1BRHA

Barnase mutant with leu 14 replaced by ala
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYAQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brhA00
1GSPA 1BRSA 1BNEA 6RNTA 2C4BA 3D5IA 1BNJA 2KF4A 3A5EA 4HAAA 1FUTA 1RCLA 1MGWA 1RGGA 1JBSA 3AGNA 1BU4A 1B20A 1BSAA 4RNTA 1GMRA 1BAOA 1TRQA 2RBIA 1X1YA 2HOHA 1RDSA 2F56A 3WR2A 1YVSA 1YNVX 2ZA4A 1BRKA 1RLSA 1FYSA 1BSDA 2F5MA 2KAAA 2KF3A 2BU4A 1BNRA 1X1UA 3AGOA 1UCKA 4BIRA 1T2HA 1BRNL 1B27A 2BIRA 4GHOA 1LOWA 1UCIA 1JBRA 2KF6A 1BRJA 1RGEA 4J5GA 1BNSA 1RNTA 1BNIA 1SARA 1BRHA 5GSPA 1B21A 8RNTA 1LOYA 1FW7A 1CH0A 1R4YA 1PY3A 3DGYA 1I0XA 1AY7A 1DETA 1X1XA 1I3IA 3GSPA 4HOHA 1GMPA 1RGLA 7RNTA 1RNBA 1HYFA 1RN4A 2GSPA 3HOHA 1BANA 4GSPA 3WHOA 1RTUA 2F4YA 1BNFA 1RGFA 6GSPA 1TTOA 1X1WA 1RHLA 1BSCA 1B3SA 7GSPA 3BU4A 1GOYA 1A2PA 1MGRA 1TRPA 5BU4A 1RMSA 1RSNA 1RN1A 1BRGA 5BIRA 1UCJA 1GOVA 1IYYA 1BNGA 5HOHA 1BIRA 1B2XA 3AHSA 1G02A 3BIRA 3DH2A 1BSBA 1B2ZA 1LNIA 5RNTA 2AAEA 1AQZA 1GOUA 3D4AA 1LRAA 9RNTA 1PYLA 1I2GA 1C54A 1I8VA 3RNTA 1RGHA 3AHWA 1RGAA 4J5KA 3SYUA 1FZUA 1I2FA 1RCKA 2AADA 1RGCA 1UCLA 2KF5A 1YGWA 1RGKA 3URPA 1FUSA 1B2SA 1GMQA 2RNTA 2F5WA 1B2MA 4BU4A 1I2EA 1BOXA 1I70A 3Q3FA 3KCHA 1BGSA 1B2UA 1T2IA 1DE3A 1Q9EA 3D5GA 1I0VA 1ZGXA 2SARA 1BUJA 1BSEA 1HZ1A 1JBTA 1BVIA 1BRIA 1LOVA 1I3FA
chains in the Genus database with same CATH superfamily
3G6E3 1G96A 1OGXA 4KFFA 1YVBI 1KD14 3V99A 2PNCA 4MEIA 1Q7Y4 3GZRA 5HGRA 1JBSA 1QJGA 4NHFA 3AGNA 3F40A 3EBTA 1BSAA 4RNTA 3NHXA 4HM4B 2RBIA 1RRHA 1JZOA 1JKGB 4H61A 5IG5A 2CFLA 2XH9A 4BTWA 1RDSA 1UGHI 2C10A 2K0MA 2UUGC 2CWTA 3IJEB 1YVSA 1NNVA 2BNGA 1J2BA 1RLSA 3HZPA 1K734 4N6LA 3D3LA 2BU4A 2CW9A 3Q2PA 2L1SA 3UL5A 3ZFZA 1T2HA 2CG0A 5IEOA 2A15A 2OTJ3 3CU3A 3S5CA 3PCRA 3F7XA 3B4OA 2F86B 3TDGA 4HM1B 4WP5A 4KVHA 5IG3A 2WOFA 1O7GB 2D1WA 3G713 5IG4A 4J5GA 3CCM3 3G0KA 3CCV3 1DMMA 4N6OB 3ZG5A 1IK3A 1ZX2A 1YJ93 1K9M4 3B7CA 1K28A 4IIAA 3EJVA 4R80A 3ER7A 3N54B 8RNTA 1U8CB 1CH0A 1R4YA 1PY3A 2O9UX 4J8TA 1TFKA 2OQEC 4HOHA 1KC84 3O8YA 4TX4A 1RN4A 3WHOA 5EEOA 1RTUA 4KT3B 3BB9A 5KP1A 1RGFA 2H0HA 3DUKA 1K8A4 3J7Yd 1LQMB 1NDOB 2CKFB 5KP3A 2FGTA 4O2HA 1RHLA 4JRFA 1NB5I 5FGOA 1GOYA 3DM8A 2FXTA 4I5QA 4N6MA 4XB5A 1CYUA 1RMSA 1TUHA 2BMQB 1RN1A 5CF1A 1UDII 3AMOA 3HIIA 4HM5B 5BVBA 1NB3I 3D79A 4GL6A 1IYYA 2MF7A 1SJWA 1W01A 1O7HB 3NBRA 4MJDA 2OOVA 1YJW3 5CF2A 4G1MB 3BIRA 3DH2A 3NX0A 2SBLA 3RDEA 3EHCA 2KXGA 2CFKA 2UX0A 2C11A 5JPPA 2XSOB 4XM4A 3D4AA 1QMAA 4OK0A 1I2GA 4XBYA 9RNTA 1I8VA 2CFDA 4K1UA 1AVKA 3AHWA 5I97A 1BUQA 2W03A 3OWUA 4LMIA 1AV4A 5AEUB 1SPUA 3F8HA 5FW5A 5D83A 1VQL3 2ML5A 5AIIA 3MYTA 4X2OA 3X3XA 1VQ63 1RGCA 1UCLA 1VQ73 3K5TA 3URPA 4ORLA 4BTYA 4K1VA 2H0IA 2RNTA 3H51A 4BU4A 1B2MA 2CWVA 3FG1A 1I70A 3GRDA 3V92A 3QK9A 2O3OA 3LTAA 4J9AA 