1BRHA

Barnase mutant with leu 14 replaced by ala
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYAQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brhA00
1JBSA 1BNFA 1CH0A 1G02A 3SYUA 1BNJA 1B2SA 1GOYA 1B20A 1UCJA 1B2ZA 6RNTA 1RTUA 1BSBA 1GSPA 1R4YA 1X1WA 2KF5A 3D5IA 1T2IA 1YGWA 5HOHA 1I2FA 1BVIA 2F5WA 2AAEA 1B3SA 1LOYA 1RNBA 1RHLA 3RNTA 1Q9EA 1UCLA 3WHOA 1B2MA 2KF6A 5RNTA 1AQZA 2ZA4A 1IYYA 1GMPA 1UCKA 1X1UA 2BIRA 1BSDA 1BRIA 1I8VA 1FZUA 1TTOA 5BIRA 1T2HA 3A5EA 4HAAA 1B27A 1RCKA 1BSAA 1ZGXA 1BGSA 2F5MA 1BSEA 1BU4A 1FYSA 1BRSA 1LOVA 1A2PA 1BAOA 1I3FA 1FUTA 4J5GA 1BNEA 1BNGA 1SARA 2HOHA 1RCLA 2RNTA 1RSNA 3D4AA 4J5KA 1RDSA 3GSPA 2KF3A 1RGAA 1I0VA 2KAAA 1B21A 1X1XA 1BRJA 3BIRA 1RN1A 1DE3A 1BNSA 2RBIA 1RN4A 1B2UA 1MGRA 1I3IA 1I0XA 1I2EA 1RGCA 1YVSA 3AHWA 3KCHA 7GSPA 3WR2A 1DETA 1I2GA 5GSPA 3URPA 1RGKA 1AY7A 1TRPA 1X1YA 3D5GA 9RNTA 3DGYA 1GMRA 1BRHA 4BU4A 3DH2A 1RMSA 1YNVX 2BU4A 1LOWA 4HOHA 3HOHA 1BSCA 1BNIA 1BRNL 3BU4A 1PYLA 1C54A 1TRQA 1BRGA 1LRAA 1UCIA 2GSPA 1BOXA 3AGNA 4BIRA 1BIRA 1JBTA 8RNTA 4GHOA 6GSPA 1BNRA 1JBRA 1LNIA 1GOVA 4GSPA 1PY3A 2AADA 7RNTA 1HZ1A 5BU4A 2SARA 3Q3FA 1GOUA 1FW7A 1BRKA 1GMQA 1RLSA 1BANA 1I70A 1FUSA 1BUJA 1RGLA 1MGWA 1RGGA 2KF4A 1RGHA 3AGOA 1RGEA 1HYFA 1B2XA 1RGFA 4RNTA 3AHSA 2C4BA 2F56A 1RNTA 2F4YA
chains in the Genus database with same CATH superfamily
1JBSA 1Q864 4DKIA 3NV0B 5EQLA 2CKFB 1O7GB 3AMOB 3Q1CA 5G1LA 5STDA 3EBTA 1B2SA 6RNTA 1VQK3 2KF5A 5CLKA 2C11A 2ZDJA 1IT8A 5M1AA 5HOHA 1YVBI 2O9UX 1I2FA 5AIHA 1GS3A 1ROVA 2UX0A 2Z6BA 4FMCA 2F5WA 1V57A 1IVWA 1B3SA 3I0YA 1RHLA 1UI8A 3K63A 4HM4B 4R9LA 1Q42A 4N6MA 5RNTA 2ZA4A 1N8QA 1UCKA 1IVUA 2P0XA 3LH4A 3ROBA 2BIRA 1BSDA 1BRIA 1SJWA 2V1LA 3D3LA 3MG1A 3WA2X 5IENA 1JZOA 5KP3A 2L1SA 2D1WA 2GXFA 3LZAA 3OV4A 1T2HA 5AIIA 3EHCA 3EQQB 1YJ93 3EE1A 1TUHA 5IEPA 3OXAA 4XBTA 1TP6A 3CPW2 1BGSA 3WOEB 1A2VA 1BU4A 4JRFA 2W2CA 2Y74A 4FMDA 2CX1A 3CMA3 3F7SA 1C7HA 4K1UA 2IYJA 1SARA 1N5PA 3OWUA 1ULIB 3KE7A 3D4AA 1JJ22 3DUKA 1O7MB 4ZM8A 1SIIA 4N6NB 1B21A 1NB3I 1VQQA 3GAXA 5JPUA 1JN5A 1W6CA 1KD14 1RN1A 2W56A 4EYCA 4WYKA 1ISKA 4XDVA 3G6E3 3MYTA 1RN4A 1UGHI 2BMRB 2CHCA 4GL6A 5FW5A 3D79A 1I3IA 1NNVA 