4FCJA

Crystal structure of the ntf2-like domain of human g3bp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
128
Chain Sequence
b'MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal Structures of the Human G3BP1 NTF2-Like Domain Visualize FxFG Nup Repeat Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 128
sequence length 137
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fcjA00
2Z7AA 5IG0A 3UJMA 3B4PA 3EF8A 1JB2A 1OHOA 3GWRA 5IF6A 4STDA 1TP6A 5AEUB 4WYKB 3MG2A 4Q53A 1GYBA 4HVNA 1EA2A 2YFJB 4N3VA 3SEDA 4XDWA 3D9RA 1OGXA 4XB5A 3DM8A 1ZO2A 1JKGB 1TUHA 1STDA 3HK4A 3EX9A 3B7CA 1IDPA 3I0YA 4R9KA 5JPPA 2RGQA 2B24B 3T8NA 1HKXA 3S5CA 5KP4A 1OGZA 1O7NB 3EN8A 3F9SA 1OHSA 3EJVA 3KZTA 1ZX2A 5IEOA 1ULIB 3VSYA 3RGAA 4HM0B 3KE7A 1OCVA 3RGRA 1Q40A 3NXJA 4LMIA 3F8XA 3OV4A 4J8TA 5HGRA 3FGYA 4HM5B 4L8OA 3B8LA 1O7MB 2CHCA 5FW5A 3HX8A 5AIHA 1OPYA 3MG1A 4K1VA 1GY6A 3FSDA 2A15A 2HMNB 1OHPA 1GY7A 3G16A 3HZPA 1W00A 3K0ZA 1ISKA 5IG3A 3CPOA 5IEPA 2B1XB 3F14A 1GS3A 1E3RA 3CNXA 3OWSA 3K7CA 3FKAA 5AIGA 3FLJA 1OH0A 5BVBA 2F99A 5D83A 3MSOA 2XR8B 2F98A 5DRVA 3ER7A 1BUQA 3OWUA 2HMLB 3GRDA 4X2HA 2STDA 1ULJB 3NM2A 4FCJA 5G2GA 4LEHA 1QJGA 4ORLA 5AEWB 3WMDA 1NDOB 1JN5B 4PEJA 1W6YA 3DUKA 2XSOB 1Q40B 1O7HB 1W01A 3BB9A 1OF5B 5CLKA 5KP1A 2JQ5A 3SOAA 1Q42A 3NV0B 4HZ9B 2HMKB 1CQSA 2QGUA 3JUMA 3ROBA 3F7XA 2PZVA 2R4IA 4OUQA 5JPUA 4CDLA 3MYTA 4I4KA 2I9WA 3JUQA 4XM4A 2QIYA 1E97A 3M8CA 1WQLB 2HMJB 3FZWA 4KVHA 3G0KA 3KSPA 1U5OA 3FF2A 1C7HA 5D82A 2XSHB 3BLZA 1DMMA 5EVHA 3F7SA 4R1KA 4XBXA 3EBYA 3CU3A 4WYKA 4K1UA 4HM8B 3EN1B 3JUOA 3LZAA 5CF1A 3NHXA 1E3VA 3F8HA 1S5AA 1O7PB 1AR0A 2XRXB 1JKGA 2BNGA 3E99A 4WWUC 5AI1A 3EBTA 5CK6A 6STDA 4HZBB 3OX9A 3FH1A 3LYGA 4HM4B 3OXAA 3NBRA 3JUNA 2Z76A 1QMAA 3EHCA 1UUWB 3KKGA 3GZYB 3MG3A 2BMQB 1DMNA 4RZMA 4X2OA 1Z1SA 4HKVB 1SJWA 3UNLA 1JB4A 3JUPA 2CKFB 3G8ZA 3T8UA 4J9AA 2YFIB 1DMQA 5DREA 1OUNA 3H3HA 5CXOA 4WP5A 4XBTA 2GBWB 5AIFA 4HM7B 3GZXB 3EC9A 5IENA 5D81A 3A76A 4HM3B 4L7KA 3F40A 3DXOA 3Q90A 2INXA 3STDA 2GXFA 2OWPA 5STDA 5IG4A 4IIAA 3H51A 2GEYA 3DMCA 5KP3A 2GEXA 3OWYA 3IPTA 2W2CA 1VZZA 4HM6B 2HMOB 8CHOA 2Z77A 1NU3A 1UUVB 3MHEA 2BMRB 5AIIA 4HM2B 3VGNA 1A2KA 3FF0A 1JN5A 2UX0A 2RFRA 3EQQB 3MKIA 4LGQA 2YFLB 2F86B 4R9LA 4XBYA 3DZLA 2RCDA 1OF5A 5IERA 3NUVA 3SOYA 3NV0A 3ECFA 4MJDA 3CNMA 1O7GB 1JB5A 3GZRA 2BMOB 5IG5A 2K54A 4OVMA 3B4OA 4XDVA 1NWWA 2HMMB 1GY5A 7STDA 2IMJA 5CF2A 1ASKA 5TGNA 4HJLB 2GBXB 4L8PA 5BXQA 4U13A 1EG9B 1K41A 4GB5A 4HM1B 1W02A 4H3UA 4FCMA 3GZBA 1O7WB
chains in the Genus database with same CATH superfamily
2Z7AA 5IG0A 4CCVA 1Q7HA 1WTHA 3UJMA 3DH2A 1RGKA 3B4PA 1BRSA 3EF8A 9RNTA 3PCSA 1IQXA 1VQM3 3I553 1JB2A 1MWUA 4O3VA 3WOFB 2MC8A 4R80A 4BTYA 1ROAA 1KC84 1OHOA 3L0RA 3WA3A 1LRAA 3PGBA 3DGOA 1BRNL 3GWRA 5IF6A 3IJEB 1RGGA 1X1UA 1IYYA 1RGAA 4STDA 1TP6A 5AEUB 4WYKB 1M9GA 3MG2A 4Q53A 1GYBA 3BU4A 4HVNA 7GSPA 1N5PA 1EUIC 3A5EA 1R4CA 1AQZA 1EA2A 2BO9B 1B2SA 2D42A 2YFJB 2KAAA 1JV2B 4N3VA 3SEDA 4XDWA 1NJI4 1N9EA 1OGXA 3D9RA 4JRFA 5RNTA 2K0MA 4XB5A 1MWSA 2P0MA 2XFTA 1RGLA 2CFKA 3DM8A 4MMZB 4EBGA 2FXTA 2GU3A 4BL2A 1ZO2A 1JKGB 1TUHA 1STDA 1Q864 1G96A 3HK4A 3LOYA 3EX9A 3MWZA 2W56A 1DYUA 4AKYA 3B7CA 1IDPA 1RN7A 3I0YA 1QVG2 4R9KA 5JPPA 2RGQA 1YJW3 2B24B 4FMBA 3UL6A 1HYFA 2P38A 3T8NA 1HKXA 5AYRB 3WDGB 4FMDA 1TU5A 3PXMA 1Q9EA 4JF8A 1D6UA 1FGTA 2XGNA 3S5CA 3X3XA 2CK3H 3S28A 1I8VA 5KP4A 1RNBA 1IU7A 1OGZA 2ML6A 4EW5A 1O7NB 2OOVA 3EN8A 4K90B 2W6JH 3F9SA 1OHSA 1V57A 4GL6A 3EJVA 3CC43 3KZTA 1A2VA 2RSXA 1BSCA 1VQK3 1ZX2A 3AMOA 5IEOA 3PCRA 4KFEA 1ULIB 3UB1A 3VSYA 3UL5A 3RGAA 4HM0B 1BRJA 3KE7A 1W2B2 1DVDA 1OCVA 4FMAA 2CX0A 3RGRA 4RNTA 2WOHA 1Q40A 4DKIA 3CCM3 1BNIA 1BAOA 3EB8A 1MGRA 1LOYA 1I2GA 1JBRA 1I0VA 1GOYA 1YNVX 1YGEA 4RBNA 3NXJA 4LMIA 5GSPA 3F8XA 4MMXB 2CW9A 3OV4A 4J8TA 4O8SA 2RBIA 3LT8A 4GSPA 5HGRA 3LMLA 4AKZA 4FCZA 1BRGA 2IA7A 4TX4A 3K63A 2W03A 4OK0A 3FG4A 3CCV3 3N9HA 3V99A 1B27A 4H61A 3FGYA 4N6LA 4HM5B 4L8OA 2CX1A 2Y74A 3B8LA 1O7MB 4N6TA 4EC6A 2CHCA 1B3SA 2XEPA 5FW5A 1A90A 4CPKA 3HX8A 1OPYA 1UCIA 3MG1A 3HI7A 1GY6A 3FSDA 4HAAA 1UI7A 2A15A 4HYZA 4K1VA 3X40A 1PU4A 3G6E3 2HMNB 1V74A 1OHPA 2UUGC 1GY7A 1RGCA 3G16A 3HZPA 1C54A 1W00A 1CYVA 3K0ZA 3K5TA 1B2XA 2M7OA 1ISKA 3GAXA 5G1KA 2W0QA 2CFDA 1CEWI 5IG3A 