHO A;  2Z77 A;  2XRX B;  1ISK A;  5IG5 A;  2XSH B;  3OV4 A;  5JPU A;  2HMK B;  1S5A A;  5IEO A;  1STD A;  4HKV B;  5IF6 A;  5EVH A;  3OXA A;  3S5C A;  5IER A;  5HGR A;  5KP4 A;  1ZO2 A;  2GEX A;  4HM4 B;  3DXO A;  2RFR A;  1W6Y A;  1UUV B;  3JUO A;  4HM3 B;  5CLK A;  3GRD A;  2RCD A;  3RGR A;  4ORL A;  3ER7 A;  3BLZ A;  3EX9 A;  3EC9 A;  5DRE A;  4I4K A;  4X2H A;  1E3V A;  2Z7A A;  4XDW A;  3K0Z A;  3F7S A;  4FCM A;  2YFJ B;  3F8H A;  4HM2 B;  3Q90 A;  3MYT A;  3F8X A;  2YFI B;  3IPT A;  1E3R A;  1GY5 A;  1Z1S A;  5AEW B;  3NXJ A;  1OPY A;  4L8O A;  3FSD A;  1NWW A;  1U5O A;  3FH1 A;  4HM7 B;  3MG3 A;  4K1V A;  3F40 A;  5FW5 A;  3DZL A;  1EG9 B;  1O7W B;  1O7N B;  1JN5 B;  4HJL B;  5D81 A;  3H51 A;  3G0K A;  1GYB A;  4XB5 A;  1QMA A;  3ROB A;  3JUP A;  3ECF A;  4OVM A;  3G16 A;  4X2O A;  1E97 A;  5AIG A;  3EBY A;  1ASK A;  4K1U A;  2GBX B;  4KVH A;  4U13 A;  2W2C A;  3OWS A;  5AIF A;  1Q42 A;  3A76 A;  1C7H A;  4WP5 A;  2INX A;  4XDV A;  3CPO A;  4J8T A;  2HMO B;  2XR8 B;  5AEU B;  4STD A;  4LMI A;  2BNG A;  3OX9 A;  5AI1 A;  3CNX A;  1DMM A;  1GY6 A;  1IDP A;  1JB2 A;  4HM0 B;  1OGX A;  3EF8 A;  3NV0 A;  3GZR A;  4WYK B;  1AR0 A;  4RZM A;  1OUN A;  2K54 A;  3FGY A;  5IEP A;  3F7X A;  2HML B;  3WMD A;  3FF0 A;  2CKF B;  1O7P B;  2HMM B;  3SOA A;  3K7C A;  2BMQ B;  1W00 A;  3JUQ A;  1OHP A;  3GZX B;  3B7C A;  5IG3 A;  1VZZ A;  3NUV A;  2OWP A;  3CU3 A;  3F9S A;  4HZ9 B;  1OHS A;  3LYG A;  1JKG A;  1QJG A;  2A15 A;  1ZX2 A;  2YFL B;  7STD A;  4HM8 B;  5AII A;  5TGN A;  5D83 A;  5KP1 A;  2STD A;  4HVN A;  3KZT A;  2GXF A;  1CQS A;  3B4O A;  3VSY A;  3I0Y A;  5DRV A;  4FCJ A;  3EHC A;  4GB5 A;  3FZW A;  1K41 A;  3FKA A;  3BB9 A;  1JKG B;  2CHC A;  1NDO B;  5CF1 A;  1DMN A;  3D9R A;  5IEN A;  2HMJ B;  3UNL A;  4L7K A;  1OF5 A;  2F86 B;  1EA2 A;  4HZB B;  3T8N A;  1O7H B;  5IG4 A;  3T8U A;  5BVB A;  5IG0 A;  4XM4 A;  5KP3 A;  3GZY B;  3GWR A;  2BMR B;  2IMJ A;  1O7G B;  1OHO A;  4XBX A;  5D82 A;  3H3H A;  4HM6 B;  5AIH A;  3DM8 A;  3CNM A;  2GBW B;  1GS3 A;  3EN1 B;  5JPP A;  4PEJ A;  2PZV A;  1TP6 A;  1OF5 B;  3LZA A;  3EN8 A;  4R9K A;  3RGA A;  1W02 A;  1UUW B;  3JUM A;  3UJM A;  3MG1 A;  3HZP A;  3DMC A;  2F98 A;  4WWU C;  4OUQ A;  4N3V A;  2B1X B;  5BXQ A;  2B24 B;  1A2K A;  1ULJ B;  3EBT A;  1OCV A;  3B4P A;  3NBR A;  4R9L A;  4LGQ A;  1O7M B;  4HM1 B;  5G2G A;  4Q53 A;  2Z76 A;  2I9W A;  1Q40 A;  3MHE A;  3JUN A;  1DMQ A;  1TUH A;  3HX8 A;  3NV0 B;  3MSO A;  3OWY A;  2HMN B;  6STD A;  1OGZ A;  1JB5 A;  3MKI A;  3B8L A;  1BUQ A;  4L8P A;  4MJD A;  4J9A A;  3GZB A;  4LEH A;  2GEY A;  2R4I A;  2QGU A;  3OWU A;  2RGQ A;  3KKG A;  3SED A;  1JN5 A;  2F99 A;  3E99 A;  3KE7 A;  3HK4 A;  1ULI B; 
