1BRHA

Barnase mutant with leu 14 replaced by ala
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYAQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brhA00
3D5GA 1GOYA 1JBRA 1AQZA 3AHSA 1AY7A 1BU4A 1BSEA 4GSPA 1RLSA 1BOXA 1BUJA 1HZ1A 3URPA 3WHOA 2RNTA 1RCKA 1RTUA 2C4BA 1RN1A 1BRNL 1I0XA 1BRHA 2KF5A 1BRIA 4GHOA 1BNEA 1BSBA 1B2MA 1T2IA 3AHWA 1G02A 2KF6A 1JBTA 1T2HA 1GSPA 2AADA 2ZA4A 3Q3FA 1JBSA 3GSPA 1B3SA 3D5IA 1UCKA 2SARA 1GMPA 1BANA 5HOHA 2F4YA 1RGEA 1I3IA 1ZGXA 3A5EA 1YGWA 1CH0A 1TTOA 1GOVA 2BU4A 1BNSA 1BNJA 1RN4A 1IYYA 3RNTA 1RSNA 4J5KA 7GSPA 1PY3A 1BVIA 1RCLA 5BU4A 1RGCA 1I2FA 1GMQA 1RGKA 1I0VA 1YVSA 2F56A 1B2ZA 4RNTA 1GMRA 6RNTA 1RGGA 1FYSA 1BIRA 1LNIA 1Q9EA 1BSDA 1B2SA 1LOWA 1R4YA 1UCIA 1MGRA 2HOHA 5RNTA 1BSCA 2F5MA 1BNRA 1BGSA 1A2PA 1RDSA 1SARA 1RMSA 1BRGA 1RGFA 1B2UA 4J5GA 1X1XA 1I2EA 1RNTA 1I2GA 3KCHA 1BNIA 1B2XA 1I8VA 1LOYA 1RGLA 1LRAA 1BRSA 1LOVA 2KAAA 1FZUA 1FUSA 5GSPA 1UCJA 3HOHA 3WR2A 3BU4A 1BNFA 6GSPA 1I3FA 1DE3A 1RGAA 1TRPA 1RGHA 3DGYA 4BIRA 4HOHA 1B21A 1PYLA 3DH2A 1B20A 1RHLA 2KF4A 3AGNA 1UCLA 1X1UA 1BRJA 1BAOA 7RNTA 5BIRA 8RNTA 2RBIA 1BSAA 1MGWA 2AAEA 1X1YA 2BIRA 1DETA 2F5WA 1I70A 2GSPA 1X1WA 1FW7A 4BU4A 9RNTA 1GOUA 1RNBA 1TRQA 1HYFA 1YNVX 2KF3A 3BIRA 1B27A 1BRKA 1BNGA 3AGOA 4HAAA 1FUTA 3SYUA 1C54A 3D4AA
chains in the Genus database with same CATH superfamily
2UX0A 2ZHXB 5AI1A 1MWTA 2JDIH 5IG5A 1GOYA 2H0HA 1Q7HA 1RN7A 2RCDA 4BTYA 3N8BA 3T8NA 2BNGA 3NX0A 3ZFZA 5G1KA 2XEPA 1RLSA 3X40A 4J8TA 5D83A 1FGTA 1O7PB 4FCMA 4L8PA 3UNLA 3JUNA 3EQQB 1Z1SA 2C4BA 3O8YA 2CHCA 1NB5I 1JZDA 2D1WA 5IW9A 3MWZA 2OTJ3 3MHEA 4MMZB 1BNEA 3H51A 2FGTA 3EE1A 3SOAA 4K1UA 2CK3H 1OHOA 1WTHA 4N6NB 4FMCA 2ZDJA 4N6MA 4OVMA 1JBSA 3GSPA 1UCKA 3PYJA 4LYLB 1YJW3 5EVHA 2CW9A 5AIFA 1Y4KA 2W6JH 1MWUA 4X2HA 1I3IA 1CEWI 1IDPA 1SQWA 1ZGXA 2M7OA 3A5EA 3GWRA 3HZPA 3NV0B 4HM3B 4N3VA 2XGNA 5KP1A 1VQ53 1OF5A 1GY7A 2BU4A 4MMYB 3HK4A 1RN4A 4LZIA 3RNTA 5FW5A 3MPHA 2WO0A 5D82A 4BTXA 1BVIA 5AIIA 1VZZA 1YVSA 4NREA 1EA2A 3CCL3 3PS8A 3VSYA 4XBYA 1W00A 1UUVB 4EYCA 1FA3A 2XSOB 3OX9A 2OTL3 1BIRA 4IPBA 3DGMA 3NQZA 1Q9EA 1BSDA 1QAFA 3DM8A 1R4YA 4EC6A 6STDA 5RNTA 1BSCA 1IVXA 3M8CA 2GBXB 1W6GA 5LC7A 3UL6A 1YIT3 1K9M4 4HM4B 2J8XB 1RMSA 5G1LA 5ELUA 1RGFA 1LVNA 3FG4A 1UUWB 4FMAA 2KCDA 5M19A 2W2CA 3S5CA 3U97A 3I563 1RNTA 1B2MA 2OQEC 3MYTA 4WHAA 2PNCA 2Q07A 4LEHA 3B4PA 4O02B 2E2UA 4QWTA 1CQSA 3F8XA 1Q7Y4 2Z6BA 2XRXB 1KSIA 3G713 3NQYA 1T5YA 5GSPA 1UCJA 3HOHA 3MG1A 4ORLA 1CYUA 1BNFA 4R80A 1I3FA 1UGHI 1DE3A 1QMAA 2OCTA 1W5ZA 2YFLB 4K90B 1RGHA 3DGYA 1HU9A 4ZM8A 1B20A 3MSOA 1OF5B 2W9PA 3G8ZA 4N6UA 4WYKA 1GD3A 2RGQA 2CX1A 2Z7AA 3MG2A 3CPW2 1Q864 3FZWA 1BAOA 3E99A 4N6LA 4N6V0 4O3VA 5BIRA 2Y74A 7RNTA 3CMA3 4K1VA 1IT7A 1W02A 3I0YA 1MGWA 2HMJB 