1BRHA

Barnase mutant with leu 14 replaced by ala
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYAQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brhA00
1BRJA 3WR2A 1I2GA 2BIRA 1BSDA 1LOVA 3AGNA 4BIRA 1B2SA 1LNIA 1GOVA 2KF4A 1RTUA 1Q9EA 1I8VA 2KF6A 1GOYA 1MGRA 1RNTA 1BSEA 4HOHA 9RNTA 1C54A 4RNTA 2BU4A 1RGFA 2AADA 1BGSA 8RNTA 1BRIA 1BRNL 1I2FA 2KAAA 3GSPA 1A2PA 2RNTA 1BANA 1HYFA 2F4YA 1B2UA 1FUSA 2ZA4A 1BRSA 3SYUA 1B20A 1BNEA 1GOUA 1YVSA 1GMQA 2SARA 1FW7A 5BIRA 1BSAA 1BIRA 1I3IA 2GSPA 1RCKA 1I0XA 1I2EA 1B27A 3URPA 1BSCA 3BIRA 3DGYA 1RGKA 1CH0A 3AGOA 1UCLA 1GMRA 2KF5A 1RN1A 1RGGA 1B2ZA 1ZGXA 1B3SA 1BRKA 1X1YA 2AAEA 2KF3A 1YNVX 1LOYA 1RLSA 1X1WA 2HOHA 3WHOA 3D5GA 2F5WA 1B2MA 1SARA 3KCHA 5GSPA 1DETA 1JBSA 1RMSA 1BRHA 1X1XA 1FYSA 7RNTA 1B2XA 1LOWA 1I0VA 4GHOA 1BNIA 1AQZA 1X1UA 1RGLA 1RDSA 1RSNA 3RNTA 4BU4A 1GMPA 1TTOA 3AHSA 5RNTA 4J5KA 1RNBA 1JBRA 1GSPA 1BSBA 3AHWA 1BU4A 6GSPA 1FUTA 3D4AA 1IYYA 1YGWA 1RGHA 1LRAA 1BAOA 1BOXA 1RGAA 2F56A 6RNTA 5HOHA 5BU4A 1BNRA 3BU4A 1HZ1A 1BNSA 1BVIA 4GSPA 4HAAA 1RHLA 4J5GA 1I3FA 1RGEA 1MGWA 3HOHA 3D5IA 1RGCA 1BUJA 2RBIA 1T2HA 1PY3A 1BNGA 1UCKA 1UCIA 1UCJA 2C4BA 1BNFA 1TRQA 1AY7A 1T2IA 1RCLA 1RN4A 3A5EA 3DH2A 1BNJA 1G02A 7GSPA 1PYLA 1TRPA 1B21A 1DE3A 1I70A 1BRGA 1FZUA 1R4YA 2F5MA 1JBTA 3Q3FA
chains in the Genus database with same CATH superfamily
1W00A 1DVDA 2W9QA 3GWRA 2OTL3 1OH0A 5IERA 4BIRA 1B2SA 3GZXB 2MC8A 3OV4A 3CMA3 2ZHXB 1RTUA 3EC9A 1WNHA 4R9KA 5CXOA 1DMQA 1N9JA 2IUKA 5IG5A 1S723 1Q7HA 4GB5A 1N5HA 1RNTA 1BSEA 1VQQA 1W7CA 3LZAA 2GBXB 3JUOA 5AIHA 5EVHA 3NHXA 3I553 4RNYA 3CME3 5DREA 4X2OA 1NU3A 3DGOA 1VQO3 1M1K4 2P0MA 1I2FA 2MF7A 2XGNA 3PCSA 3V98A 5FW5A 2QA43 1YIT3 2E2UA 3Q90A 1LQGC 1B2UA 2IMJA 2ML5A 3BLZA 4N6LA 4R80A 4RNZA 5D83A 3X42A 3SYUA 3CD63 1KC84 3N54B 3CC43 4XBYA 3CPW2 3F8XA 2W03A 1FW7A 1TIJA 1VQ63 3LT8A 3D3LA 3L0RA 1GS3A 2GSPA 2R4IA 2UUGC 2XR8B 3I0YA 4MEIA 2PZVA 1FGOA 1B27A 3URPA 2OWPA 2QGUA 1RGKA 1EA2A 5IF6A 3S27A 3AGOA 2XGLA 1NWWA 2K3DA 4L7KA 1RN1A 3Q2PA 3B8LA 1B3SA 3EB8A 3EF8A 1NO3A 1JV2B 5G1KA 4STDA 2AAEA 3STDA 1LVNA 1Q40A 2KF3A 1T5YA 2CG0A 3D9RA 3LXUX 1YJW3 2HOHA 1UUGB 2F5WA 4HJLB 3F40A 3LTAA 3KCHA 1M1XB 3RGRA 4ILFA 1DETA 1RMSA 1WMNA 3MSOA 5AYRB 1FYSA 7RNTA 2K54A 3ZFZA 2V1LA 1YIJ3 1W4NA 3LOYA 1AQZA 3S5CA 1UI8A 2W56B 1RGLA 2XSHB 3SLUA 1W5ZA 1ZX2A 1GY6A 5KP1A 5BVBA 5M18A 6STDA 1G0TA 4BL2A 4BU4A 3T8UA 3CCV3 1QALA 1D6ZA 1UW1A 3WA3A 4FCZA 4HM5B 3SXXA 2I9WA 5LC6A 4N6NB 6GSPA 1FUTA 3UL6A 3KKGA 3HK4A 2YX9A 2P38A 2F86B 3D4AA 3E99A 4HZBB 4N6MA 4NREA 1IYYA 1RGHA 3EJVA 2B1XB 1LRAA 4K90B 1BOXA 1IK3A 5HOHA 5BU4A 1OCVA 4KFFA 2P05A 1WMPA 2D1WA 3H51A 1U8CB 2BMRB 4GSPA 1UI7A 2HMNB 3WOEB 1ASKA 3CCS3 4J5GA 4EV2A 4L8OA 3DGMA 3X41A 1I3FA 2Z6BA 3BNBA 3HOHA 