#chains in the Genus database with same CATH topology
 3Q1C A;  1YJ9 3;  1JB4 A;  2YX9 A;  4XBY A;  3ZG0 A;  2XSO B;  4EBG A;  5CXO A;  3CC4 3;  2W56 B;  1AVK A;  3M8C A;  1BRH A;  1GMP A;  5STD A;  1HKX A;  2OTJ 3;  3CME 3;  1Q40 B;  3KSP A;  5EQL A;  1KC8 4;  1SJW A;  4N6U A;  3U97 A;  1BRI A;  2QIY A;  1JZO A;  1OH0 A;  1Q7H A;  3EJV A;  1U8C B;  1KQS 2;  1MNL A;  1M90 4;  5RNT A;  1UI7 A;  2D42 A;  1EEJ A;  1LQM B;  4EW5 A;  3PCR A;  1NB5 I;  3DUK A;  2BMO B;  1A90 A;  1NU3 A;  5AYS C;  3VF1 A;  3K9M C;  2OQE C;  3UL5 A;  2ZHX B;  1W01 A;  3LTA A;  3G8Z A;  3CCV 3;  2UGI A;  1DE3 A;  1I70 A;  3LTB A;  2CFG A;  2ZDJ A;  4CDL A;  1F8N A;  1DET A;  1I2G A;  7RNT A;  1FUW A;  2UX0 A;  2W9P A;  1LOY A;  1TIJ A;  1BNI A;  1I8V A;  3NM2 A;  4H3U A;  5CK6 A;  1TRQ A;  4JRF A;  2XGN A;  1WQL B;  1FGM A;  3F14 A;  3FG4 A;  2H0I A;  1IVU A;  1B2S A;  3LTC A;  1X1U A;  1GY7 A;  3SOY A;  3JVC A;  3QRD A;  5JBS A;  4IIA A;  2BU4 A;  5CF2 A;  3STD A;  3CCR 3;  3FLJ A;  2JDI H;  4HM5 B;  2CW9 A;  4GHO A;  3VGN A;  4XBT A;  1PYL A;  1MGR A;  3WOF B;  4NHF A;  1YI2 3;  1QVG 2;  3MG2 A;  3NQZ A;  1IVV A;  3KCH A;  3NHX A;  3CD6 3;  3EQQ B;  4R1K A;  5G1L A;  2XF3 A;  8RNT A;  5EEO A;  4R4K A;  5I97 A;  1YJN 3;  1FGQ A;  1GOY A;  1UCI A;  4WYK A;  1KSI A;  3D4A A;  4MMZ B;  3CMA 3;  1GOV A;  3S67 A;  1IQX A;  5M1A A;  2JQ5 A;  1GOU A;  1X1W A;  3T0U A;  1LOV A;  3FF2 A;  2WGQ A;  4NRE A;  1I0V A;  8CHO A;  1YGE A;  1MWS A;  5A0O B;  2H0H A;  1YGW A;  1FZU A;  2CWT A;  1UUG B;  3DGM A;  3FG3 A;  1W6G A;  4BTX A;  2Z77 A;  3QK9 A;  2BO9 B;  2XRX B;  1JBS A;  1ISK A;  1RGF A;  5IG5 A;  1AV4 A;  1V58 A;  1IU7 A;  2OOV C;  3IMA B;  3GSP A;  2IY2 A;  2R41 A;  2XSH B;  1RGG A;  3OV4 A;  2OCT A;  5JPU A;  2HMK B;  1S5A A;  5IEO A;  1STD A;  2CFW A;  4HKV B;  1B2M A;  1SQW A;  2W6J H;  1NNV A;  2CC3 A;  5IF6 A;  3OW2 2;  4HOH A;  1QVF 2;  1V57 A;  5EVH A;  3BU4 A;  3S27 A;  2QA4 3;  1BOX A;  1BRG A;  3OXA A;  1G0T A;  1BSE A;  4O2H A;  3S5C A;  4WFO A;  5HOH A;  1EUI C;  4J5G A;  5IER A;  2Q07 A;  3ZFZ A;  3NX0 A;  2IYJ A;  1UCK A;  5HGR A;  5KP4 A;  1ZO2 A;  2GEX A;  4HM4 