2WGQA 1IQYA 3KN4A 4CJNA 2ML5A 5G2GA 1QVF2 1YIJ3 2OQEA 2HMOB 4FCJA 3BNDA 3LTBA 1J2BA 2H0IA 2Z77A 1PFPA 4OK0A 4RNZA 3WA3A 1DYUA 1LNHA 2R41A 3KSPA 1KD14 1RRHA 1LQGC 1GY5A 2XH9A 1W01A 3SYUA 3TDGA 3GZYB 1DMMA 3D5GA 2BHMA 1S5AA 3FG3A 1JBRA 3B7CA 3DGNA 3SLUA 4H61A 4HZ9B 1D6UA 3JVCA 5TGNA 2UGIA 2IUKA 5LC6A 3CCV3 3LMLA 4HM2B 1A67A 1DVDA 3ALAA 3FLJA 3N54B 1JKGA 4XBXA 1G96A 3LOYA 1RCKA 3K9MC 2OOVA 2XR8B 2UUGC 2KXGA 3NBJA 3X3ZA 4STDA 1I0XA 3G4S3 2KF5A 2CFGA 1IVVA 2CWVA 2K3DA 1EQKA 2BO9B 1GSPA 1OGXA 1FGMA 2AADA 2ZA4A 4KFEA 1B3SA 3D5IA 2P0XA 2P09A 1BANA 2GEYA 3WMDA 3ZG5A 1RGEA 3NM7A 1TUHA 3HIIA 3CD63 3HI7A 3KFQC 2YFIB 3CNMA 2Z76A 1FGQA 4OUQA 5I97A 1UUGB 1R4CA 1TTOA 5IG4A 1VQ83 4RBNA 5AIHA 4KVHA 4O2HA 1EUIC 1W4NA 3UJMA 1NWWA 7GSPA 4XM4A 1GMQA 2FNQA 1B2ZA 6RNTA 5ELJA 1D6ZA 1RGGA 1KC84 1NU3A 1US1A 3F14A 3LZAA 2CIUA 1N9EA 1YI23 3FG1A 3NXJA 4R4KA 1W2B2 1QJGA 2IY2A 2CG0A 3SX1A 1RDSA 1SARA 3X3XA 1VQM3 1E97A 1BRGA 1TP6A 1EG9B 2W56A 3FSDA 4WFOA 1B2UA 2YX9A 4AEQA 3CCS3 1JJ22 3GRDA 1VQO3 3EF8A 3NHXA 3FF0A 1DMNA 1OHPA 3KCHA 1Q40A 1UDII 2W03A 1I8VA 1LOYA 2GU1A 1RJOA 1ASKA 1K41A 3F9SA 4XB5A 1WMPA 1K8A4 2CWUA 3OXAA 3BNEA 1OHSA 1BRSA 1LOVA 5FGOA 1JNQA 1G0TA 2KAAA 3LH4A 3S29A 3CCM3 1IV7A 3Q2PA 4XBTA 3WR2A 5IEPA 1F8NA 1RGAA 1TRPA 1MWRA 3FGYA 5CF1A 1EKMA 4HOHA 1B21A 1OGZA 1JB5A 2CC3A 4H3UA 4KFDA 2HMKB 2RSXA 2W04A 4LMIA 2R4IA 1PYLA 4KFFA 3X41A 1KQS2 1IQ8A 1O7HB 2Y73A 3CCE3 3AGNA 3B8LA 3A76A 3BNCA 3DUKA 3VF1A 3LT9A 4PEJA 1K734 1RKYA 2WOFA 3SXXA 1UW1A 1E3VA 2P38A 1SJWA 3DGOA 3Q90A 1NNVA 2BIRA 2F5WA 4R9KA 2KRTA 1I70A 3X3YA 2LYXA 2GBWB 1DMQA 4BU4A 3DXOA 4CCVA 1TIJA 1TRQA 2P0MA 5BXQA 1HYFA 3BIRA 3GZRA 3CME3 3G0KA 4MMXB 3AGOA 3EHCA 3D79A 4HAAA 1PU4A 4FCZA 3CC43 1ZO2A 3ER7A 3LTAA 4I4KA 4CPKA 4EV5A 3JUQA 3PGBA 5IG0A 1LOXA 4J9AA 2O9UX 1AQZA 4AKZA 1GYBA 3AHSA 1AY7A 1BU4A 5BVBA 1U5OA 3CPOA 5IENA 1DVCA 1VQ63 4WP5A 1JZOA 1IV9A 2RNTA 5DREA 1RTUA 1RN1A 1BRNL 4R9LA 1IVUA 4KT3B 1V57A 4BL2A 4FMDA 1SPUA 1VQL3 1BRIA 3G6E3 1BUQA 1JN5A 5JPPA 1BSBA 2ZL8A 1OACA 1T2IA 3K0ZA 1N5PA 2XF3A 3GZBA 2I9WA 5AEUB 2KF6A 1Q42A 2XGLA 1NDOB 2E2VA 3JUMA 4K61A 1NO3A 3MKIA 3J7Yd 5CLKA 1YHQ3 5CK6A 3F8HA 1M1K4 1WQLB 4GL6A 3FCSB 2XFTA 1ZS7A 2XFSA 5HGRA 2C11A 3BB9A 3IMAB 1YGWA 2IYJA 1VQ93 2BT3A 3LYGA 3VGNA 1WNHA 4KZ1A 1CH0A 3SVAA 1GOVA 3RGAA 1BNSA 5JPUA 3K7CA 3CCJ3 3ZG0A 1NB3I 4FMBA 4J5KA 1RCLA 2XSHB 2F99A 1A2VA 1QALA 5BU4A 1I0VA 2W9QA 3KZTA 4RNTA 1GS3A 3K63A 1VQK3 3K5TA 3EJVA 3IJEB 4EXRA 2K54A 1ISKA 1AR0A 4U13A 4LSOA 1LNIA 3ROBA 3S28A 1B2SA 1KWIA 1LOWA 1UCIA 2CFWA 3JUOA 4WYKB 5AYSC 4AKYA 1BGSA 1A2PA 2HMNB 2QGUA 2C10A 2K0MA 1IQXA 4HM6B 5CXOA 3DY5A 1T3BA 1OPYA 1X1XA 4IT7A 3CCQ3 1I2EA 3SOYA 4MJDA 2BMRB 2L1SA 3S27A 1C7HA 4L8OA 4XDVA 2H0GA 2B24B 5DRVA 3NV0A 5IERA 1LRAA 