3CPOA 1MNLA 5IEPA 1UGHI 1NNVA 1IVUA 2B1XB 3F14A 1GS3A 1E3RA 1RDSA 2L1SA 1JBTA 3U97A 1I3IA 3CNXA 2LYXA 3OWSA 3K7CA 1BNJA 2XFSA 4O02B 3FKAA 3WHOA 5AIGA 3FLJA 1OH0A 6RNTA 1BUJA 5BVBA 2F99A 2O9UX 2KF6A 3D3LA 2WGQA 5D83A 3CCQ3 4K61A 1R4YA 2P05A 3MSOA 2W56B 3N8BA 2XR8B 4LZIA 4MEIA 1UW1A 2F98A 3ER7A 5DRVA 1BIRA 3TDGA 1BUQA 1FUTA 3OWUA 1EEJA 2HMLB 3GRDA 1IV9A 4X2HA 2STDA 4HBRA 4O2HA 5FGOA 1ULJB 2KF5A 2J8XB 3NM2A 1B2UA 1IT7A 3HOHA 2YX9A 4FCJA 3AHSA 5G2GA 4EYCA 3CCU3 1FYSA 1MGWA 1LQGC 1ZGXA 2CFLA 4I5QA 4LEHA 4N6UA 3ALAA 1FUWA 1NO3A 3K9MC 1GD3A 1QJGA 4ORLA 4HOHA 1YJ93 2F4YA 5AEWB 1X1XA 3WMDA 5I97A 1YI23 1YVBI 1NDOB 1VQO3 1KD14 5A0OB 3U1WA 3CCJ3 1JN5B 4PEJA 1W6GA 3CXC2 1W6YA 3DUKA 3AMOB 2XSOB 1IK3A 3NM7A 2W9PA 1FGMA 2OQEC 1Q40B 2Y73A 1VQ83 1O7HB 1UDII 1AV4A 1W01A 6GSPA 3BB9A 1IVWA 1OF5B 1GMPA 2PNCA 2ZA4A 1UGIA 1MOLA 5CLKA 5KP1A 1NB5I 2JQ5A 1U8CB 2KRTA 1YVSA 5JBSA 3CC73 1K28A 1BSBA 2E2UA 3SOAA 1K9M4 5LC6A 1Q42A 1BNGA 3NV0B 2HMKB 4HZ9B 1CQSA 1G02A 2IY2A 3PS8A 2CH9A 4J5GA 3CME3 3BNCA 2KXGA 3S29A 4CJNA 1TFKA 1JZDA 1JNQA 1K8A4 4N6OB 1BSAA 2QA43 2QGUA 1RRHA 3FG3A 4AEQA 3JUMA 2MF7A 3S27A 3X41A 2JDIH 3ROBA 1RKYA 1BGSA 1QVF2 3F7XA 1ZS7A 5BIRA 3BNDA 1I2FA 2PZVA 1VQN3 2R4IA 1LNIA 4OUQA 5JPUA 4CDLA 3CCL3 3MYTA 4I4KA 2I9WA 1Q7Y4 1GOVA 5ELJA 3JUQA 4XM4A 3G713 1HU9A 2QIYA 3SVAA 1E97A 3M8CA 3O8YA 1WQLB 2HMJB 1M1K4 3FZWA 1X1WA 4KVHA 1M1XB 1LOXA 2CWTA 1D6ZA 3BNEA 1W2ZA 3G0KA 1CH0A 3DGMA 3KSPA 1U5OA 3FF2A 1C7HA 3NX0A 3DGYA 5D82A 3KCHA 2XSHB 5EEOA 3CCS3 1W5ZA 1RJOA 2OTL3 1DMMA 3BLZA 3LT9A 5EVHA 3ZG0A 3AHWA 3F7SA 3Q2PA 4ZM8A 4R1KA 3CC23 2CFGA 1B2MA 4XBXA 3KSED 3URPA 3EBYA 4EXRA 1EQKA 1QAKA 2HOHA 1ROVA 2GSPA 3CU3A 3LTDA 4WYKA 1LOWA 2C10A 4BTXA 3CCE3 3J7Yd 1RSNA 2KF3A 1RCLA 3DGLA 4K1UA 3DY5A 4HM8B 1EKMA 3EN1B 1I0XA 3JUOA 3LZAA 1VQP3 2BU4A 3KN4A 3DGNA 5CF1A 4BTWA 3MPHA 3RDEA 3QK9A 2OCTA 1N9JA 1RGHA 1TRQA 1VQL3 2OTJ3 1BRHA 3NHXA 2XGLA 3D5IA 2IUJA 1VQ53 1E3VA 3NQYA 3F8HA 7RNTA 1S5AA 1O7PB 1AR0A 2GU1A 3SX1A 1RLSA 2XRXB 1JKGA 1LNHA 1RMSA 5EQLA 1QAFA 1Y4KA 2BNGA 3E99A 4WWUC 5AI1A 1SARA 1LOVA 2OOVC 3CPW2 1PYLA 3EBTA 5CK6A 2FNQA 4RNZA 1RGFA 3SYUA 1STFI 3NQZA 6STDA 3WR2A 4HZBB 4EV5A 1BU4A 3OX9A 1KQS2 1PFPA 1BOXA 3FH1A 4LSOA 3LTBA 3KIIA 4J5KA 1L5GB 3LYGA 3JVCA 3D79A 2RNTA 4HM4B 1GMQA 1F8NA 2KCDA 1WNHA 1FGRA 1MWRA 3OXAA 3X3YA 5LC7A 1N8R4 3NBRA 3FCSB 3JUNA 2XF3A 2CIUA 3CMA3 1DE3A 2CFWA 2Z76A 1QMAA 3EHCA 1RGEA 1FA3A 1LQMB 1S723 5M18A 1UUWB 1DETA 3KKGA 3GZYB 3MG3A 3AGNA 1A67A 4KFDA 2BMQB 2FGTA 1DMNA 1SIIA 4RZMA 4X2OA 3LXUX 1JZOA 1Z1SA 3LH4A 4HKVB 1SJWA 2Q07A 3UNLA 1JB4A 1RRLA 1JJ22 2K3DA 1W4NA 3WODG 1YJN3 3JUPA 5G1LA 2BHMA 4WHAA 2CKFB 3G8ZA 4KZ1A 4J9AA 3T8UA 1W7CA 2YFIB 2D1WA 4R4KA 1TFOA 3NBJA 1UCLA 1B20A 1DMQA 3ZFZA 1QALA 1TTOA 2F5MA 4N6V0 5DREA 4IPBA 2E2VA 4LYLB 2C11A 1OUNA 2WOFA 3H3HA 2R41A 5CXOA 4WP5A 4XBTA 3T0UA 3G4S3 2GBWB 3LTCA 1IVXA 2H0IA 3PZWA 1VQ63 2V1LA 4FMCA 5AIFA 3FG1A 1BANA 4HM7B 1W6CA 3GZXB 3EC9A 1VQ93 1MWTA 2SARA 1V58A 5IENA 1VQ73 5D81A 3A76A 4HM3B 1BNFA 1UCJA 1BRIA 4L7KA 2ZHXB 3V98A 1B21A 2XH9A 3DXOA 3F40A 3Q90A 4ILFA 1T2IA 2INXA 1RN1A 3S67A 3STDA 1D6YA 2GXFA 4KFFA 2OWPA 5STDA 2ZL8A 4IIAA 3ZG5A 5IG4A 3CD63 3H51A 1M904 1IQ8A 2GEYA 3DMCA 2AAEA 5KP3A 2GEXA 1WMOA 2H0HA 5AYSC 3GSPA 4BIRA 1BSEA 5IW9A 2O3OA 3OWYA 5ELUA 3IPTA 1RN4A 1FGQA 1A2PA 1UI8A 4BU4A 3OW22 3AGOA 1SQWA 5AIHA 3WOEB 1JRQA 2W2CA 2IUKA 2LQVA 1VZZA 4HM6B 2HMOB 2W04A 2CG0A 1PY3A 1RNTA 2L4VA 2E2TA 1FZUA 2Z77A 8CHOA 1NU3A 1K734 4NPBA 1AY7A 1UUVB 2W9QA 1SPUA 2WO0A 3X42A 2BT3A 1BNSA 3MHEA 1YIJ3 1B2ZA 1CYUA 3KFQC 1AVLA 1DVCA 2BMRB 4RNYA 2F56A 4HM2B 5AIIA 4N6MA 3VGNA 1BRKA 2Z6BA 1Q814 1A2KA 1YGWA 3FF0A 3Q1CA 4MMYB 3WA2X 1JN5A 2UX0A 1TRPA 2RFRA 4IT7A 1KWIA 1BVIA 1LXEA 2CC3A 5HOHA 3Q3FA 3EQQB 1BNEA 3MKIA 1FW7A 1OACA 2QEX3 1T5YA 1UCKA 4LGQA 1TIJA 2YFLB 1Q824 1T3BA 3D5GA 1I2EA 1BSDA 2F86B 4R9LA 3PYJA 4XBYA 1VQ43 2AADA 3DZLA 1HZ1A 4BL3A 8RNTA 4NREA 1N8QA 2F5WA 2WGOA 3V92A 2RCDA 1OF5A 3EE1A 1N5HA 3SXXA 1I3FA 2IYJA 2KF4A 5IERA 1YHQ3 1GMRA 3NUVA 1RHLA 3SOYA 3NV0A 3D4AA 1RCKA 3ECFA 1IVVA 1LVNA 3CNMA 4GHOA 4MJDA 1O7GB 1JB5A 2P09A 1VQQA 4G1MB 3SLUA 4EV2A 3GZRA 3BNBA 2CG1A 1SIHA 2BMOB 4N6NB 4QWTA 1T2HA 5IG5A 2ML5A 2K54A 4OVMA 1TJDA 2UGIA 4WFOA 3B4OA 1IQYA 3N54B 4XDVA 2H0GA 1NWWA 2HMMB 4FR9A 3CCR3 2C4BA 3LTAA 1WMNA 3VF1A 3NBBA 1FUSA 2CWVA 1J2BA 1KSIA 3X3ZA 3BIRA 1GY5A 3IMAB 7STDA 4KT3B 1I70A 2IMJA 3RNTA 5M19A 5BU4A 5CF2A 2OQEA 1ASKA 5TGNA 4HJLB 2BIRA 2GBXB 1GOUA 2CWUA 4L8PA 1JBSA 3I563 5BXQA 1GD4A 4U13A 1US1A 1IV7A 1EG9B 4NHFA 1K41A 1YIT3 1G0TA 1IT8A 2P0XA 2SBLA 2ZDJA 4GB5A 1BNRA 4HM1B 1UUGB 5M1AA 1FGOA 1NB3I 1RTUA 1W02A 1GSPA 4H3UA 1WMPA 3HIIA 4FCMA 3HIGA 3QRDA 1X1YA 3GZBA 1AVKA 1O7WB