B;  2MC8 A;  3DXO A;  2RFR A;  3BNB A;  1W6Y A;  1SPU A;  3ALA A;  3CCJ 3;  1UUV B;  3JUO A;  1FUS A;  4HM3 B;  1VQM 3;  1FGR A;  5CLK A;  1MOL A;  3FG1 A;  3LXU X;  3GRD A;  3PXM A;  2RCD A;  3Q3F A;  4DKI A;  1JBT A;  3SLU A;  4N6L A;  3SXX A;  2SAR A;  3PS8 A;  3CXC 2;  2GSP A;  5IW9 A;  1BAN A;  1TJD A;  3RGR A;  3D79 A;  2GU1 A;  3BLZ A;  3ER7 A;  4ORL A;  3V99 A;  1YIJ 3;  1V74 A;  1RNT A;  1KD1 4;  4J5K A;  3EX9 A;  1A67 A;  3EC9 A;  1UGI A;  5DRE A;  4I4K A;  2E2V A;  1UI8 A;  4X2H A;  1Q7Y 4;  1RGH A;  1E3V A;  1LOX A;  2F5W A;  2O3O A;  2Z7A A;  4JF8 A;  4XDW A;  3K0Z A;  5LC7 A;  3F7S A;  2OQE A;  3LTD A;  6GSP A;  4EV5 A;  1G02 A;  4FCM A;  2YFJ B;  4H61 A;  4O8S A;  2V1L A;  4KFF A;  3F8H A;  2KCD A;  1RHL A;  4HM2 B;  3Q90 A;  2BT3 A;  3KN4 A;  3MYT A;  3F8X A;  2YFI B;  3IPT A;  4GL6 A;  3WOE B;  1E3R A;  3WR2 A;  1C54 A;  1GY5 A;  1Z1S A;  2KXG A;  3AGO A;  3S28 A;  1BNE A;  1BRJ A;  1TU5 A;  2J8X B;  4FMA A;  3CCM 3;  1WMO A;  3I55 3;  1JV2 B;  2HOH A;  2KF6 A;  5AEW B;  1RCL A;  3NXJ A;  4HAA A;  3KE7 A;  3BND A;  1BUJ A;  1OPY A;  4L8O A;  1IVX A;  3WHO A;  3FSD A;  4KZ1 A;  1YIT 3;  1NWW A;  2WO0 A;  1VQP 3;  1U5O A;  5LC6 A;  1I3F A;  1B2Z A;  3Q2P A;  2L1S A;  2CFK A;  2LQV A;  1R4Y A;  3FH1 A;  4FMC A;  3L0R A;  1T2I A;  1VQK 3;  1VQN 3;  4HM7 B;  1N8Q A;  1AVL A;  1I0X A;  3KFQ C;  2WGO A;  1FW7 A;  3MG3 A;  2AAE A;  3ZG5 A;  1K8A 4;  4K1V A;  3F40 A;  3HIG A;  3S29 A;  1UDI I;  3G6E 3;  4HBR A;  1X1Y A;  1N9E A;  1UW1 A;  3DZL A;  5FW5 A;  1K73 4;  1EG9 B;  3WA3 A;  2C10 A;  3BNE A;  3LOY A;  1O7W B;  2ML5 A;  4KFD A;  1O7N B;  5BIR A;  5M19 A;  1JN5 B;  1NB3 I;  4HJL B;  1PFP A;  3WDG B;  5D81 A;  1BAO A;  1IVW A;  2E2U A;  2XFS A;  3AHW A;  3D5G A;  3FCS B;  3G0K A;  3H51 A;  1GYB A;  2CWU A;  2FGT A;  4EXR A;  3N54 B;  2CIU A;  1D6Y A;  1W4N A;  4XB5 A;  1VQO 3;  3DGN A;  2UUG C;  1VQ8 3;  1LXE A;  1QMA A;  2K0M A;  3WA2 X;  3ROB A;  3JUP A;  3ECF A;  3DGY A;  2RSX A;  3LML A;  2D1W A;  4OVM A;  3G16 A;  3NQY A;  4X2O A;  1E97 A;  1N9J A;  3LT8 A;  2ML6 A;  1RRL A;  5AIG A;  1BGS A;  3EBY A;  1ASK A;  1YVS A;  3U1W A;  2AAD A;  4RNT A;  4K1U A;  2GBX B;  4KVH A;  1SAR A;  2P0X A;  4U13 A;  2W2C A;  1T2H A;  3NBB A;  2RBI A;  3OWS A;  5AIF A;  1Q42 A;  3A76 A;  1A2P A;  2O9U X;  3PCS A;  1C7H A;  1YHQ 3;  1BSC A;  1B3S A;  4WP5 A;  1VQ6 3;  2INX A;  4XDV A;  3CPO A;  4OK0 A;  2CG1 A;  4J8T A;  