2W9PA 1MNLA 4FMCA 2RGQA 1Q814 1BNGA 2W6JH 2UX0A 2GU3A 1GY5A 2LYXA 2C4BA 1BNFA 2CH9A 2CWTA 3CNXA 3N8BA 4HM1B 3JUNA 2P09A 3A5EA 1RCLA 1K9M4 4N3VA 1R4CA 1F8NA 1DE3A 1VZZA 1I70A 5CF1A 1R4YA 3K0ZA 3PGBA 3K5TA 4OK0A 5AYSC 2OQEC 5ELJA 3WR2A 1AV4A 2GBWB 1HU9A 1LOVA 1Q7Y4 3IJEB 1LNIA 1GOVA 4HBRA 1IVXA 2KF4A 2M7OA 5A0OB 1Q9EA 1IQYA 2OTJ3 3EN1B 1A67A 1ROVA 5IEPA 3Q1CA 5HGRA 4XBTA 1KWIA 2QEX3 3DGLA 3X3ZA 3LTBA 1IVUA 8CHOA 1N8QA 1VQ73 1C54A 2HMKB 2Z7AA 3F9SA 3G6E3 3PYJA 1JZDA 3N9HA 3UJMA 3BB9A 3CC23 1VQN3 1V58A 2KAAA 1A2PA 3B7CA 1YHQ3 4HM7B 1BANA 1HYFA 2F4YA 1MOLA 2R41A 1OUNA 1QAKA 2ZA4A 1BRSA 3K9MC 1IDPA 3FSDA 2Z77A 4J8TA 5JPUA 1YVSA 2STDA 3GAXA 2SARA 4FCJA 4KVHA 4MMXB 3SEDA 1ULIB 1FA3A 3J7Yd 5BIRA 1E3VA 3DXOA 3LT9A 1TU5A 1IQXA 4U13A 1BIRA 1I3IA 4WHAA 1VQP3 1UUVB 1I0XA 2Z76A 3LYGA 2CK3H 1KSIA 2W04A 5ELUA 2Y73A 4K1VA 4NHFA 4H3UA 1GMRA 1K41A 1G96A 3WOFB 2KF5A 1IT8A 1GY7A 3SX1A 3BNEA 3DUKA 2E2VA 1JJ22 3CCL3 3OXAA 1X1YA 4KT3B 2QIYA 2XH9A 4MMZB 3EQQB 4QWTA 3S29A 2OOVC 2OQEA 2GXFA 1SJWA 1IV9A 1AR0A 2XEPA 4HM0B 4LEHA 1VQ43 2CW9A 2P0XA 1B2MA 1O7GB 5AEWB 1VQ93 2BT3A 3NBRA 5GSPA 1GYBA 2SBLA 1JN5A 1OF5B 3NV0B 5KP4A 3IPTA 4CPKA 1W01A 1Z1SA 1A2VA 3FCSB 3CCE3 1BRHA 2CX0A 1X1XA 4R9LA 4WP5A 1FUWA 1LOWA 2XFTA 5D81A 1I0VA 4JF8A 1C7HA 2IYJA 2CFDA 3EHCA 5CLKA 3OW22 1X1UA 5AIIA 3ECFA 1VQ83 3HZPA 2WGOA 1NJI4 2XRXB 1CYVA 2YFLB 3MWZA 1DMNA 2OOVA 1N8R4 1E97A 3CCR3 3CCQ3 1JB4A 4EBGA 4CJNA 2FXTA 5RNTA 2XSOB 1US1A 3F14A 4J5KA 3WDGB 3NBBA 4KFDA 2KRTA 2E2TA 4Q53A 2Q07A 1BSBA 1O7WB 4BTWA 1UUWB 2XFSA 3X3YA 3PZWA 3SVAA 4X2HA 4O02B 1BAOA 1RGAA 3JUQA 3G713 2F56A 6RNTA 4FMDA 1Q864 1EQKA 2GEYA 3TDGA 1FGQA 3RDEA 1BVIA 4WWUC 3EN8A 1RKYA 1IT7A 4KFEA 2ZL8A 2CFWA 3M8CA 1BUJA 1QMAA 2CHCA 1PY3A 5IEOA 1JB2A 3VF1A 1Q824 3O8YA 1IV7A 1TRQA 3DGNA 4N6V0 3K63A 1O7NB 2CFKA 3LH4A 2BO9B 2ZDJA 4LSOA 5AEUB 1RN4A 1JN5B 1OF5A 1BNJA 3WA2X 1IVWA 3H3HA 1OGXA 4WYKB 2BMQB 2LQVA 7STDA 1Q40B 2YFIB 1JBTA 1TUHA 1ULJB 1A90A 4I5QA 1BSDA 2CFLA 1GD4A 1OHOA 2IA7A 4IIAA 3OWUA 4AKZA 3AGNA 3NBJA 4LYLB 3U97A 2FGTA 1IU7A 3NM7A 1K8A4 2RFRA 3FZWA 2INXA 3FG3A 5IG0A 4XDWA 5EQLA 3KSED 1MGRA 2IUJA 1WQLB 5LC7A 9RNTA 4HOHA 1O7HB 3S67A 2L4VA 2CWUA 1VQM3 1TP6A 1RGFA 2BU4A 3EBTA 1J2BA 1JKGA 1W02A 3GZRA 1BRIA 4HKVB 1BRNL 4HM8B 5EEOA 1QVF2 1BUQA 2KXGA 3KSPA 3LTCA 1FUSA 2HMJB 4PEJA 2FNQA 4EC6A 2ML6A 3CCM3 1GOUA 1OGZA 3FGYA 4LZIA 1GMQA 1M904 2JQ5A 1MWSA 1TJDA 2F99A 4HM2B 3FKAA 1CEWI 3NXJA 1FGRA 1STFI 2GEXA 3NV0A 1RCKA 4RZMA 4XBXA 3DGYA 3T8NA 3UB1A 1W2B2 4HZ9B 1SIIA 1ROAA 3KFQC 1UCLA 2CKFB 3OWYA 1RGGA 1ISKA 1OACA 1ZGXA 1U5OA 1W2ZA 3NQYA 5IW9A 1NB5I 5AIGA 4WYKA 2RSXA 1YJN3 1DVCA 4FMBA 1UGIA 5I97A 2F98A 1YNVX 1LOYA 3BNCA 3PS8A 3CC73 1X1WA 1LXEA 4L8PA 3WHOA 4HM4B 2O9UX 3D5GA 1WMOA 3D79A 3RGAA 