1BGSA 5D82A 3LT8A 1IV9A 1T2IA 2H0GA 2W04A 2BMOB 2MC8A 2SARA 3CXC2 1BUJA 3NXJA 1JN5A 1BSEA 1JZDA 1BVIA 5AYRB 2E2VA 1LOVA 3EF8A 5JPUA 1BNEA 1DMQA 3JVCA 2P0XA 4BL3A 1STFI 1IVUA 3FG4A 1N8R4 1BNJA 1IT8A 3KSED 3LOYA 1ROVA 1RCLA 4BL2A 1RGGA 4EW5A 1JRQA 3T8NA 4IPBA 1YHQ3 1B20A 4I4KA 1HKXA 2Y73A 1WMPA 4WYKA 1QVF2 1G0TA 1N5HA 3JUOA 4N6NB 5ELJA 1FGMA 3I563 4CJNA 1NWWA 2F56A 3WR2A 3VSYA 3EE1A 4OUQA 2ZA4A 5KP4A 3CC23 1JV2B 1EUIC 4GB5A 1CEWI 2CFGA 2KAAA 2LYXA 1BNRA 3OWYA 1VQ53 3AGOA 3VGNA 1FGOA 1B27A 1M1XB 4CDLA 3MPHA 1QAKA 2CG1A 2QIYA 1IV7A 2JDIH 5DRVA 3IMAB 1WQLB 2BMRB 1ISKA 3LZAA 3SOAA 1LQGC 1OGZA 4L7KA 3S67A 3STDA 1JBRA 1V57A 2KF6A 4KZ1A 3LH4A 1BNSA 1RNTA 1OHOA 1IQ8A 1BNIA 1TP6A 1SARA 2CH9A 1Q864 1CYVA 3FZWA 3KFQC 1B21A 5GSPA 2XFTA 1GY5A 2W56A 3S27A 1I0XA 2W0QA 1X1XA 3GZYB 2XGNA 2CK3H 3G4S3 3NV0A 1F8NA 3H3HA 1WMOA 3HOHA 2XSHB 1BNFA 2Z77A 6GSPA 1HU9A 1QAFA 1UUGB 1MOLA 1X1WA 2ZL8A 2WO0A 4N3VA 1B3SA 7GSPA 3BU4A 4K61A 3CPOA 1A2KA 3BNCA 1MGRA 1LOXA 1MWSA 2Z6BA 4XBXA 3KIIA 4XDVA 1RSNA 3DGMA 3CMA3 1BRGA 3GZBA 3EX9A 4OVMA 1TU5A 3PZWA 1IU7A 4O02B 1GOVA 2CC3A 4K90B 5IW9A 5M1AA 5HOHA 1VQM3 1OF5A 1B2XA 4U13A 3AHSA 2K54A 2GEYA 4MMZB 4HYZA 2RGQA 2W9QA 4NPBA 5LC6A 3AMOB 3WOEB 3ZG0A 1RRLA 2E2TA 5IG0A 3SXXA 3WA2X 2AAEA 4EBGA 1GOUA 1PYLA 2BO9B 1C54A 3DY5A 1KWIA 3RNTA 1IVWA 4KFDA 1FA3A 3FSDA 5AIGA 1E3VA 1FZUA 2M7OA 1W2ZA 2B24B 4HM6B 5EVHA 2AADA 2HMOB 1Q7HA 4FMCA 3MWZA 3HX8A 1R4CA 2KF5A 1D6ZA 1MWUA 1E97A 1CQSA 1QALA 2B1XB 2KCDA 2CX1A 1EG9B 2F5WA 3EB8A 4LSOA 3FH1A 4RZMA 5G2GA 1Q42A 5ELUA 1OPYA 4BTXA 3EC9A 1C7HA 3N9HA 5AYSC 4L8PA 1T3BA 1W6GA 2F99A 2R41A 1UUWB 1S723 3WDGB 1B2UA 1SQWA 2KRTA 4HJLB 1I0VA 1WNHA 2V1LA 1HZ1A 1TIJA 2GXFA 1JBTA 1BRIA 3WMDA 3NUVA 1GSPA 1BRSA 1MNLA 2XFSA 4HM0B 6RNTA 6STDA 3CCQ3 3UNLA 1EKMA 3A5EA 2YFLB 4HAAA 2P05A 1JN5B 1O7MB 3L0RA 4R1KA 3FF0A 4HM2B 3CCR3 1KQS2 1BU4A 1IDPA 4PEJA 1GMRA 1W7CA 1TRQA 1ULIB 1A90A 3GZXB 1X1YA 2HOHA 3NQYA 2XGLA 1VZZA 4HKVB 1UGIA 1M1K4 1AR0A 3MG2A 3KZTA 2YFIB 3SEDA 1AVLA 4CCVA 2OWPA 4EV5A 2CWUA 3PXMA 1YNVX 3LMLA 4HM3B 3G8ZA 3OXAA 4Q53A 2P0MA 1BSDA 1FGTA 1K41A 1YIJ3 2KF3A 4STDA 5G1LA 1X1UA 4FMDA 1UCKA 1UI7A 3K7CA 1BRNL 1GS3A 1O7NB 1WTHA 4KFEA 3X42A 5M18A 3CCS3 1OCVA 1VQP3 1O7PB 2P09A 3KE7A 4GHOA 3OWSA 3HI7A 3NBBA 4EYCA 3ECFA 5BXQA 1OHPA 1BRJA 4R9KA 1RGEA 4NREA 3JUPA 3MKIA 3WODG 1QVG2 3NQZA 3SLUA 2ZDJA 3OW22 5A0OB 3E99A 2IUJA 2WOHA 4L8OA 3T0UA 4HZ9B 1STDA 3DGYA 3LYGA 2FNQA 2RCDA 3K0ZA 3Q90A 3CCE3 2D42A 1D6YA 1OHSA 3GSPA 1T5YA 1JB2A 1OUNA 5AIHA 1RGLA 4RBNA 3UL6A 1RKYA 3MSOA 2GSPA 2YFJB 1BANA 3RGRA 2W56B 1MWTA 2F4YA 2W9PA 3DMCA 3MG1A 2ZHXB 2Z76A 4N6UA 2RSXA 1TTOA 4R4KA 5D81A 5LC7A 3D9RA 4N6TA 1EQKA 4WHAA 3NV0B 3QRDA 5M19A 3CD63 1A2PA 3DGLA 4QWTA 3EQQB 1Q814 5EQLA 1FGQA 2PZVA 