1E3RA 3BNBA 3STDA 4CDLA 1FZUA 3OWYA 3T8UA 3DGLA 3CCR3 1VQ73 3BU4A 3DZLA 1LXEA 3UB1A 6GSPA 1C54A 1ZX2A 5M18A 1S723 3DMCA 4BL3A 1TJDA 1N8R4 4BIRA 1VQN3 1V58A 3OV4A 2SBLA 1OUNA 2F86B 3DH2A 1O7GB 1RHLA 3PCSA 3LXUX 1IVWA 1JKGB 3OW22 3X42A 3HX8A 1OH0A 1M9GA 3NUVA 1IU7A 3NM2A 3WOEB 3WODG 1NJI4 3D3LA 2OWPA 1BSAA 1U8CB 2AAEA 3AMOA 1X1YA 4HM1B 8CHOA 2CH9A 1OCVA 2GEXA 2CX0A 1QAKA 2GSPA 3LT8A 3PXMA 4HM7B 4JF8A 5D81A 3UL5A 3WOFB 1W6YA 1STFI 3NBRA 1GOUA 1O7NB 4I5QA 3V99A 3CC23 2CG1A 1RNBA 1IK3A 2KF3A 3LTCA 1QVG2 2WOHA 5EQLA 1A2KA 1UI8A 3T0UA 1BNGA 4IIAA 1ROVA 1JB2A 2F98A 1FUTA 2BMQB 3QRDA 4NHFA 1VQQA 4BTWA 3EN8A 4FR9A 3LTDA 2QIYA 3CNXA 4HM0B 2INXA 1JV2B 1CYVA 4L7KA 1A90A 4X2OA 3JUPA 3F7XA 3PCRA 1SIIA 2PZVA 3F7SA 1N5HA 1BSEA 4GSPA 5M1AA 1ULIB 1BOXA 1BUJA 1HZ1A 2STDA 3URPA 5KP4A 3WHOA 1Q814 4EW5A 3KIIA 5AIGA 2HMLB 1FGRA 2JQ5A 5STDA 5AEWB 4HJLB 2YFJB 3QK9A 3WDGB 3FF2A 1BRHA 2HMMB 4GHOA 4NPBA 2ML6A 3AHWA 4HZBB 2GU3A 1G02A 2IMJA 3IPTA 1SIHA 2W56B 4N6TA 5IEOA 1T2HA 3BLZA 1WMOA 4XDWA 5IG3A 1JBTA 3Q3FA 1AV4A 2CFKA 4HYZA 2SARA 1GMPA 1TFKA 1W7CA 2CFLA 2V1LA 3EN1B 5KP3A 2F4YA 5HOHA 1MOLA 3AMOB 5CF2A 3EB8A 3KSED 1YJN3 1Q40B 4EBGA 3Q1CA 3CCU3 1M904 2IA7A 3B4OA 3G16A 1BNJA 4DKIA 1IYYA 1MNLA 1MWSA 1RSNA 2P05A 1N9JA 1PY3A 3EBTA 1K28A 1RGCA 1GY6A 1I2FA 1W2ZA 1RGKA 2CKFB 3KKGA 3D9RA 2LQVA 5A0OB 2F56A 1GMRA 4RNYA 3H3HA 3V98A 3CC73 1JB4A 2CWTA 4HM8B 1FYSA 1O7WB 4EV2A 5EEOA 1IT8A 1AVLA 2L4VA 1V74A 3SEDA 1YVBI 2HOHA 1MGRA 1ULJB 2F5MA 1BNRA 1JRQA 2FXTA 1AVKA 2OOVC 3EBYA 3FH1A 4J5GA 5JBSA 2GXFA 4N6OB 3I553 3PZWA 3OWUA 3GAXA 5IF6A 1UGIA 1I2GA 1VQP3 2WGOA 4HKVB 4Q53A 1BNIA 1B2XA 1RGLA 1WMNA 5AYRB 2CFDA 4MEIA 3GZXB 1FUSA 1M1XB 4RZMA 1O7MB 3S67A 1D6YA 2A15A 4LGQA 3RGRA 3CU3A 3OWSA 4ILFA 3V92A 1EEJA 3EX9A 4TX4A 1TU5A 4JRFA 2KF4A 3L0RA 4G1MB 2QA43 3U1WA 2MF7A 3RDEA 1Q824 1UCLA 1GD4A 1FGOA 3F40A 1X1UA 2E2TA 1BRJA 2IUJA 2BMOB 3MG3A 2MC8A 3FKAA 2O3OA 4O8SA 8RNTA 1STDA 2RBIA 3N9HA 4HBRA 3WA2X 4HVNA 1HKXA 3EC9A 1LQMB 2D42A 1DETA 1JN5B 1ROAA 1RRLA 1X1WA 1W6CA 1FW7A 4HM5B 9RNTA 3CXC2 7STDA 1YJ93 1N8QA 1UI7A 4R1KA 1YNVX 1VQ43 3HIGA 1B27A 3NBBA 1BRKA 1L5GB 2QEX3 1TFOA 2RFRA 1YGEA 4WWUC 2B1XB 1FUWA 3KE7A 2W0QA 4GB5A 3ECFA 3D4AA
chains in the Genus database with same CATH topology
3D5GA 1GOYA 1JBRA 1AQZA 3AHSA 1AY7A 1BU4A 1BSEA 4GSPA 1RLSA 1BOXA 1BUJA 1HZ1A 3URPA 3WHOA 2RNTA 1RCKA 1RTUA 2C4BA 1RN1A 1BRNL 1I0XA 1BRHA 2KF5A 1BRIA 4GHOA 1BNEA 1BSBA 1B2MA 1T2IA 3AHWA 1G02A 2KF6A 1JBTA 1T2HA 1GSPA 2AADA 2ZA4A 3Q3FA 1JBSA 3GSPA 1B3SA 3D5IA 1UCKA 2SARA 1GMPA 1BANA 5HOHA 2F4YA 1RGEA 1I3IA 1ZGXA 3A5EA 1YGWA 1CH0A 1TTOA 1GOVA 2BU4A 1BNSA 1BNJA 1RN4A 1IYYA 3RNTA 1RSNA 4J5KA 7GSPA 1PY3A 1BVIA 1RCLA 5BU4A 1RGCA 1I2FA 1GMQA 1RGKA 1I0VA 1YVSA 2F56A 1B2ZA 4RNTA 