1WNHA 3GZRA 1OCVA 1OACA 5CF1A 1DVCA 1IDPA 1DETA 1KQS2 1YJW3 4HM2B 1FGTA 1ASKA 1N5HA 2XH9A 3JVCA 3K9MC 4AKYA 1AY7A 2CG0A 3D5GA 2XSHB 4XM4A 4BTXA 1NB5I 3DGYA 1GMRA 1RMSA 1RKYA 1VQ63 3B7CA 4LYLB 4HOHA 3HOHA 1BNIA 1IV9A 3X41A 1PYLA 3S28A 3LTBA 4K61A 5G1KA 1Q40B 3BNEA 1UCIA 1A2KA 3FF0A 3ZG0A 1O7PB 3UL6A 1YIT3 1JKGB 3CCE3 4KZ1A 3JUMA 3ECFA 1JV2B 1KWIA 3SXXA 2QA43 3HIIA 3KKGA 3LT8A 5HGRA 5IG0A 3G16A 3B4OA 3MKIA 1FGMA 3IJEB 4WHAA 2MF7A 2W04A 3FF2A 1RRHA 2CH9A 1JBRA 1LNIA 1GOVA 1UI7A 1LOXA 5FGOA 1HZ1A 4L7KA 1K28A 1QJGA 2GBWB 3KSPA 2F99A 2ZHXB 4BL2A 1V74A 1NDOB 2M7OA 3BNDA 4HKVB 1BANA 1W6GA 1FGRA 4IIAA 1TFOA 4O02B 2OQEA 1BUJA 4IT7A 4RNZA 5AI1A 1FA3A 5IG5A 4RNTA 1RGFA 4XBXA 4Q53A 4BTWA 2F56A 2KRTA 3EC9A 3CPOA 1RNTA 3DMCA 4EV2A 2CG1A 1N8R4 3WODG 2LYXA 1QAKA 1N9EA 1VQ43 1G02A 1V58A 1ZO2A 3SYUA 1US1A 2QIYA 3LOYA 3HX8A 2WO0A 3HI7A 1B20A 1UCJA 3B8LA 1RTUA 2B1XB 1YIJ3 5A0OB 3I553 1J2BA 1T2IA 1YGWA 4I4KA 4STDA 5I97A 3KIIA 1WMPA 2R4IA 1G0TA 2XF3A 4GB5A 1OHSA 2XSOB 4CPKA 1O7HB 1D6ZA 3NBJA 3UJMA 3DY5A 1GD3A 2HMMB 2BO9B 1W00A 2HMOB 1Q9EA 2H0HA 2KF6A 2HMKB 1S5AA 1TJDA 2Z76A 5ELJA 1GMPA 1IYYA 4O3VA 2Z77A 1DVDA 1OPYA 1I8VA 1FZUA 5AYSC 1YHQ3 1DMNA 3B4PA 1AVKA 1TTOA 5BIRA 3IPTA 3SX1A 5EVHA 3T8NA 2CK3H 1F8NA 1D6UA 1GY6A 1D6YA 4HAAA 3X3ZA 1B27A 3AMOA 2IUJA 1GD4A 2F5MA 1BSEA 1FGQA 3WMDA 1EA2A 1BRSA 1VQ83 3S5CA 4HJLB 1BAOA 1IVXA 4LZIA 3DM8A 2XFSA 1K734 1JB5A 3FCSB 3CD63 2IY2A 1UUGB 4PEJA 2W03A 1LXEA 1QMAA 1WMNA 3X3YA 4RZMA 1RCLA 1K9M4 1RDSA 1W6YA 3GSPA 3PZWA 1VQP3 5DRVA 1JNQA 2RGQA 2KAAA 3F8HA 1X1XA 3BIRA 3F40A 4X2OA 1BNSA 1LVNA 2RBIA 3KN4A 3RGAA 4G1MB 3CCU3 3MG3A 1I0XA 1YVSA 3MSOA 1U8CB 3N8BA 7GSPA 2YFJB 3WR2A 3QK9A 2P0MA 1OF5A 3BNBA 1I2GA 1AR0A 1GYBA 3URPA 1YGEA 4MMXB 3DGOA 3NQYA 1Y4KA 1NO3A 4MJDA 3F7XA 3V99A 3CCV3 4BU4A 1BRHA 5D81A 3KFQC 1W5ZA 1YNVX 1JN5B 4EBGA 3CC23 1QVF2 3F14A 4J9AA 1BSCA 1IK3A 4K1VA 1BRNL 5AEWB 3GWRA 3E99A 1VQN3 1BUQA 2INXA 2GBXB 2XRXB 4HM0B 3EF8A 3DGLA 2R41A 4O2HA 4QWTA 3T0UA 6STDA 2GSPA 1BOXA 4BL3A 3AGNA 2MC8A 4N3VA 3RGRA 3LTCA 2GEYA 3NBRA 1SPUA 3Q2PA 3OW22 1FUWA 3SVAA 4BIRA 3M8CA 2BNGA 3LMLA 5AYRB 5M18A 1JBTA 8RNTA 1A67A 2CWVA 4N6TA 4WYKB 2PNCA 3LTDA 