4RNZA 5BIRA 3CC43 3FF2A 3DGNA 1LXEA 2HMKB 4O3VA 3WOFB 3CCJ3 2HMJB 1NJI4 5CXOA 1BNGA 1BIRA 1OH0A 1ZO2A 3SX1A 1G02A 3JUNA 4FR9A 3CCU3 1W2B2 2STDA 2I9WA 3HK4A 1BSBA 3N8BA 5AI1A 3RGAA 2XRXB 1W00A 3F14A 4HBRA 5AEWB 1LVNA 1US1A 2ML6A 1OF5B 3B8LA 2WGOA 3K63A 3JUQA 1ASKA 1M9GA 1RGHA 2IMJA 3HIGA 3S28A 5IERA 1FGRA 4MMYB 4J5KA 3SYUA 2GU3A 4X2HA 1GY7A 1I2FA 2OCTA 1UW1A 4EXRA 1D6UA 1DMNA 1Q40A 2HMNB 1RN7A 1NO3A 1WMNA 3SOYA 1YGWA 1RGKA 5IEPA 1A67A 4AKYA 1IT7A 1FUSA 1B2SA 4LGQA 3PS8A 1JNQA 5TGNA 3SVAA 3FKAA 4IT7A 3LTCA 1U5OA 2INXA 2QA43 7STDA 2IA7A 3ROBA 4LEHA 2XF3A 3T8UA 1VQN3 5JBSA 1N9JA 3D5GA 2WGQA 3X40A 3F8XA 1EEJA 4FCZA 3LT9A 1UI8A 1I3FA 2CIUA 2CFWA 2GBWB 3CNXA 1VQ43 2C4BA 1IVVA 3D5IA 1V58A 1W4NA 2GU1A 3DGOA 3KSPA 2KF4A 1JKGA 5IF6A 3X3ZA 1FUTA 1NU3A 3BNBA 2OOVC 1MGWA 3MG3A 3BNDA 2W6JH 2BHMA 1Y4KA 3I553 2GEXA 4RNYA 1BAOA 1KSIA 3K9MC 4EC6A 1GY6A 1GD4A 1SIIA 3LXUX 3FLJA 3G16A 5CK6A 1L5GB 2Q07A 1BRKA 4LYLB 1FYSA 4O8SA 2F5MA 3GAXA 1ROAA 3F9SA 1DYUA 3S29A 1N8QA 4BIRA 2IYJA 3IPTA 1N5PA 1W6CA 3KKGA 1YI23 1PFPA 2XR8B 1VQ83 2BIRA 1VQ93 4WWUC 3CPW2 2OTL3 1LNHA 4ILFA 1LOWA 4FCJA 1O7WB 2E2UA 1UCIA 2OQEA 2L4VA 1DVDA 3DZLA 2Z7AA 3PCSA 1OACA 2P38A 2IY2A 3CC73 4LZIA 1YGEA 2QEX3 1W02A 4R9LA 1W6YA 1BRHA 1LOYA 3OX9A 3Q1CA 1FW7A 3NBJA 1V74A 3MHEA 1MWRA 1AY7A 1DETA 1I3IA 3OV4A 1ZS7A 2Y74A 1GMPA 7RNTA 2YX9A 1RNBA 2W2CA 1HYFA 3NM7A 4WYKB 4ZM8A 2BT3A 4GSPA 4FMBA 3EN8A 3U97A 5CLKA 3V98A 2UGIA 4H3UA 1JB4A 4AEQA 1W5ZA 1BSCA 3ALAA 3LTBA 2CX0A 3PGBA 1IQXA 1TFOA 2XEPA 4AKZA 3EN1B 1TRPA 5BU4A 3B4PA 4N6V0 1EA2A 4HM7B 2HMMB 3U1WA 1UCJA 4HVNA 3FGYA 1YIT3 1FUWA 4XBTA 2K3DA 5AIFA 1IQYA 4FCMA 1B2ZA 1LNIA 3UB1A 2R4IA 3VF1A 4EV2A 5RNTA 3DXOA 3PYJA 4DKIA 1Q824 1AQZA 1Z1SA 3X41A 1LRAA 1VQQA 5STDA 3I0YA 3FG3A 1N9EA 1S5AA 1RGAA 1ULJB 2LQVA 3KN4A 3CCL3 4HM8B 2RFRA 4XDWA 1RCKA 5G1KA 3CME3 1VQO3 3M8CA 4MMXB 3EBYA 2GBXB 1JB5A 2JQ5A 2QGUA 2IUKA 3CNMA 3UJMA 1GD3A 1TJDA 1GMQA 3BLZA 3LTDA 3BNEA 2F98A 4CPKA 1YJN3 3A76A 1A2VA 5DREA 5IENA 1I2EA 3WA3A 1BOXA 1Q40B 3Q3FA 1RJOA 3X3YA 1JJ22 4WFOA 3KCHA 3FCSB 8CHOA 1SIHA 4FMAA 1DE3A 4JF8A 1Q9EA 1UUVB 1PU4A 1ZGXA 1VQK3 2J8XB 1E3RA 3GWRA 2CHCA 3NM2A 4HZBB 1GYBA 1M904 3F7SA 1IVXA 3JUMA 1DVCA 2HMLB
chains in the Genus database with same CATH topology
1GSPA 1BRSA 1BNEA 6RNTA 2C4BA 3D5IA 1BNJA 2KF4A 3A5EA 4HAAA 1FUTA 1RCLA 1MGWA 1RGGA 1JBSA 3AGNA 1BU4A 1B20A 1BSAA 4RNTA 1GMRA 1BAOA 1TRQA 2RBIA 1X1YA 2HOHA 1RDSA 2F56A 3WR2A 1YVSA 1YNVX 2ZA4A 1BRKA 1RLSA 1FYSA 1BSDA 2F5MA 2KAAA 2KF3A 2BU4A 1BNRA 1X1UA 3AGOA 1UCKA 4BIRA 1T2HA 1BRNL 1B27A 2BIRA 4GHOA 1LOWA 1UCIA 1JBRA 2KF6A 1BRJA 1RGEA 4J5GA 1BNSA 1RNTA 1BNIA 1SARA 1BRHA 5GSPA 1B21A 8RNTA 1LOYA 1FW7A 1CH0A 1R4YA 1PY3A 3DGYA 1I0XA 1AY7A 1DETA 1X1XA 1I3IA 3GSPA 4HOHA 1GMPA 