4FCJA

Crystal structure of the ntf2-like domain of human g3bp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal Structures of the Human G3BP1 NTF2-Like Domain Visualize FxFG Nup Repeat Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 128
sequence length 137
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fcjA00
3CNXA 1E3VA 3F14A 1GYBA 5D81A 2A15A 2GBWB 4HM8B 5KP3A 1OHOA 1W00A 4L8OA 4X2HA 1W02A 3ER7A 5AIIA 2YFIB 4LGQA 5CF2A 3FLJA 4U13A 2F86B 3ECFA 3GZYB 2BMRB 5FW5A 5AIHA 1ZO2A 6STDA 3F7XA 4XDWA 4OUQA 1CQSA 4N3VA 2HMLB 3IPTA 5JPPA 1DMMA 4HM2B 4IIAA 3EJVA 4MJDA 2F98A 3EBTA 3MYTA 1BUQA 4GB5A 4HVNA 3KE7A 3OWYA 4L7KA 1EA2A 3DUKA 3A76A 1O7NB 1OH0A 4K1VA 4HJLB 2RFRA 3EC9A 1WQLB 1AR0A 4ORLA 3GRDA 2XR8B 4R9KA 3B4OA 4OVMA 1JB2A 5IENA 3MG3A 1JN5B 4LEHA 2XRXB 5JPUA 2F99A 4L8PA 4WWUC 1NU3A 5BXQA 8CHOA 2B24B 3FF2A 4KVHA 4FCMA 3DMCA 3BLZA 3MKIA 2STDA 3CNMA 5AI1A 1JB4A 1JB5A 1TP6A 3ROBA 5IG3A 3EBYA 4HM5B 3STDA 1GY5A 5IF6A 4R1KA 2RCDA 1E97A 2CHCA 3NV0A 4R9LA 3DXOA 3FKAA 2HMNB 2Z77A 1ZX2A 7STDA 3EX9A 1O7WB 3B7CA 4XBXA 1OHSA 1HKXA 1O7GB 3MSOA 3CU3A 2CKFB 3GZBA 1OGZA 3EN1B 4HM6B 3D9RA 3EHCA 3FF0A 1GY6A 3NV0B 2INXA 2Z7AA 3CPOA 3S5CA 4XDVA 4Q53A 1JKGA 4LMIA 1K41A 3H51A 4XM4A 5IERA 5IG0A 3G16A 4HM1B 3K7CA 5AIGA 5IG4A 2Z76A 3JUNA 5BVBA 3M8CA 5AEUB 3HK4A 3JUMA 2BMQB 3DZLA 3NBRA 3SOAA 3F9SA 3K0ZA 3EN8A 3F7SA 3KKGA 1JKGB 1NWWA 3T8UA 3F40A 3NUVA 3FZWA 4WP5A 2QIYA 3VGNA 3F8HA 2PZVA 1Q42A 5TGNA 3UNLA 2OWPA 3SEDA 1C7HA 1ISKA 3I0YA 3JUOA 3KSPA 2HMOB 4FCJA 1OUNA 3DM8A 1OGXA 4RZMA 1A2KA 2YFJB 5STDA 3VSYA 5CK6A 1W01A 4XBTA 3LZAA 1OPYA 3GZXB 1STDA 5CF1A 3H3HA 3JUQA 1GS3A 2GEYA 1OF5A 1Q40A 1UUVB 3SOYA 3FH1A 1E3RA 2BNGA 5HGRA 2GBXB 3OWUA 1U5OA 1O7HB 4HKVB 1ULIB 2HMMB 5DRVA 2K54A 3WMDA 3OXAA 4X2OA 3FSDA 1DMNA 2RGQA 3MG1A 3MHEA 1QMAA 3LYGA 3MG2A 3NM2A 1TUHA 1OF5B 1Q40B 4J8TA 5EVHA 3UJMA 2YFLB 5AIFA 3HZPA 3G0KA 3OWSA 4HM3B 3Q90A 3EQQB 1VZZA 2IMJA 3T8NA 3OV4A 3KZTA 1S5AA 1DMQA 3GWRA 3B8LA 3HX8A 3BB9A 2XSOB 4HM0B 5CXOA 5AEWB 2I9WA 3GZRA 1OHPA 1ASKA 3OX9A 1EG9B 2HMKB 1GY7A 1JN5A 4XBYA 5KP4A 3FGYA 3B4PA 4HZBB 2XSHB 4HM4B 5IEOA 4HZ9B 2B1XB 5G2GA 5D83A 2GEXA 1NDOB 5CLKA 5IEPA 4XB5A 1QJGA 1UUWB 3EF8A 1Z1SA 4PEJA 4WYKA 3RGAA 3NXJA 3RGRA 2GXFA 3JUPA 2UX0A 4H3UA 4STDA 4CDLA 1O7PB 2JQ5A 3F8XA 2BMOB 4I4KA 5D82A 4K1UA 3G8ZA 1W6YA 2HMJB 5IG5A 1IDPA 2W2CA 2QGUA 1ULJB 3E99A 4WYKB 2R4IA 5KP1A 4HM7B 1O7MB 1SJWA 4J9AA 1OCVA 5DREA 3NHXA
chains in the Genus database with same CATH superfamily
3CNXA 1E3VA 2F56A 3F14A 2BO9B 1SARA 3D5IA 1KC84 1GYBA 5D81A 2A15A 1GOVA 2GBWB 2H0GA 3ALAA 1OHOA 1V58A 1W00A 4HM8B 4IPBA 5KP3A 1DE3A 1EKMA 1GOUA 3SYUA 2OOVA 1UI7A 4N6LA 2E2UA 1SPUA 4L8OA 1JBSA 1B2MA 2OCTA 4HOHA 4J5GA 1LQMB 4NPBA 1IQXA 1M1XB 4X2HA 1W02A 5BU4A 1UI8A 3ER7A 5AIIA 9RNTA 1YIT3 3CC43 2P05A 2YFIB 1A67A 4LGQA 5CF2A 1IQ8A 4RBNA 3FLJA 1NNVA 1TRPA 2RBIA 4AKYA 2CFWA 1RN1A 1K8A4 1IU7A 1LOYA 3BIRA 3D5GA 1WMPA 3HIGA 2F86B 1BIRA 4LYLB 4U13A 4ZM8A 3ECFA 1QAKA 4WHAA 4BTYA 1FUTA 3GZYB 2BMRB 3CCM3 5FW5A 5AIHA 1ZO2A 4BL2A 2Y73A 1JZDA 6STDA 3BNBA 1UCLA 3F7XA 3X41A 5M18A 4XDWA 2WOHA 5AYSC 1N8R4 3GAXA 4RNZA 1BSBA 1LNHA 1GSPA 4OUQA 1CYVA 1CQSA 1EQKA 1ZS7A 4N3VA 1BANA 4IT7A 3G4S3 3CME3 2AADA 1SIHA 1ZGXA 1RMSA 2HMLB 2IA7A 1I2FA 2W04A 3IPTA 5JPPA 1YJW3 1DMMA 4HM2B 4IIAA 1VQ43 2CFDA 3EJVA 4MJDA 1LRAA 2FGTA 2F98A 3EBTA 4FMAA 1IV9A 2WGOA 3MYTA 2H0IA 4GB5A 1BUQA 3ZFZA 1AY7A 4HVNA 1IVUA 3N9HA 4N6OB 2W9QA 1RGFA 3KE7A 1X1UA 2R41A 3OWYA 5M1AA 4L7KA 1HU9A 1EA2A 1RRLA 3DUKA 1YNVX 1IYYA 1MWRA 1BOXA 3A76A 3AGNA 1UCKA 2KF6A 1O7NB 1OH0A 4JF8A 4K1VA 4MEIA 5AYRB 2LQVA 2RFRA 4HJLB 1VQL3 1Q864 2J8XB 1ROVA 1FGQA 2ZA4A 3EC9A 1Q824 1B2ZA 4FMDA 1WQLB 3LXUX 3SLUA 1RNTA 2CFKA 2L1SA 4ORLA 3GRDA 1LVNA 1RGEA 2AAEA 2XR8B 3KIIA 2E2VA 1KSIA 4N6TA 1TTOA 4RNTA 4GSPA 1B2XA 1BRNL 2KF3A 3B4OA 4OVMA 4R9KA 3A5EA 1KD14 3L0RA 1JB2A 1AV4A 1MWUA 4MMXB 1GMQA 3JVCA 5IENA 1FGRA 1OACA 1NJI4 3MG3A 3S67A 1JN5B 2YX9A 4LEHA 2XRXB 2BT3A 2XF3A 2F99A 5JPUA 4L8PA 3HIIA 1YI23 1RRHA 1YGWA 2E2TA 4WWUC 1NU3A 5BXQA 6GSPA 4KZ1A 3VF1A 1EUIC 8CHOA 1WMNA 3MPHA 2B24B 3WR2A 3FF2A 1FW7A 2P38A 4FMCA 5A0OB 1YVBI 1K734 3WDGB 3WOFB 4KVHA 1GMPA 4BTWA 4LZIA 1YJ93 4FCMA 1VQ63 4MMYB 3G713 1KQS2 3DMCA 3BLZA 2CFGA 2STDA 3CNMA 3MKIA 