1WTH A;  2LYX A;  2HMO B;  1YVB I;  2XR8 B;  4STD A;  2CX1 A;  1TFO A;  2BNG A;  4LMI A;  5G1K A;  5AEU B;  3J7Y d;  3OX9 A;  5AI1 A;  3CNX A;  3SX1 A;  2QEX 3;  4TX4 A;  1NJI 4;  1BRN L;  4N6T A;  2C11 A;  1RN7 A;  2E2T A;  1BSB A;  1DMM A;  1GY6 A;  1IDP A;  4O3V A;  1JB2 A;  4HM0 B;  1OGX A;  5M18 A;  1I3I A;  4RNZ A;  3N8B A;  3EF8 A;  3NV0 A;  3UL6 A;  3GZR A;  2CFD A;  3DGL A;  1AR0 A;  1EKM A;  4WYK B;  1HZ1 A;  1RGE A;  1VQQ A;  3D3L A;  4RZM A;  2IUJ A;  1OUN A;  1Q86 4;  4NPB A;  1M1K 4;  2F56 A;  2K54 A;  3FGY A;  4LYL B;  3F7X A;  2F5M A;  5IEP A;  1SII A;  1G96 A;  3DY5 A;  1Y4K A;  1BNF A;  4BTY A;  2C4B A;  1LVN A;  2HML B;  2KRT A;  3WMD A;  4AEQ A;  1BSD A;  2CKF B;  3FF0 A;  3UB1 A;  1O7P B;  2HMM B;  2KF4 A;  3K5T A;  3SOA A;  2BHM A;  3K7C A;  2BMQ B;  1MWU A;  1W00 A;  1B27 A;  2XEP A;  4FMD A;  1T5Y A;  4RNY A;  5BU4 A;  3CCL 3;  1UGH I;  1JBR A;  3JUQ A;  1OHP A;  4MMX B;  3GZX B;  1LNH A;  1ZS7 A;  3IJE B;  3HII A;  3B7C A;  5IG3 A;  1VZZ A;  2W56 A;  1CEW I;  4KFE A;  2PNC A;  1DVC A;  1I2E A;  3NUV A;  2P05 A;  3AHS A;  1BVI A;  1MWT A;  2OWP A;  1DYU A;  3AMO A;  1TRP A;  3CU3 A;  4QWT A;  4EC6 A;  1WMP A;  3F9S A;  4BL3 A;  4HZ9 B;  1OHS A;  2Y73 A;  4KT3 B;  3G4S 3;  3LYG A;  1JKG A;  1QAF A;  1US1 A;  4CJN A;  3KSE D;  4G1M B;  4O02 B;  7GSP A;  1QJG A;  4MMY B;  4AKZ A;  2A15 A;  1ZX2 A;  1W6C A;  2YFL B;  1RMS A;  1T3B A;  4N6V 0;  4EYC A;  1IV9 A;  2IUK A;  2CH9 A;  2F4Y A;  1D6U A;  1BNG A;  2GU3 A;  3I56 3;  2ZL8 A;  2WOF A;  7STD A;  1DVD A;  4GSP A;  4HM8 B;  5AII A;  5TGN A;  4FMB A;  4RBN A;  1BRS A;  5D83 A;  4ZM8 A;  5KP1 A;  3G71 3;  2STD A;  3HI7 A;  1QAL A;  1M1X B;  2XFT A;  4HVN A;  1GD4 A;  5ELU A;  3KZT A;  1RLS A;  1VQ5 3;  2P09 A;  1FGO A;  1CQS A;  1CYV A;  2GXF A;  3B4O A;  3MWZ A;  4FCZ A;  1LNI A;  3VSY A;  2CFL A;  3RDE A;  1RN1 A;  3I0Y A;  5DRV A;  4CPK A;  3NM7 A;  4FCJ A;  1IT7 A;  3X3Y A;  1PU4 A;  3A5E A;  3EHC A;  4GB5 A;  4CCV A;  3FZW A;  1STF I;  2OTL 3;  1K41 A;  2OOV A;  3AMO B;  3FKA A;  3HOH A;  3KII A;  3BB9 A;  1JKG B;  3EE1 A;  3NBJ A;  1BU4 A;  2XGL A;  1GSP A;  3CCQ 3;  2CHC A;  1NDO B;  1TFK A;  1IQY A;  3CCE 3;  5CF1 A;  1DMN A;  4BTW A;  3D9R A;  4ILF A;  3HK4 A;  1LRA A;  5IEN A;  1K9M 4;  1W7C A;  3GAX A;  2HMJ B;  3O8Y A;  2W9Q A;  3UNL A;  1IK3 A;  4K90 B;  5ELJ A;  1BSA A;  4BU4 A;  4L7K A;  2W04 A;  1OF5 A;  2F86 B;  3X42 A;  3CC2 3;  1EA2 