1RGLA 7RNTA 1RNBA 1HYFA 1RN4A 2GSPA 3HOHA 1BANA 4GSPA 3WHOA 1RTUA 2F4YA 1BNFA 1RGFA 6GSPA 1TTOA 1X1WA 1RHLA 1BSCA 1B3SA 7GSPA 3BU4A 1GOYA 1A2PA 1MGRA 1TRPA 5BU4A 1RMSA 1RSNA 1RN1A 1BRGA 5BIRA 1UCJA 1GOVA 1IYYA 1BNGA 5HOHA 1BIRA 1B2XA 3AHSA 1G02A 3BIRA 3DH2A 1BSBA 1B2ZA 1LNIA 5RNTA 2AAEA 1AQZA 1GOUA 3D4AA 1LRAA 9RNTA 1PYLA 1I2GA 1C54A 1I8VA 3RNTA 1RGHA 3AHWA 1RGAA 4J5KA 3SYUA 1FZUA 1I2FA 1RCKA 2AADA 1RGCA 1UCLA 2KF5A 1YGWA 1RGKA 3URPA 1FUSA 1B2SA 1GMQA 2RNTA 2F5WA 1B2MA 4BU4A 1I2EA 1BOXA 1I70A 3Q3FA 3KCHA 1BGSA 1B2UA 1T2IA 1DE3A 1Q9EA 3D5GA 1I0VA 1ZGXA 2SARA 1BUJA 1BSEA 1HZ1A 1JBTA 1BVIA 1BRIA 1LOVA 1I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSP A;  1BRS A;  1BNE A;  6RNT A;  2C4B A;  3D5I A;  1BNJ A;  2KF4 A;  3A5E A;  4HAA A;  1FUT A;  1RCL A;  1MGW A;  1RGG A;  1JBS A;  3AGN A;  1BU4 A;  1B20 A;  1BSA A;  4RNT A;  1GMR A;  1BAO A;  1TRQ A;  2RBI A;  1X1Y A;  2HOH A;  1RDS A;  2F56 A;  3WR2 A;  1YVS A;  1YNV X;  2ZA4 A;  1BRK A;  1RLS A;  1FYS A;  1BSD A;  2F5M A;  2KAA A;  2KF3 A;  2BU4 A;  1BNR A;  1X1U A;  3AGO A;  1UCK A;  4BIR A;  1T2H A;  1BRN L;  1B27 A;  2BIR A;  4GHO A;  1LOW A;  1UCI A;  1JBR A;  2KF6 A;  1BRJ A;  1RGE A;  4J5G A;  1BNS A;  1RNT A;  1BNI A;  1SAR A;  1BRH A;  5GSP A;  1B21 A;  8RNT A;  1LOY A;  1FW7 A;  1CH0 A;  1R4Y A;  1PY3 A;  3DGY A;  1I0X A;  1AY7 A;  1DET A;  1X1X A;  1I3I A;  3GSP A;  4HOH A;  1GMP A;  1RGL A;  7RNT A;  1RNB A;  1HYF A;  1RN4 A;  2GSP A;  3HOH A;  1BAN A;  4GSP A;  3WHO A;  1RTU A;  2F4Y A;  1BNF A;  1RGF A;  6GSP A;  1TTO A;  1X1W A;  1RHL A;  1BSC A;  1B3S A;  7GSP A;  3BU4 A;  1GOY A;  1A2P A;  1MGR A;  1TRP A;  5BU4 A;  1RMS A;  1RSN A;  1RN1 A;  1BRG A;  5BIR A;  1UCJ A;  1GOV A;  1IYY A;  1BNG A;  5HOH A;  1BIR A;  1B2X A;  3AHS A;  1G02 A;  3BIR A;  3DH2 A;  1BSB A;  1B2Z A;  1LNI A;  5RNT A;  2AAE A;  1AQZ A;  1GOU A;  3D4A A;  1LRA A;  9RNT A;  1PYL A;  1I2G A;  1C54 A;  1I8V A;  3RNT A;  1RGH A;  3AHW A;  1RGA A;  4J5K A;  3SYU A;  1FZU A;  1I2F A;  1RCK A;  2AAD A;  1RGC A;  1UCL A;  2KF5 A;  1YGW A;  1RGK A;  3URP A;  1FUS A;  1B2S A;  1GMQ A;  2RNT A;  2F5W A;  1B2M A;  4BU4 A;  1I2E A;  1BOX A;  1I70 A;  3Q3F A;  3KCH A;  1BGS A;  1B2U A;  1T2I A;  1DE3 A;  1Q9E A;  3D5G A;  1I0V A;  1ZGX A;  2SAR A;  1BUJ A;  1BSE A;  1HZ1 A;  1JBT A;  1BVI A;  1BRI A;  1LOV A;  1I3F A; 
#chains in the Genus database with same CATH topology