1JZDA 1W02A 3X42A 1TFKA 2CFKA 1PY3A 3CNXA 2W0QA 4MEIA 5IEOA 1W2B2 5BU4A 3BNCA 2Q07A 2P09A 3PGBA 3BB9A 1GOUA 3CU3A 2W9PA 1VQL3 3MHEA 4KFEA 1N9JA 4U13A 1I70A 2CW9A 1UUWB 2XGNA 4FCZA 1RGLA 3TDGA 1RGGA 2P05A 3NQZA 5CF2A 4AKZA 3AGOA 4FCMA 4BTYA 4N6UA 3UNLA 3FG1A 2C4BA 3OWSA 2BT3A 2JQ5A 3G8ZA 1DMMA 4ILFA 2OOVA 4FCJA 1GOYA 1B2ZA 3J7Yd 4NHFA 1GSPA 2L4VA 2XR8B 3FLJA 3V98A 2XFTA 2E2VA 3D5IA 2WGQA 1LNHA 4LSOA 3DGNA 1L5GB 1YI23 1QALA 1M1XB 4MMYB 1DMQA 2K3DA 3PS8A 4H3UA 4I5QA 2AAEA 1SIHA 4CJNA 1STFI 2OQEC 4ORLA 4R80A 3G4S3 1RNBA 5KP1A 1EG9B 1B2MA 3NX0A 3MG2A 3MWZA 1AQZA 5IERA 1OH0A 1RRLA 3EN1B 3DGMA 3LYGA 1M904 3N9HA 3N54B 4LEHA 4OK0A 3VSYA 1QVG2 1LQGC 4HM3B 3QRDA 1IT7A 2YFLB 3NM7A 3A5EA 4H61A 4LGQA 4EC6A 2FGTA 2STDA 2W9QA 1RCKA 1BSAA 1VZZA 2CC3A 1ZGXA 3PCRA 5G2GA 2OTL3 1EKMA 2BMOB 4O8SA 1LOVA 2OCTA 3FSDA 3ER7A 3U1WA 3VF1A 3WDGB 4R4KA 3EB8A 4JF8A 1BNEA 1BNGA 1STDA 1ZX2A 2H0GA 2O3OA 4HM8B 2HOHA 3NUVA 7STDA 5IG3A 2RNTA 1RSNA 1MWTA 4XBYA 3JUPA 3WOFB 1SQWA 1JB2A 1I0VA 3G713 2PZVA 3CNMA 1OUNA 3FZWA 3T8UA 1UGIA 1IV7A 3HZPA 1Q824 4XB5A 1IU7A 5LC6A 3D9RA 3LTAA 4RNYA 3KZTA 4N6LA 8CHOA 1VQM3 1MGRA 1MWSA 1I2EA 1RGCA 2HMNB 3AHWA 3KCHA 4EW5A 5EEOA 5AEUB 3JUOA 3NHXA 1W7CA 4XDWA 3CC43 1M9GA 1RGKA 1X1YA 2P38A 2Z7AA 9RNTA 1A90A 2WOFA 3CCM3 1IQXA 5CXOA 3S29A 4LMIA 3SLUA 3NBBA 1LOWA 3FGYA 1NJI4 5KP4A 2UUGC 4RBNA 1EUIC 1W2ZA 1WTHA 2XEPA 1TRQA 3BU4A 1BRGA 3LT9A 3MPHA 1LRAA 4HM1B 2QGUA 1GY5A 4CDLA 1Q7Y4 4HZBB 3G0KA 2IMJA 1JB4A 1O7WB 2F86B 1R4CA 1G96A 2ML6A 4R9KA 5IG4A 3RDEA 1EEJA 2GU3A 4N6OB 1M1K4 3HK4A 4GHOA 6GSPA 1ZS7A 1JRQA 2YFIB 2GEXA 4KFFA 1DYUA 4CCVA 1RJOA 2SARA 3A76A 3NV0A 1W4NA 4HBRA 1OGXA 3LXUX 3X40A 1OF5B 3SEDA 1K41A 3F8XA 2BMQB 1GMQA 1LQMB 2CWTA 3GZBA 4KVHA 1FW7A 1IQYA 1RLSA 2KCDA 4L8OA 1MGWA 4NREA 2A15A 1RGHA 1Z1SA 2ML5A 3FKAA 4HM5B 1ULJB 2CFLA 1RGEA 5JBSA 1UDII 5DREA 1E3VA 1U5OA 2CFDA 2IA7A 1K8A4 2HMLB 1PU4A 3Q90A 3NM2A 4IPBA 1BNFA 2OOVC 4R1KA 4WP5A 2F98A 1E97A 1CH0A 3PYJA 1VQO3 3SOAA 3BLZA 2E2TA 1BNJA 2KXGA 2FXTA 3CCQ3 5AIGA 1PFPA 3EBYA 2FNQA 2D42A 3H3HA 1BSBA 1R4YA 2UGIA 1UUVB 1X1WA 3JUNA 3S67A 4N6V0 1S723 3I563 3IMAB 1EQKA 4HYZA 4HM6B 1BVIA 2CIUA 2HMJB 3ZFZA 2K0MA 1LOYA 