3D3LA 3DGLA 4I5QA 2QEX3 1BSAA 3CCS3 1YIJ3 2FXTA 4AKZA 2XH9A 4BIRA 4N6UA 3S28A 2L4VA 2SARA 3V99A 4LSOA 3EB8A 5AI1A 1T2HA 1IT8A 2HOHA 1JBRA 1EEJA 2XFTA 1DVCA 1JNQA 1JB4A 1JB5A 1U8CB 2CH9A 3EE1A 1TP6A 1NB5I 3CCV3 3ROBA 5IG3A 1BSEA 3IMAB 2BU4A 1TJDA 1RN4A 3EBYA 4HM5B 4R80A 1BNJA 1IVWA 3FG4A 3LTAA 3CCQ3 2Z6BA 3STDA 1GY5A 2PNCA 5IF6A 1QALA 2KF5A 3N54B 5FGOA 1QVF2 2Q07A 4R1KA 2CWUA 1BNRA 1VQN3 1R4YA 2RCDA 4EV5A 1IVVA 1SQWA 3K9MC 3AGOA 3X42A 1VQP3 1TFOA 1E97A 1BRSA 2CHCA 1RLSA 1VQ73 3NV0A 1PYLA 1FA3A 3PCSA 1M1K4 4R9LA 1UUGB 1BNIA 3DXOA 3FKAA 3PYJA 3CCU3 4BL3A 2HMNB 1YVSA 2RSXA 2Z77A 3X3XA 1ZX2A 7STDA 1I0XA 3EX9A 1BNFA 3NM7A 3G6E3 2CK3H 1O7WB 1BRIA 5BIRA 3B7CA 3NBBA 4XBXA 1YGEA 1OHSA 1BNGA 1HKXA 3KN4A 1O7GB 4TX4A 2O3OA 1RHLA 5HOHA 3OW22 1JBTA 3MSOA 3AHWA 3CU3A 2CKFB 3GZBA 3NHXA 1C54A 2XFSA 1OGZA 1G96A 1LOXA 2MC8A 4BU4A 1UDII 1IK3A 2CFLA 1VQK3 3EN1B 4HM6B 3D9RA 4CJNA 5GSPA 1M9GA 1TFKA 4O8SA 1OCVA 3CXC2 1RJOA 3EHCA 3FF0A 1GY6A 1MWSA 3S27A 1GMRA 3UL5A 1BGSA 3CD63 2CIUA 3NV0B 1M904 2INXA 4GHOA 2KCDA 3NQYA 4HAAA 2Z7AA 2W9PA 3CPOA 3S5CA 1IQYA 4XDVA 3I563 1D6YA 4KFDA 2ML5A 2ZDJA 4KT3B 4Q53A 3DGOA 1BRJA 1JKGA 4LMIA 4HYZA 4N6MA 1K41A 1B2UA 1DYUA 1FUSA 5G1KA 4MMZB 3H51A 3D79A 3AHSA 4XM4A 4J5KA 4BTXA 1UW1A 1V74A 5IERA 3MWZA 5IG0A 3FG3A 3G16A 4HM1B 1BRGA 2IUJA 3V92A 3K7CA 5AIGA 1IV7A 5IG4A 2IY2A 2Z76A 1US1A 4DKIA 2W56A 3ZG0A 1MWTA 1X1XA 1YHQ3 1VQ83 3JUNA 5BVBA 3M8CA 5AEUB 1VQ53 3HK4A 1W4NA 3JUMA 2BMQB 3DZLA 3NBRA 5JBSA 2BHMA 1BU4A 2WO0A 1B2SA 3SOAA 1A2PA 2SBLA 3IJEB 1JV2B 2KXGA 3F9SA 3K0ZA 4O2HA 2W6JH 3EN8A 3F7SA 1J2BA 3KKGA 4EXRA 1JKGB 4WFOA 3FCSB 1NWWA 5EEOA 1TU5A 1W2ZA 4O02B 1CEWI 1FZUA 2F5MA 3F40A 3T8UA 3NUVA 4H61A 1D6UA 4EV2A 2P0XA 3FZWA 5IW9A 4WP5A 1R4CA 2QIYA 3VGNA 1BRHA 1VQ93 3F8HA 2PZVA 1Q42A 5TGNA 3UNLA 1BVIA 3LTCA 1ISKA 2OWPA 4CPKA 3SEDA 2W03A 1C7HA 3K5TA 4CCVA 1W5ZA 1BNEA 3I0YA 3JUOA 1Y4KA 1CH0A 4K61A 2C10A 3KSPA 1MOLA 2HMOB 4FCJA 1VQM3 1OUNA 2CWVA 2W56B 3DM8A 2IYJA 4QWTA 1I2EA 1OGXA 1W6GA 1N9EA 4ILFA 4RZMA 1A2KA 2YFJB 2UUGC 5STDA 3X3ZA 2QA43 3HOHA 3VSYA 1IVXA 1YJN3 2KF4A 1ROAA 5CK6A 2OQEC 3WODG 1W01A 4XBTA 2ZL8A 3LZAA 1B21A 1A2VA 1OPYA 4R4KA 1W2B2 3QK9A 1MNLA 3GZXB 1WNHA 1STDA 3HI7A 1GOYA 2ML6A 1Q7HA 1GD3A 5CF1A 3H3HA 3JUQA 3N8BA 1RGCA 3RNTA 1GS3A 2GEYA 4N6V0 1FGTA 2F5WA 3U1WA 1LOVA 1OF5A 1WTHA 8RNTA 1Q40A 1UUVB 3WHOA 3K63A 3SOYA 5LC7A 1W7CA 1MGWA 2LYXA 1BAOA 4JRFA 3FH1A 3PXMA 1E3RA 3S29A 1CYUA 2BNGA 3OX9A 4KFFA 5HGRA 2GBXB 3OWUA 2C11A 3KSED 1U5OA 1HZ1A 1O7HB 3BNEA 3KFQC 1TIJA 3Q1CA 1ULIB 4HKVB 1RGAA 2HMMB 5ELJA 2K0MA 4GL6A 2K54A 5DRVA 3PGBA 3OXAA 3WMDA 2OTL3 3CC23 3DGMA 1HYFA 1BRKA 2CX1A 2K3DA 1PY3A 3NBJA 3FSDA 4X2OA 5EQLA 1DMNA 3LTDA 3J7Yd 2F4YA 2RGQA 1N9JA 3DGNA 1D6ZA 3MG1A 3MHEA 2OQEA 4NREA 3U97A 1QMAA 1RCLA 1N5HA 3LYGA 3MG2A 3NM2A 2FNQA 1K9M4 1STFI 3BNCA 2D1WA 3O8YA 1TUHA 2BIRA 2WOFA 1OF5B 4HBRA 2W0QA 3BU4A 2V1LA 1Q40B 4J8TA 1RSNA 2CC3A 2KRTA 5EVHA 3UJMA 2CW9A 2YFLB 1DVDA 1JZOA 5AIFA 3Q2PA 3X40A 2M7OA 3HZPA 2D42A 3G0KA 3PZWA 1LOWA 3WOEB 1MGRA 1X1WA 5G1LA 3OWSA 4HM3B 3FG1A 1X1YA 3NQZA 3EQQB 3Q90A 1VZZA 2IMJA 4K90B 3DGYA 3OV4A 3LMLA 1B20A 3GSPA 3PS8A 3T8NA 1RGKA 1PU4A 3CCJ3 1I3IA 1GD4A 2H0HA 1LXEA 3NX0A 1RTUA 1RDSA 3KZTA 1S5AA 3SXXA 1BSDA 2MF7A 3DH2A 1DMQA 3T0UA 1TRQA 2KAAA 3GWRA 4FR9A 1VQQA 1NB3I 1UGIA 3B8LA 3HX8A 3BB9A 1BUJA 1S723 4EYCA 2XSOB 4HM0B 1PFPA 1FYSA 5CXOA 1N5PA 5AEWB 1Q814 3UB1A 2I9WA 3GZRA 1RKYA 1LQGC 1WMOA 1ASKA 1IT7A 1OHPA 1T3BA 1RGLA 1UCJA 1EG9B 2Y74A 3KCHA 1BSCA 3I553 3LTBA 5RNTA 2HMKB 2P09A 1L5GB 1B27A 3Q3FA 3URPA 2CG1A 1GY7A 1JN5A 1KWIA 4XBYA 3CPW2 3CCE3 2CWTA 5KP4A 2C4BA 1QAFA 3FGYA 3B4PA 1SIIA 1UCIA 4HZBB 2XSHB 4HM4B 1Q7Y4 1A90A 5IEOA 4HZ9B 2XGNA 2ZHXB 3X3YA 3AMOA 1F8NA 1I70A 2B1XB 4KFEA 5G2GA 5D83A 2GEXA 3SX1A 1NDOB 1T5YA 5CLKA 3CC73 1UGHI 3WA2X 1G02A 1QVG2 5IEPA 1I8VA 2GU3A 4OK0A 5M19A 1LNIA 4XB5A 1QJGA 4O3VA 2CX0A 1UUWB 4RNYA 3EF8A 1Z1SA 1W6CA 3PCRA 4PEJA 1I0VA 1NO3A 4WYKA 3CMA3 1DETA 3RGAA 3NXJA 4FCZA 5I97A 3RDEA 1I3FA 1JRQA 1G0TA 4G1MB 7GSPA 3QRDA 3UL6A 3RGRA 2CG0A 2GXFA 5ELUA 4NHFA 3JUPA 3LOYA 2UGIA 2UX0A 4H3UA 4STDA 3TDGA 4EBGA 1FUWA 4CDLA 3LT9A 6RNTA 1O7PB 2JQ5A 3F8XA 2JDIH 3AMOB 7RNTA 2OOVC 2BMOB 2XGLA 4I4KA 1FGOA 1AQZA 3LT8A 1BNSA 3WA3A 5D82A 1AVKA 1Q9EA 4K1UA 2IUKA 1RNBA 2O9UX 3G8ZA 1W6YA 2XEPA 1RN7A 2HMJB 2GU1A 3V98A 5LC6A 1RGHA 4EW5A 5IG5A 2OTJ3 1IDPA 1I2GA 1V57A 1FGMA 2QGUA 1ULJB 2W2CA 4FMBA 2P0MA 3SVAA 3CCL3 1B3SA 3E99A 4WYKB 2R4IA 5KP1A 3ZG5A 4HM7B 2WGQA 1RGGA 1AVLA 1JJ22 1K28A 3D4AA 1N8QA 1O7MB 1SJWA 2GSPA 2RNTA 4EC6A 3BNDA 1RCKA 3LH4A 4AEQA 3DY5A 4J9AA 3CCR3 1T2IA 1VQO3 5DREA 1AR0A 4N6NB