5AIFA 5TGNA 1EUIC 2C10A 4XB5A 1CQSA 1JBSA 4TX4A 2CX1A 4XM4A 3ZG5A 2Y74A 2JDIH 2W2CA 4R1KA 5IG3A 1KQS2 2B24B 3UL5A 1RDSA 1RSNA 1IVVA 1LQMB 1GMPA 1L5GB 1TTOA 1MWUA 5STDA 3FLJA 3AMOA 1JBRA 4AKYA 1GSPA 2OCTA 3AHWA 3FF0A 1BU4A 3B4OA 1PFPA 1DYUA 3CCJ3 3OX9A 1LNHA 1GD3A 5CK6A 3JUPA 4KZ1A 4BTXA 1ZO2A 3BU4A 4EV5A 1OHPA 3DMCA 3JUMA 4HAAA 3F7XA 2HMOB 4OUQA 3CXC2 1NNVA 3WMDA 3EBYA 2UGIA 1RGEA 1D6UA 3G8ZA 5JPPA 4HVNA 2O3OA 1DMMA 3MG2A 3T0UA 3CCU3 2H0IA 3JVCA 3NM2A 1AY7A 1T2IA 4CCVA 7GSPA 3DH2A 3MHEA 1G02A 1TRPA 1Y4KA 3FF2A 3NX0A 2BMOB 1FGTA 2C11A 1QJGA 1UGHI 3FG1A 4N6TA 3X40A 1BRGA 1NDOB 1WTHA 1RRLA 2F5MA 3DZLA 3Q3FA 1BRJA 4MMYB 1I2GA 1JNQA 2BIRA 2H0HA 4IT7A 2KCDA 4O2HA 1RRHA 4DKIA 3NQZA 1ZS7A 1I8VA 2KF6A 2YFJB 1TFOA 3KE7A 3MG3A 3U1WA 1GOYA 3HIIA 1T3BA 4N6OB 3VSYA 1YVBI 4O8SA 3SOAA 1O7MB 5D82A 5M1AA 5DRVA 4RNTA 3GRDA 5G2GA 1QAFA 2WOHA 4LMIA 4FCMA 2AADA 1BGSA 1N9EA 8RNTA 3GSPA 4OVMA 2CFGA 2RNTA 4EW5A 3FG4A 4LGQA 1AVKA 1EEJA 5AI1A 1QVG2 3S28A 1LOXA 4H61A 4EYCA 1YJ93 1B20A 1BNEA 1A2KA 4N6UA 2J8XB 1UDII 1JB5A 1NB3I 1JZOA 2BHMA 1BSAA 3HX8A 4EXRA 1MWTA 3DM8A 3ZG0A 1I2EA 3LMLA 5BXQA 1BSCA 3ROBA 3BIRA 3V99A 5JBSA 2WO0A 3SOYA 4RBNA 1CH0A 3KZTA 1KD14 3A76A 4BL3A 2CC3A 1S5AA 3QK9A 3CPOA 1B2ZA 1SQWA 2K0MA 3HIGA 1V74A 3HI7A 4FMAA 2W56A 3GZBA 1BRKA 1EG9B 3G4S3 3CNMA 3MG1A 3EX9A 3ALAA 1RLSA 3QRDA 2WOFA 3DY5A 3FH1A 4HYZA 5IG4A 1SARA 4K1UA 1D6YA 3F7SA 1W6CA 3V92A 3KN4A 2A15A 1MWRA 4HM3B 3I563 1AVLA 4I4KA 1B2XA 4K61A 2HMLB 3NUVA 4AEQA 4GHOA 2H0GA 1RJOA 3BNDA 4ORLA 1BNIA 1SPUA 2L1SA 1O7PB 3EE1A 3MKIA 5M19A 2RCDA 4GL6A 5G1LA 2GU1A 3IMAB 1JRQA 1W6YA 5KP3A 2CG1A 2CIUA 3KIIA 3RNTA 1M9GA 3K7CA 4HM6B 3X3XA 1V57A 3AHSA 3F8HA 1SIHA 3MYTA 2IY2A 3G0KA 4R4KA 3PXMA 1VQ53 1RNBA 4XDVA 1FGMA 2XF3A 3ER7A 4O3VA 4J9AA 2WGQA 4NPBA 3LTDA 1HKXA 1RN7A 3MPHA 3PCRA 1N5PA 4WFOA 1TFKA 3WODG 1JKGB 5CF2A 1YGWA 3GZYB 2D42A 1OHSA 1VQK3 2PNCA 1BNRA 3UNLA 1EKMA 1IQ8A 1HZ1A 1BNSA 4IPBA 5FGOA 4JRFA 1STDA 5IENA 1RHLA 2HMMB 1YI23 1CYUA 1MGWA 1E3RA 4FR9A 3B4PA 1K734 1VQL3 3AMOB 3D5IA 1RGCA 2BNGA 2CWVA 1PU4A 2RBIA 4BTYA 1T2HA 1W6GA 1UCKA 1YGEA 1UCIA 4ZM8A 1UCJA 1Q42A 3OWSA 1OPYA 4MJDA 4CDLA 1K28A 3CU3A 2W0QA 1PYLA 4G1MB 3G16A 1B21A 3VGNA 1FZUA
chains in the Genus database with same CATH topology
1BRJA 3WR2A 1I2GA 2BIRA 1BSDA 1LOVA 3AGNA 4BIRA 1B2SA 1LNIA 1GOVA 2KF4A 1RTUA 1Q9EA 1I8VA 2KF6A 1GOYA 1MGRA 1RNTA 1BSEA 4HOHA 9RNTA 1C54A 4RNTA 2BU4A 1RGFA 2AADA 1BGSA 8RNTA 1BRIA 1BRNL 1I2FA 2KAAA 3GSPA 1A2PA 2RNTA 1BANA 1HYFA 2F4YA 1B2UA 1FUSA 2ZA4A 1BRSA 3SYUA 1B20A 1BNEA 1GOUA 1YVSA 1GMQA 2SARA 1FW7A 5BIRA 1BSAA 1BIRA 1I3IA 2GSPA 1RCKA 1I0XA 1I2EA 1B27A 3URPA 1BSCA 3BIRA 3DGYA 1RGKA 1CH0A 3AGOA 1UCLA 1GMRA 2KF5A 1RN1A 1RGGA 1B2ZA 1ZGXA 1B3SA 1BRKA 1X1YA 2AAEA 2KF3A 