A;  1GMQ A;  1IV7 A;  1GMR A;  1MGW A;  2P38 A;  3DGO A;  3PGB A;  2BIR A;  4R80 A;  1EQK A;  4HZB B;  3X41 A;  1RGL A;  1JZD A;  3T8N A;  1O7H B;  1AY7 A;  1JRQ A;  5IG4 A;  3D5I A;  2RNT A;  2CG0 A;  1QAK A;  1JNQ A;  3T8U A;  1HU9 A;  1GD3 A;  2WOH A;  5BVB A;  5IG0 A;  4XM4 A;  5KP3 A;  3GZY B;  1R4C A;  2W03 A;  3PZW A;  1RSN A;  3GWR A;  2P0M A;  2CWV A;  2BMR B;  1SIH A;  1CH0 A;  1N5P A;  1O7G B;  2IMJ A;  1OHO A;  2CX0 A;  2KF3 A;  3X40 A;  3BNC A;  4XBX A;  1BIR A;  4IT7 A;  1BNR A;  1I2F A;  1OAC A;  5D82 A;  3H3H A;  2SBL A;  1W2B 2;  1JJ2 2;  3BIR A;  4HM6 B;  5AIH A;  1W2Z A;  1RRH A;  2H0G A;  1TTO A;  3CNM A;  3DM8 A;  3X3X A;  4BIR A;  1VQ4 3;  1VQ9 3;  2GBW B;  4N6M A;  1GS3 A;  2FXT A;  3EN1 B;  1FGT A;  5FGO A;  1NO3 A;  3LT9 A;  1B2U A;  4PEJ A;  5JPP A;  1D6Z A;  3X3Z A;  4HYZ A;  4WHA A;  3K63 A;  2L4V A;  2PZV A;  1RTU A;  4IPB A;  1TP6 A;  6RNT A;  3CCS 3;  1CYU A;  3TDG A;  1BRK A;  1OF5 B;  3LZA A;  3EN8 A;  4I5Q A;  4R9K A;  1B21 A;  3CPW 2;  1ROA A;  1MWR A;  1BNS A;  1FUT A;  2Y74 A;  1PY3 A;  1WNH A;  3RGA A;  1RCK A;  1IYY A;  3LH4 A;  1W02 A;  1UUW B;  3JUM A;  3UJM A;  3V98 A;  3CCU 3;  1AQZ A;  2M7O A;  9RNT A;  3PYJ A;  1IQ8 A;  3MG1 A;  3HZP A;  3DMC A;  1B2X A;  1LQG C;  2F98 A;  4WWU C;  3CC7 3;  4OUQ A;  4K61 A;  1Q82 4;  1B20 A;  1IT8 A;  4N3V A;  2B1X B;  4N6N B;  4LZI A;  5BXQ A;  2B24 B;  1N5H A;  1A2K A;  1ULJ B;  3EBT A;  1LOW A;  1OCV A;  2MF7 A;  3B4P A;  1RN4 A;  5GSP A;  1RJO A;  1VQL 3;  3NBR A;  4R9L A;  1Q9E A;  2KF5 A;  3MPH A;  1RGK A;  1YNV X;  4LGQ A;  4LSO A;  1O7M B;  1A2V A;  2CK3 H;  1BNJ A;  2W0Q A;  4HM1 B;  1RDS A;  5G2G A;  1ROV A;  2FNQ A;  3DH2 A;  3RNT A;  3SYU A;  3V92 A;  1VQ7 3;  1UCL A;  4Q53 A;  1FA3 A;  2KAA A;  5AYR B;  1L5G B;  2Z76 A;  1KWI A;  4AKY A;  1S72 3;  2I9W A;  1Q40 A;  3MHE A;  1ZGX A;  2XH9 A;  3JUN A;  3URP A;  1UCJ A;  1DMQ A;  1TUH A;  3HX8 A;  3NV0 B;  1RKY A;  1WMN A;  2ZA4 A;  3MSO A;  1RGC A;  1RNB A;  3AGN A;  3OWY A;  2HMN B;  6STD A;  1OGZ A;  1HYF A;  4BL2 A;  1JB5 A;  2IA7 A;  3EB8 A;  1M9G A;  3MKI A;  3B8L A;  3WOD G;  1BUQ A;  4L8P A;  4MJD A;  1YJW 3;  4J9A A;  1Q81 4;  4EV2 A;  3GZB A;  3N9H A;  4LEH A;  1N8R 4;  1FYS A;  2GEY A;  2R4I A;  1J2B A;  2QGU A;  2Z6B A;  3OWU A;  2RGQ A;  3KKG A;  4MEI A;  4N6O B;  3SED A;  1W5Z A;  1JN5 A;  2K3D A;  4FR9 A;  2F99 A;  3E99 A;  3SVA A;  1RGA A;  1K28 A;  1X1X A;  1ULI B; 