chains in the Genus database with same CATH topology
3CNXA 1E3VA 3F14A 2BO9B 1KC84 1GYBA 5D81A 2A15A 2GBWB 3ALAA 4HM8B 4IPBA 1OHOA 1W00A 5KP3A 1EKMA 2OOVA 1UI7A 4N6LA 2E2UA 1SPUA 4L8OA 2OCTA 4X2HA 1IQXA 1M1XB 1W02A 1UI8A 3ER7A 5AIIA 1YIT3 3CC43 2P05A 2YFIB 1A67A 4LGQA 5CF2A 1IQ8A 4RBNA 3FLJA 4AKYA 2CFWA 1K8A4 1IU7A 4U13A 3HIGA 1WMPA 2F86B 4ZM8A 3ECFA 1QAKA 4WHAA 4BTYA 3GZYB 2BMRB 3CCM3 5FW5A 5AIHA 1ZO2A 2Y73A 6STDA 3BNBA 3F7XA 3X41A 4XDWA 2WOHA 5AYSC 1N8R4 3GAXA 4RNZA 1LNHA 4OUQA 1CYVA 1CQSA 1EQKA 4N3VA 4IT7A 3G4S3 3CME3 1SIHA 2HMLB 2IA7A 2W04A 1YJW3 3IPTA 5JPPA 1DMMA 4HM2B 4IIAA 1VQ43 2CFDA 3EJVA 4MJDA 2FGTA 2F98A 3EBTA 4FMAA 1IV9A 2WGOA 3MYTA 1BUQA 4GB5A 4HVNA 1IVUA 3N9HA 4N6OB 2W9QA 3KE7A 3OWYA 4L7KA 1HU9A 1EA2A 1RRLA 3DUKA 3A76A 4JF8A 1O7NB 1OH0A 4MEIA 4K1VA 5AYRB 2LQVA 2RFRA 4HJLB 1VQL3 1Q864 1ROVA 1FGQA 3EC9A 1Q824 4FMDA 1WQLB 3LXUX 3SLUA 2CFKA 4ORLA 3GRDA 1LVNA 2XR8B 3KIIA 2E2VA 1KSIA 4N6TA 3B4OA 4OVMA 4R9KA 1KD14 3L0RA 1JB2A 1AV4A 4MMXB 3JVCA 5IENA 1FGRA 1OACA 1NJI4 3MG3A 3S67A 1JN5B 2YX9A 4LEHA 2XRXB 2BT3A 2XF3A 2F99A 5JPUA 4L8PA 3HIIA 1YI23 1RRHA 2E2TA 4WWUC 1NU3A 5BXQA 4KZ1A 3VF1A 8CHOA 1WMNA 3MPHA 2B24B 3FF2A 2P38A 4FMCA 5A0OB 1YVBI 1K734 3WDGB 3WOFB 4KVHA 4BTWA 4LZIA 1YJ93 4FCMA 1VQ63 4MMYB 3G713 1KQS2 3DMCA 3BLZA 2CFGA 2STDA 3CNMA 3MKIA 3D3LA 3DGLA 2QEX3 3CCS3 1YIJ3 2FXTA 4AKZA 2XH9A 4N6UA 3S28A 2L4VA 3V99A 4LSOA 3EB8A 5AI1A 1IT8A 2XFTA 1DVCA 1JNQA 1JB4A 1JB5A 1U8CB 2CH9A 3EE1A 1TP6A 1NB5I 3CCV3 3ROBA 5IG3A 3IMAB 3EBYA 4HM5B 4R80A 1IVWA 3FG4A 3LTAA 3CCQ3 2Z6BA 3STDA 1GY5A 2PNCA 5IF6A 1QALA 3N54B 5FGOA 1QVF2 2Q07A 4R1KA 2CWUA 1VQN3 2RCDA 4EV5A 1YJN3 1IVVA 1SQWA 3K9MC 3X42A 1VQP3 1TFOA 1E97A 2CHCA 1VQ73 3NV0A 1FA3A 3PCSA 1M1K4 4R9LA 3DXOA 3FKAA 3CCU3 3PYJA 2HMNB 2RSXA 2Z77A 3X3XA 1ZX2A 7STDA 3EX9A 3NM7A 3G6E3 2CK3H 1O7WB 3B7CA 3NBBA 4XBXA 1YGEA 1OHSA 1HKXA 3KN4A 1O7GB 4TX4A 2O3OA 3OW22 3MSOA 3CU3A 2CKFB 3GZBA 3NHXA 2XFSA 1OGZA 1G96A 1LOXA 2MC8A 1IK3A 1VQK3 2CFLA 3EN1B 4HM6B 3D9RA 1M9GA 1TFKA 4O8SA 3CXC2 1RJOA 3EHCA 3FF0A 1GY6A 3S27A 3UL5A 3CD63 2CIUA 3NV0B 1M904 2INXA 2KCDA 3NQYA 2Z7AA 2W9PA 3CPOA 3S5CA 1IQYA 4XDVA 3I563 1D6YA 4KFDA 2ML5A 2ZDJA 4Q53A 3DGOA 1JKGA 4LMIA 4HYZA 4N6MA 1K41A 1DYUA 4MMZB 3H51A 4XM4A 4BTXA 1UW1A 1V74A 5IERA 3MWZA 5IG0A 3FG3A 3G16A 4HM1B 2IUJA 3V92A 3K7CA 5AIGA 1IV7A 5IG4A 2Z76A 1US1A 2W56A 1YHQ3 1VQ83 3JUNA 5BVBA 3M8CA 5AEUB 1VQ53 3HK4A 1W4NA 3JUMA 2BMQB 3DZLA 3NBRA 5JBSA 2BHMA 2WO0A 3SOAA 2SBLA 3IJEB 1JV2B 2KXGA 3F9SA 3K0ZA 4O2HA 2W6JH 3EN8A 3F7SA 1J2BA 3KKGA 4EXRA 1JKGB 4WFOA 3FCSB 1NWWA 5EEOA 1TU5A 1W2ZA 4O02B 1CEWI 3T8UA 3F40A 3NUVA 4H61A 1D6UA 4EV2A 2P0XA 3FZWA 5IW9A 4WP5A 1R4CA 2QIYA 3VGNA 1VQ93 3F8HA 2PZVA 1Q42A 5TGNA 3UNLA 3LTCA 2OWPA 3SEDA 2W03A 1C7HA 3K5TA 4CCVA 1W5ZA 3I0YA 3JUOA 4K61A 1Y4KA 1Q814 1ISKA 2C10A 3KSPA 1MOLA 2HMOB 4FCJA 1VQM3 1OUNA 2CWVA 2W56B 3DM8A 4QWTA 1OGXA 1W6GA 1N9EA 4RZMA 1A2KA 2YFJB 5STDA 3X3ZA 2QA43 3VSYA 1IVXA 1ROAA 5CK6A 2OQEC 3WODG 1W01A 4XBTA 2ZL8A 3LZAA 1OPYA 1A2VA 4R4KA 1W2B2 3QK9A 1MNLA 3GZXB 1WNHA 1STDA 3HI7A 2ML6A 1GD3A 5CF1A 3H3HA 3JUQA 3N8BA 1GS3A 2GEYA 4N6V0 1FGTA 3U1WA 1OF5A 1WTHA 1Q40A 1UUVB 3K63A 3SOYA 5LC7A 1W7CA 2LYXA 4JRFA 3FH1A 3PXMA 1E3RA 3S29A 1CYUA 2BNGA 4KFFA 5HGRA 2GBXB 3OWUA 2C11A 3KSED 1U5OA 1O7HB 3BNEA 3KFQC 3Q1CA 1TIJA 4HKVB 1ULIB 5ELJA 2HMMB 2K0MA 4GL6A 2K54A 5DRVA 3PGBA 3OXAA 3WMDA 2OTL3 3CC23 3DGMA 3NBJA 4X2OA 3FSDA 5EQLA 1DMNA 3LTDA 3J7Yd 2RGQA 1N9JA 3DGNA 1D6ZA 3MG1A 3MHEA 2OQEA 4NREA 3U97A 1QMAA 1N5HA 3LYGA 3MG2A 3NM2A 2FNQA 1K9M4 1STFI 3BNCA 2D1WA 3O8YA 1TUHA 2WOFA 4HBRA 1OF5B 2W0QA 2V1LA 1Q40B 4J8TA 2CC3A 2KRTA 5EVHA 3UJMA 2CW9A 2YFLB 1DVDA 5AIFA 3Q2PA 3X40A 2M7OA 3HZPA 2D42A 3G0KA 3PZWA 3WOEB 3OWSA 4HM3B 3FG1A 3NQZA 3EQQB 3Q90A 1VZZA 2IMJA 4K90B 3OV4A 3T8NA 3LMLA 3PS8A 1PU4A 3CCJ3 3NX0A 1GD4A 1LXEA 3KZTA 1S5AA 3SXXA 2MF7A 1DMQA 3T0UA 3GWRA 