1YNVX 1LOYA 1RLSA 1X1WA 2HOHA 3WHOA 3D5GA 2F5WA 1B2MA 1SARA 3KCHA 5GSPA 1DETA 1JBSA 1RMSA 1BRHA 1X1XA 1FYSA 7RNTA 1B2XA 1LOWA 1I0VA 4GHOA 1BNIA 1AQZA 1X1UA 1RGLA 1RDSA 1RSNA 3RNTA 4BU4A 1GMPA 1TTOA 3AHSA 5RNTA 4J5KA 1RNBA 1JBRA 1GSPA 1BSBA 3AHWA 1BU4A 6GSPA 1FUTA 3D4AA 1IYYA 1YGWA 1RGHA 1LRAA 1BAOA 1BOXA 1RGAA 2F56A 6RNTA 5HOHA 5BU4A 1BNRA 3BU4A 1HZ1A 1BNSA 1BVIA 4GSPA 4HAAA 1RHLA 4J5GA 1I3FA 1RGEA 1MGWA 3HOHA 3D5IA 1RGCA 1BUJA 2RBIA 1T2HA 1PY3A 1BNGA 1UCKA 1UCIA 1UCJA 2C4BA 1BNFA 1TRQA 1AY7A 1T2IA 1RCLA 1RN4A 3A5EA 3DH2A 1BNJA 1G02A 7GSPA 1PYLA 1TRPA 1B21A 1DE3A 1I70A 1BRGA 1FZUA 1R4YA 2F5MA 1JBTA 3Q3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRJ A;  3WR2 A;  1I2G A;  2BIR A;  1BSD A;  1LOV A;  3AGN A;  4BIR A;  1B2S A;  1LNI A;  1GOV A;  2KF4 A;  1RTU A;  1Q9E A;  1I8V A;  2KF6 A;  1GOY A;  1MGR A;  1RNT A;  1BSE A;  4HOH A;  9RNT A;  1C54 A;  4RNT A;  2BU4 A;  1RGF A;  2AAD A;  1BGS A;  8RNT A;  1BRI A;  1BRN L;  1I2F A;  2KAA A;  3GSP A;  1A2P A;  2RNT A;  1BAN A;  1HYF A;  2F4Y A;  1B2U A;  1FUS A;  2ZA4 A;  1BRS A;  3SYU A;  1B20 A;  1BNE A;  1GOU A;  1YVS A;  1GMQ A;  2SAR A;  1FW7 A;  5BIR A;  1BSA A;  1BIR A;  1I3I A;  2GSP A;  1RCK A;  1I0X A;  1I2E A;  1B27 A;  3URP A;  1BSC A;  3BIR A;  3DGY A;  1RGK A;  1CH0 A;  3AGO A;  1UCL A;  1GMR A;  2KF5 A;  1RN1 A;  1RGG A;  1B2Z A;  1ZGX A;  1B3S A;  1BRK A;  1X1Y A;  2AAE A;  2KF3 A;  1YNV X;  1LOY A;  1RLS A;  1X1W A;  2HOH A;  3WHO A;  3D5G A;  2F5W A;  1B2M A;  1SAR A;  3KCH A;  5GSP A;  1DET A;  1JBS A;  1RMS A;  1BRH A;  1X1X A;  1FYS A;  7RNT A;  1B2X A;  1LOW A;  1I0V A;  4GHO A;  1BNI A;  1AQZ A;  1X1U A;  1RGL A;  1RDS A;  1RSN A;  3RNT A;  4BU4 A;  1GMP A;  1TTO A;  3AHS A;  5RNT A;  4J5K A;  1RNB A;  1JBR A;  1GSP A;  1BSB A;  3AHW A;  1BU4 A;  6GSP A;  1FUT A;  3D4A A;  1IYY A;  1YGW A;  1RGH A;  1LRA A;  1BAO A;  1BOX A;  1RGA A;  2F56 A;  6RNT A;  5HOH A;  5BU4 A;  1BNR A;  3BU4 A;  1HZ1 A;  1BNS A;  1BVI A;  4GSP A;  4HAA A;  1RHL A;  4J5G A;  1I3F A;  1RGE A;  1MGW A;  3HOH A;  3D5I A;  1RGC A;  1BUJ A;  2RBI A;  1T2H A;  1PY3 A;  1BNG A;  1UCK A;  1UCI A;  1UCJ A;  2C4B A;  1BNF A;  1TRQ A;  1AY7 A;  1T2I A;  1RCL A;  1RN4 A;  3A5E A;  3DH2 A;  1BNJ A;  1G02 A;  7GSP A;  1PYL A;  1TRP A;  1B21 A;  1DE3 A;  1I70 A;  1BRG A;  1FZU A;  1R4Y A;  2F5M A;  1JBT A;  3Q3F A; 
#chains in the Genus database with same CATH topology