3HIGA 2B24B 3O8YA 3RNTA 1OHOA 1UCLA 3GRDA 3WHOA 4FR9A 4L8PA 2JDIH 1X1UA 2I9WA 5IF6A 1OGZA 2BHMA 3GZXB 2J8XB 2CFWA 3K0ZA 2YX9A 2E2UA 3OX9A 4OUQA 2OTJ3 2XGLA 1ROAA 4FMAA 1WMOA 2OWPA 4NPBA 2CFGA 3EN8A 1FYSA 4WFOA 5BXQA 1GY7A 1A2PA 1FGOA 1E3RA 1I3FA 2C10A 5JPPA 1VQ73 1FUTA 1CYVA 1NWWA 4J5GA 5D82A 2CX0A 1CEWI 3DZLA 1IQ8A 4HVNA 1VQ53 4EV5A 1AV4A 2GU1A 1Q40A 3EX9A 4J5KA 3VGNA 2H0IA 3F9SA 4HZ9B 2KF3A 3H51A 1RGAA 1NU3A 1T5YA 1T3BA 1BRJA 1CQSA 3KSED 3UB1A 1MWRA 1DE3A 1AVLA 2QEX3 3NXJA 1B2UA 4WWUC 3UL5A 3DXOA 1YJN3 1KSIA 4OVMA 3ZG5A 3CCR3 3X3XA 3SOYA 5GSPA 1IVVA 1TIJA 3CXC2 1TRPA 1CYUA 3FG4A 4J8TA 4TX4A 3PCSA 4AEQA 3DH2A 3CCS3 2W6JH 2BU4A 5D83A 3K7CA 1MNLA 3CME3 5TGNA 3S27A 3CCL3 2RFRA 1WQLB 1KC84 2WGOA 5AIFA 3FG3A 3U97A 1C54A 5IW9A 4X2HA 1TU5A 3OWYA 2SBLA 1RN7A 3PXMA 3STDA 1BIRA 4HM7B 2CWUA 2WOHA 4KFDA 3ALAA 1QAFA 2RSXA 1BNRA 2K54A 3FH1A 3CC73 3JUQA 4GSPA 1JKGA 2RCDA 2AADA 3GZYB 7RNTA 5BVBA 5LC7A 3L0RA 4K90B 4FMBA 1Q7HA 3Q3FA 3WA3A 1OHPA 1UW1A 3CCJ3 1BRKA 1HKXA 5M19A 4KT3B 1Q814 2LQVA 1FUSA 2KF4A 4MMZB 1MOLA 1MWUA 2IUKA 3K5TA 5ELUA 3EJVA 1HU9A 2Y73A 1HYFA 1B2XA 2W56B 1W01A 3AHSA 1VQ93 2ZL8A 5CK6A 4EXRA 1O7NB 2F4YA 3V92A
chains in the Genus database with same CATH topology
1JBSA 1BNFA 1CH0A 1G02A 3SYUA 1BNJA 1B2SA 1GOYA 1B20A 1UCJA 1B2ZA 6RNTA 1RTUA 1BSBA 1GSPA 1R4YA 1X1WA 2KF5A 3D5IA 1T2IA 1YGWA 5HOHA 1I2FA 1BVIA 2F5WA 2AAEA 1B3SA 1LOYA 1RNBA 1RHLA 3RNTA 1Q9EA 1UCLA 3WHOA 1B2MA 2KF6A 5RNTA 1AQZA 2ZA4A 1IYYA 1GMPA 1UCKA 1X1UA 2BIRA 1BSDA 1BRIA 1I8VA 1FZUA 1TTOA 5BIRA 1T2HA 3A5EA 4HAAA 1B27A 1RCKA 1BSAA 1ZGXA 1BGSA 2F5MA 1BSEA 1BU4A 1FYSA 1BRSA 1LOVA 1A2PA 1BAOA 1I3FA 1FUTA 4J5GA 1BNEA 1BNGA 1SARA 2HOHA 1RCLA 2RNTA 1RSNA 3D4AA 4J5KA 1RDSA 3GSPA 2KF3A 1RGAA 1I0VA 2KAAA 1B21A 1X1XA 1BRJA 3BIRA 1RN1A 1DE3A 1BNSA 2RBIA 1RN4A 1B2UA 1MGRA 1I3IA 1I0XA 1I2EA 1RGCA 1YVSA 3AHWA 3KCHA 7GSPA 3WR2A 1DETA 1I2GA 5GSPA 3URPA 1RGKA 1AY7A 1TRPA 1X1YA 3D5GA 9RNTA 3DGYA 1GMRA 1BRHA 4BU4A 3DH2A 1RMSA 1YNVX 2BU4A 1LOWA 4HOHA 3HOHA 1BSCA 1BNIA 1BRNL 3BU4A 1PYLA 1C54A 1TRQA 1BRGA 1LRAA 1UCIA 2GSPA 1BOXA 3AGNA 4BIRA 1BIRA 1JBTA 8RNTA 4GHOA 6GSPA 1BNRA 1JBRA 1LNIA 1GOVA 4GSPA 1PY3A 2AADA 