4FR9A 1NB3I 3B8LA 3HX8A 3BB9A 1S723 4EYCA 2XSOB 4HM0B 1PFPA 5CXOA 1N5PA 5AEWB 3UB1A 2I9WA 3GZRA 1RKYA 1OHPA 1ASKA 1IT7A 1WMOA 3OX9A 1EG9B 2Y74A 3I553 3LTBA 2HMKB 2P09A 1L5GB 2CG1A 1GY7A 1JN5A 1KWIA 4XBYA 3CPW2 3CCE3 2CWTA 5KP4A 1QAFA 3FGYA 3B4PA 1SIIA 4HZBB 2XSHB 4HM4B 1Q7Y4 1A90A 5IEOA 4HZ9B 2XGNA 3X3YA 3AMOA 1F8NA 2B1XB 4KFEA 5G2GA 5D83A 2GEXA 3SX1A 1NDOB 1T5YA 5CLKA 3CC73 3WA2X 1QVG2 5IEPA 2GU3A 4OK0A 4XB5A 1QJGA 4O3VA 1UUWB 4RNYA 3EF8A 1Z1SA 1W6CA 3PCRA 4PEJA 1NO3A 4WYKA 3CMA3 3RGAA 3NXJA 4FCZA 5I97A 3RDEA 1JRQA 4G1MB 3QRDA 3UL6A 3RGRA 2CG0A 2GXFA 5ELUA 4NHFA 3JUPA 3LOYA 2UX0A 4H3UA 4STDA 3TDGA 4EBGA 1FUWA 4CDLA 3LT9A 1O7PB 2JQ5A 3F8XA 2JDIH 3AMOB 2OOVC 2BMOB 2XGLA 4I4KA 1FGOA 3LT8A 3WA3A 5D82A 1AVKA 4K1UA 2IUKA 2O9UX 3G8ZA 1W6YA 2XEPA 1RN7A 2HMJB 2GU1A 3V98A 5LC6A 5IG5A 2OTJ3 1IDPA 2W2CA 4FMBA 1FGMA 2QGUA 1ULJB 2P0MA 3SVAA 3CCL3 3E99A 4WYKB 2R4IA 5KP1A 4HM7B 2WGQA 1AVLA 1JJ22 1K28A 1N8QA 1O7MB 1SJWA 4EC6A 3BNDA 3LH4A 4AEQA 3DY5A 4J9AA 3CCR3 1OCVA 1VQO3 5DREA 1AR0A 4N6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNX A;  1E3V A;  3F14 A;  1GYB A;  5D81 A;  2A15 A;  2GBW B;  4HM8 B;  5KP3 A;  1OHO A;  1W00 A;  4L8O A;  4X2H A;  1W02 A;  3ER7 A;  5AII A;  2YFI B;  4LGQ A;  5CF2 A;  3FLJ A;  4U13 A;  2F86 B;  3ECF A;  3GZY B;  2BMR B;  5FW5 A;  5AIH A;  1ZO2 A;  6STD A;  3F7X A;  4XDW A;  4OUQ A;  1CQS A;  4N3V A;  2HML B;  3IPT A;  5JPP A;  1DMM A;  4HM2 B;  4IIA A;  3EJV A;  4MJD A;  2F98 A;  3EBT A;  3MYT A;  1BUQ A;  4GB5 A;  4HVN A;  3KE7 A;  3OWY A;  4L7K A;  1EA2 A;  3DUK A;  3A76 A;  1O7N B;  1OH0 A;  4K1V A;  4HJL B;  2RFR A;  3EC9 A;  1WQL B;  1AR0 A;  4ORL A;  3GRD A;  2XR8 B;  4R9K A;  3B4O A;  4OVM A;  1JB2 A;  5IEN A;  3MG3 A;  1JN5 B;  4LEH A;  2XRX B;  5JPU A;  2F99 A;  4L8P A;  4WWU C;  1NU3 A;  5BXQ A;  8CHO A;  2B24 B;  3FF2 A;  4KVH A;  4FCM A;  3DMC A;  3BLZ A;  3MKI A;  2STD A;  3CNM A;  5AI1 A;  1JB4 A;  1JB5 A;  1TP6 A;  3ROB A;  5IG3 A;  3EBY A;  4HM5 B;  3STD A;  1GY5 A;  5IF6 A;  4R1K A;  2RCD A;  1E97 A;  2CHC A;  3NV0 A;  4R9L A;  3DXO A;  3FKA A;  2HMN B;  2Z77 A;  1ZX2 A;  7STD A;  3EX9 A;  1O7W B;  3B7C A;  4XBX A;  1OHS A;  1HKX A;  1O7G B;  3MSO A;  3CU3 A;  2CKF B;  3GZB A;  1OGZ A;  3EN1 B;  4HM6 B;  3D9R A;  3EHC A;  3FF0 A;  1GY6 A;  3NV0 B;  2INX A;  2Z7A A;  3CPO A;  3S5C A;  4XDV A;  4Q53 A;  1JKG A;  4LMI A;  1K41 A;  3H51 A;  4XM4 A;  5IER A;  5IG0 A;  3G16 A;  4HM1 B;  3K7C A;  5AIG A;  5IG4 A;  2Z76 A;  3JUN A;  5BVB A;  3M8C A;  5AEU B;  3HK4 A;  3JUM A;  2BMQ B;  3DZL A;  3NBR A;  3SOA A;  3F9S A;  3K0Z A;  3EN8 A;  3F7S A;  3KKG A;  1JKG B;  1NWW A;  3T8U A;  3F40 A;  3NUV A;  3FZW A;  4WP5 A;  2QIY A;  3VGN A;  3F8H A;  2PZV A;  1Q42 A;  5TGN A;  3UNL A;  2OWP A;  3SED A;  1C7H A;  1ISK A;  3I0Y A;  3JUO A;  3KSP A;  2HMO B;  4FCJ A;  1OUN A;  3DM8 A;  1OGX A;  4RZM A;  1A2K A;  2YFJ B;  5STD A;  3VSY A;  5CK6 A;  1W01 A;  4XBT A;  3LZA A;  1OPY A;  3GZX B;  1STD A;  5CF1 A;  3H3H A;  3JUQ A;  1GS3 A;  2GEY A;  1OF5 A;  1Q40 A;  1UUV B;  3SOY A;  3FH1 A;  1E3R A;  2BNG A;  5HGR A;  2GBX B;  3OWU A;  1U5O A;  1O7H B;  4HKV B;  1ULI B;  2HMM B;  5DRV A;  2K54 A;  3WMD A;  3OXA A;  4X2O A;  3FSD A;  1DMN A;  2RGQ A;  3MG1 A;  3MHE A;  1QMA A;  3LYG A;  3MG2 A;  3NM2 A;  1TUH A;  1OF5 B;  1Q40 B;  4J8T A;  5EVH A;  3UJM A;  2YFL B;  5AIF A;  3HZP A;  3G0K A;  3OWS A;  4HM3 B;  3Q90 A;  3EQQ B;  1VZZ A;  2IMJ A;  3T8N A;  3OV4 A;  3KZT A;  1S5A A;  1DMQ A;  3GWR A;  3B8L A;  3HX8 A;  3BB9 A;  2XSO B;  4HM0 B;  5CXO A;  5AEW B;  2I9W A;  3GZR A;  1OHP A;  1ASK A;  3OX9 A;  1EG9 B;  2HMK B;  1GY7 A;  1JN5 A;  4XBY A;  5KP4 A;  3FGY A;  3B4P A;  4HZB B;  2XSH B;  4HM4 B;  5IEO A;  4HZ9 B;  2B1X B;  5G2G A;  5D83 A;  2GEX A;  1NDO B;  5CLK A;  5IEP A;  4XB5 A;  1QJG A;  1UUW B;  3EF8 A;  1Z1S A;  4PEJ A;  4WYK A;  3RGA A;  3NXJ A;  3RGR A;  2GXF A;  3JUP A;  2UX0 A;  4H3U A;  4STD A;  4CDL A;  1O7P B;  2JQ5 A;  3F8X A;  2BMO B;  4I4K A;  5D82 A;  4K1U A;  3G8Z A;  1W6Y A;  2HMJ B;  5IG5 A;  1IDP A;  2W2C A;  2QGU A;  1ULJ B;  3E99 A;  4WYK B;  2R4I A;  5KP1 A;  4HM7 B;  1O7M B;  1SJW A;  4J9A A;  1OCV A;  5DRE A;  3NHX A; 