#chains in the Genus database with same CATH homology
 3Q1C A;  1YJ9 3;  1JB4 A;  2YX9 A;  4XBY A;  2XSO B;  4EBG A;  5CXO A;  3CC4 3;  2W56 B;  1AVK A;  3M8C A;  5STD A;  1HKX A;  2OTJ 3;  3CME 3;  1Q40 B;  3KSP A;  5EQL A;  1KC8 4;  1SJW A;  4N6U A;  3U97 A;  2QIY A;  1OH0 A;  3EJV A;  1U8C B;  1KQS 2;  1MNL A;  1M90 4;  1UI7 A;  2D42 A;  1NB5 I;  3PCR A;  3DUK A;  2BMO B;  1A90 A;  1NU3 A;  5AYS C;  3VF1 A;  3K9M C;  2OQE C;  3UL5 A;  1W01 A;  3LTA A;  3G8Z A;  3CCV 3;  3LTB A;  2CFG A;  2ZDJ A;  4CDL A;  1F8N A;  1FUW A;  2UX0 A;  2W9P A;  1TIJ A;  3NM2 A;  4H3U A;  5CK6 A;  1Q81 4;  1QVF 2;  1CYU A;  4JRF A;  2XGN A;  1WQL B;  1FGM A;  3F14 A;  3FG4 A;  1IVU A;  3LTC A;  1GY7 A;  3SOY A;  3JVC A;  3QRD A;  5JBS A;  4IIA A;  5CF2 A;  3STD A;  3CCR 3;  3FLJ A;  2JDI H;  4HM5 B;  2CW9 A;  3VGN A;  3WOF B;  4XBT A;  1YI2 3;  1QVG 2;  4NHF A;  3MG2 A;  3NQZ A;  1IVV A;  3NHX A;  3CD6 3;  3EQQ B;  4R1K A;  2XF3 A;  5EEO A;  4R4K A;  5I97 A;  1YJN 3;  1FGQ A;  4WYK A;  3CMA 3;  1KSI A;  4MMZ B;  3S67 A;  1IQX A;  2JQ5 A;  3T0U A;  3FF2 A;  2WGQ A;  4NRE A;  8CHO A;  1YGE A;  5A0O B;  2CWT A;  3DGM A;  3FG3 A;  1W6G A;  4BTX A;  2Z77 A;  3QK9 A;  2XRX B;  2BO9 B;  1ISK A;  5IG5 A;  1AV4 A;  2OOV C;  1IU7 A;  3IMA B;  2XSH B;  3OV4 A;  2OCT A;  5JPU A;  2HMK B;  1S5A A;  5IEO A;  1STD A;  2CFW A;  4HKV B;  1SQW A;  2W6J H;  3OW2 2;  2CC3 A;  5IF6 A;  5EVH A;  3S27 A;  2QA4 3;  3OXA A;  4O2H A;  3S5C A;  4WFO A;  5IER A;  2Q07 A;  3NX0 A;  5HGR A;  5KP4 A;  1ZO2 A;  2GEX A;  4HM4 B;  2MC8 A;  3DXO A;  2RFR A;  3BNB A;  1W6Y A;  1SPU A;  3ALA A;  3CCJ 3;  1UUV B;  3JUO A;  4HM3 B;  1VQM 3;  1FGR A;  5CLK A;  1MOL A;  3FG1 A;  3LXU X;  3GRD A;  3PXM A;  2RCD A;  3SLU A;  4N6L A;  3SXX A;  3CXC 2;  3PS8 A;  5IW9 A;  3RGR A;  4ORL A;  2GU1 A;  3BLZ A;  3ER7 A;  3V99 A;  1YIJ 3;  1V74 A;  1KD1 4;  3EX9 A;  1A67 A;  3EC9 A;  5DRE A;  4I4K A;  2E2V A;  1UI8 A;  4X2H A;  1Q7Y 4;  1E3V A;  1LOX A;  2O3O A;  2Z7A A;  4JF8 A;  4XDW A;  3K0Z A;  5LC7 A;  3F7S A;  2OQE A;  3LTD A;  4EV5 A;  4FCM A;  2YFJ B;  4H61 A;  4O8S A;  2V1L A;  4KFF A;  3F8H A;  2KCD A;  4HM2 B;  3Q90 A;  2BT3 A;  3KN4 A;  3MYT A;  3F8X A;  2YFI B;  3IPT A;  4GL6 A;  3WOE B;  1E3R A;  1GY5 A;  1Z1S A;  2KXG A;  3S28 A;  1TU5 A;  3CCM 3;  4FMA A;  1WMO A;  3I55 3;  1JV2 B;  5AEW B;  3NXJ A;  3BND A;  1OPY A;  4L8O A;  1IVX A;  3FSD A;  4KZ1 A;  1YIT 3;  1NWW A;  