1GMRA 6RNTA 1RGGA 1FYSA 1BIRA 1LNIA 1Q9EA 1BSDA 1B2SA 1LOWA 1R4YA 1UCIA 1MGRA 2HOHA 5RNTA 1BSCA 2F5MA 1BNRA 1BGSA 1A2PA 1RDSA 1SARA 1RMSA 1BRGA 1RGFA 1B2UA 4J5GA 1X1XA 1I2EA 1RNTA 1I2GA 3KCHA 1BNIA 1B2XA 1I8VA 1LOYA 1RGLA 1LRAA 1BRSA 1LOVA 2KAAA 1FZUA 1FUSA 5GSPA 1UCJA 3HOHA 3WR2A 3BU4A 1BNFA 6GSPA 1I3FA 1DE3A 1RGAA 1TRPA 1RGHA 3DGYA 4BIRA 4HOHA 1B21A 1PYLA 3DH2A 1B20A 1RHLA 2KF4A 3AGNA 1UCLA 1X1UA 1BRJA 1BAOA 7RNTA 5BIRA 8RNTA 2RBIA 1BSAA 1MGWA 2AAEA 1X1YA 2BIRA 1DETA 2F5WA 1I70A 2GSPA 1X1WA 1FW7A 4BU4A 9RNTA 1GOUA 1RNBA 1TRQA 1HYFA 1YNVX 2KF3A 3BIRA 1B27A 1BRKA 1BNGA 3AGOA 4HAAA 1FUTA 3SYUA 1C54A 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5G A;  1GOY A;  1JBR A;  1AQZ A;  3AHS A;  1AY7 A;  1BU4 A;  1BSE A;  4GSP A;  1RLS A;  1BOX A;  1BUJ A;  1HZ1 A;  3URP A;  3WHO A;  2RNT A;  1RCK A;  1RTU A;  2C4B A;  1RN1 A;  1BRN L;  1I0X A;  1BRH A;  2KF5 A;  1BRI A;  4GHO A;  1BNE A;  1BSB A;  1B2M A;  1T2I A;  3AHW A;  1G02 A;  2KF6 A;  1JBT A;  1T2H A;  1GSP A;  2AAD A;  2ZA4 A;  3Q3F A;  1JBS A;  3GSP A;  1B3S A;  3D5I A;  1UCK A;  2SAR A;  1GMP A;  1BAN A;  5HOH A;  2F4Y A;  1RGE A;  1I3I A;  1ZGX A;  3A5E A;  1YGW A;  1CH0 A;  1TTO A;  1GOV A;  2BU4 A;  1BNS A;  1BNJ A;  1RN4 A;  1IYY A;  3RNT A;  1RSN A;  4J5K A;  7GSP A;  1PY3 A;  1BVI A;  1RCL A;  5BU4 A;  1RGC A;  1I2F A;  1GMQ A;  1RGK A;  1I0V A;  1YVS A;  2F56 A;  1B2Z A;  4RNT A;  1GMR A;  6RNT A;  1RGG A;  1FYS A;  1BIR A;  1LNI A;  1Q9E A;  1BSD A;  1B2S A;  1LOW A;  1R4Y A;  1UCI A;  1MGR A;  2HOH A;  5RNT A;  1BSC A;  2F5M A;  1BNR A;  1BGS A;  1A2P A;  1RDS A;  1SAR A;  1RMS A;  1BRG A;  1RGF A;  1B2U A;  4J5G A;  1X1X A;  1I2E A;  1RNT A;  1I2G A;  3KCH A;  1BNI A;  1B2X A;  1I8V A;  1LOY A;  1RGL A;  1LRA A;  1BRS A;  1LOV A;  2KAA A;  1FZU A;  1FUS A;  5GSP A;  1UCJ A;  3HOH A;  3WR2 A;  3BU4 A;  1BNF A;  6GSP A;  1I3F A;  1DE3 A;  1RGA A;  1TRP A;  1RGH A;  3DGY A;  4BIR A;  4HOH A;  1B21 A;  1PYL A;  3DH2 A;  1B20 A;  1RHL A;  2KF4 A;  3AGN A;  1UCL A;  1X1U A;  1BRJ A;  1BAO A;  7RNT A;  5BIR A;  8RNT A;  2RBI A;  1BSA A;  1MGW A;  2AAE A;  1X1Y A;  2BIR A;  1DET A;  2F5W A;  1I70 A;  2GSP A;  1X1W A;  1FW7 A;  4BU4 A;  9RNT A;  1GOU A;  1RNB A;  1TRQ A;  1HYF A;  1YNV X;  2KF3 A;  3BIR A;  1B27 A;  1BRK A;  1BNG A;  3AGO A;  4HAA A;  1FUT A;  3SYU A;  1C54 A;  3D4A A; 
#chains in the Genus database with same CATH topology