#chains in the Genus database with same CATH topology
 3CNX A;  1E3V A;  2F56 A;  3F14 A;  2BO9 B;  1SAR A;  3D5I A;  1KC8 4;  1GYB A;  5D81 A;  2A15 A;  1GOV A;  2GBW B;  2H0G A;  3ALA A;  1OHO A;  1V58 A;  1W00 A;  4HM8 B;  4IPB A;  5KP3 A;  1DE3 A;  1EKM A;  1GOU A;  3SYU A;  2OOV A;  1UI7 A;  4N6L A;  2E2U A;  1SPU A;  4L8O A;  1JBS A;  1B2M A;  2OCT A;  4HOH A;  4J5G A;  1LQM B;  4NPB A;  1IQX A;  1M1X B;  4X2H A;  1W02 A;  5BU4 A;  1UI8 A;  3ER7 A;  5AII A;  9RNT A;  1YIT 3;  3CC4 3;  2P05 A;  2YFI B;  1A67 A;  4LGQ A;  5CF2 A;  1IQ8 A;  4RBN A;  3FLJ A;  1NNV A;  1TRP A;  2RBI A;  4AKY A;  2CFW A;  1RN1 A;  1K8A 4;  1IU7 A;  1LOY A;  3BIR A;  3D5G A;  1WMP A;  3HIG A;  2F86 B;  1BIR A;  4LYL B;  4U13 A;  4ZM8 A;  3ECF A;  1QAK A;  4WHA A;  4BTY A;  1FUT A;  3GZY B;  2BMR B;  3CCM 3;  5FW5 A;  5AIH A;  1ZO2 A;  4BL2 A;  2Y73 A;  1JZD A;  6STD A;  3BNB A;  1UCL A;  3F7X A;  3X41 A;  5M18 A;  4XDW A;  2WOH A;  5AYS C;  1N8R 4;  3GAX A;  4RNZ A;  1BSB A;  1LNH A;  1GSP A;  4OUQ A;  1CYV A;  1CQS A;  1EQK A;  1ZS7 A;  4N3V A;  1BAN A;  4IT7 A;  3G4S 3;  3CME 3;  2AAD A;  1SIH A;  1ZGX A;  1RMS A;  2HML B;  2IA7 A;  1I2F A;  2W04 A;  3IPT A;  5JPP A;  1YJW 3;  1DMM A;  4HM2 B;  4IIA A;  1VQ4 3;  2CFD A;  3EJV A;  4MJD A;  1LRA A;  2FGT A;  2F98 A;  3EBT A;  4FMA A;  1IV9 A;  2WGO A;  3MYT A;  2H0I A;  4GB5 A;  1BUQ A;  3ZFZ A;  1AY7 A;  4HVN A;  1IVU A;  3N9H A;  4N6O B;  2W9Q A;  1RGF A;  3KE7 A;  1X1U A;  2R41 A;  3OWY A;  5M1A A;  4L7K A;  1HU9 A;  1EA2 A;  1RRL A;  3DUK A;  1YNV X;  1IYY A;  1MWR A;  1BOX A;  3A76 A;  3AGN A;  1UCK A;  2KF6 A;  1O7N B;  1OH0 A;  4JF8 A;  4K1V A;  4MEI A;  5AYR B;  2LQV A;  2RFR A;  4HJL B;  1VQL 3;  1Q86 4;  2J8X B;  1ROV A;  1FGQ A;  2ZA4 A;  3EC9 A;  1Q82 4;  1B2Z A;  4FMD A;  1WQL B;  3LXU X;  3SLU A;  1RNT A;  2CFK A;  2L1S A;  4ORL A;  3GRD A;  1LVN A;  1RGE A;  2AAE A;  2XR8 B;  3KII A;  2E2V A;  1KSI A;  4N6T A;  1TTO A;  4RNT A;  4GSP A;  1B2X A;  1BRN L;  2KF3 A;  3B4O A;  4OVM A;  4R9K A;  3A5E A;  1KD1 4;  3L0R A;  1JB2 A;  1AV4 A;  1MWU A;  4MMX B;  1GMQ A;  3JVC A;  5IEN A;  1FGR A;  1OAC A;  1NJI 4;  3MG3 A;  3S67 A;  1JN5 B;  2YX9 A;  4LEH A;  2XRX B;  2BT3 A;  2XF3 A;  2F99 A;  5JPU A;  4L8P A;  3HII A;  1YI2 3;  1RRH A;  1YGW A;  2E2T A;  4WWU C;  1NU3 A;  5BXQ A;  6GSP A;  4KZ1 A;  3VF1 A;  1EUI C;  8CHO A;  1WMN A;  3MPH A;  2B24 B;  3WR2 A;  3FF2 A;  1FW7 A;  2P38 A;  4FMC A;  5A0O B;  1YVB I;  1K73 4;  3WDG B;  3WOF B;  4KVH A;  1GMP A;  4BTW A;  4LZI A;  1YJ9 3;  4FCM A;  1VQ6 3;  4MMY B;  3G71 3;  1KQS 2;  3DMC A;  3BLZ A;  2CFG A;  2STD A;  3CNM A;  3MKI A;  3D3L A;  3DGL A;  4I5Q A;  2QEX 3;  1BSA A;  3CCS 3;  1YIJ 3;  2FXT A;  4AKZ A;  2XH9 A;  4BIR A;  4N6U A;  3S28 A;  2L4V A;  2SAR A;  3V99 A;  4LSO A;  3EB8 A;  5AI1 A;  1T2H A;  1IT8 A;  2HOH A;  1JBR A;  1EEJ A;  2XFT A;  1DVC A;  1JNQ A;  1JB4 A;  1JB5 A;  1U8C B;  2CH9 A;  3EE1 A;  1TP6 A;  1NB5 I;  3CCV 3;  3ROB A;  5IG3 A;  1BSE A;  3IMA B;  2BU4 A;  1TJD A;  1RN4 A;  3EBY A;  4HM5 B;  4R80 A;  1BNJ A;  1IVW A;  3FG4 A;  3LTA A;  3CCQ 3;  2Z6B A;  3STD A;  1GY5 A;  2PNC A;  5IF6 A;  1QAL A;  2KF5 A;  3N54 B;  5FGO A;  1QVF 2;  2Q07 A;  4R1K A;  2CWU A;  1BNR A;  1VQN 3;  1R4Y A;  2RCD A;  4EV5 A;  1IVV A;  1SQW A;  3K9M C;  3AGO A;  3X42 A;  1VQP 3;  1TFO A;  1E97 A;  1BRS A;  2CHC A;  1RLS A;  1VQ7 3;  3NV0 A;  1PYL A;  1FA3 A;  3PCS A;  1M1K 4;  4R9L A;  1UUG B;  1BNI A;  3DXO A;  3FKA A;  3PYJ A;  3CCU 3;  4BL3 A;  2HMN B;  1YVS A;  2RSX A;  2Z77 A;  3X3X A;  1ZX2 A;  7STD A;  1I0X A;  3EX9 A;  1BNF A;  3NM7 A;  3G6E 3;  2CK3 H;  1O7W B;  1BRI A;  5BIR A;  3B7C A;  3NBB A;  4XBX A;  1YGE A;  1OHS A;  1BNG A;  1HKX A;  3KN4 A;  1O7G B;  4TX4 A;  2O3O A;  1RHL A;  5HOH A;  3OW2 2;  1JBT A;  3MSO A;  3AHW A;  3CU3 A;  2CKF B;  3GZB A;  3NHX A;  1C54 A;  2XFS A;  1OGZ A;  1G96 A;  1LOX A;  2MC8 A;  4BU4 A;  1UDI I;  1IK3 A;  2CFL A;  1VQK 3;  3EN1 B;  4HM6 B;  3D9R A;  4CJN A;  5GSP A;  1M9G A;  1TFK A;  4O8S A;  1OCV A;  3CXC 2;  1RJO A;  3EHC A;  3FF0 A;  1GY6 A;  1MWS A;  3S27 A;  1GMR A;  3UL5 A;  1BGS A;  3CD6 3;  2CIU A;  3NV0 B;  1M90 4;  2INX A;  4GHO A;  2KCD A;  3NQY