2WO0 A;  1VQP 3;  1U5O A;  5LC6 A;  3Q2P A;  2CFK A;  2LQV A;  3FH1 A;  4FMC A;  3L0R A;  1VQK 3;  1VQN 3;  4HM7 B;  1N8Q A;  1AVL A;  3KFQ C;  2WGO A;  3MG3 A;  1K8A 4;  4K1V A;  3F40 A;  3HIG A;  3S29 A;  3G6E 3;  4HBR A;  1N9E A;  1UW1 A;  3DZL A;  5FW5 A;  1K73 4;  1EG9 B;  3WA3 A;  2C10 A;  3BNE A;  3LOY A;  1O7W B;  2ML5 A;  4KFD A;  1O7N B;  1JN5 B;  1NB3 I;  4HJL B;  1PFP A;  3WDG B;  5D81 A;  1IVW A;  2XFS A;  2E2U A;  3FCS B;  3H51 A;  3G71 3;  3G0K A;  1GYB A;  2CWU A;  2FGT A;  4EXR A;  3N54 B;  2CIU A;  1D6Y A;  1W4N A;  4XB5 A;  1VQO 3;  3DGN A;  1VQ8 3;  1LXE A;  1QMA A;  2K0M A;  3WA2 X;  3ROB A;  3JUP A;  3ECF A;  2RSX A;  3LML A;  2D1W A;  4OVM A;  3G16 A;  3NQY A;  4X2O A;  1E97 A;  1N9J A;  3LT8 A;  2ML6 A;  1RRL A;  5AIG A;  3EBY A;  1ASK A;  3U1W A;  4K1U A;  2GBX B;  4KVH A;  2P0X A;  4U13 A;  2W2C A;  3NBB A;  3OWS A;  5AIF A;  1Q42 A;  3A76 A;  2O9U X;  3PCS A;  1C7H A;  1YHQ 3;  4WP5 A;  1VQ6 3;  2INX A;  4XDV A;  3CPO A;  4OK0 A;  2CG1 A;  4J8T A;  1WTH A;  2LYX A;  2HMO B;  1YVB I;  2XR8 B;  4STD A;  5AEU B;  1TFO A;  2BNG A;  4LMI A;  3J7Y d;  2QEX 3;  3OX9 A;  5AI1 A;  3CNX A;  3SX1 A;  1NJI 4;  4TX4 A;  4N6T A;  2C11 A;  1RN7 A;  2E2T A;  1DMM A;  1GY6 A;  1IDP A;  4O3V A;  1JB2 A;  4HM0 B;  1OGX A;  4RNZ A;  3N8B A;  3EF8 A;  3NV0 A;  3UL6 A;  3GZR A;  2CFD A;  3DGL A;  1AR0 A;  1EKM A;  4WYK B;  3D3L A;  2IUJ A;  4RZM A;  1OUN A;  1Q86 4;  1M1K 4;  2K54 A;  3FGY A;  5IEP A;  3F7X A;  1SII A;  1G96 A;  3DY5 A;  1Y4K A;  4BTY A;  1LVN A;  2HML B;  2KRT A;  3WMD A;  4AEQ A;  3FF0 A;  2CKF B;  3UB1 A;  1O7P B;  2HMM B;  3K5T A;  3SOA A;  2BHM A;  3K7C A;  2BMQ B;  2XEP A;  1W00 A;  4FMD A;  4RNY A;  3CCL 3;  1T5Y A;  3JUQ A;  1OHP A;  4MMX B;  3GZX B;  1LNH A;  3IJE B;  3HII A;  3B7C A;  5IG3 A;  1VZZ A;  2W56 A;  1CEW I;  4KFE A;  2PNC A;  1DVC A;  3NUV A;  2P05 A;  2OWP A;  1DYU A;  3AMO A;  3CU3 A;  4QWT A;  4EC6 A;  1WMP A;  3F9S A;  4HZ9 B;  1OHS A;  2Y73 A;  3G4S 3;  3LYG A;  1JKG A;  1QAF A;  1US1 A;  3KSE D;  4G1M B;  4O02 B;  1QJG A;  4MMY B;  4AKZ A;  2A15 A;  1ZX2 A;  1W6C A;  2YFL B;  4N6V 0;  4EYC A;  1IV9 A;  2IUK A;  2CH9 A;  1D6U A;  2GU3 A;  3I56 3;  2ZL8 A;  2WOF A;  7STD A;  1DVD A;  4HM8 B;  5AII A;  5TGN A;  4FMB A;  4RBN A;  5D83 A;  4ZM8 A;  1FA3 A;  5KP1 A;  2STD A;  3HI7 A;  1QAL A;  1M1X B;  2XFT A;  4HVN A;  1GD4 A;  5ELU A;  3KZT A;  1VQ5 3;  2P09 A;  1FGO A;  1CQS