chains in the Genus database with same CATH topology
2Z7AA 5IG0A 4CCVA 1WTHA 3UJMA 3B4PA 3EF8A 3PCSA 1IQXA 1VQM3 3I553 1JB2A 4O3VA 3WOFB 2MC8A 4R80A 4BTYA 1ROAA 1KC84 1OHOA 3L0RA 3WA3A 3PGBA 3DGOA 3GWRA 5IF6A 3IJEB 4STDA 1TP6A 5AEUB 4WYKB 1M9GA 3MG2A 4Q53A 1GYBA 4HVNA 1N5PA 1R4CA 2BO9B 1EA2A 2D42A 2YFJB 1JV2B 4N3VA 3SEDA 4XDWA 1NJI4 1N9EA 1OGXA 3D9RA 4JRFA 2K0MA 4XB5A 2P0MA 2XFTA 3DM8A 2CFKA 4MMZB 4EBGA 2FXTA 2GU3A 1ZO2A 1JKGB 1TUHA 1STDA 1Q864 1G96A 3HK4A 3LOYA 3EX9A 3MWZA 2W56A 1DYUA 4AKYA 3B7CA 1IDPA 1RN7A 3I0YA 1QVG2 4R9KA 5JPPA 2RGQA 1YJW3 2B24B 4FMBA 3UL6A 2P38A 3T8NA 1HKXA 5AYRB 3WDGB 4FMDA 1TU5A 3PXMA 4JF8A 1D6UA 1FGTA 2XGNA 3S5CA 3X3XA 2CK3H 3S28A 5KP4A 1IU7A 1OGZA 2ML6A 1O7NB 2OOVA 3EN8A 4K90B 2W6JH 3F9SA 1OHSA 4GL6A 3EJVA 3CC43 3KZTA 1A2VA 2RSXA 1VQK3 1ZX2A 3AMOA 5IEOA 3PCRA 4KFEA 1ULIB 3UB1A 3VSYA 3UL5A 3RGAA 4HM0B 3KE7A 1W2B2 1DVDA 1OCVA 4FMAA 3RGRA 2WOHA 1Q40A 3CCM3 3EB8A 1YGEA 4RBNA 3NXJA 4LMIA 3F8XA 4MMXB 2CW9A 3OV4A 4J8TA 4O8SA 4AKZA 3LT8A 5HGRA 3LMLA 4FCZA 2IA7A 4TX4A 3K63A 2W03A 4OK0A 3FG4A 3CCV3 3N9HA 3V99A 4H61A 3FGYA 4N6LA 4HM5B 4L8OA 3B8LA 2Y74A 4N6TA 1O7MB 4EC6A 2CHCA 2XEPA 1A90A 5FW5A 3HX8A 1OPYA 3MG1A 4HYZA 3HI7A 1GY6A 3FSDA 4K1VA 1UI7A 2A15A 5AIHA 3X40A 1PU4A 3G6E3 2HMNB 1V74A 1OHPA 1GY7A 3G16A 3HZPA 1W00A 1CYVA 3K0ZA 3K5TA 2M7OA 1ISKA 3GAXA 2W0QA 2CFDA 1CEWI 5IG3A 3CPOA 1MNLA 5IEPA 1IVUA 2B1XB 3F14A 1GS3A 1E3RA 3U97A 3CNXA 2LYXA 3OWSA 3K7CA 2XFSA 4O02B 3FKAA 5AIGA 3FLJA 1OH0A 5BVBA 2F99A 2O9UX 3D3LA 5D83A 2WGQA 3CCQ3 4K61A 2P05A 3MSOA 2W56B 3N8BA 2XR8B 4LZIA 4MEIA 1UW1A 2F98A 3ER7A 5DRVA 3TDGA 1BUQA 3OWUA 2HMLB 3GRDA 1IV9A 4X2HA 2STDA 4HBRA 4O2HA 5FGOA 1ULJB 3NM2A 1IT7A 2YX9A 4FCJA 5G2GA 4EYCA 3CCU3 2CFLA 4LEHA 4N6UA 3ALAA 1FUWA 1NO3A 3K9MC 1GD3A 1QJGA 4ORLA 1YJ93 5I97A 5AEWB 3WMDA 1YI23 1YVBI 1NDOB 1VQO3 1KD14 5A0OB 3U1WA 3CCJ3 1JN5B 4PEJA 1W6GA 3CXC2 1W6YA 3DUKA 3AMOB 2XSOB 1IK3A 3NM7A 2W9PA 1FGMA 2OQEC 1Q40B 2Y73A 1VQ83 1O7HB 1AV4A 1W01A 3BB9A 1IVWA 1OF5B 2PNCA 5CLKA 5KP1A 1MOLA 1NB5I 2JQ5A 1U8CB 2KRTA 5JBSA 3CC73 1K28A 2E2UA 3SOAA 1K9M4 5LC6A 1Q42A 3NV0B 4HZ9B 2HMKB 3WODG 1CQSA 3CME3 3PS8A 2CH9A 3BNCA 2KXGA 3S29A 1TFKA 1JNQA 1K8A4 4N6OB 2QA43 2QGUA 1RRHA 3FG3A 4AEQA 3JUMA 2MF7A 3S27A 3X41A 2JDIH 3ROBA 1RKYA 1QVF2 3F7XA 3BNDA 1VQN3 2PZVA 2R4IA 4OUQA 5JPUA 4CDLA 3CCL3 3MYTA 4I4KA 2I9WA 1Q7Y4 5ELJA 3JUQA 4XM4A 3G713 1HU9A 2QIYA 3SVAA 1E97A 3M8CA 3O8YA 1WQLB 2HMJB 1M1K4 3FZWA 4KVHA 1M1XB 1LOXA 2CWTA 1D6ZA 3BNEA 1W2ZA 3G0KA 3KSPA 3DGMA 1U5OA 3FF2A 1C7HA 3NX0A 5D82A 2XSHB 5EEOA 3CCS3 1W5ZA 1RJOA 2OTL3 1DMMA 3BLZA 3LT9A 5EVHA 4ZM8A 3Q2PA 3F7SA 3CC23 4R1KA 2CFGA 4XBXA 3KSED 3EBYA 4EXRA 1EQKA 1QAKA 1ROVA 3CU3A 3LTDA 4WYKA 2C10A 4BTXA 3CCE3 3J7Yd 3DGLA 4K1UA 3DY5A 4HM8B 1EKMA 3EN1B 3JUOA 3LZAA 1VQP3 3KN4A 3DGNA 5CF1A 4BTWA 3MPHA 3RDEA 3QK9A 2OCTA 1N9JA 1VQL3 2OTJ3 3NHXA 2XGLA 1VQ53 2IUJA 1E3VA 3NQYA 3F8HA 1VQ93 1S5AA 1O7PB 1AR0A 2GU1A 3SX1A 2XRXB 1JKGA 1LNHA 5EQLA 1QAFA 1Y4KA 2BNGA 3E99A 4WWUC 5AI1A 2OOVC 3CPW2 3EBTA 5CK6A 2FNQA 4RNZA 1STFI 3NQZA 6STDA 4HZBB 4EV5A 3OX9A 1KQS2 1PFPA 3FH1A 4LSOA 3LTBA 3KIIA 1L5GB 3LYGA 3JVCA 4HM4B 1F8NA 2KCDA 1WNHA 1FGRA 3OXAA 3X3YA 5LC7A 1N8R4 3NBRA 3FCSB 3JUNA 2XF3A 2CIUA 3CMA3 2CFWA 2Z76A 1QMAA 3EHCA 1FA3A 1S723 1UUWB 3KKGA 3GZYB 3MG3A 1A67A 4KFDA 2BMQB 2FGTA 1DMNA 1SIIA 4RZMA 4X2OA 3LXUX 1Z1SA 3LH4A 4HKVB 1SJWA 2Q07A 3UNLA 1JB4A 1RRLA 1JJ22 1W4NA 1YJN3 3JUPA 2BHMA 4WHAA 2CKFB 3G8ZA 4KZ1A 4J9AA 3T8UA 1W7CA 2YFIB 2D1WA 4R4KA 1TFOA 3NBJA 1DMQA 1QALA 4N6V0 5DREA 4IPBA 2E2VA 2C11A 1OUNA 2WOFA 3H3HA 5CXOA 4WP5A 4XBTA 3T0UA 3G4S3 2GBWB 3LTCA 1IVXA 3PZWA 1VQ63 2V1LA 4FMCA 5AIFA 3FG1A 4HM7B 1W6CA 3GZXB 3EC9A 5IENA 1VQ73 5D81A 3A76A 4HM3B 4L7KA 3V98A 2XH9A 3F40A 3DXOA 3Q90A 2INXA 3S67A 3STDA 1D6YA 2GXFA 4KFFA 2OWPA 5STDA 2ZL8A 4IIAA 5IG4A 3CD63 3H51A 