 2UX0 A;  2ZHX B;  5AI1 A;  1MWT A;  2JDI H;  5IG5 A;  1GOY A;  2H0H A;  1Q7H A;  1RN7 A;  2RCD A;  4BTY A;  3N8B A;  3T8N A;  2BNG A;  3NX0 A;  3ZFZ A;  5G1K A;  2XEP A;  1RLS A;  3X40 A;  4J8T A;  5D83 A;  1FGT A;  1O7P B;  4FCM A;  4L8P A;  3UNL A;  3JUN A;  3EQQ B;  1Z1S A;  2C4B A;  3O8Y A;  2CHC A;  1NB5 I;  1JZD A;  2D1W A;  5IW9 A;  3MWZ A;  2OTJ 3;  3MHE A;  4MMZ B;  1BNE A;  3H51 A;  2FGT A;  3EE1 A;  3SOA A;  4K1U A;  2CK3 H;  1OHO A;  1WTH A;  4N6N B;  4FMC A;  2ZDJ A;  4N6M A;  4OVM A;  1JBS A;  3GSP A;  1UCK A;  3PYJ A;  4LYL B;  1YJW 3;  5EVH A;  2CW9 A;  5AIF A;  1Y4K A;  2W6J H;  1MWU A;  4X2H A;  1I3I A;  1CEW I;  1IDP A;  1SQW A;  1ZGX A;  2M7O A;  3A5E A;  3GWR A;  3HZP A;  3NV0 B;  4HM3 B;  4N3V A;  2XGN A;  5KP1 A;  1VQ5 3;  1OF5 A;  1GY7 A;  2BU4 A;  4MMY B;  3HK4 A;  1RN4 A;  4LZI A;  3RNT A;  5FW5 A;  3MPH A;  2WO0 A;  5D82 A;  4BTX A;  1BVI A;  5AII A;  1VZZ A;  1YVS A;  4NRE A;  1EA2 A;  3CCL 3;  3PS8 A;  3VSY A;  4XBY A;  1W00 A;  1UUV B;  4EYC A;  1FA3 A;  2XSO B;  3OX9 A;  2OTL 3;  1BIR A;  4IPB A;  3DGM A;  3NQZ A;  1Q9E A;  1BSD A;  1QAF A;  3DM8 A;  1R4Y A;  4EC6 A;  6STD A;  5RNT A;  1BSC A;  1IVX A;  3M8C A;  2GBX B;  1W6G A;  5LC7 A;  3UL6 A;  1YIT 3;  1K9M 4;  4HM4 B;  2J8X B;  1RMS A;  5G1L A;  5ELU A;  1RGF A;  1LVN A;  3FG4 A;  1UUW B;  4FMA A;  2KCD A;  5M19 A;  2W2C A;  3S5C A;  3U97 A;  3I56 3;  1RNT A;  1B2M A;  2OQE C;  3MYT A;  4WHA A;  2PNC A;  2Q07 A;  4LEH A;  3B4P A;  4O02 B;  2E2U A;  4QWT A;  1CQS A;  3F8X A;  1Q7Y 4;  2Z6B A;  2XRX B;  1KSI A;  3G71 3;  3NQY A;  1T5Y A;  5GSP A;  1UCJ A;  3HOH A;  3MG1 A;  4ORL A;  1CYU A;  1BNF A;  4R80 A;  1I3F A;  1UGH I;  1DE3 A;  1QMA A;  2OCT A;  1W5Z A;  2YFL B;  4K90 B;  1RGH A;  3DGY A;  1HU9 A;  4ZM8 A;  1B20 A;  3MSO A;  1OF5 B;  2W9P A;  3G8Z A;  4N6U A;  4WYK A;  1GD3 A;  2RGQ A;  2CX1 A;  2Z7A A;  3MG2 A;  3CPW 2;  1Q86 4;  3FZW A;  1BAO A;  3E99 A;  4N6L A;  4N6V 0;  4O3V A;  5BIR A;  2Y74 A;  7RNT A;  3CMA 3;  4K1V A;  1IT7 A;  1W02 A;  3I0Y A;  1MGW A;  2HMJ B;  2WGQ A;  1IQY A;  3KN4 A;  4CJN A;  2ML5 A;  5G2G A;  1QVF 2;  1YIJ 3;  2OQE A;  2HMO B;  4FCJ A;  3BND A;  3LTB A;  1J2B A;  2H0I A;  2Z77 A;  1PFP A;  4OK0 A;  4RNZ A;  3WA3 A;  1DYU A;  1LNH A;  2R41 A;  3KSP A;  1KD1 4;  1RRH A;  1LQG C;  1GY5 A;  2XH9 A;  1W01 A;  3SYU A;  3TDG A;  3GZY B;  1DMM A;  3D5G A;  2BHM A;  1S5A A;  3FG3 A;  1JBR A;  3B7C A;  3DGN A;  3SLU A;  4H61 A;  4HZ9 B;  1D6U A;  3JVC A;  5TGN A;  2UGI A;  2IUK A;  5LC6 A;  3CCV 3;  3LML A;  4HM2 B;  1A67 A;  1DVD A;  3ALA A;  3FLJ A;  3N54 B;  1JKG A;  4XBX A;  1G96 A;  3LOY A;  1RCK A;  3K9M C;  2OOV A;  2XR8 B;  2UUG C;  2KXG A;  3NBJ A;  3X3Z A;  4STD A;  1I0X A;  3G4S 3;  2KF5 A;  2CFG A;  1IVV A;  2CWV A;  2K3D A;  1EQK A;  2BO9 B;  1GSP A;  1OGX A;  1FGM A;  2AAD A;  2ZA4 A;  4KFE A;  1B3S A;  3D5I A;  2P0X A;  2P09 A;  1BAN A;  2GEY A;  3WMD A;  3ZG5 A;  1RGE A;  3NM7 A;  1TUH A;  3HII A;  3CD6 3;  3HI7 A;  3KFQ C;  2YFI B;  3CNM A;  2Z76 A;  