 3G6E 3;  1G96 A;  1OGX A;  4KFF A;  1YVB I;  1KD1 4;  3V99 A;  2PNC A;  4MEI A;  1Q7Y 4;  3GZR A;  5HGR A;  1JBS A;  1QJG A;  4NHF A;  3AGN A;  3F40 A;  3EBT A;  1BSA A;  4RNT A;  3NHX A;  4HM4 B;  2RBI A;  1RRH A;  1JZO A;  1JKG B;  4H61 A;  5IG5 A;  2CFL A;  2XH9 A;  4BTW A;  1RDS A;  1UGH I;  2C10 A;  2K0M A;  2UUG C;  2CWT A;  3IJE B;  1YVS A;  1NNV A;  2BNG A;  1J2B A;  1RLS A;  3HZP A;  1K73 4;  4N6L A;  3D3L A;  2BU4 A;  2CW9 A;  3Q2P A;  2L1S A;  3UL5 A;  3ZFZ A;  1T2H A;  2CG0 A;  5IEO A;  2A15 A;  2OTJ 3;  3CU3 A;  3S5C A;  3PCR A;  3F7X A;  3B4O A;  2F86 B;  3TDG A;  4HM1 B;  4WP5 A;  4KVH A;  5IG3 A;  2WOF A;  1O7G B;  2D1W A;  3G71 3;  5IG4 A;  4J5G A;  3CCM 3;  3G0K A;  3CCV 3;  1DMM A;  4N6O B;  3ZG5 A;  1IK3 A;  1ZX2 A;  1YJ9 3;  1K9M 4;  3B7C A;  1K28 A;  4IIA A;  3EJV A;  4R80 A;  3ER7 A;  3N54 B;  8RNT A;  1U8C B;  1CH0 A;  1R4Y A;  1PY3 A;  2O9U X;  4J8T A;  1TFK A;  2OQE C;  4HOH A;  1KC8 4;  3O8Y A;  4TX4 A;  1RN4 A;  3WHO A;  5EEO A;  1RTU A;  4KT3 B;  3BB9 A;  5KP1 A;  1RGF A;  2H0H A;  3DUK A;  1K8A 4;  3J7Y d;  1LQM B;  1NDO B;  2CKF B;  5KP3 A;  2FGT A;  4O2H A;  1RHL A;  4JRF A;  1NB5 I;  5FGO A;  1GOY A;  3DM8 A;  2FXT A;  4I5Q A;  4N6M A;  4XB5 A;  1CYU A;  1RMS A;  1TUH A;  2BMQ B;  1RN1 A;  5CF1 A;  1UDI I;  3AMO A;  3HII A;  4HM5 B;  5BVB A;  1NB3 I;  3D79 A;  4GL6 A;  1IYY A;  2MF7 A;  1SJW A;  1W01 A;  1O7H B;  3NBR A;  4MJD A;  2OOV A;  1YJW 3;  5CF2 A;  4G1M B;  3BIR A;  3DH2 A;  3NX0 A;  2SBL A;  3RDE A;  3EHC A;  2KXG A;  2CFK A;  2UX0 A;  2C11 A;  5JPP A;  2XSO B;  4XM4 A;  3D4A A;  1QMA A;  4OK0 A;  1I2G A;  4XBY A;  9RNT A;  1I8V A;  2CFD A;  4K1U A;  1AVK A;  3AHW A;  5I97 A;  1BUQ A;  2W03 A;  3OWU A;  4LMI A;  1AV4 A;  5AEU B;  1SPU A;  3F8H A;  5FW5 A;  5D83 A;  1VQL 3;  2ML5 A;  5AII A;  3MYT A;  4X2O A;  3X3X A;  1VQ6 3;  1RGC A;  1UCL A;  1VQ7 3;  3K5T A;  3URP A;  4ORL A;  4BTY A;  4K1V A;  2H0I A;  2RNT A;  3H51 A;  4BU4 A;  1B2M A;  2CWV A;  3FG1 A;  1I70 A;  3GRD A;  3V92 A;  3QK9 A;  2O3O A;  3LTA A;  4J9A A;  1BGS A;  5D82 A;  3LT8 A;  1IV9 A;  1T2I A;  2H0G A;  2W04 A;  2BMO B;  2MC8 A;  2SAR A;  3CXC 2;  1BUJ A;  3NXJ A;  1JN5 A;  1BSE A;  1JZD A;  1BVI A;  5AYR B;  2E2V A;  1LOV A;  3EF8 A;  5JPU A;  1BNE A;  1DMQ A;  3JVC A;  2P0X A;  4BL3 A;  1STF I;  1IVU A;  3FG4 A;  1N8R 4;  1BNJ A;  1IT8 A;  3KSE D;  3LOY A;  1ROV A;  1RCL A;  4BL2 A;  1RGG A;  4EW5 A;  1JRQ A;  3T8N A;  4IPB A;  1YHQ 3;  1B20 A;  4I4K A;  1HKX A;  2Y73 A;  1WMP A;  4WYK A;  1QVF 2;  1G0T A;  1N5H A;  3JUO A;  4N6N B;  5ELJ A;  1FGM A;  3I56 3;  4CJN A;  1NWW A;  2F56 A;  3WR2 A;  3VSY A;  3EE1 A;  4OUQ A;  2ZA4 A;  5KP4 A;  3CC2 3;  1JV2 B;  1EUI C;  4GB5 A;  1CEW I;  2CFG A;  2KAA A;  2LYX A;  1BNR A;  3OWY A;  1VQ5 3;  3AGO A;  3VGN A;  1FGO A;  1B27 A;  1M1X B;  4CDL A;  3MPH A;  1QAK A;  2CG1 A;  2QIY A;  1IV7 A;  2JDI H;  5DRV A;  3IMA B;  1WQL B;  2BMR B;  1ISK A;  3LZA A;  3SOA A;  1LQG C;  1OGZ A;  4L7K A;  3S67 A;  3STD A;  1JBR A;  1V57 A;  