1M904 1IQ8A 2GEYA 3DMCA 5KP3A 2GEXA 1WMOA 5AYSC 5IW9A 2O3OA 3OWYA 5ELUA 3IPTA 1FGQA 1UI8A 3OW22 1SQWA 3WOEB 1JRQA 2W2CA 2IUKA 2LQVA 1VZZA 4HM6B 2HMOB 2W04A 2CG0A 2L4VA 8CHOA 2Z77A 2E2TA 1K734 1NU3A 1UUVB 2W9QA 1SPUA 2WO0A 3X42A 2BT3A 1YIJ3 3MHEA 1CYUA 3KFQC 1AVLA 1DVCA 2BMRB 4RNYA 4HM2B 5AIIA 4N6MA 3VGNA 2Z6BA 1Q814 1A2KA 3FF0A 4MMYB 3Q1CA 3WA2X 1JN5A 2UX0A 2RFRA 4IT7A 1KWIA 1LXEA 2CC3A 3EQQB 3MKIA 1OACA 2QEX3 1T5YA 4LGQA 1Q824 1TIJA 2YFLB 2F86B 4R9LA 3PYJA 4XBYA 1VQ43 3DZLA 4NREA 1N8QA 2WGOA 3V92A 2RCDA 1OF5A 3EE1A 1N5HA 3SXXA 5IERA 1YHQ3 3NUVA 3SOYA 3NV0A 3ECFA 4MJDA 1YIT3 1IVVA 1LVNA 3CNMA 3SLUA 1O7GB 1JB5A 2P09A 4G1MB 4EV2A 3GZRA 3BNBA 2CG1A 1SIHA 2BMOB 4N6NB 4QWTA 5IG5A 2ML5A 2K54A 4OVMA 4WFOA 3B4OA 1IQYA 3N54B 4XDVA 1NWWA 2HMMB 4FR9A 3CCR3 3LTAA 1WMNA 3VF1A 3NBBA 2CWVA 1J2BA 1KSIA 3X3ZA 3IMAB 1GY5A 7STDA 2IMJA 5CF2A 2OQEA 1ASKA 5TGNA 4HJLB 2GBXB 2CWUA 4L8PA 3I563 5BXQA 1GD4A 4U13A 1US1A 1IV7A 1EG9B 4NHFA 1K41A 1IT8A 2P0XA 2SBLA 2ZDJA 4GB5A 4HM1B 1FGOA 1NB3I 1W02A 4H3UA 1WMPA 3HIIA 4FCMA 3HIGA 3QRDA 3GZBA 1AVKA 1O7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7A A;  5IG0 A;  3UJM A;  3B4P A;  3EF8 A;  1JB2 A;  1OHO A;  3GWR A;  5IF6 A;  4STD A;  1TP6 A;  5AEU B;  4WYK B;  3MG2 A;  4Q53 A;  1GYB A;  4HVN A;  1EA2 A;  2YFJ B;  4N3V A;  3SED A;  4XDW A;  3D9R A;  1OGX A;  4XB5 A;  3DM8 A;  1ZO2 A;  1JKG B;  1TUH A;  1STD A;  3HK4 A;  3EX9 A;  3B7C A;  1IDP A;  3I0Y A;  4R9K A;  5JPP A;  2RGQ A;  2B24 B;  3T8N A;  1HKX A;  3S5C A;  5KP4 A;  1OGZ A;  1O7N B;  3EN8 A;  3F9S A;  1OHS A;  3EJV A;  3KZT A;  1ZX2 A;  5IEO A;  1ULI B;  3VSY A;  3RGA A;  4HM0 B;  3KE7 A;  1OCV A;  3RGR A;  1Q40 A;  3NXJ A;  4LMI A;  3F8X A;  3OV4 A;  4J8T A;  5HGR A;  3FGY A;  4HM5 B;  4L8O A;  3B8L A;  1O7M B;  2CHC A;  5FW5 A;  3HX8 A;  5AIH A;  1OPY A;  3MG1 A;  4K1V A;  1GY6 A;  3FSD A;  2A15 A;  2HMN B;  1OHP A;  1GY7 A;  3G16 A;  3HZP A;  1W00 A;  3K0Z A;  1ISK A;  5IG3 A;  3CPO A;  5IEP A;  2B1X B;  3F14 A;  1GS3 A;  1E3R A;  3CNX A;  3OWS A;  3K7C A;  3FKA A;  5AIG A;  3FLJ A;  1OH0 A;  5BVB A;  2F99 A;  5D83 A;  3MSO A;  2XR8 B;  2F98 A;  5DRV A;  3ER7 A;  1BUQ A;  3OWU A;  2HML B;  3GRD A;  4X2H A;  2STD A;  1ULJ B;  3NM2 A;  4FCJ A;  5G2G A;  4LEH A;  1QJG A;  4ORL A;  5AEW B;  3WMD A;  1NDO B;  1JN5 B;  4PEJ A;  1W6Y A;  3DUK A;  2XSO B;  1Q40 B;  1O7H B;  1W01 A;  3BB9 A;  1OF5 B;  5CLK A;  5KP1 A;  2JQ5 A;  3SOA A;  1Q42 A;  3NV0 B;  4HZ9 B;  2HMK B;  1CQS A;  2QGU A;  3JUM A;  3ROB A;  3F7X A;  2PZV A;  2R4I A;  4OUQ A;  5JPU A;  4CDL A;  3MYT A;  4I4K A;  2I9W A;  3JUQ A;  4XM4 A;  2QIY A;  1E97 A;  3M8C A;  1WQL B;  2HMJ B;  3FZW A;  4KVH A;  3G0K A;  3KSP A;  1U5O A;  3FF2 A;  1C7H A;  5D82 A;  2XSH B;  3BLZ A;  1DMM A;  5EVH A;  3F7S A;  4R1K A;  4XBX A;  3EBY A;  3CU3 A;  4WYK A;  4K1U A;  4HM8 B;  3EN1 B;  3JUO A;  3LZA A;  5CF1 A;  3NHX A;  1E3V A;  3F8H A;  1S5A A;  1O7P B;  1AR0 A;  2XRX B;  1JKG A;  2BNG A;  3E99 A;  4WWU C;  5AI1 A;  3EBT A;  5CK6 A;  6STD A;  4HZB B;  3OX9 A;  3FH1 A;  3LYG A;  4HM4 B;  3OXA A;  3NBR A;  3JUN A;  2Z76 A;  1QMA A;  3EHC A;  1UUW B;  3KKG A;  3GZY B;  3MG3 A;  2BMQ B;  1DMN A;  4RZM A;  4X2O A;  1Z1S A;  4HKV B;  1SJW A;  3UNL A;  1JB4 A;  3JUP A;  2CKF B;  3G8Z A;  3T8U A;  4J9A A;  2YFI B;  1DMQ A;  5DRE A;  1OUN A;  3H3H A;  5CXO A;  4WP5 A;  4XBT A;  2GBW B;  5AIF A;  4HM7 B;  3GZX B;  3EC9 A;  5IEN A;  5D81 A;  3A76 A;  4HM3 B;  4L7K A;  3F40 A;  3DXO A;  3Q90 A;  2INX A;  3STD A;  2GXF A;  2OWP A;  5STD A;  5IG4 A;  4IIA A;  3H51 A;  2GEY A;  3DMC A;  5KP3 A;  2GEX A;  3OWY A;  3IPT A;  2W2C A;  1VZZ A;  4HM6 B;  2HMO B;  8CHO A;  2Z77 A;  1NU3 A;  1UUV B;  3MHE A;  2BMR B;  5AII A;  4HM2 B;  3VGN A;  1A2K A;  3FF0 A;  1JN5 A;  2UX0 A;  2RFR A;  3EQQ B;  3MKI A;  4LGQ A;  2YFL B;  2F86 B;  4R9L A;  4XBY A;  3DZL A;  2RCD A;  1OF5 A;  5IER A;  3NUV A;  3SOY A;  3NV0 A;  3ECF A;  4MJD A;  3CNM A;  1O7G B;  1JB5 A;  3GZR A;  2BMO B;  5IG5 A;  2K54 A;  4OVM A;  3B4O A;  4XDV A;  1NWW A;  2HMM B;  1GY5 A;  7STD A;  2IMJ A;  5CF2 A;  1ASK A;  5TGN A;  4HJL B;  2GBX B;  4L8P A;  5BXQ A;  4U13 A;  1EG9 B;  1K41 A;  4GB5 A;  4HM1 B;  1W02 A;  4H3U A;  4FCM A;  3GZB A;  1O7W B; 