 1W00 A;  1DVD A;  2W9Q A;  3GWR A;  2OTL 3;  1OH0 A;  5IER A;  4BIR A;  1B2S A;  3GZX B;  2MC8 A;  3OV4 A;  3CMA 3;  2ZHX B;  1RTU A;  3EC9 A;  1WNH A;  4R9K A;  5CXO A;  1DMQ A;  1N9J A;  2IUK A;  5IG5 A;  1S72 3;  1Q7H A;  4GB5 A;  1N5H A;  1RNT A;  1BSE A;  1VQQ A;  1W7C A;  3LZA A;  2GBX B;  3JUO A;  5AIH A;  5EVH A;  3NHX A;  3I55 3;  4RNY A;  3CME 3;  5DRE A;  4X2O A;  1NU3 A;  3DGO A;  1VQO 3;  1M1K 4;  2P0M A;  1I2F A;  2MF7 A;  2XGN A;  3PCS A;  3V98 A;  5FW5 A;  2QA4 3;  1YIT 3;  2E2U A;  3Q90 A;  1LQG C;  1B2U A;  2IMJ A;  2ML5 A;  3BLZ A;  4N6L A;  4R80 A;  4RNZ A;  5D83 A;  3X42 A;  3SYU A;  3CD6 3;  1KC8 4;  3N54 B;  3CC4 3;  4XBY A;  3CPW 2;  3F8X A;  2W03 A;  1FW7 A;  1TIJ A;  1VQ6 3;  3LT8 A;  3D3L A;  3L0R A;  1GS3 A;  2GSP A;  2R4I A;  2UUG C;  2XR8 B;  3I0Y A;  4MEI A;  2PZV A;  1FGO A;  1B27 A;  3URP A;  2OWP A;  2QGU A;  1RGK A;  1EA2 A;  5IF6 A;  3S27 A;  3AGO A;  2XGL A;  1NWW A;  2K3D A;  4L7K A;  1RN1 A;  3Q2P A;  3B8L A;  1B3S A;  3EB8 A;  3EF8 A;  1NO3 A;  1JV2 B;  5G1K A;  4STD A;  2AAE A;  3STD A;  1LVN A;  1Q40 A;  2KF3 A;  1T5Y A;  2CG0 A;  3D9R A;  3LXU X;  1YJW 3;  2HOH A;  1UUG B;  2F5W A;  4HJL B;  3F40 A;  3LTA A;  3KCH A;  1M1X B;  3RGR A;  4ILF A;  1DET A;  1RMS A;  1WMN A;  3MSO A;  5AYR B;  1FYS A;  7RNT A;  2K54 A;  3ZFZ A;  2V1L A;  1YIJ 3;  1W4N A;  3LOY A;  1AQZ A;  3S5C A;  1UI8 A;  2W56 B;  1RGL A;  2XSH B;  3SLU A;  1W5Z A;  1ZX2 A;  1GY6 A;  5KP1 A;  5BVB A;  5M18 A;  6STD A;  1G0T A;  4BL2 A;  4BU4 A;  3T8U A;  3CCV 3;  1QAL A;  1D6Z A;  1UW1 A;  3WA3 A;  4FCZ A;  4HM5 B;  3SXX A;  2I9W A;  5LC6 A;  4N6N B;  6GSP A;  1FUT A;  3UL6 A;  3KKG A;  3HK4 A;  2YX9 A;  2P38 A;  2F86 B;  3D4A A;  3E99 A;  4HZB B;  4N6M A;  4NRE A;  1IYY A;  1RGH A;  3EJV A;  2B1X B;  1LRA A;  4K90 B;  1BOX A;  1IK3 A;  5HOH A;  5BU4 A;  1OCV A;  4KFF A;  2P05 A;  1WMP A;  2D1W A;  3H51 A;  1U8C B;  2BMR B;  4GSP A;  1UI7 A;  2HMN B;  3WOE B;  1ASK A;  3CCS 3;  4J5G A;  4EV2 A;  4L8O A;  3DGM A;  3X41 A;  1I3F A;  2Z6B A;  3BNB A;  3HOH A;  2W9P A;  1MNL A;  4FMC A;  2RGQ A;  1Q81 4;  1BNG A;  2W6J H;  2UX0 A;  2GU3 A;  1GY5 A;  2LYX A;  2C4B A;  1BNF A;  2CH9 A;  2CWT A;  3CNX A;  3N8B A;  4HM1 B;  3JUN A;  2P09 A;  3A5E A;  1RCL A;  1K9M 4;  4N3V A;  1R4C A;  1F8N A;  1DE3 A;  1VZZ A;  1I70 A;  5CF1 A;  1R4Y A;  3K0Z A;  3PGB A;  3K5T A;  4OK0 A;  5AYS C;  2OQE C;  5ELJ A;  3WR2 A;  1AV4 A;  2GBW B;  1HU9 A;  1LOV A;  1Q7Y 4;  3IJE B;  1LNI A;  1GOV A;  4HBR A;  1IVX A;  2KF4 A;  2M7O A;  5A0O B;  1Q9E A;  1IQY A;  2OTJ 3;  3EN1 B;  1A67 A;  1ROV A;  5IEP A;  3Q1C A;  5HGR A;  4XBT A;  1KWI A;  2QEX 3;  3DGL A;  3X3Z A;  3LTB A;  1IVU A;  8CHO A;  1N8Q A;  1VQ7 3;  1C54 A;  2HMK B;  2Z7A A;  3F9S A;  3G6E 3;  3PYJ A;  1JZD A;  3N9H A;  3UJM A;  3BB9 A;  3CC2 3;  1VQN 3;  1V58 A;  2KAA A;  1A2P A;  3B7C A;  1YHQ 3;  4HM7 B;  1BAN A;  1HYF A;  2F4Y A;  1MOL A;  2R41 A;  1OUN A;  1QAK A;  2ZA4 A;  1BRS A;  3K9M C;  1IDP A;  3FSD A;  2Z77 A;  4J8T A;  5JPU A;  