2KF6 A;  4KZ1 A;  3LH4 A;  1BNS A;  1RNT A;  1OHO A;  1IQ8 A;  1BNI A;  1TP6 A;  1SAR A;  2CH9 A;  1Q86 4;  1CYV A;  3FZW A;  3KFQ C;  1B21 A;  5GSP A;  2XFT A;  1GY5 A;  2W56 A;  3S27 A;  1I0X A;  2W0Q A;  1X1X A;  3GZY B;  2XGN A;  2CK3 H;  3G4S 3;  3NV0 A;  1F8N A;  3H3H A;  1WMO A;  3HOH A;  2XSH B;  1BNF A;  2Z77 A;  6GSP A;  1HU9 A;  1QAF A;  1UUG B;  1MOL A;  1X1W A;  2ZL8 A;  2WO0 A;  4N3V A;  1B3S A;  7GSP A;  3BU4 A;  4K61 A;  3CPO A;  1A2K A;  3BNC A;  1MGR A;  1LOX A;  1MWS A;  2Z6B A;  4XBX A;  3KII A;  4XDV A;  1RSN A;  3DGM A;  3CMA 3;  1BRG A;  3GZB A;  3EX9 A;  4OVM A;  1TU5 A;  3PZW A;  1IU7 A;  4O02 B;  1GOV A;  2CC3 A;  4K90 B;  5IW9 A;  5M1A A;  5HOH A;  1VQM 3;  1OF5 A;  1B2X A;  4U13 A;  3AHS A;  2K54 A;  2GEY A;  4MMZ B;  4HYZ A;  2RGQ A;  2W9Q A;  4NPB A;  5LC6 A;  3AMO B;  3WOE B;  3ZG0 A;  1RRL A;  2E2T A;  5IG0 A;  3SXX A;  3WA2 X;  2AAE A;  4EBG A;  1GOU A;  1PYL A;  2BO9 B;  1C54 A;  3DY5 A;  1KWI A;  3RNT A;  1IVW A;  4KFD A;  1FA3 A;  3FSD A;  5AIG A;  1E3V A;  1FZU A;  2M7O A;  1W2Z A;  2B24 B;  4HM6 B;  5EVH A;  2AAD A;  2HMO B;  1Q7H A;  4FMC A;  3MWZ A;  3HX8 A;  1R4C A;  2KF5 A;  1D6Z A;  1MWU A;  1E97 A;  1CQS A;  1QAL A;  2B1X B;  2KCD A;  2CX1 A;  1EG9 B;  2F5W A;  3EB8 A;  4LSO A;  3FH1 A;  4RZM A;  5G2G A;  1Q42 A;  5ELU A;  1OPY A;  4BTX A;  3EC9 A;  1C7H A;  3N9H A;  5AYS C;  4L8P A;  1T3B A;  1W6G A;  2F99 A;  2R41 A;  1UUW B;  1S72 3;  3WDG B;  1B2U A;  1SQW A;  2KRT A;  4HJL B;  1I0V A;  1WNH A;  2V1L A;  1HZ1 A;  1TIJ A;  2GXF A;  1JBT A;  1BRI A;  3WMD A;  3NUV A;  1GSP A;  1BRS A;  1MNL A;  2XFS A;  4HM0 B;  6RNT A;  6STD A;  3CCQ 3;  3UNL A;  1EKM A;  3A5E A;  2YFL B;  4HAA A;  2P05 A;  1JN5 B;  1O7M B;  3L0R A;  4R1K A;  3FF0 A;  4HM2 B;  3CCR 3;  1KQS 2;  1BU4 A;  1IDP A;  4PEJ A;  1GMR A;  1W7C A;  1TRQ A;  1ULI B;  1A90 A;  3GZX B;  1X1Y A;  2HOH A;  3NQY A;  2XGL A;  1VZZ A;  4HKV B;  1UGI A;  1M1K 4;  1AR0 A;  3MG2 A;  3KZT A;  2YFI B;  3SED A;  1AVL A;  4CCV A;  2OWP A;  4EV5 A;  2CWU A;  3PXM A;  1YNV X;  3LML A;  4HM3 B;  3G8Z A;  3OXA A;  4Q53 A;  2P0M A;  1BSD A;  1FGT A;  1K41 A;  1YIJ 3;  2KF3 A;  4STD A;  5G1L A;  1X1U A;  4FMD A;  1UCK A;  1UI7 A;  3K7C A;  1BRN L;  1GS3 A;  1O7N B;  1WTH A;  4KFE A;  3X42 A;  5M18 A;  3CCS 3;  1OCV A;  1VQP 3;  1O7P B;  2P09 A;  3KE7 A;  4GHO A;  3OWS A;  3HI7 A;  3NBB A;  4EYC A;  3ECF A;  5BXQ A;  1OHP A;  1BRJ A;  4R9K A;  1RGE A;  4NRE A;  3JUP A;  3MKI A;  3WOD G;  1QVG 2;  3NQZ A;  3SLU A;  2ZDJ A;  3OW2 2;  5A0O B;  3E99 A;  2IUJ A;  2WOH A;  4L8O A;  3T0U A;  4HZ9 B;  1STD A;  3DGY A;  3LYG A;  2FNQ A;  2RCD A;  3K0Z A;  3Q90 A;  3CCE 3;  2D42 A;  1D6Y A;  1OHS A;  3GSP A;  1T5Y A;  