7RNTA 1HZ1A 5BU4A 2SARA 3Q3FA 1GOUA 1FW7A 1BRKA 1GMQA 1RLSA 1BANA 1I70A 1FUSA 1BUJA 1RGLA 1MGWA 1RGGA 2KF4A 1RGHA 3AGOA 1RGEA 1HYFA 1B2XA 1RGFA 4RNTA 3AHSA 2C4BA 2F56A 1RNTA 2F4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBS A;  1BNF A;  1CH0 A;  1G02 A;  3SYU A;  1BNJ A;  1B2S A;  1GOY A;  1B20 A;  1UCJ A;  1B2Z A;  6RNT A;  1RTU A;  1BSB A;  1GSP A;  1R4Y A;  1X1W A;  2KF5 A;  3D5I A;  1T2I A;  1YGW A;  5HOH A;  1I2F A;  1BVI A;  2F5W A;  2AAE A;  1B3S A;  1LOY A;  1RNB A;  1RHL A;  3RNT A;  1Q9E A;  1UCL A;  3WHO A;  1B2M A;  2KF6 A;  5RNT A;  1AQZ A;  2ZA4 A;  1IYY A;  1GMP A;  1UCK A;  1X1U A;  2BIR A;  1BSD A;  1BRI A;  1I8V A;  1FZU A;  1TTO A;  5BIR A;  1T2H A;  3A5E A;  4HAA A;  1B27 A;  1RCK A;  1BSA A;  1ZGX A;  1BGS A;  2F5M A;  1BSE A;  1BU4 A;  1FYS A;  1BRS A;  1LOV A;  1A2P A;  1BAO A;  1I3F A;  1FUT A;  4J5G A;  1BNE A;  1BNG A;  1SAR A;  2HOH A;  1RCL A;  2RNT A;  1RSN A;  3D4A A;  4J5K A;  1RDS A;  3GSP A;  2KF3 A;  1RGA A;  1I0V A;  2KAA A;  1B21 A;  1X1X A;  1BRJ A;  3BIR A;  1RN1 A;  1DE3 A;  1BNS A;  2RBI A;  1RN4 A;  1B2U A;  1MGR A;  1I3I A;  1I0X A;  1I2E A;  1RGC A;  1YVS A;  3AHW A;  3KCH A;  7GSP A;  3WR2 A;  1DET A;  1I2G A;  5GSP A;  3URP A;  1RGK A;  1AY7 A;  1TRP A;  1X1Y A;  3D5G A;  9RNT A;  3DGY A;  1GMR A;  1BRH A;  4BU4 A;  3DH2 A;  1RMS A;  1YNV X;  2BU4 A;  1LOW A;  4HOH A;  3HOH A;  1BSC A;  1BNI A;  1BRN L;  3BU4 A;  1PYL A;  1C54 A;  1TRQ A;  1BRG A;  1LRA A;  1UCI A;  2GSP A;  1BOX A;  3AGN A;  4BIR A;  1BIR A;  1JBT A;  8RNT A;  4GHO A;  6GSP A;  1BNR A;  1JBR A;  1LNI A;  1GOV A;  4GSP A;  1PY3 A;  2AAD A;  7RNT A;  1HZ1 A;  5BU4 A;  2SAR A;  3Q3F A;  1GOU A;  1FW7 A;  1BRK A;  1GMQ A;  1RLS A;  1BAN A;  1I70 A;  1FUS A;  1BUJ A;  1RGL A;  1MGW A;  1RGG A;  2KF4 A;  1RGH A;  3AGO A;  1RGE A;  1HYF A;  1B2X A;  1RGF A;  4RNT A;  3AHS A;  2C4B A;  2F56 A;  1RNT A;  2F4Y A; 
#chains in the Genus database with same CATH topology