A;  4HAA A;  2Z7A A;  2W9P A;  3CPO A;  3S5C A;  1IQY A;  4XDV A;  3I56 3;  1D6Y A;  4KFD A;  2ML5 A;  2ZDJ A;  4KT3 B;  4Q53 A;  3DGO A;  1BRJ A;  1JKG A;  4LMI A;  4HYZ A;  4N6M A;  1K41 A;  1B2U A;  1DYU A;  1FUS A;  5G1K A;  4MMZ B;  3H51 A;  3D79 A;  3AHS A;  4XM4 A;  4J5K A;  4BTX A;  1UW1 A;  1V74 A;  5IER A;  3MWZ A;  5IG0 A;  3FG3 A;  3G16 A;  4HM1 B;  1BRG A;  2IUJ A;  3V92 A;  3K7C A;  5AIG A;  1IV7 A;  5IG4 A;  2IY2 A;  2Z76 A;  1US1 A;  4DKI A;  2W56 A;  3ZG0 A;  1MWT A;  1X1X A;  1YHQ 3;  1VQ8 3;  3JUN A;  5BVB A;  3M8C A;  5AEU B;  1VQ5 3;  3HK4 A;  1W4N A;  3JUM A;  2BMQ B;  3DZL A;  3NBR A;  5JBS A;  2BHM A;  1BU4 A;  2WO0 A;  1B2S A;  3SOA A;  1A2P A;  2SBL A;  3IJE B;  1JV2 B;  2KXG A;  3F9S A;  3K0Z A;  4O2H A;  2W6J H;  3EN8 A;  3F7S A;  1J2B A;  3KKG A;  4EXR A;  1JKG B;  4WFO A;  3FCS B;  1NWW A;  5EEO A;  1TU5 A;  1W2Z A;  4O02 B;  1CEW I;  1FZU A;  2F5M A;  3F40 A;  3T8U A;  3NUV A;  4H61 A;  1D6U A;  4EV2 A;  2P0X A;  3FZW A;  5IW9 A;  4WP5 A;  1R4C A;  2QIY A;  3VGN A;  1BRH A;  1VQ9 3;  3F8H A;  2PZV A;  1Q42 A;  5TGN A;  3UNL A;  1BVI A;  3LTC A;  1ISK A;  2OWP A;  4CPK A;  3SED A;  2W03 A;  1C7H A;  3K5T A;  4CCV A;  1W5Z A;  1BNE A;  3I0Y A;  3JUO A;  1Y4K A;  1CH0 A;  4K61 A;  2C10 A;  3KSP A;  1MOL A;  2HMO B;  4FCJ A;  1VQM 3;  1OUN A;  2CWV A;  2W56 B;  3DM8 A;  2IYJ A;  4QWT A;  1I2E A;  1OGX A;  1W6G A;  1N9E A;  4ILF A;  4RZM A;  1A2K A;  2YFJ B;  2UUG C;  5STD A;  3X3Z A;  2QA4 3;  3HOH A;  3VSY A;  1IVX A;  1YJN 3;  2KF4 A;  1ROA A;  5CK6 A;  2OQE C;  3WOD G;  1W01 A;  4XBT A;  2ZL8 A;  3LZA A;  1B21 A;  1A2V A;  1OPY A;  4R4K A;  1W2B 2;  3QK9 A;  1MNL A;  3GZX B;  1WNH A;  1STD A;  3HI7 A;  1GOY A;  2ML6 A;  1Q7H A;  1GD3 A;  5CF1 A;  3H3H A;  3JUQ A;  3N8B A;  1RGC A;  3RNT A;  1GS3 A;  2GEY A;  4N6V 0;  1FGT A;  2F5W A;  3U1W A;  1LOV A;  1OF5 A;  1WTH A;  8RNT A;  1Q40 A;  1UUV B;  3WHO A;  3K63 A;  3SOY A;  5LC7 A;  1W7C A;  1MGW A;  2LYX A;  1BAO A;  4JRF A;  3FH1 A;  3PXM A;  1E3R A;  3S29 A;  1CYU A;  2BNG A;  3OX9 A;  4KFF A;  5HGR A;  2GBX B;  3OWU A;  2C11 A;  3KSE D;  1U5O A;  1HZ1 A;  1O7H B;  3BNE A;  3KFQ C;  1TIJ A;  3Q1C A;  1ULI B;  4HKV B;  1RGA A;  2HMM B;  5ELJ A;  2K0M A;  4GL6 A;  2K54 A;  5DRV A;  3PGB A;  3OXA A;  3WMD A;  2OTL 3;  3CC2 3;  3DGM A;  1HYF A;  1BRK A;  2CX1 A;  2K3D A;  1PY3 A;  3NBJ A;  3FSD A;  4X2O A;  5EQL A;  1DMN A;  3LTD A;  3J7Y d;  2F4Y A;  2RGQ A;  1N9J A;  3DGN A;  1D6Z A;  3MG1 A;  3MHE A;  2OQE A;  4NRE A;  3U97 A;  1QMA A;  1RCL A;  1N5H A;  3LYG A;  3MG2 A;  3NM2 A;  2FNQ A;  1K9M 4;  1STF I;  3BNC A;  2D1W A;  3O8Y A;  1TUH A;  2BIR A;  2WOF A;  1OF5 B;  4HBR A;  2W0Q A;  3BU4 A;  2V1L A;  1Q40 B;  4J8T A;  1RSN A;  2CC3 A;  2KRT A;  5EVH A;  3UJM A;  2CW9 A;  2YFL B;  1DVD A;  1JZO A;  5AIF A;  3Q2P A;  3X40 A;  2M7O A;  3HZP A;  2D42 A;  3G0K A;  3PZW A;  1LOW A;  3WOE B;  1MGR A;  1X1W A;  5G1L A;  3OWS A;  4HM3 B;  3FG1 A;  1X1Y A;  3NQZ A;  3EQQ B;  3Q90 A;  1VZZ A;  2IMJ A;  4K90 B;  3DGY A;  3OV4 A;  3LML A;  1B20 A;  3GSP A;  3PS8 A;  3T8N A;  1RGK A;  1PU4 A;  3CCJ 3;  1I3I A;  1GD4 A;  2H0H A;  1LXE A;  3NX0 A;  1RTU A;  1RDS A;  3KZT A;  1S5A A;  3SXX A;  1BSD A;  2MF7 A;  3DH2 A;  1DMQ A;  3T0U A;  1TRQ A;  2KAA A;  3GWR A;  4FR9 A;  1VQQ A;  1NB3 I;  1UGI A;  3B8L A;  3HX8 A;  3BB9 A;  1BUJ A;  1S72 3;  4EYC A;  2XSO B;  4HM0 B;  1PFP A;  1FYS A;  5CXO A;  1N5P A;  5AEW B;  1Q81 4;  3UB1 A;  2I9W A;  3GZR A;  1RKY A;  1LQG C;  1WMO A;  1ASK A;  1IT7 A;  1OHP A;  1T3B A;  1RGL A;  1UCJ A;  1EG9 B;  2Y74 A;  3KCH A;  1BSC A;  3I55 3;  3LTB A;  5RNT A;  2HMK B;  2P09 A;  1L5G B;  1B27 A;  3Q3F A;  3URP A;  2CG1 A;  1GY7 A;  1JN5 A;  1KWI A;  4XBY A;  3CPW 2;  3CCE 3;  2CWT A;  5KP4 A;  2C4B A;  1QAF A;  3FGY A;  3B4P A;  1SII A;  1UCI A;  4HZB B;  2XSH B;  4HM4 B;  1Q7Y 4;  1A90 A;  5IEO A;  4HZ9 B;  2XGN A;  2ZHX B;  3X3Y A;  3AMO A;  1F8N A;  1I70 A;  2B1X B;  4KFE A;  5G2G A;  5D83 A;  2GEX A;  3SX1 A;  1NDO B;  1T5Y A;  5CLK A;  3CC7 3;  1UGH I;  3WA2 X;  1G02 A;  1QVG 2;  5IEP A;  1I8V A;  2GU3 A;  4OK0 A;  5M19 A;  1LNI A;  4XB5 A;  1QJG A;  4O3V A;  2CX0 A;  1UUW B;  4RNY