1JB2 A;  1OUN A;  5AIH A;  1RGL A;  4RBN A;  3UL6 A;  1RKY A;  3MSO A;  2GSP A;  2YFJ B;  1BAN A;  3RGR A;  2W56 B;  1MWT A;  2F4Y A;  2W9P A;  3DMC A;  3MG1 A;  2ZHX B;  2Z76 A;  4N6U A;  2RSX A;  1TTO A;  4R4K A;  5D81 A;  5LC7 A;  3D9R A;  4N6T A;  1EQK A;  4WHA A;  3NV0 B;  3QRD A;  5M19 A;  3CD6 3;  1A2P A;  3DGL A;  4QWT A;  3EQQ B;  1Q81 4;  5EQL A;  1FGQ A;  2PZV A;  4RNZ A;  5BIR A;  3CC4 3;  3FF2 A;  3DGN A;  1LXE A;  2HMK B;  4O3V A;  3WOF B;  3CCJ 3;  2HMJ B;  1NJI 4;  5CXO A;  1BNG A;  1BIR A;  1OH0 A;  1ZO2 A;  3SX1 A;  1G02 A;  3JUN A;  4FR9 A;  3CCU 3;  1W2B 2;  2STD A;  2I9W A;  3HK4 A;  1BSB A;  3N8B A;  5AI1 A;  3RGA A;  2XRX B;  1W00 A;  3F14 A;  4HBR A;  5AEW B;  1LVN A;  1US1 A;  2ML6 A;  1OF5 B;  3B8L A;  2WGO A;  3K63 A;  3JUQ A;  1ASK A;  1M9G A;  1RGH A;  2IMJ A;  3HIG A;  3S28 A;  5IER A;  1FGR A;  4MMY B;  4J5K A;  3SYU A;  2GU3 A;  4X2H A;  1GY7 A;  1I2F A;  2OCT A;  1UW1 A;  4EXR A;  1D6U A;  1DMN A;  1Q40 A;  2HMN B;  1RN7 A;  1NO3 A;  1WMN A;  3SOY A;  1YGW A;  1RGK A;  5IEP A;  1A67 A;  4AKY A;  1IT7 A;  1FUS A;  1B2S A;  4LGQ A;  3PS8 A;  1JNQ A;  5TGN A;  3SVA A;  3FKA A;  4IT7 A;  3LTC A;  1U5O A;  2INX A;  2QA4 3;  7STD A;  2IA7 A;  3ROB A;  4LEH A;  2XF3 A;  3T8U A;  1VQN 3;  5JBS A;  1N9J A;  3D5G A;  2WGQ A;  3X40 A;  3F8X A;  1EEJ A;  4FCZ A;  3LT9 A;  1UI8 A;  1I3F A;  2CIU A;  2CFW A;  2GBW B;  3CNX A;  1VQ4 3;  2C4B A;  1IVV A;  3D5I A;  1V58 A;  1W4N A;  2GU1 A;  3DGO A;  3KSP A;  2KF4 A;  1JKG A;  5IF6 A;  3X3Z A;  1FUT A;  1NU3 A;  3BNB A;  2OOV C;  1MGW A;  3MG3 A;  3BND A;  2W6J H;  2BHM A;  1Y4K A;  3I55 3;  2GEX A;  4RNY A;  1BAO A;  1KSI A;  3K9M C;  4EC6 A;  1GY6 A;  1GD4 A;  1SII A;  3LXU X;  3FLJ A;  3G16 A;  5CK6 A;  1L5G B;  2Q07 A;  1BRK A;  4LYL B;  1FYS A;  4O8S A;  2F5M A;  3GAX A;  1ROA A;  3F9S A;  1DYU A;  3S29 A;  1N8Q A;  4BIR A;  2IYJ A;  3IPT A;  1N5P A;  1W6C A;  3KKG A;  1YI2 3;  1PFP A;  2XR8 B;  1VQ8 3;  2BIR A;  1VQ9 3;  4WWU C;  3CPW 2;  2OTL 3;  1LNH A;  4ILF A;  1LOW A;  4FCJ A;  1O7W B;  2E2U A;  1UCI A;  2OQE A;  2L4V A;  1DVD A;  3DZL A;  2Z7A A;  3PCS A;  1OAC A;  2P38 A;  2IY2 A;  3CC7 3;  4LZI A;  1YGE A;  2QEX 3;  1W02 A;  4R9L A;  1W6Y A;  1BRH A;  1LOY A;  3OX9 A;  3Q1C A;  1FW7 A;  3NBJ A;  1V74 A;  3MHE A;  1MWR A;  1AY7 A;  1DET A;  1I3I A;  3OV4 A;  1ZS7 A;  2Y74 A;  1GMP A;  7RNT A;  2YX9 A;  1RNB A;  2W2C A;  1HYF A;  3NM7 A;  4WYK B;  4ZM8 A;  2BT3 A;  4GSP A;  4FMB A;  3EN8 A;  3U97 A;  5CLK A;  3V98 A;  2UGI A;  4H3U A;  1JB4 A;  4AEQ A;  1W5Z A;  1BSC A;  3ALA A;  3LTB A;  2CX0 A;  3PGB A;  1IQX A;  1TFO A;  2XEP A;  4AKZ A;  3EN1 B;  1TRP A;  5BU4 A;  3B4P A;  4N6V 0;  1EA2 A;  4HM7 B;  2HMM B;  3U1W