1FGQ A;  4OUQ A;  5I97 A;  1UUG B;  1R4C A;  1TTO A;  5IG4 A;  1VQ8 3;  4RBN A;  5AIH A;  4KVH A;  4O2H A;  1EUI C;  1W4N A;  3UJM A;  1NWW A;  7GSP A;  4XM4 A;  1GMQ A;  2FNQ A;  1B2Z A;  6RNT A;  5ELJ A;  1D6Z A;  1RGG A;  1KC8 4;  1NU3 A;  1US1 A;  3F14 A;  3LZA A;  2CIU A;  1N9E A;  1YI2 3;  3FG1 A;  3NXJ A;  4R4K A;  1W2B 2;  1QJG A;  2IY2 A;  2CG0 A;  3SX1 A;  1RDS A;  1SAR A;  3X3X A;  1VQM 3;  1E97 A;  1BRG A;  1TP6 A;  1EG9 B;  2W56 A;  3FSD A;  4WFO A;  1B2U A;  2YX9 A;  4AEQ A;  3CCS 3;  1JJ2 2;  3GRD A;  1VQO 3;  3EF8 A;  3NHX A;  3FF0 A;  1DMN A;  1OHP A;  3KCH A;  1Q40 A;  1UDI I;  2W03 A;  1I8V A;  1LOY A;  2GU1 A;  1RJO A;  1ASK A;  1K41 A;  3F9S A;  4XB5 A;  1WMP A;  1K8A 4;  2CWU A;  3OXA A;  3BNE A;  1OHS A;  1BRS A;  1LOV A;  5FGO A;  1JNQ A;  1G0T A;  2KAA A;  3LH4 A;  3S29 A;  3CCM 3;  1IV7 A;  3Q2P A;  4XBT A;  3WR2 A;  5IEP A;  1F8N A;  1RGA A;  1TRP A;  1MWR A;  3FGY A;  5CF1 A;  1EKM A;  4HOH A;  1B21 A;  1OGZ A;  1JB5 A;  2CC3 A;  4H3U A;  4KFD A;  2HMK B;  2RSX A;  2W04 A;  4LMI A;  2R4I A;  1PYL A;  4KFF A;  3X41 A;  1KQS 2;  1IQ8 A;  1O7H B;  2Y73 A;  3CCE 3;  3AGN A;  3B8L A;  3A76 A;  3BNC A;  3DUK A;  3VF1 A;  3LT9 A;  4PEJ A;  1K73 4;  1RKY A;  2WOF A;  3SXX A;  1UW1 A;  1E3V A;  2P38 A;  1SJW A;  3DGO A;  3Q90 A;  1NNV A;  2BIR A;  2F5W A;  4R9K A;  2KRT A;  1I70 A;  3X3Y A;  2LYX A;  2GBW B;  1DMQ A;  4BU4 A;  3DXO A;  4CCV A;  1TIJ A;  1TRQ A;  2P0M A;  5BXQ A;  1HYF A;  3BIR A;  3GZR A;  3CME 3;  3G0K A;  4MMX B;  3AGO A;  3EHC A;  3D79 A;  4HAA A;  1PU4 A;  4FCZ A;  3CC4 3;  1ZO2 A;  3ER7 A;  3LTA A;  4I4K A;  4CPK A;  4EV5 A;  3JUQ A;  3PGB A;  5IG0 A;  1LOX A;  4J9A A;  2O9U X;  1AQZ A;  4AKZ A;  1GYB A;  3AHS A;  1AY7 A;  1BU4 A;  5BVB A;  1U5O A;  3CPO A;  5IEN A;  1DVC A;  1VQ6 3;  4WP5 A;  1JZO A;  1IV9 A;  2RNT A;  5DRE A;  1RTU A;  1RN1 A;  1BRN L;  4R9L A;  1IVU A;  4KT3 B;  1V57 A;  4BL2 A;  4FMD A;  1SPU A;  1VQL 3;  1BRI A;  3G6E 3;  1BUQ A;  1JN5 A;  5JPP A;  1BSB A;  2ZL8 A;  1OAC A;  1T2I A;  3K0Z A;  1N5P A;  2XF3 A;  3GZB A;  2I9W A;  5AEU B;  2KF6 A;  1Q42 A;  2XGL A;  1NDO B;  2E2V A;  3JUM A;  4K61 A;  1NO3 A;  3MKI A;  3J7Y d;  5CLK A;  1YHQ 3;  5CK6 A;  3F8H A;  1M1K 4;  1WQL B;  4GL6 A;  3FCS B;  2XFT A;  1ZS7 A;  2XFS A;  5HGR A;  2C11 A;  3BB9 A;  3IMA B;  1YGW A;  2IYJ A;  1VQ9 3;  2BT3 A;  3LYG A;  3VGN A;  1WNH A;  4KZ1 A;  1CH0 A;  3SVA A;  1GOV A;  3RGA A;  1BNS A;  5JPU A;  3K7C A;  3CCJ 3;  3ZG0 A;  1NB3 I;  4FMB A;  4J5K A;  1RCL A;  2XSH B;  2F99 A;  1A2V A;  1QAL A;  5BU4 A;  1I0V A;  2W9Q A;  3KZT A;  4RNT A;  1GS3 A;  3K63 A;  1VQK 3;  3K5T A;  3EJV A;  3IJE B;  4EXR A;  2K54 A;  1ISK A;  1AR0 A;  4U13 A;  4LSO A;  