A;  3EF8 A;  1Z1S A;  1W6C A;  3PCR A;  4PEJ A;  1I0V A;  1NO3 A;  4WYK A;  3CMA 3;  1DET A;  3RGA A;  3NXJ A;  4FCZ A;  5I97 A;  3RDE A;  1I3F A;  1JRQ A;  1G0T A;  4G1M B;  7GSP A;  3QRD A;  3UL6 A;  3RGR A;  2CG0 A;  2GXF A;  5ELU A;  4NHF A;  3JUP A;  3LOY A;  2UGI A;  2UX0 A;  4H3U A;  4STD A;  3TDG A;  4EBG A;  1FUW A;  4CDL A;  3LT9 A;  6RNT A;  1O7P B;  2JQ5 A;  3F8X A;  2JDI H;  3AMO B;  7RNT A;  2OOV C;  2BMO B;  2XGL A;  4I4K A;  1FGO A;  1AQZ A;  3LT8 A;  1BNS A;  3WA3 A;  5D82 A;  1AVK A;  1Q9E A;  4K1U A;  2IUK A;  1RNB A;  2O9U X;  3G8Z A;  1W6Y A;  2XEP A;  1RN7 A;  2HMJ B;  2GU1 A;  3V98 A;  5LC6 A;  1RGH A;  4EW5 A;  5IG5 A;  2OTJ 3;  1IDP A;  1I2G A;  1V57 A;  1FGM A;  2QGU A;  1ULJ B;  2W2C A;  4FMB A;  2P0M A;  3SVA A;  3CCL 3;  1B3S A;  3E99 A;  4WYK B;  2R4I A;  5KP1 A;  3ZG5 A;  4HM7 B;  2WGQ A;  1RGG A;  1AVL A;  1JJ2 2;  1K28 A;  3D4A A;  1N8Q A;  1O7M B;  1SJW A;  2GSP A;  2RNT A;  4EC6 A;  3BND A;  1RCK A;  3LH4 A;  4AEQ A;  3DY5 A;  4J9A A;  3CCR 3;  1T2I A;  1VQO 3;  5DRE A;  1AR0 A;  4N6N B; 
#chains in the Genus database with same CATH homology
 3CNX A;  1E3V A;  3F14 A;  2BO9 B;  1KC8 4;  1GYB A;  5D81 A;  2A15 A;  2GBW B;  3ALA A;  4HM8 B;  4IPB A;  1OHO A;  1W00 A;  5KP3 A;  1EKM A;  2OOV A;  1UI7 A;  4N6L A;  2E2U A;  1SPU A;  4L8O A;  2OCT A;  4X2H A;  1IQX A;  1M1X B;  1W02 A;  1UI8 A;  3ER7 A;  5AII A;  1YIT 3;  3CC4 3;  2P05 A;  2YFI B;  1A67 A;  4LGQ A;  5CF2 A;  1IQ8 A;  4RBN A;  3FLJ A;  4AKY A;  2CFW A;  1K8A 4;  1IU7 A;  4U13 A;  3HIG A;  1WMP A;  2F86 B;  4ZM8 A;  3ECF A;  1QAK A;  4WHA A;  4BTY A;  3GZY B;  2BMR B;  3CCM 3;  5FW5 A;  5AIH A;  1ZO2 A;  2Y73 A;  6STD A;  3BNB A;  3F7X A;  3X41 A;  4XDW A;  2WOH A;  5AYS C;  1N8R 4;  3GAX A;  4RNZ A;  1LNH A;  4OUQ A;  1CYV A;  1CQS A;  1EQK A;  4N3V A;  4IT7 A;  3G4S 3;  3CME 3;  1SIH A;  2HML B;  2IA7 A;  2W04 A;  1YJW 3;  3IPT A;  5JPP A;  1DMM A;  4HM2 B;  4IIA A;  1VQ4 3;  2CFD A;  3EJV A;  4MJD A;  2FGT A;  2F98 A;  3EBT A;  4FMA A;  1IV9 A;  2WGO A;  3MYT A;  1BUQ A;  4GB5 A;  4HVN A;  1IVU A;  3N9H A;  4N6O B;  2W9Q A;  3KE7 A;  3OWY A;  4L7K A;  1HU9 A;  1EA2 A;  1RRL A;  3DUK A;  3A76 A;  4JF8 A;  1O7N B;  1OH0 A;  4MEI A;  4K1V A;  5AYR B;  2LQV A;  2RFR A;  4HJL B;  1VQL 3;  1Q86 4;  1ROV A;  1FGQ A;  3EC9 A;  1Q82 4;  4FMD A;  1WQL B;  3LXU X;  3SLU A;  2CFK A;  4ORL A;  3GRD A;  1LVN A;  2XR8 B;  3KII A;  2E2V A;  1KSI A;  4N6T A;  3B4O A;  4OVM A;  4R9K A;  1KD1 4;  3L0R A;  1JB2 A;  1AV4 A;  4MMX B;  3JVC A;  5IEN A;  1FGR A;  1OAC A;  1NJI 4;  3MG3 A;  3S67 A;  1JN5 B;  2YX9 A;  4LEH A;  2XRX B;  2BT3 A;  2XF3 A;  2F99 A;  5JPU A;  4L8P A;  3HII A;  1YI2 3;  1RRH A;  2E2T A;  4WWU C;  1NU3 A;  5BXQ A;  4KZ1 A;  3VF1 A;  8CHO A;  1WMN A;  3MPH A;  2B24 B;  3FF2 A;  2P38 A;  4FMC A;  5A0O B;  1YVB I;  1K73 4;  3WDG B;  3WOF B;  4KVH A;  4BTW A;  4LZI A;  1YJ9 3;  4FCM A;  1VQ6 3;  4MMY B;  3G71 3;  1KQS 2;  3DMC A;  3BLZ A;  2CFG A;  2STD A;  3CNM A;  3MKI A;  3D3L A;  3DGL A;  2QEX 3;  3CCS 3;  1YIJ 3;  2FXT A;  4AKZ A;  2XH9 A;  4N6U A;  3S28 A;  2L4V A;  3V99 A;  4LSO A;  3EB8 A;  5AI1 A;  1IT8 A;  2XFT A;  1DVC A;  1JNQ A;  1JB4 A;  1JB5 A;  1U8C B;  2CH9 A;  3EE1 A;  1TP6 A;  1NB5 I;  3CCV 3;  3ROB A;  5IG3 A;  3IMA B;  3EBY A;  4HM5 B;  4R80 A;  1IVW A;  3FG4 A;  3LTA A;  3CCQ 3;  2Z6B A;  3STD A;  1GY5 A;  2PNC A;  5IF6 A;  1QAL A;  3N54 B;  5FGO A;  1QVF 2;  2Q07 A;  4R1K A;  2CWU A;  1VQN 3;  2RCD A;  4EV5 A;  1YJN 3;  1IVV A;  1SQW A;  3K9M C;  3X42 A;  1VQP 3;  1TFO A;  1E97 A;  2CHC A;  1VQ7 3;  3NV0 A;  1FA3 A;  3PCS A;  1M1K 4;  4R9L A;  3DXO A;  3FKA A;  3CCU 3;  3PYJ A;  2HMN B;  2RSX A;  2Z77 A;  3X3X A;  1ZX2 A;  7STD A;  3EX9 A;  3NM7 A;  3G6E 3;  2CK3 H;  1O7W B;  3B7C A;  3NBB A;  4XBX A;  1YGE A;  1OHS A;  1HKX A;  3KN4 A;  1O7G B;  4TX4 A;  2O3O A;  3OW2 2;  3MSO A;  3CU3 A;  2CKF B;  3GZB A;  3NHX A;  2XFS A;  1OGZ A;  1G96 A;  1LOX A;  2MC8 A;  1IK3 A;  1VQK 3;  2CFL A;  3EN1 B;  4HM6 B;  3D9R A;  1M9G A;  1TFK A;  4O8S A;  3CXC 2;  1RJO A;  3EHC A;  3FF0 A;  1GY6 A;  3S27 A;  3UL5 A;  3CD6 3;  2CIU A;  3NV0 B;  1M90 4;  2INX A;  2KCD A;  3NQY A;  2Z7A