#chains in the Genus database with same CATH topology
 2Z7A A;  5IG0 A;  4CCV A;  1Q7H A;  1WTH A;  3UJM A;  3DH2 A;  1RGK A;  3B4P A;  1BRS A;  3EF8 A;  9RNT A;  3PCS A;  1IQX A;  1VQM 3;  3I55 3;  1JB2 A;  1MWU A;  4O3V A;  3WOF B;  2MC8 A;  4R80 A;  4BTY A;  1ROA A;  1KC8 4;  1OHO A;  3L0R A;  3WA3 A;  1LRA A;  3PGB A;  3DGO A;  1BRN L;  3GWR A;  5IF6 A;  3IJE B;  1RGG A;  1X1U A;  1IYY A;  1RGA A;  4STD A;  1TP6 A;  5AEU B;  4WYK B;  1M9G A;  3MG2 A;  4Q53 A;  1GYB A;  3BU4 A;  4HVN A;  7GSP A;  1N5P A;  1EUI C;  3A5E A;  1R4C A;  1AQZ A;  1EA2 A;  2BO9 B;  1B2S A;  2D42 A;  2YFJ B;  2KAA A;  1JV2 B;  4N3V A;  3SED A;  4XDW A;  1NJI 4;  1N9E A;  1OGX A;  3D9R A;  4JRF A;  5RNT A;  2K0M A;  4XB5 A;  1MWS A;  2P0M A;  2XFT A;  1RGL A;  2CFK A;  3DM8 A;  4MMZ B;  4EBG A;  2FXT A;  2GU3 A;  4BL2 A;  1ZO2 A;  1JKG B;  1TUH A;  1STD A;  1Q86 4;  1G96 A;  3HK4 A;  3LOY A;  3EX9 A;  3MWZ A;  2W56 A;  1DYU A;  4AKY A;  3B7C A;  1IDP A;  1RN7 A;  3I0Y A;  1QVG 2;  4R9K A;  5JPP A;  2RGQ A;  1YJW 3;  2B24 B;  4FMB A;  3UL6 A;  1HYF A;  2P38 A;  3T8N A;  1HKX A;  5AYR B;  3WDG B;  4FMD A;  1TU5 A;  3PXM A;  1Q9E A;  4JF8 A;  1D6U A;  1FGT A;  2XGN A;  3S5C A;  3X3X A;  2CK3 H;  3S28 A;  1I8V A;  5KP4 A;  1RNB A;  1IU7 A;  1OGZ A;  2ML6 A;  4EW5 A;  1O7N B;  2OOV A;  3EN8 A;  4K90 B;  2W6J H;  3F9S A;  1OHS A;  1V57 A;  4GL6 A;  3EJV A;  3CC4 3;  3KZT A;  1A2V A;  2RSX A;  1BSC A;  1VQK 3;  1ZX2 A;  3AMO A;  5IEO A;  3PCR A;  4KFE A;  1ULI B;  3UB1 A;  3VSY A;  3UL5 A;  3RGA A;  4HM0 B;  1BRJ A;  3KE7 A;  1W2B 2;  1DVD A;  1OCV A;  4FMA A;  2CX0 A;  3RGR A;  4RNT A;  2WOH A;  1Q40 A;  4DKI A;  3CCM 3;  1BNI A;  1BAO A;  3EB8 A;  1MGR A;  1LOY A;  1I2G A;  1JBR A;  1I0V A;  1GOY A;  1YNV X;  1YGE A;  4RBN A;  3NXJ A;  4LMI A;  5GSP A;  3F8X A;  4MMX B;  2CW9 A;  3OV4 A;  4J8T A;  4O8S A;  2RBI A;  3LT8 A;  4GSP A;  5HGR A;  3LML A;  4AKZ A;  4FCZ A;  1BRG A;  2IA7 A;  4TX4 A;  3K63 A;  2W03 A;  4OK0 A;  3FG4 A;  3CCV 3;  3N9H A;  3V99 A;  1B27 A;  4H61 A;  3FGY A;  4N6L A;  4HM5 B;  4L8O A;  2CX1 A;  2Y74 A;  3B8L A;  1O7M B;  4N6T A;  4EC6 A;  2CHC A;  1B3S A;  2XEP A;  5FW5 A;  1A90 A;  4CPK A;  3HX8 A;  1OPY A;  1UCI A;  3MG1 A;  3HI7 A;  1GY6 A;  3FSD A;  4HAA A;  1UI7 A;  2A15 A;  4HYZ A;  4K1V A;  3X40 A;  1PU4 A;  3G6E 3;  2HMN B;  1V74 A;  1OHP A;  2UUG C;  1GY7 A;  1RGC A;  3G16 A;  3HZP A;  1C54 A;  1W00 A;  1CYV A;  3K0Z A;  3K5T A;  1B2X A;  2M7O A;  1ISK A;  3GAX A;  5G1K A;  2W0Q A;  2CFD A;  1CEW I;  5IG3 A;  3CPO A;  1MNL A;  5IEP A;  1UGH I;  1NNV A;  1IVU A;  2B1X B;  3F14 A;  1GS3 A;  1E3R A;  1RDS A;  2L1S A;  1JBT A;  3U97 A;  1I3I A;  3CNX A;  2LYX A;  3OWS A;  3K7C A;  1BNJ A;  2XFS A;  4O02 B;  3FKA A;  3WHO A;  5AIG A;  3FLJ A;  1OH0 A;  6RNT A;  1BUJ A;  5BVB A;  2F99 A;  2O9U X;  2KF6 A;  3D3L A;  2WGQ A;  5D83 A;  3CCQ 3;  4K61 A;  1R4Y A;  2P05 A;  3MSO A;  2W56 B;  3N8B A;  2XR8 B;  4LZI A;  4MEI A;  1UW1 A;  2F98 A;  3ER7 A;  5DRV A;  1BIR A;  3TDG A;  1BUQ A;  1FUT A;  3OWU A;  1EEJ A;  2HML B;  3GRD A;  1IV9 A;  4X2H A;  2STD A;  4HBR A;  4O2H A;  5FGO A;  1ULJ B;  2KF5 A;  2J8X B;  3NM2 A;  1B2U A;  1IT7 A;  3HOH A;  2YX9 A;  4FCJ A;  3AHS A;  5G2G A;  4EYC A;  3CCU 3;  1FYS A;  1MGW A;  1LQG C;  1ZGX A;  2CFL A;  4I5Q A;  4LEH A;  4N6U A;  3ALA A;  1FUW A;  1NO3 A;  3K9M C;  1GD3 A;  1QJG A;  4ORL A;  4HOH A;  1YJ9 3;  2F4Y A;  5AEW B;  1X1X A;  3WMD A;  5I97 A;  1YI2 3;  1YVB I;  1NDO B;  1VQO 3;  1KD1 4;  5A0O B;  3U1W A;  3CCJ 3;  1JN5 B;  4PEJ A;  1W6G A;  3CXC 2;  1W6Y A;  3DUK A;  3AMO B;  2XSO B;  1IK3 A;  3NM7 A;  2W9P A;  1FGM A;  2OQE C;  1Q40 B;  2Y73 A;  1VQ8 3;  1O7H B;  1UDI I;  1AV4 A;  1W01 A;  6GSP A;  3BB9 A;  1IVW A;  1OF5 B;  1GMP A;  2PNC A;  2ZA4 A;  1UGI A;  1MOL A;  5CLK A;  5KP1 A;  1NB5 I;  2JQ5 A;  1U8C B;  2KRT A;  1YVS A;  5JBS A;  3CC7 3;  1K28 A;  1BSB A;  2E2U A;  3SOA A;  1K9M 4;  5LC6 A;  1Q42 A;  1BNG A;  3NV0 B;  2HMK B;  4HZ9 B;  1CQS A;  1G02 A;  2IY2 A;  3PS8 A;  2CH9 A;  4J5G A;  3CME 3;  3BNC A;  2KXG A;  3S29 A;  4CJN A;  1TFK A;  1JZD A;  1JNQ A;  1K8A 4;  4N6O B;  1BSA A;  2QA4 3;  2QGU A;  1RRH A;  3FG3 