1YVS A;  2STD A;  3GAX A;  2SAR A;  4FCJ A;  4KVH A;  4MMX B;  3SED A;  1ULI B;  1FA3 A;  3J7Y d;  5BIR A;  1E3V A;  3DXO A;  3LT9 A;  1TU5 A;  1IQX A;  4U13 A;  1BIR A;  1I3I A;  4WHA A;  1VQP 3;  1UUV B;  1I0X A;  2Z76 A;  3LYG A;  2CK3 H;  1KSI A;  2W04 A;  5ELU A;  2Y73 A;  4K1V A;  4NHF A;  4H3U A;  1GMR A;  1K41 A;  1G96 A;  3WOF B;  2KF5 A;  1IT8 A;  1GY7 A;  3SX1 A;  3BNE A;  3DUK A;  2E2V A;  1JJ2 2;  3CCL 3;  3OXA A;  1X1Y A;  4KT3 B;  2QIY A;  2XH9 A;  4MMZ B;  3EQQ B;  4QWT A;  3S29 A;  2OOV C;  2OQE A;  2GXF A;  1SJW A;  1IV9 A;  1AR0 A;  2XEP A;  4HM0 B;  4LEH A;  1VQ4 3;  2CW9 A;  2P0X A;  1B2M A;  1O7G B;  5AEW B;  1VQ9 3;  2BT3 A;  3NBR A;  5GSP A;  1GYB A;  2SBL A;  1JN5 A;  1OF5 B;  3NV0 B;  5KP4 A;  3IPT A;  4CPK A;  1W01 A;  1Z1S A;  1A2V A;  3FCS B;  3CCE 3;  1BRH A;  2CX0 A;  1X1X A;  4R9L A;  4WP5 A;  1FUW A;  1LOW A;  2XFT A;  5D81 A;  1I0V A;  4JF8 A;  1C7H A;  2IYJ A;  2CFD A;  3EHC A;  5CLK A;  3OW2 2;  1X1U A;  5AII A;  3ECF A;  1VQ8 3;  3HZP A;  2WGO A;  1NJI 4;  2XRX B;  1CYV A;  2YFL B;  3MWZ A;  1DMN A;  2OOV A;  1N8R 4;  1E97 A;  3CCR 3;  3CCQ 3;  1JB4 A;  4EBG A;  4CJN A;  2FXT A;  5RNT A;  2XSO B;  1US1 A;  3F14 A;  4J5K A;  3WDG B;  3NBB A;  4KFD A;  2KRT A;  2E2T A;  4Q53 A;  2Q07 A;  1BSB A;  1O7W B;  4BTW A;  1UUW B;  2XFS A;  3X3Y A;  3PZW A;  3SVA A;  4X2H A;  4O02 B;  1BAO A;  1RGA A;  3JUQ A;  3G71 3;  2F56 A;  6RNT A;  4FMD A;  1Q86 4;  1EQK A;  2GEY A;  3TDG A;  1FGQ A;  3RDE A;  1BVI A;  4WWU C;  3EN8 A;  1RKY A;  1IT7 A;  4KFE A;  2ZL8 A;  2CFW A;  3M8C A;  1BUJ A;  1QMA A;  2CHC A;  1PY3 A;  5IEO A;  1JB2 A;  3VF1 A;  1Q82 4;  3O8Y A;  1IV7 A;  1TRQ A;  3DGN A;  4N6V 0;  3K63 A;  1O7N B;  2CFK A;  3LH4 A;  2BO9 B;  2ZDJ A;  4LSO A;  5AEU B;  1RN4 A;  1JN5 B;  1OF5 A;  1BNJ A;  3WA2 X;  1IVW A;  3H3H A;  1OGX A;  4WYK B;  2BMQ B;  2LQV A;  7STD A;  1Q40 B;  2YFI B;  1JBT A;  1TUH A;  1ULJ B;  1A90 A;  4I5Q A;  1BSD A;  2CFL A;  1GD4 A;  1OHO A;  2IA7 A;  4IIA A;  3OWU A;  4AKZ A;  3AGN A;  3NBJ A;  4LYL B;  3U97 A;  2FGT A;  1IU7 A;  3NM7 A;  1K8A 4;  2RFR A;  3FZW A;  2INX A;  3FG3 A;  5IG0 A;  4XDW A;  5EQL A;  3KSE D;  1MGR A;  2IUJ A;  1WQL B;  5LC7 A;  9RNT A;  4HOH A;  1O7H B;  3S67 A;  2L4V A;  2CWU A;  1VQM 3;  1TP6 A;  1RGF A;  2BU4 A;  3EBT A;  1J2B A;  1JKG A;  1W02 A;  3GZR A;  1BRI A;  4HKV B;  1BRN L;  4HM8 B;  5EEO A;  1QVF 2;  1BUQ A;  2KXG A;  3KSP A;  3LTC A;  1FUS A;  2HMJ B;  4PEJ A;  2FNQ A;  4EC6 A;  2ML6 A;  3CCM 3;  1GOU A;  1OGZ A;  3FGY A;  4LZI A;  1GMQ A;  1M90 4;  2JQ5 A;  1MWS A;  1TJD A;  2F99 A;  4HM2 B;  3FKA A;  1CEW I;  3NXJ A;  1FGR A;  1STF I;  2GEX A;  3NV0 A;  1RCK A;  4RZM A;  4XBX A;  3DGY A;  3T8N A;  3UB1 