A;  1UCJ A;  4HVN A;  3FGY A;  1YIT 3;  1FUW A;  4XBT A;  2K3D A;  5AIF A;  1IQY A;  4FCM A;  1B2Z A;  1LNI A;  3UB1 A;  2R4I A;  3VF1 A;  4EV2 A;  5RNT A;  3DXO A;  3PYJ A;  4DKI A;  1Q82 4;  1AQZ A;  1Z1S A;  3X41 A;  1LRA A;  1VQQ A;  5STD A;  3I0Y A;  3FG3 A;  1N9E A;  1S5A A;  1RGA A;  1ULJ B;  2LQV A;  3KN4 A;  3CCL 3;  4HM8 B;  2RFR A;  4XDW A;  1RCK A;  5G1K A;  3CME 3;  1VQO 3;  3M8C A;  4MMX B;  3EBY A;  2GBX B;  1JB5 A;  2JQ5 A;  2QGU A;  2IUK A;  3CNM A;  3UJM A;  1GD3 A;  1TJD A;  1GMQ A;  3BLZ A;  3LTD A;  3BNE A;  2F98 A;  4CPK A;  1YJN 3;  3A76 A;  1A2V A;  5DRE A;  5IEN A;  1I2E A;  3WA3 A;  1BOX A;  1Q40 B;  3Q3F A;  1RJO A;  3X3Y A;  1JJ2 2;  4WFO A;  3KCH A;  3FCS B;  8CHO A;  1SIH A;  4FMA A;  1DE3 A;  4JF8 A;  1Q9E A;  1UUV B;  1PU4 A;  1ZGX A;  1VQK 3;  2J8X B;  1E3R A;  3GWR A;  2CHC A;  3NM2 A;  4HZB B;  1GYB A;  1M90 4;  3F7S A;  1IVX A;  3JUM A;  1DVC A;  2HML B; 
#chains in the Genus database with same CATH homology
 1GSP A;  1BRS A;  1BNE A;  6RNT A;  2C4B A;  3D5I A;  1BNJ A;  2KF4 A;  3A5E A;  4HAA A;  1FUT A;  1RCL A;  1MGW A;  1RGG A;  1JBS A;  3AGN A;  1BU4 A;  1B20 A;  1BSA A;  4RNT A;  1GMR A;  1BAO A;  1TRQ A;  2RBI A;  1X1Y A;  2HOH A;  1RDS A;  2F56 A;  3WR2 A;  1YVS A;  1YNV X;  2ZA4 A;  1BRK A;  1RLS A;  1FYS A;  1BSD A;  2F5M A;  2KAA A;  2KF3 A;  2BU4 A;  1BNR A;  1X1U A;  3AGO A;  1UCK A;  4BIR A;  1T2H A;  1BRN L;  1B27 A;  2BIR A;  4GHO A;  1LOW A;  1UCI A;  1JBR A;  2KF6 A;  1BRJ A;  1RGE A;  4J5G A;  1BNS A;  1RNT A;  1BNI A;  1SAR A;  1BRH A;  5GSP A;  1B21 A;  8RNT A;  1LOY A;  1FW7 A;  1CH0 A;  1R4Y A;  1PY3 A;  3DGY A;  1I0X A;  1AY7 A;  1DET A;  1X1X A;  1I3I A;  3GSP A;  4HOH A;  1GMP A;  1RGL A;  7RNT A;  1RNB A;  1HYF A;  1RN4 A;  2GSP A;  3HOH A;  1BAN A;  4GSP A;  3WHO A;  1RTU A;  2F4Y A;  1BNF A;  1RGF A;  6GSP A;  1TTO A;  1X1W A;  1RHL A;  1BSC A;  1B3S A;  7GSP A;  3BU4 A;  1GOY A;  1A2P A;  1MGR A;  1TRP A;  5BU4 A;  1RMS A;  1RSN A;  1RN1 A;  1BRG A;  5BIR A;  1UCJ A;  1GOV A;  1IYY A;  1BNG A;  5HOH A;  1BIR A;  1B2X A;  3AHS A;  1G02 A;  3BIR A;  3DH2 A;  1BSB A;  1B2Z A;  1LNI A;  5RNT A;  2AAE A;  1AQZ A;  1GOU A;  3D4A A;  1LRA A;  9RNT A;  1PYL A;  1I2G A;  1C54 A;  1I8V A;  3RNT A;  1RGH A;  3AHW A;  1RGA A;  4J5K A;  3SYU A;  1FZU A;  1I2F A;  1RCK A;  2AAD A;  1RGC A;  1UCL A;  2KF5 A;  1YGW A;  1RGK A;  3URP A;  1FUS A;  1B2S A;  1GMQ A;  2RNT A;  2F5W A;  1B2M A;  4BU4 A;  1I2E A;  1BOX A;  1I70 A;  3Q3F A;  3KCH A;  1BGS A;  1B2U A;  1T2I A;  1DE3 A;  1Q9E A;  3D5G A;  1I0V A;  1ZGX A;  2SAR A;  1BUJ A;  1BSE A;  1HZ1 A;  1JBT A;  1BVI A;  1BRI A;  1LOV A;  1I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...