A;  4AEQ A;  3JUM A;  2MF7 A;  3S27 A;  3X41 A;  2JDI H;  3ROB A;  1RKY A;  1BGS A;  1QVF 2;  3F7X A;  1ZS7 A;  5BIR A;  3BND A;  1I2F A;  2PZV A;  1VQN 3;  2R4I A;  1LNI A;  4OUQ A;  5JPU A;  4CDL A;  3CCL 3;  3MYT A;  4I4K A;  2I9W A;  1Q7Y 4;  1GOV A;  5ELJ A;  3JUQ A;  4XM4 A;  3G71 3;  1HU9 A;  2QIY A;  3SVA A;  1E97 A;  3M8C A;  3O8Y A;  1WQL B;  2HMJ B;  1M1K 4;  3FZW A;  1X1W A;  4KVH A;  1M1X B;  1LOX A;  2CWT A;  1D6Z A;  3BNE A;  1W2Z A;  3G0K A;  1CH0 A;  3DGM A;  3KSP A;  1U5O A;  3FF2 A;  1C7H A;  3NX0 A;  3DGY A;  5D82 A;  3KCH A;  2XSH B;  5EEO A;  3CCS 3;  1W5Z A;  1RJO A;  2OTL 3;  1DMM A;  3BLZ A;  3LT9 A;  5EVH A;  3ZG0 A;  3AHW A;  3F7S A;  3Q2P A;  4ZM8 A;  4R1K A;  3CC2 3;  2CFG A;  1B2M A;  4XBX A;  3KSE D;  3URP A;  3EBY A;  4EXR A;  1EQK A;  1QAK A;  2HOH A;  1ROV A;  2GSP A;  3CU3 A;  3LTD A;  4WYK A;  1LOW A;  2C10 A;  4BTX A;  3CCE 3;  3J7Y d;  1RSN A;  2KF3 A;  1RCL A;  3DGL A;  4K1U A;  3DY5 A;  4HM8 B;  1EKM A;  3EN1 B;  1I0X A;  3JUO A;  3LZA A;  1VQP 3;  2BU4 A;  3KN4 A;  3DGN A;  5CF1 A;  4BTW A;  3MPH A;  3RDE A;  3QK9 A;  2OCT A;  1N9J A;  1RGH A;  1TRQ A;  1VQL 3;  2OTJ 3;  1BRH A;  3NHX A;  2XGL A;  3D5I A;  2IUJ A;  1VQ5 3;  1E3V A;  3NQY A;  3F8H A;  7RNT A;  1S5A A;  1O7P B;  1AR0 A;  2GU1 A;  3SX1 A;  1RLS A;  2XRX B;  1JKG A;  1LNH A;  1RMS A;  5EQL A;  1QAF A;  1Y4K A;  2BNG A;  3E99 A;  4WWU C;  5AI1 A;  1SAR A;  1LOV A;  2OOV C;  3CPW 2;  1PYL A;  3EBT A;  5CK6 A;  2FNQ A;  4RNZ A;  1RGF A;  3SYU A;  1STF I;  3NQZ A;  6STD A;  3WR2 A;  4HZB B;  4EV5 A;  1BU4 A;  3OX9 A;  1KQS 2;  1PFP A;  1BOX A;  3FH1 A;  4LSO A;  3LTB A;  3KII A;  4J5K A;  1L5G B;  3LYG A;  3JVC A;  3D79 A;  2RNT A;  4HM4 B;  1GMQ A;  1F8N A;  2KCD A;  1WNH A;  1FGR A;  1MWR A;  3OXA A;  3X3Y A;  5LC7 A;  1N8R 4;  3NBR A;  3FCS B;  3JUN A;  2XF3 A;  2CIU A;  3CMA 3;  1DE3 A;  2CFW A;  2Z76 A;  1QMA A;  3EHC A;  1RGE A;  1FA3 A;  1LQM B;  1S72 3;  5M18 A;  1UUW B;  1DET A;  3KKG A;  3GZY B;  3MG3 A;  3AGN A;  1A67 A;  4KFD A;  2BMQ B;  2FGT A;  1DMN A;  1SII A;  4RZM A;  4X2O A;  3LXU X;  1JZO A;  1Z1S A;  3LH4 A;  4HKV B;  1SJW A;  2Q07 A;  3UNL A;  1JB4 A;  1RRL A;  1JJ2 2;  2K3D A;  1W4N A;  3WOD G;  1YJN 3;  3JUP A;  5G1L A;  2BHM A;  4WHA A;  2CKF B;  3G8Z A;  4KZ1 A;  4J9A A;  3T8U A;  1W7C A;  2YFI B;  2D1W A;  4R4K A;  1TFO A;  3NBJ A;  1UCL A;  1B20 A;  1DMQ A;  3ZFZ A;  1QAL A;  1TTO A;  2F5M A;  4N6V 0;  5DRE A;  4IPB A;  2E2V A;  4LYL B;  2C11 A;  1OUN A;  2WOF A;  3H3H A;  2R41 A;  5CXO A;  4WP5 A;  4XBT A;  3T0U A;  3G4S 3;  2GBW B;  3LTC A;  1IVX A;  2H0I A;  3PZW A;  1VQ6 3;  2V1L A;  4FMC A;  5AIF A;  3FG1 A;  1BAN A;  4HM7 B;  1W6C A;  3GZX B;  3EC9 A;  1VQ9 3;  1MWT A;  2SAR A;  1V58 A;  5IEN A;  1VQ7 3;  5D81 A;  3A76 A;  4HM3 B;  1BNF A;  1UCJ A;  1BRI A;  4L7K A;  2ZHX B;  3V98 A;  1B21 A;  2XH9 A;  3DXO A;  3F40 A;  3Q90 A;  4ILF A;  1T2I A;  2INX A;  1RN1 A;  3S67 A;  3STD A;  1D6Y A;  2GXF A;  4KFF A;  2OWP A;  5STD A;  2ZL8 A;  4IIA A;  3ZG5 A;  5IG4 A;  3CD6 3;  3H51 A;  1M90 4;  1IQ8 A;  2GEY A;  3DMC A;  2AAE A;  5KP3 A;  2GEX A;  1WMO A;  2H0H A;  5AYS C;  3GSP A;  4BIR A;  1BSE A;  5IW9 A;  2O3O A;  3OWY A;  5ELU A;  3IPT A;  1RN4 A;  1FGQ A;  1A2P A;  1UI8 A;  4BU4 A;  3OW2 2;  3AGO A;  1SQW A;  5AIH A;  3WOE B;  1JRQ A;  2W2C A;  2IUK A;  2LQV A;  1VZZ A;  4HM6 B;  2HMO B;  2W04 A;  2CG0 A;  1PY3 A;  1RNT A;  2L4V A;  2E2T A;  1FZU A;  2Z77 A;  8CHO A;  1NU3 A;  1K73 4;  4NPB A;  1AY7 A;  1UUV B;  2W9Q A;  1SPU A;  2WO0 A;  3X42 A;  2BT3 A;  1BNS A;  3MHE A;  1YIJ 3;  1B2Z A;  1CYU A;  3KFQ C;  1AVL A;  1DVC A;  2BMR B;  4RNY A;  2F56 A;  4HM2 B;  5AII A;  4N6M A;  3VGN A;  1BRK A;  2Z6B A;  1Q81 4;  1A2K A;  1YGW A;  3FF0 A;  3Q1C A;  4MMY B;  3WA2 X;  1JN5 A;  2UX0 A;  1TRP A;  2RFR A;  4IT7 A;  1KWI A;  1BVI A;  1LXE A;  2CC3 A;  5HOH A;  3Q3F A;  3EQQ B;  1BNE A;  3MKI A;  1FW7 A;  1OAC A;  2QEX 3;  1T5Y A;  1UCK A;  4LGQ A;  1TIJ A;  2YFL B;  1Q82 4;  1T3B A;  3D5G A;  1I2E A;  1BSD A;  2F86 B;  4R9L A;  3PYJ A;  4XBY A;  1VQ4 3;  2AAD A;  3DZL A;  1HZ1 A;  4BL3 A;  8RNT A;  4NRE A;  1N8Q A;  2F5W A;  2WGO A;  3V92 A;  2RCD A;  1OF5 A;  3EE1 