A;  1W2B 2;  4HZ9 B;  1SII A;  1ROA A;  3KFQ C;  1UCL A;  2CKF B;  3OWY A;  1RGG A;  1ISK A;  1OAC A;  1ZGX A;  1U5O A;  1W2Z A;  3NQY A;  5IW9 A;  1NB5 I;  5AIG A;  4WYK A;  2RSX A;  1YJN 3;  1DVC A;  4FMB A;  1UGI A;  5I97 A;  2F98 A;  1YNV X;  1LOY A;  3BNC A;  3PS8 A;  3CC7 3;  1X1W A;  1LXE A;  4L8P A;  3WHO A;  4HM4 B;  2O9U X;  3D5G A;  1WMO A;  3D79 A;  3RGA A;  5AIF A;  5TGN A;  1EUI C;  2C10 A;  4XB5 A;  1CQS A;  1JBS A;  4TX4 A;  2CX1 A;  4XM4 A;  3ZG5 A;  2Y74 A;  2JDI H;  2W2C A;  4R1K A;  5IG3 A;  1KQS 2;  2B24 B;  3UL5 A;  1RDS A;  1RSN A;  1IVV A;  1LQM B;  1GMP A;  1L5G B;  1TTO A;  1MWU A;  5STD A;  3FLJ A;  3AMO A;  1JBR A;  4AKY A;  1GSP A;  2OCT A;  3AHW A;  3FF0 A;  1BU4 A;  3B4O A;  1PFP A;  1DYU A;  3CCJ 3;  3OX9 A;  1LNH A;  1GD3 A;  5CK6 A;  3JUP A;  4KZ1 A;  4BTX A;  1ZO2 A;  3BU4 A;  4EV5 A;  1OHP A;  3DMC A;  3JUM A;  4HAA A;  3F7X A;  2HMO B;  4OUQ A;  3CXC 2;  1NNV A;  3WMD A;  3EBY A;  2UGI A;  1RGE A;  1D6U A;  3G8Z A;  5JPP A;  4HVN A;  2O3O A;  1DMM A;  3MG2 A;  3T0U A;  3CCU 3;  2H0I A;  3JVC A;  3NM2 A;  1AY7 A;  1T2I A;  4CCV A;  7GSP A;  3DH2 A;  3MHE A;  1G02 A;  1TRP A;  1Y4K A;  3FF2 A;  3NX0 A;  2BMO B;  1FGT A;  2C11 A;  1QJG A;  1UGH I;  3FG1 A;  4N6T A;  3X40 A;  1BRG A;  1NDO B;  1WTH A;  1RRL A;  2F5M A;  3DZL A;  3Q3F A;  1BRJ A;  4MMY B;  1I2G A;  1JNQ A;  2BIR A;  2H0H A;  4IT7 A;  2KCD A;  4O2H A;  1RRH A;  4DKI A;  3NQZ A;  1ZS7 A;  1I8V A;  2KF6 A;  2YFJ B;  1TFO A;  3KE7 A;  3MG3 A;  3U1W A;  1GOY A;  3HII A;  1T3B A;  4N6O B;  3VSY A;  1YVB I;  4O8S A;  3SOA A;  1O7M B;  5D82 A;  5M1A A;  5DRV A;  4RNT A;  3GRD A;  5G2G A;  1QAF A;  2WOH A;  4LMI A;  4FCM A;  2AAD A;  1BGS A;  1N9E A;  8RNT A;  3GSP A;  4OVM A;  2CFG A;  2RNT A;  4EW5 A;  3FG4 A;  4LGQ A;  1AVK A;  1EEJ A;  5AI1 A;  1QVG 2;  3S28 A;  1LOX A;  4H61 A;  4EYC A;  1YJ9 3;  1B20 A;  1BNE A;  1A2K A;  4N6U A;  2J8X B;  1UDI I;  1JB5 A;  1NB3 I;  1JZO A;  2BHM A;  1BSA A;  3HX8 A;  4EXR A;  1MWT A;  3DM8 A;  3ZG0 A;  1I2E A;  3LML A;  5BXQ A;  1BSC A;  3ROB A;  3BIR A;  3V99 A;  5JBS A;  2WO0 A;  3SOY A;  4RBN A;  1CH0 A;  3KZT A;  1KD1 4;  3A76 A;  4BL3 A;  2CC3 A;  1S5A A;  3QK9 A;  3CPO A;  1B2Z A;  1SQW A;  2K0M A;  3HIG A;  1V74 A;  3HI7 A;  4FMA A;  2W56 A;  3GZB A;  1BRK A;  1EG9 B;  3G4S 3;  3CNM A;  3MG1 A;  3EX9 A;  3ALA A;  1RLS A;  3QRD A;  2WOF A;  3DY5 A;  3FH1 A;  4HYZ A;  5IG4 A;  1SAR A;  4K1U A;  1D6Y A;  3F7S A;  1W6C A;  3V92 A;  3KN4 A;  2A15 A;  1MWR A;  4HM3 B;  3I56 3;  1AVL A;  4I4K A;  1B2X A;  4K61 A;  2HML B;  3NUV A;  4AEQ A;  4GHO A;  2H0G A;  1RJO A;  3BND A;  4ORL A;  1BNI A;  1SPU A;  2L1S A;  1O7P B;  3EE1 A;  3MKI A;  5M19 A;  2RCD A;  4GL6 