A;  1CYV A;  2GXF A;  3B4O A;  3MWZ A;  4FCZ A;  3VSY A;  2CFL A;  3RDE A;  3I0Y A;  5DRV A;  3NM7 A;  4FCJ A;  1IT7 A;  3X3Y A;  1PU4 A;  3EHC A;  4GB5 A;  4CCV A;  3FZW A;  1STF I;  2OTL 3;  1K41 A;  2OOV A;  3AMO B;  3FKA A;  3KII A;  3BB9 A;  1JKG B;  3EE1 A;  3NBJ A;  2XGL A;  3CCQ 3;  2CHC A;  1NDO B;  1TFK A;  1IQY A;  3CCE 3;  5CF1 A;  1DMN A;  4BTW A;  3D9R A;  3HK4 A;  5IEN A;  1K9M 4;  1W7C A;  3GAX A;  2HMJ B;  3O8Y A;  2W9Q A;  3UNL A;  1IK3 A;  4K90 B;  5ELJ A;  4L7K A;  2W04 A;  1OF5 A;  2F86 B;  3X42 A;  3CC2 3;  1EA2 A;  3DGO A;  1IV7 A;  2P38 A;  3PGB A;  4R80 A;  1EQK A;  4HZB B;  3X41 A;  3T8N A;  1O7H B;  1JRQ A;  5IG4 A;  2CG0 A;  1QAK A;  1JNQ A;  3T8U A;  1HU9 A;  1GD3 A;  2WOH A;  5BVB A;  5IG0 A;  4XM4 A;  5KP3 A;  3GZY B;  1R4C A;  2W03 A;  3PZW A;  3GWR A;  2P0M A;  2CWV A;  2BMR B;  1SIH A;  2IMJ A;  1N5P A;  1O7G B;  1OHO A;  3X40 A;  3BNC A;  4XBX A;  4IT7 A;  1OAC A;  5D82 A;  3H3H A;  2SBL A;  1W2B 2;  1JJ2 2;  4HM6 B;  5AIH A;  1W2Z A;  1RRH A;  3DM8 A;  3CNM A;  3X3X A;  1VQ4 3;  1VQ9 3;  2GBW B;  4N6M A;  1GS3 A;  2FXT A;  3EN1 B;  1FGT A;  5FGO A;  1NO3 A;  3LT9 A;  5JPP A;  4PEJ A;  1D6Z A;  3X3Z A;  4HYZ A;  4WHA A;  3K63 A;  2L4V A;  2PZV A;  4IPB A;  1TP6 A;  3CCS 3;  3TDG A;  1OF5 B;  3LZA A;  3EN8 A;  4R9K A;  3CPW 2;  1ROA A;  2Y74 A;  1WNH A;  3RGA A;  3LH4 A;  1W02 A;  1UUW B;  3JUM A;  3UJM A;  3V98 A;  3CCU 3;  2M7O A;  3PYJ A;  1IQ8 A;  3MG1 A;  3HZP A;  3DMC A;  2F98 A;  4WWU C;  3CC7 3;  4OUQ A;  4K61 A;  1Q82 4;  1IT8 A;  4N3V A;  2B1X B;  4N6N B;  4LZI A;  5BXQ A;  2B24 B;  1N5H A;  1A2K A;  1ULJ B;  3EBT A;  1OCV A;  2MF7 A;  3B4P A;  1RJO A;  1VQL 3;  3NBR A;  4R9L A;  3MPH A;  4LGQ A;  4LSO A;  1O7M B;  1A2V A;  2CK3 H;  4HM1 B;  2W0Q A;  5G2G A;  3V92 A;  1ROV A;  2FNQ A;  1VQ7 3;  4Q53 A;  5AYR B;  1L5G B;  2Z76 A;  1KWI A;  4AKY A;  1S72 3;  2I9W A;  1Q40 A;  3MHE A;  2XH9 A;  3JUN A;  1DMQ A;  1TUH A;  3HX8 A;  3NV0 B;  1RKY A;  1WMN A;  3MSO A;  3OWY A;  2HMN B;  6STD A;  1OGZ A;  1JB5 A;  2IA7 A;  3EB8 A;  1M9G A;  3MKI A;  3B8L A;  3WOD G;  1BUQ A;  4L8P A;  4MJD A;  1YJW 3;  4J9A A;  4EV2 A;  3GZB A;  3N9H A;  4LEH A;  1N8R 4;  2GEY A;  2R4I A;  1J2B A;  2QGU A;  2Z6B A;  3OWU A;  2RGQ A;  3KKG A;  4MEI A;  4N6O B;  3SED A;  1W5Z A;  1JN5 A;  4FR9 A;  2F99 A;  3E99 A;  3SVA A;  3KE7 A;  1K28 A;  1ULI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...