A;  1N5H A;  3SXX A;  1I3F A;  2IYJ A;  2KF4 A;  5IER A;  1YHQ 3;  1GMR A;  3NUV A;  1RHL A;  3SOY A;  3NV0 A;  3D4A A;  1RCK A;  3ECF A;  1IVV A;  1LVN A;  3CNM A;  4GHO A;  4MJD A;  1O7G B;  1JB5 A;  2P09 A;  1VQQ A;  4G1M B;  3SLU A;  4EV2 A;  3GZR A;  3BNB A;  2CG1 A;  1SIH A;  2BMO B;  4N6N B;  4QWT A;  1T2H A;  5IG5 A;  2ML5 A;  2K54 A;  4OVM A;  1TJD A;  2UGI A;  4WFO A;  3B4O A;  1IQY A;  3N54 B;  4XDV A;  2H0G A;  1NWW A;  2HMM B;  4FR9 A;  3CCR 3;  2C4B A;  3LTA A;  1WMN A;  3VF1 A;  3NBB A;  1FUS A;  2CWV A;  1J2B A;  1KSI A;  3X3Z A;  3BIR A;  1GY5 A;  3IMA B;  7STD A;  4KT3 B;  1I70 A;  2IMJ A;  3RNT A;  5M19 A;  5BU4 A;  5CF2 A;  2OQE A;  1ASK A;  5TGN A;  4HJL B;  2BIR A;  2GBX B;  1GOU A;  2CWU A;  4L8P A;  1JBS A;  3I56 3;  5BXQ A;  1GD4 A;  4U13 A;  1US1 A;  1IV7 A;  1EG9 B;  4NHF A;  1K41 A;  1YIT 3;  1G0T A;  1IT8 A;  2P0X A;  2SBL A;  2ZDJ A;  4GB5 A;  1BNR A;  4HM1 B;  1UUG B;  5M1A A;  1FGO A;  1NB3 I;  1RTU A;  1W02 A;  1GSP A;  4H3U A;  1WMP A;  3HII A;  4FCM A;  3HIG A;  3QRD A;  1X1Y A;  3GZB A;  1AVK A;  1O7W B; 
#chains in the Genus database with same CATH homology
 2Z7A A;  5IG0 A;  4CCV A;  1WTH A;  3UJM A;  3B4P A;  3EF8 A;  3PCS A;  1IQX A;  1VQM 3;  3I55 3;  1JB2 A;  4O3V A;  3WOF B;  2MC8 A;  4R80 A;  4BTY A;  1ROA A;  1KC8 4;  1OHO A;  3L0R A;  3WA3 A;  3PGB A;  3DGO A;  3GWR A;  5IF6 A;  3IJE B;  4STD A;  1TP6 A;  5AEU B;  4WYK B;  1M9G A;  3MG2 A;  4Q53 A;  1GYB A;  4HVN A;  1N5P A;  1R4C A;  2BO9 B;  1EA2 A;  2D42 A;  2YFJ B;  1JV2 B;  4N3V A;  3SED A;  4XDW A;  1NJI 4;  1N9E A;  1OGX A;  3D9R A;  4JRF A;  2K0M A;  4XB5 A;  2P0M A;  2XFT A;  3DM8 A;  2CFK A;  4MMZ B;  4EBG A;  2FXT A;  2GU3 A;  1ZO2 A;  1JKG B;  1TUH A;  1STD A;  1Q86 4;  1G96 A;  3HK4 A;  3LOY A;  3EX9 A;  3MWZ A;  2W56 A;  1DYU A;  4AKY A;  3B7C A;  1IDP A;  1RN7 A;  3I0Y A;  1QVG 2;  4R9K A;  5JPP A;  2RGQ A;  1YJW 3;  2B24 B;  4FMB A;  3UL6 A;  2P38 A;  3T8N A;  1HKX A;  5AYR B;  3WDG B;  4FMD A;  1TU5 A;  3PXM A;  4JF8 A;  1D6U A;  1FGT A;  2XGN A;  3S5C A;  3X3X A;  2CK3 H;  3S28 A;  5KP4 A;  1IU7 A;  1OGZ A;  2ML6 A;  1O7N B;  2OOV A;  3EN8 A;  4K90 B;  2W6J H;  3F9S A;  1OHS A;  4GL6 A;  3EJV A;  3CC4 3;  3KZT A;  1A2V A;  2RSX A;  1VQK 3;  1ZX2 A;  3AMO A;  5IEO A;  3PCR A;  4KFE A;  1ULI B;  3UB1 A;  3VSY A;  3UL5 A;  3RGA A;  4HM0 B;  3KE7 A;  1W2B 2;  1DVD A;  1OCV A;  4FMA A;  3RGR A;  2WOH A;  1Q40 A;  3CCM 3;  3EB8 A;  1YGE A;  4RBN A;  3NXJ A;  4LMI A;  3F8X A;  4MMX B;  2CW9 A;  3OV4 A;  4J8T A;  4O8S A;  4AKZ A;  3LT8 A;  5HGR A;  3LML A;  4FCZ A;  2IA7 A;  4TX4 A;  3K63 A;  2W03 A;  4OK0 A;  3FG4 A;  3CCV 3;  3N9H A;  3V99 A;  4H61 A;  3FGY A;  4N6L A;  4HM5 B;  4L8O A;  3B8L A;  2Y74 A;  4N6T A;  1O7M B;  4EC6 A;  2CHC A;  2XEP A;  1A90 A;  5FW5 A;  3HX8 A;  1OPY A;  3MG1 A;  4HYZ A;  3HI7 A;  1GY6 A;  3FSD A;  4K1V A;  1UI7 A;  2A15 A;  5AIH A;  3X40 A;  1PU4 A;  3G6E 3;  2HMN B;  1V74 A;  1OHP A;  1GY7 A;  3G16 A;  3HZP A;  1W00 A;  1CYV A;  3K0Z A;  3K5T A;  2M7O A;  1ISK A;  3GAX A;  2W0Q A;  2CFD A;  1CEW I;  5IG3 A;  3CPO A;  1MNL A;  5IEP A;  1IVU A;  2B1X B;  3F14 A;  1GS3 A;  1E3R A;  3U97 A;  3CNX A;  2LYX A;  3OWS A;  3K7C A;  2XFS A;  4O02 B;  3FKA A;  5AIG A;  3FLJ A;  1OH0 A;  5BVB A;  2F99 A;  2O9U X;  3D3L A;  5D83 A;  2WGQ A;  3CCQ 3;  4K61 A;  2P05 A;  3MSO A;  2W56 B;  3N8B A;  2XR8 B;  4LZI A;  4MEI A;  1UW1 A;  2F98 A;  3ER7 A;  5DRV A;  3TDG A;  1BUQ A;  3OWU A;  2HML B;  3GRD A;  1IV9 A;  4X2H A;  2STD A;  4HBR A;  4O2H A;  5FGO A;  1ULJ B;  3NM2 A;  1IT7 A;  2YX9 A;  4FCJ A;  5G2G A;  4EYC A;  3CCU 3;  2CFL A;  4LEH A;  4N6U A;  3ALA A;  1FUW A;  1NO3 A;  3K9M C;  1GD3 A;  1QJG A;  4ORL A;  1YJ9 3;  5I97 A;  5AEW B;  3WMD A;  1YI2 3;  1YVB I;  1NDO B;  1VQO 3;  1KD1 4;  5A0O B;  3U1W A;  3CCJ 3;  1JN5 B;  4PEJ A;  1W6G A;  3CXC 2;  1W6Y A;  3DUK A;  3AMO B;  2XSO B;  1IK3 A;  3NM7 A;  2W9P A;  1FGM A;  2OQE C;  1Q40 B;  2Y73 A;  1VQ8 3;  1O7H B;  1AV4 A;  1W01 A;  3BB9 A;  1IVW A;  1OF5 B;  2PNC A;  5CLK A;  5KP1 A;  1MOL A;  1NB5 I;  2JQ5 A;  1U8C B;  2KRT A;  5JBS A;  3CC7 3;  1K28 A;  2E2U A;  3SOA A;  1K9M 4;  5LC6 A;  1Q42 A;  3NV0 B;  4HZ9 