 1JBS A;  1Q86 4;  4DKI A;  3NV0 B;  5EQL A;  2CKF B;  1O7G B;  3AMO B;  3Q1C A;  5G1L A;  5STD A;  3EBT A;  1B2S A;  6RNT A;  1VQK 3;  2KF5 A;  5CLK A;  2C11 A;  2ZDJ A;  1IT8 A;  5M1A A;  5HOH A;  1YVB I;  2O9U X;  1I2F A;  5AIH A;  1GS3 A;  1ROV A;  2UX0 A;  2Z6B A;  4FMC A;  2F5W A;  1V57 A;  1IVW A;  1B3S A;  3I0Y A;  1RHL A;  1UI8 A;  3K63 A;  4HM4 B;  4R9L A;  1Q42 A;  4N6M A;  5RNT A;  2ZA4 A;  1N8Q A;  1UCK A;  1IVU A;  2P0X A;  3LH4 A;  3ROB A;  2BIR A;  1BSD A;  1BRI A;  1SJW A;  2V1L A;  3D3L A;  3MG1 A;  3WA2 X;  5IEN A;  1JZO A;  5KP3 A;  2L1S A;  2D1W A;  2GXF A;  3LZA A;  3OV4 A;  1T2H A;  5AII A;  3EHC A;  3EQQ B;  1YJ9 3;  3EE1 A;  1TUH A;  5IEP A;  3OXA A;  4XBT A;  1TP6 A;  3CPW 2;  1BGS A;  3WOE B;  1A2V A;  1BU4 A;  4JRF A;  2W2C A;  2Y74 A;  4FMD A;  2CX1 A;  3CMA 3;  3F7S A;  1C7H A;  4K1U A;  2IYJ A;  1SAR A;  1N5P A;  3OWU A;  1ULI B;  3KE7 A;  3D4A A;  1JJ2 2;  3DUK A;  1O7M B;  4ZM8 A;  1SII A;  4N6N B;  1B21 A;  1NB3 I;  1VQQ A;  3GAX A;  5JPU A;  1JN5 A;  1W6C A;  1KD1 4;  1RN1 A;  2W56 A;  4EYC A;  4WYK A;  1ISK A;  4XDV A;  3G6E 3;  3MYT A;  1RN4 A;  1UGH I;  2BMR B;  2CHC A;  4GL6 A;  5FW5 A;  3D79 A;  1I3I A;  1NNV A;  1WNH A;  3GZR A;  1OCV A;  1OAC A;  5CF1 A;  1DVC A;  1IDP A;  1DET A;  1KQS 2;  1YJW 3;  4HM2 B;  1FGT A;  1ASK A;  1N5H A;  2XH9 A;  3JVC A;  3K9M C;  4AKY A;  1AY7 A;  2CG0 A;  3D5G A;  2XSH B;  4XM4 A;  4BTX A;  1NB5 I;  3DGY A;  1GMR A;  1RMS A;  1RKY A;  1VQ6 3;  3B7C A;  4LYL B;  4HOH A;  3HOH A;  1BNI A;  1IV9 A;  3X41 A;  1PYL A;  3S28 A;  3LTB A;  4K61 A;  5G1K A;  1Q40 B;  3BNE A;  1UCI A;  1A2K A;  3FF0 A;  3ZG0 A;  1O7P B;  3UL6 A;  1YIT 3;  1JKG B;  3CCE 3;  4KZ1 A;  3JUM A;  3ECF A;  1JV2 B;  1KWI A;  3SXX A;  2QA4 3;  3HII A;  3KKG A;  3LT8 A;  5HGR A;  5IG0 A;  3G16 A;  3B4O A;  3MKI A;  1FGM A;  3IJE B;  4WHA A;  2MF7 A;  2W04 A;  3FF2 A;  1RRH A;  2CH9 A;  1JBR A;  1LNI A;  1GOV A;  1UI7 A;  1LOX A;  5FGO A;  1HZ1 A;  4L7K A;  1K28 A;  1QJG A;  2GBW B;  3KSP A;  2F99 A;  2ZHX B;  4BL2 A;  1V74 A;  1NDO B;  2M7O A;  3BND A;  4HKV B;  1BAN A;  1W6G A;  1FGR A;  4IIA A;  1TFO A;  4O02 B;  2OQE A;  1BUJ A;  4IT7 A;  4RNZ A;  5AI1 A;  1FA3 A;  5IG5 A;  4RNT A;  1RGF A;  4XBX A;  4Q53 A;  4BTW A;  2F56 A;  2KRT A;  3EC9 A;  3CPO A;  1RNT A;  3DMC A;  4EV2 A;  2CG1 