1LNI A;  3ROB A;  3S28 A;  1B2S A;  1KWI A;  1LOW A;  1UCI A;  2CFW A;  3JUO A;  4WYK B;  5AYS C;  4AKY A;  1BGS A;  1A2P A;  2HMN B;  2QGU A;  2C10 A;  2K0M A;  1IQX A;  4HM6 B;  5CXO A;  3DY5 A;  1T3B A;  1OPY A;  1X1X A;  4IT7 A;  3CCQ 3;  1I2E A;  3SOY A;  4MJD A;  2BMR B;  2L1S A;  3S27 A;  1C7H A;  4L8O A;  4XDV A;  2H0G A;  2B24 B;  5DRV A;  3NV0 A;  5IER A;  1LRA A;  1E3R A;  3BNB A;  3STD A;  4CDL A;  1FZU A;  3OWY A;  3T8U A;  3DGL A;  3CCR 3;  1VQ7 3;  3BU4 A;  3DZL A;  1LXE A;  3UB1 A;  6GSP A;  1C54 A;  1ZX2 A;  5M18 A;  1S72 3;  3DMC A;  4BL3 A;  1TJD A;  1N8R 4;  4BIR A;  1VQN 3;  1V58 A;  3OV4 A;  2SBL A;  1OUN A;  2F86 B;  3DH2 A;  1O7G B;  1RHL A;  3PCS A;  3LXU X;  1IVW A;  1JKG B;  3OW2 2;  3X42 A;  3HX8 A;  1OH0 A;  1M9G A;  3NUV A;  1IU7 A;  3NM2 A;  3WOE B;  3WOD G;  1NJI 4;  3D3L A;  2OWP A;  1BSA A;  1U8C B;  2AAE A;  3AMO A;  1X1Y A;  4HM1 B;  8CHO A;  2CH9 A;  1OCV A;  2GEX A;  2CX0 A;  1QAK A;  2GSP A;  3LT8 A;  3PXM A;  4HM7 B;  4JF8 A;  5D81 A;  3UL5 A;  3WOF B;  1W6Y A;  1STF I;  3NBR A;  1GOU A;  1O7N B;  4I5Q A;  3V99 A;  3CC2 3;  2CG1 A;  1RNB A;  1IK3 A;  2KF3 A;  3LTC A;  1QVG 2;  2WOH A;  5EQL A;  1A2K A;  1UI8 A;  3T0U A;  1BNG A;  4IIA A;  1ROV A;  1JB2 A;  2F98 A;  1FUT A;  2BMQ B;  3QRD A;  4NHF A;  1VQQ A;  4BTW A;  3EN8 A;  4FR9 A;  3LTD A;  2QIY A;  3CNX A;  4HM0 B;  2INX A;  1JV2 B;  1CYV A;  4L7K A;  1A90 A;  4X2O A;  3JUP A;  3F7X A;  3PCR A;  1SII A;  2PZV A;  3F7S A;  1N5H A;  1BSE A;  4GSP A;  5M1A A;  1ULI B;  1BOX A;  1BUJ A;  1HZ1 A;  2STD A;  3URP A;  5KP4 A;  3WHO A;  1Q81 4;  4EW5 A;  3KII A;  5AIG A;  2HML B;  1FGR A;  2JQ5 A;  5STD A;  5AEW B;  4HJL B;  2YFJ B;  3QK9 A;  3WDG B;  3FF2 A;  1BRH A;  2HMM B;  4GHO A;  4NPB A;  2ML6 A;  3AHW A;  4HZB B;  2GU3 A;  1G02 A;  2IMJ A;  3IPT A;  1SIH A;  2W56 B;  4N6T A;  5IEO A;  1T2H A;  3BLZ A;  1WMO A;  4XDW A;  5IG3 A;  1JBT A;  3Q3F A;  1AV4 A;  2CFK A;  4HYZ A;  2SAR A;  1GMP A;  1TFK A;  1W7C A;  2CFL A;  2V1L A;  3EN1 B;  5KP3 A;  2F4Y A;  5HOH A;  1MOL A;  3AMO B;  5CF2 A;  3EB8 A;  3KSE D;  1YJN 3;  1Q40 B;  4EBG A;  3Q1C A;  3CCU 3;  1M90 4;  2IA7 A;  3B4O A;  3G16 A;  1BNJ A;  4DKI A;  1IYY A;  1MNL A;  1MWS A;  1RSN A;  2P05 A;  1N9J A;  1PY3 A;  3EBT A;  1K28 A;  1RGC A;  1GY6 A;  1I2F A;  1W2Z A;  1RGK A;  2CKF B;  3KKG A;  3D9R A;  2LQV A;  5A0O B;  2F56 A;  1GMR A;  4RNY A;  3H3H A;  3V98 A;  3CC7 3;  1JB4 A;  2CWT A;  4HM8 B;  1FYS A;  1O7W B;  4EV2 A;  5EEO A;  1IT8 A;  1AVL A;  2L4V A;  1V74 A;  3SED A;  1YVB I;  2HOH A;  1MGR A;  1ULJ B;  2F5M A;  1BNR A;  1JRQ A;  2FXT A;  1AVK A;  2OOV C;  3EBY A;  3FH1 A;  4J5G A;  5JBS A;  2GXF A;  4N6O B;  3I55 3;  3PZW A;  3OWU A;  