B;  2HMK B;  3WOD G;  1CQS A;  3CME 3;  3PS8 A;  2CH9 A;  3BNC A;  2KXG A;  3S29 A;  1TFK A;  1JNQ A;  1K8A 4;  4N6O B;  2QA4 3;  2QGU A;  1RRH A;  3FG3 A;  4AEQ A;  3JUM A;  2MF7 A;  3S27 A;  3X41 A;  2JDI H;  3ROB A;  1RKY A;  1QVF 2;  3F7X A;  3BND A;  1VQN 3;  2PZV A;  2R4I A;  4OUQ A;  5JPU A;  4CDL A;  3CCL 3;  3MYT A;  4I4K A;  2I9W A;  1Q7Y 4;  5ELJ A;  3JUQ A;  4XM4 A;  3G71 3;  1HU9 A;  2QIY A;  3SVA A;  1E97 A;  3M8C A;  3O8Y A;  1WQL B;  2HMJ B;  1M1K 4;  3FZW A;  4KVH A;  1M1X B;  1LOX A;  2CWT A;  1D6Z A;  3BNE A;  1W2Z A;  3G0K A;  3KSP A;  3DGM A;  1U5O A;  3FF2 A;  1C7H A;  3NX0 A;  5D82 A;  2XSH B;  5EEO A;  3CCS 3;  1W5Z A;  1RJO A;  2OTL 3;  1DMM A;  3BLZ A;  3LT9 A;  5EVH A;  4ZM8 A;  3Q2P A;  3F7S A;  3CC2 3;  4R1K A;  2CFG A;  4XBX A;  3KSE D;  3EBY A;  4EXR A;  1EQK A;  1QAK A;  1ROV A;  3CU3 A;  3LTD A;  4WYK A;  2C10 A;  4BTX A;  3CCE 3;  3J7Y d;  3DGL A;  4K1U A;  3DY5 A;  4HM8 B;  1EKM A;  3EN1 B;  3JUO A;  3LZA A;  1VQP 3;  3KN4 A;  3DGN A;  5CF1 A;  4BTW A;  3MPH A;  3RDE A;  3QK9 A;  2OCT A;  1N9J A;  1VQL 3;  2OTJ 3;  3NHX A;  2XGL A;  1VQ5 3;  2IUJ A;  1E3V A;  3NQY A;  3F8H A;  1VQ9 3;  1S5A A;  1O7P B;  1AR0 A;  2GU1 A;  3SX1 A;  2XRX B;  1JKG A;  1LNH A;  5EQL A;  1QAF A;  1Y4K A;  2BNG A;  3E99 A;  4WWU C;  5AI1 A;  2OOV C;  3CPW 2;  3EBT A;  5CK6 A;  2FNQ A;  4RNZ A;  1STF I;  3NQZ A;  6STD A;  4HZB B;  4EV5 A;  3OX9 A;  1KQS 2;  1PFP A;  3FH1 A;  4LSO A;  3LTB A;  3KII A;  1L5G B;  3LYG A;  3JVC A;  4HM4 B;  1F8N A;  2KCD A;  1WNH A;  1FGR A;  3OXA A;  3X3Y A;  5LC7 A;  1N8R 4;  3NBR A;  3FCS B;  3JUN A;  2XF3 A;  2CIU A;  3CMA 3;  2CFW A;  2Z76 A;  1QMA A;  3EHC A;  1FA3 A;  1S72 3;  1UUW B;  3KKG A;  3GZY B;  3MG3 A;  1A67 A;  4KFD A;  2BMQ B;  2FGT A;  1DMN A;  1SII A;  4RZM A;  4X2O A;  3LXU X;  1Z1S A;  3LH4 A;  4HKV B;  1SJW A;  2Q07 A;  3UNL A;  1JB4 A;  1RRL A;  1JJ2 2;  1W4N A;  1YJN 3;  3JUP A;  2BHM A;  4WHA A;  2CKF B;  3G8Z A;  4KZ1 A;  4J9A A;  3T8U A;  1W7C A;  2YFI B;  2D1W A;  4R4K A;  1TFO A;  3NBJ A;  1DMQ A;  1QAL A;  4N6V 0;  5DRE A;  4IPB A;  2E2V A;  2C11 A;  1OUN A;  2WOF A;  3H3H A;  5CXO A;  4WP5 A;  4XBT A;  3T0U A;  3G4S 3;  2GBW B;  3LTC A;  1IVX A;  3PZW A;  1VQ6 3;  2V1L A;  4FMC A;  5AIF A;  3FG1 A;  4HM7 B;  1W6C A;  3GZX B;  3EC9 A;  5IEN A;  1VQ7 3;  5D81 A;  3A76 A;  4HM3 B;  4L7K A;  3V98 A;  2XH9 A;  3F40 A;  3DXO A;  3Q90 A;  2INX A;  3S67 A;  3STD A;  1D6Y A;  2GXF A;  4KFF A;  2OWP A;  5STD A;  2ZL8 A;  4IIA A;  5IG4 A;  3CD6 3;  3H51 A;  1M90 4;  1IQ8 A;  2GEY A;  3DMC A;  5KP3 A;  2GEX A;  1WMO A;  5AYS C;  5IW9 A;  2O3O A;  3OWY A;  5ELU A;  3IPT A;  1FGQ A;  1UI8 A;  3OW2 2;  1SQW A;  3WOE B;  1JRQ A;  2W2C A;  2IUK A;  2LQV A;  1VZZ A;  4HM6 B;  2HMO B;  2W04 A;  2CG0 A;  2L4V A;  8CHO A;  2Z77 A;  2E2T A;  1K73 4;  1NU3 A;  1UUV B;  2W9Q A;  1SPU A;  2WO0 A;  3X42 A;  2BT3 A;  1YIJ 3;  3MHE A;  1CYU A;  3KFQ C;  1AVL A;  1DVC A;  2BMR B;  4RNY A;  4HM2 B;  5AII A;  4N6M A;  3VGN A;  2Z6B A;  1Q81 4;  1A2K A;  3FF0 A;  4MMY B;  3Q1C A;  3WA2 X;  1JN5 A;  2UX0 A;  2RFR A;  4IT7 A;  1KWI A;  1LXE A;  2CC3 A;  3EQQ B;  3MKI A;  1OAC A;  2QEX 3;  1T5Y A;  4LGQ A;  1Q82 4;  1TIJ A;  2YFL B;  2F86 B;  4R9L A;  3PYJ A;  4XBY A;  1VQ4 3;  3DZL A;  4NRE A;  1N8Q A;  2WGO A;  3V92 A;  2RCD A;  1OF5 A;  3EE1 A;  1N5H A;  3SXX A;  5IER A;  1YHQ 3;  3NUV A;  3SOY A;  3NV0 A;  3ECF A;  4MJD A;  1YIT 3;  1IVV A;  1LVN A;  3CNM A;  3SLU A;  1O7G B;  1JB5 A;  2P09 A;  4G1M B;  4EV2 A;  3GZR A;  3BNB A;  2CG1 A;  1SIH A;  2BMO B;  4N6N B;  4QWT A;  5IG5 A;  2ML5 A;  2K54 A;  4OVM A;  4WFO A;  3B4O A;  1IQY A;  3N54 B;  4XDV A;  1NWW A;  2HMM B;  4FR9 A;  3CCR 3;  3LTA A;  1WMN A;  3VF1 A;  3NBB A;  2CWV A;  1J2B A;  1KSI A;  3X3Z A;  3IMA B;  1GY5 A;  7STD A;  2IMJ A;  5CF2 A;  2OQE A;  1ASK A;  5TGN A;  4HJL B;  2GBX B;  2CWU A;  4L8P A;  3I56 3;  5BXQ A;  1GD4 A;  4U13 A;  1US1 A;  1IV7 A;  1EG9 B;  4NHF A;  1K41 A;  1IT8 A;  2P0X A;  2SBL A;  2ZDJ A;  4GB5 A;  4HM1 B;  1FGO A;  1NB3 I;  1W02 A;  4H3U A;  1WMP A;  3HII A;  4FCM A;  3HIG A;  3QRD A;  3GZB A;  1AVK A;  1O7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...