A;  1N8R 4;  3WOD G;  2LYX A;  1QAK A;  1N9E A;  1VQ4 3;  1G02 A;  1V58 A;  1ZO2 A;  3SYU A;  1US1 A;  2QIY A;  3LOY A;  3HX8 A;  2WO0 A;  3HI7 A;  1B20 A;  1UCJ A;  3B8L A;  1RTU A;  2B1X B;  1YIJ 3;  5A0O B;  3I55 3;  1J2B A;  1T2I A;  1YGW A;  4I4K A;  4STD A;  5I97 A;  3KII A;  1WMP A;  2R4I A;  1G0T A;  2XF3 A;  4GB5 A;  1OHS A;  2XSO B;  4CPK A;  1O7H B;  1D6Z A;  3NBJ A;  3UJM A;  3DY5 A;  1GD3 A;  2HMM B;  2BO9 B;  1W00 A;  2HMO B;  1Q9E A;  2H0H A;  2KF6 A;  2HMK B;  1S5A A;  1TJD A;  2Z76 A;  5ELJ A;  1GMP A;  1IYY A;  4O3V A;  2Z77 A;  1DVD A;  1OPY A;  1I8V A;  1FZU A;  5AYS C;  1YHQ 3;  1DMN A;  3B4P A;  1AVK A;  1TTO A;  5BIR A;  3IPT A;  3SX1 A;  5EVH A;  3T8N A;  2CK3 H;  1F8N A;  1D6U A;  1GY6 A;  1D6Y A;  4HAA A;  3X3Z A;  1B27 A;  3AMO A;  2IUJ A;  1GD4 A;  2F5M A;  1BSE A;  1FGQ A;  3WMD A;  1EA2 A;  1BRS A;  1VQ8 3;  3S5C A;  4HJL B;  1BAO A;  1IVX A;  4LZI A;  3DM8 A;  2XFS A;  1K73 4;  1JB5 A;  3FCS B;  3CD6 3;  2IY2 A;  1UUG B;  4PEJ A;  2W03 A;  1LXE A;  1QMA A;  1WMN A;  3X3Y A;  4RZM A;  1RCL A;  1K9M 4;  1RDS A;  1W6Y A;  3GSP A;  3PZW A;  1VQP 3;  5DRV A;  1JNQ A;  2RGQ A;  2KAA A;  3F8H A;  1X1X A;  3BIR A;  3F40 A;  4X2O A;  1BNS A;  1LVN A;  2RBI A;  3KN4 A;  3RGA A;  4G1M B;  3CCU 3;  3MG3 A;  1I0X A;  1YVS A;  3MSO A;  1U8C B;  3N8B A;  7GSP A;  2YFJ B;  3WR2 A;  3QK9 A;  2P0M A;  1OF5 A;  3BNB A;  1I2G A;  1AR0 A;  1GYB A;  3URP A;  1YGE A;  4MMX B;  3DGO A;  3NQY A;  1Y4K A;  1NO3 A;  4MJD A;  3F7X A;  3V99 A;  3CCV 3;  4BU4 A;  1BRH A;  5D81 A;  3KFQ C;  1W5Z A;  1YNV X;  1JN5 B;  4EBG A;  3CC2 3;  1QVF 2;  3F14 A;  4J9A A;  1BSC A;  1IK3 A;  4K1V A;  1BRN L;  5AEW B;  3GWR A;  3E99 A;  1VQN 3;  1BUQ A;  2INX A;  2GBX B;  2XRX B;  4HM0 B;  3EF8 A;  3DGL A;  2R41 A;  4O2H A;  4QWT A;  3T0U A;  6STD A;  2GSP A;  1BOX A;  4BL3 A;  3AGN A;  2MC8 A;  4N3V A;  3RGR A;  3LTC A;  2GEY A;  3NBR A;  1SPU A;  3Q2P A;  3OW2 2;  1FUW A;  3SVA A;  4BIR A;  3M8C A;  2BNG A;  3LML A;  5AYR B;  5M18 A;  1JBT A;  8RNT A;  1A67 A;  2CWV A;  4N6T A;  4WYK B;  2PNC A;  3LTD A;  1JZD A;  1W02 A;  3X42 A;  1TFK A;  2CFK A;  1PY3 A;  