A;  5G1L A;  2GU1 A;  3IMA B;  1JRQ A;  1W6Y A;  5KP3 A;  2CG1 A;  2CIU A;  3KII A;  3RNT A;  1M9G A;  3K7C A;  4HM6 B;  3X3X A;  1V57 A;  3AHS A;  3F8H A;  1SIH A;  3MYT A;  2IY2 A;  3G0K A;  4R4K A;  3PXM A;  1VQ5 3;  1RNB A;  4XDV A;  1FGM A;  2XF3 A;  3ER7 A;  4O3V A;  4J9A A;  2WGQ A;  4NPB A;  3LTD A;  1HKX A;  1RN7 A;  3MPH A;  3PCR A;  1N5P A;  4WFO A;  1TFK A;  3WOD G;  1JKG B;  5CF2 A;  1YGW A;  3GZY B;  2D42 A;  1OHS A;  1VQK 3;  2PNC A;  1BNR A;  3UNL A;  1EKM A;  1IQ8 A;  1HZ1 A;  1BNS A;  4IPB A;  5FGO A;  4JRF A;  1STD A;  5IEN A;  1RHL A;  2HMM B;  1YI2 3;  1CYU A;  1MGW A;  1E3R A;  4FR9 A;  3B4P A;  1K73 4;  1VQL 3;  3AMO B;  3D5I A;  1RGC A;  2BNG A;  2CWV A;  1PU4 A;  2RBI A;  4BTY A;  1T2H A;  1W6G A;  1UCK A;  1YGE A;  1UCI A;  4ZM8 A;  1UCJ A;  1Q42 A;  3OWS A;  1OPY A;  4MJD A;  4CDL A;  1K28 A;  3CU3 A;  2W0Q A;  1PYL A;  4G1M B;  3G16 A;  1B21 A;  3VGN A;  1FZU A; 
#chains in the Genus database with same CATH homology
 1BRJ A;  3WR2 A;  1I2G A;  2BIR A;  1BSD A;  1LOV A;  3AGN A;  4BIR A;  1B2S A;  1LNI A;  1GOV A;  2KF4 A;  1RTU A;  1Q9E A;  1I8V A;  2KF6 A;  1GOY A;  1MGR A;  1RNT A;  1BSE A;  4HOH A;  9RNT A;  1C54 A;  4RNT A;  2BU4 A;  1RGF A;  2AAD A;  1BGS A;  8RNT A;  1BRI A;  1BRN L;  1I2F A;  2KAA A;  3GSP A;  1A2P A;  2RNT A;  1BAN A;  1HYF A;  2F4Y A;  1B2U A;  1FUS A;  2ZA4 A;  1BRS A;  3SYU A;  1B20 A;  1BNE A;  1GOU A;  1YVS A;  1GMQ A;  2SAR A;  1FW7 A;  5BIR A;  1BSA A;  1BIR A;  1I3I A;  2GSP A;  1RCK A;  1I0X A;  1I2E A;  1B27 A;  3URP A;  1BSC A;  3BIR A;  3DGY A;  1RGK A;  1CH0 A;  3AGO A;  1UCL A;  1GMR A;  2KF5 A;  1RN1 A;  1RGG A;  1B2Z A;  1ZGX A;  1B3S A;  1BRK A;  1X1Y A;  2AAE A;  2KF3 A;  1YNV X;  1LOY A;  1RLS A;  1X1W A;  2HOH A;  3WHO A;  3D5G A;  2F5W A;  1B2M A;  1SAR A;  3KCH A;  5GSP A;  1DET A;  1JBS A;  1RMS A;  1BRH A;  1X1X A;  1FYS A;  7RNT A;  1B2X A;  1LOW A;  1I0V A;  4GHO A;  1BNI A;  1AQZ A;  1X1U A;  1RGL A;  1RDS A;  1RSN A;  3RNT A;  4BU4 A;  1GMP A;  1TTO A;  3AHS A;  5RNT A;  4J5K A;  1RNB A;  1JBR A;  1GSP A;  1BSB A;  3AHW A;  1BU4 A;  6GSP A;  1FUT A;  3D4A A;  1IYY A;  1YGW A;  1RGH A;  1LRA A;  1BAO A;  1BOX A;  1RGA A;  2F56 A;  6RNT A;  5HOH A;  5BU4 A;  1BNR A;  3BU4 A;  1HZ1 A;  1BNS A;  1BVI A;  4GSP A;  4HAA A;  1RHL A;  4J5G A;  1I3F A;  1RGE A;  1MGW A;  3HOH A;  3D5I A;  1RGC A;  1BUJ A;  2RBI A;  1T2H A;  1PY3 A;  1BNG A;  1UCK A;  1UCI A;  1UCJ A;  2C4B A;  1BNF A;  1TRQ A;  1AY7 A;  1T2I A;  1RCL A;  1RN4 A;  3A5E A;  3DH2 A;  1BNJ A;  1G02 A;  7GSP A;  1PYL A;  1TRP A;  1B21 A;  1DE3 A;  1I70 A;  1BRG A;  1FZU A;  1R4Y A;  2F5M A;  1JBT A;  3Q3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...