3GAX A;  5IF6 A;  1UGI A;  1I2G A;  1VQP 3;  2WGO A;  4HKV B;  4Q53 A;  1BNI A;  1B2X A;  1RGL A;  1WMN A;  5AYR B;  2CFD A;  4MEI A;  3GZX B;  1FUS A;  1M1X B;  4RZM A;  1O7M B;  3S67 A;  1D6Y A;  2A15 A;  4LGQ A;  3RGR A;  3CU3 A;  3OWS A;  4ILF A;  3V92 A;  1EEJ A;  3EX9 A;  4TX4 A;  1TU5 A;  4JRF A;  2KF4 A;  3L0R A;  4G1M B;  2QA4 3;  3U1W A;  2MF7 A;  3RDE A;  1Q82 4;  1UCL A;  1GD4 A;  1FGO A;  3F40 A;  1X1U A;  2E2T A;  1BRJ A;  2IUJ A;  2BMO B;  3MG3 A;  2MC8 A;  3FKA A;  2O3O A;  4O8S A;  8RNT A;  1STD A;  2RBI A;  3N9H A;  4HBR A;  3WA2 X;  4HVN A;  1HKX A;  3EC9 A;  1LQM B;  2D42 A;  1DET A;  1JN5 B;  1ROA A;  1RRL A;  1X1W A;  1W6C A;  1FW7 A;  4HM5 B;  9RNT A;  3CXC 2;  7STD A;  1YJ9 3;  1N8Q A;  1UI7 A;  4R1K A;  1YNV X;  1VQ4 3;  3HIG A;  1B27 A;  3NBB A;  1BRK A;  1L5G B;  2QEX 3;  1TFO A;  2RFR A;  1YGE A;  4WWU C;  2B1X B;  1FUW A;  3KE7 A;  2W0Q A;  4GB5 A;  3ECF A;  3D4A A; 
#chains in the Genus database with same CATH homology
 3D5G A;  1GOY A;  1JBR A;  1AQZ A;  3AHS A;  1AY7 A;  1BU4 A;  1BSE A;  4GSP A;  1RLS A;  1BOX A;  1BUJ A;  1HZ1 A;  3URP A;  3WHO A;  2RNT A;  1RCK A;  1RTU A;  2C4B A;  1RN1 A;  1BRN L;  1I0X A;  1BRH A;  2KF5 A;  1BRI A;  4GHO A;  1BNE A;  1BSB A;  1B2M A;  1T2I A;  3AHW A;  1G02 A;  2KF6 A;  1JBT A;  1T2H A;  1GSP A;  2AAD A;  2ZA4 A;  3Q3F A;  1JBS A;  3GSP A;  1B3S A;  3D5I A;  1UCK A;  2SAR A;  1GMP A;  1BAN A;  5HOH A;  2F4Y A;  1RGE A;  1I3I A;  1ZGX A;  3A5E A;  1YGW A;  1CH0 A;  1TTO A;  1GOV A;  2BU4 A;  1BNS A;  1BNJ A;  1RN4 A;  1IYY A;  3RNT A;  1RSN A;  4J5K A;  7GSP A;  1PY3 A;  1BVI A;  1RCL A;  5BU4 A;  1RGC A;  1I2F A;  1GMQ A;  1RGK A;  1I0V A;  1YVS A;  2F56 A;  1B2Z A;  4RNT A;  1GMR A;  6RNT A;  1RGG A;  1FYS A;  1BIR A;  1LNI A;  1Q9E A;  1BSD A;  1B2S A;  1LOW A;  1R4Y A;  1UCI A;  1MGR A;  2HOH A;  5RNT A;  1BSC A;  2F5M A;  1BNR A;  1BGS A;  1A2P A;  1RDS A;  1SAR A;  1RMS A;  1BRG A;  1RGF A;  1B2U A;  4J5G A;  1X1X A;  1I2E A;  1RNT A;  1I2G A;  3KCH A;  1BNI A;  1B2X A;  1I8V A;  1LOY A;  1RGL A;  1LRA A;  1BRS A;  1LOV A;  2KAA A;  1FZU A;  1FUS A;  5GSP A;  1UCJ A;  3HOH A;  3WR2 A;  3BU4 A;  1BNF A;  6GSP A;  1I3F A;  1DE3 A;  1RGA A;  1TRP A;  1RGH A;  3DGY A;  4BIR A;  4HOH A;  1B21 A;  1PYL A;  3DH2 A;  1B20 A;  1RHL A;  2KF4 A;  3AGN A;  1UCL A;  1X1U A;  1BRJ A;  1BAO A;  7RNT A;  5BIR A;  8RNT A;  2RBI A;  1BSA A;  1MGW A;  2AAE A;  1X1Y A;  2BIR A;  1DET A;  2F5W A;  1I70 A;  2GSP A;  1X1W A;  1FW7 A;  4BU4 A;  9RNT A;  1GOU A;  1RNB A;  1TRQ A;  1HYF A;  1YNV X;  2KF3 A;  3BIR A;  1B27 A;  1BRK A;  1BNG A;  3AGO A;  4HAA A;  1FUT A;  3SYU A;  1C54 A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...