A;  2W9P A;  3CPO A;  3S5C A;  1IQY A;  4XDV A;  3I56 3;  1D6Y A;  4KFD A;  2ML5 A;  2ZDJ A;  4Q53 A;  3DGO A;  1JKG A;  4LMI A;  4HYZ A;  4N6M A;  1K41 A;  1DYU A;  4MMZ B;  3H51 A;  4XM4 A;  4BTX A;  1UW1 A;  1V74 A;  5IER A;  3MWZ A;  5IG0 A;  3FG3 A;  3G16 A;  4HM1 B;  2IUJ A;  3V92 A;  3K7C A;  5AIG A;  1IV7 A;  5IG4 A;  2Z76 A;  1US1 A;  2W56 A;  1YHQ 3;  1VQ8 3;  3JUN A;  5BVB A;  3M8C A;  5AEU B;  1VQ5 3;  3HK4 A;  1W4N A;  3JUM A;  2BMQ B;  3DZL A;  3NBR A;  5JBS A;  2BHM A;  2WO0 A;  3SOA A;  2SBL A;  3IJE B;  1JV2 B;  2KXG A;  3F9S A;  3K0Z A;  4O2H A;  2W6J H;  3EN8 A;  3F7S A;  1J2B A;  3KKG A;  4EXR A;  1JKG B;  4WFO A;  3FCS B;  1NWW A;  5EEO A;  1TU5 A;  1W2Z A;  4O02 B;  1CEW I;  3T8U A;  3F40 A;  3NUV A;  4H61 A;  1D6U A;  4EV2 A;  2P0X A;  3FZW A;  5IW9 A;  4WP5 A;  1R4C A;  2QIY A;  3VGN A;  1VQ9 3;  3F8H A;  2PZV A;  1Q42 A;  5TGN A;  3UNL A;  3LTC A;  2OWP A;  3SED A;  2W03 A;  1C7H A;  3K5T A;  4CCV A;  1W5Z A;  3I0Y A;  3JUO A;  4K61 A;  1Y4K A;  1Q81 4;  1ISK A;  2C10 A;  3KSP A;  1MOL A;  2HMO B;  4FCJ A;  1VQM 3;  1OUN A;  2CWV A;  2W56 B;  3DM8 A;  4QWT A;  1OGX A;  1W6G A;  1N9E A;  4RZM A;  1A2K A;  2YFJ B;  5STD A;  3X3Z A;  2QA4 3;  3VSY A;  1IVX A;  1ROA A;  5CK6 A;  2OQE C;  3WOD G;  1W01 A;  4XBT A;  2ZL8 A;  3LZA A;  1OPY A;  1A2V A;  4R4K A;  1W2B 2;  3QK9 A;  1MNL A;  3GZX B;  1WNH A;  1STD A;  3HI7 A;  2ML6 A;  1GD3 A;  5CF1 A;  3H3H A;  3JUQ A;  3N8B A;  1GS3 A;  2GEY A;  4N6V 0;  1FGT A;  3U1W A;  1OF5 A;  1WTH A;  1Q40 A;  1UUV B;  3K63 A;  3SOY A;  5LC7 A;  1W7C A;  2LYX A;  4JRF A;  3FH1 A;  3PXM A;  1E3R A;  3S29 A;  1CYU A;  2BNG A;  4KFF A;  5HGR A;  2GBX B;  3OWU A;  2C11 A;  3KSE D;  1U5O A;  1O7H B;  3BNE A;  3KFQ C;  3Q1C A;  1TIJ A;  4HKV B;  1ULI B;  5ELJ A;  2HMM B;  2K0M A;  4GL6 A;  2K54 A;  5DRV A;  3PGB A;  3OXA A;  3WMD A;  2OTL 3;  3CC2 3;  3DGM A;  3NBJ A;  4X2O A;  3FSD A;  5EQL A;  1DMN A;  3LTD A;  3J7Y d;  2RGQ A;  1N9J A;  3DGN A;  1D6Z A;  3MG1 A;  3MHE A;  2OQE A;  4NRE A;  3U97 A;  1QMA A;  1N5H A;  3LYG A;  3MG2 A;  3NM2 A;  2FNQ A;  1K9M 4;  1STF I;  3BNC A;  2D1W A;  3O8Y A;  1TUH A;  2WOF A;  4HBR A;  1OF5 B;  2W0Q A;  2V1L A;  1Q40 B;  4J8T A;  2CC3 A;  2KRT A;  5EVH A;  3UJM A;  2CW9 A;  2YFL B;  1DVD A;  5AIF A;  3Q2P A;  3X40 A;  2M7O A;  3HZP A;  2D42 A;  3G0K A;  3PZW A;  3WOE B;  3OWS A;  4HM3 B;  3FG1 A;  3NQZ A;  3EQQ B;  3Q90 A;  1VZZ A;  2IMJ A;  4K90 B;  3OV4 A;  3T8N A;  3LML A;  3PS8 A;  1PU4 A;  3CCJ 3;  3NX0 A;  1GD4 A;  1LXE A;  3KZT A;  1S5A A;  3SXX A;  2MF7 A;  1DMQ A;  3T0U A;  3GWR A;  4FR9 A;  1NB3 I;  3B8L A;  3HX8 A;  3BB9 A;  1S72 3;  4EYC A;  2XSO B;  4HM0 B;  1PFP A;  5CXO A;  1N5P A;  5AEW B;  3UB1 A;  2I9W A;  3GZR A;  1RKY A;  1OHP A;  1ASK A;  1IT7 A;  1WMO A;  3OX9 A;  1EG9 B;  2Y74 A;  3I55 3;  3LTB A;  2HMK B;  2P09 A;  1L5G B;  2CG1 A;  1GY7 A;  1JN5 A;  1KWI A;  4XBY A;  3CPW 2;  3CCE 3;  2CWT A;  5KP4 A;  1QAF A;  3FGY A;  3B4P A;  1SII A;  4HZB B;  2XSH B;  4HM4 B;  1Q7Y 4;  1A90 A;  5IEO A;  4HZ9 B;  2XGN A;  3X3Y A;  3AMO A;  1F8N A;  2B1X B;  4KFE A;  5G2G A;  5D83 A;  2GEX A;  3SX1 A;  1NDO B;  1T5Y A;  5CLK A;  3CC7 3;  3WA2 X;  1QVG 2;  5IEP A;  2GU3 A;  4OK0 A;  4XB5 A;  1QJG A;  4O3V A;  1UUW B;  4RNY A;  3EF8 A;  1Z1S A;  1W6C A;  3PCR A;  4PEJ A;  1NO3 A;  4WYK A;  3CMA 3;  3RGA A;  3NXJ A;  4FCZ A;  5I97 A;  3RDE A;  1JRQ A;  4G1M B;  3QRD A;  3UL6 A;  3RGR A;  2CG0 A;  2GXF A;  5ELU A;  4NHF A;  3JUP A;  3LOY A;  2UX0 A;  4H3U A;  4STD A;  3TDG A;  4EBG A;  1FUW A;  4CDL A;  3LT9 A;  1O7P B;  2JQ5 A;  3F8X A;  2JDI H;  3AMO B;  2OOV C;  2BMO B;  2XGL A;  4I4K A;  1FGO A;  3LT8 A;  3WA3 A;  5D82 A;  1AVK A;  4K1U A;  2IUK A;  2O9U X;  3G8Z A;  1W6Y A;  2XEP A;  1RN7 A;  2HMJ B;  2GU1 A;  3V98 A;  5LC6 A;  5IG5 A;  2OTJ 3;  1IDP A;  2W2C A;  4FMB A;  1FGM A;  2QGU A;  1ULJ B;  2P0M A;  3SVA A;  3CCL 3;  3E99 A;  4WYK B;  2R4I A;  5KP1 A;  4HM7 B;  2WGQ A;  1AVL A;  1JJ2 2;  1K28 A;  1N8Q A;  1O7M B;  1SJW A;  4EC6 A;  3BND A;  3LH4 A;  4AEQ A;  3DY5 A;  4J9A A;  3CCR 3;  1OCV A;  1VQO 3;  5DRE A;  1AR0 A;  4N6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...