3CNX A;  2W0Q A;  4MEI A;  5IEO A;  1W2B 2;  5BU4 A;  3BNC A;  2Q07 A;  2P09 A;  3PGB A;  3BB9 A;  1GOU A;  3CU3 A;  2W9P A;  1VQL 3;  3MHE A;  4KFE A;  1N9J A;  4U13 A;  1I70 A;  2CW9 A;  1UUW B;  2XGN A;  4FCZ A;  1RGL A;  3TDG A;  1RGG A;  2P05 A;  3NQZ A;  5CF2 A;  4AKZ A;  3AGO A;  4FCM A;  4BTY A;  4N6U A;  3UNL A;  3FG1 A;  2C4B A;  3OWS A;  2BT3 A;  2JQ5 A;  3G8Z A;  1DMM A;  4ILF A;  2OOV A;  4FCJ A;  1GOY A;  1B2Z A;  3J7Y d;  4NHF A;  1GSP A;  2L4V A;  2XR8 B;  3FLJ A;  3V98 A;  2XFT A;  2E2V A;  3D5I A;  2WGQ A;  1LNH A;  4LSO A;  3DGN A;  1L5G B;  1YI2 3;  1QAL A;  1M1X B;  4MMY B;  1DMQ A;  2K3D A;  3PS8 A;  4H3U A;  4I5Q A;  2AAE A;  1SIH A;  4CJN A;  1STF I;  2OQE C;  4ORL A;  4R80 A;  3G4S 3;  1RNB A;  5KP1 A;  1EG9 B;  1B2M A;  3NX0 A;  3MG2 A;  3MWZ A;  1AQZ A;  5IER A;  1OH0 A;  1RRL A;  3EN1 B;  3DGM A;  3LYG A;  1M90 4;  3N9H A;  3N54 B;  4LEH A;  4OK0 A;  3VSY A;  1QVG 2;  1LQG C;  4HM3 B;  3QRD A;  1IT7 A;  2YFL B;  3NM7 A;  3A5E A;  4H61 A;  4LGQ A;  4EC6 A;  2FGT A;  2STD A;  2W9Q A;  1RCK A;  1BSA A;  1VZZ A;  2CC3 A;  1ZGX A;  3PCR A;  5G2G A;  2OTL 3;  1EKM A;  2BMO B;  4O8S A;  1LOV A;  2OCT A;  3FSD A;  3ER7 A;  3U1W A;  3VF1 A;  3WDG B;  4R4K A;  3EB8 A;  4JF8 A;  1BNE A;  1BNG A;  1STD A;  1ZX2 A;  2H0G A;  2O3O A;  4HM8 B;  2HOH A;  3NUV A;  7STD A;  5IG3 A;  2RNT A;  1RSN A;  1MWT A;  4XBY A;  3JUP A;  3WOF B;  1SQW A;  1JB2 A;  1I0V A;  3G71 3;  2PZV A;  3CNM A;  1OUN A;  3FZW A;  3T8U A;  1UGI A;  1IV7 A;  3HZP A;  1Q82 4;  4XB5 A;  1IU7 A;  5LC6 A;  3D9R A;  3LTA A;  4RNY A;  3KZT A;  4N6L A;  8CHO A;  1VQM 3;  1MGR A;  1MWS A;  1I2E A;  1RGC A;  2HMN B;  3AHW A;  3KCH A;  4EW5 A;  5EEO A;  5AEU B;  3JUO A;  3NHX A;  1W7C A;  4XDW A;  3CC4 3;  1M9G A;  1RGK A;  1X1Y A;  2P38 A;  2Z7A A;  9RNT A;  1A90 A;  2WOF A;  3CCM 3;  1IQX A;  5CXO A;  3S29 A;  4LMI A;  3SLU A;  3NBB A;  1LOW A;  3FGY A;  1NJI 4;  5KP4 A;  2UUG C;  4RBN A;  1EUI C;  1W2Z A;  1WTH A;  2XEP A;  1TRQ A;  3BU4 A;  1BRG A;  3LT9 A;  3MPH A;  1LRA A;  4HM1 B;  2QGU A;  1GY5 A;  4CDL A;  1Q7Y 4;  4HZB B;  3G0K A;  2IMJ A;  1JB4 A;  1O7W B;  2F86 B;  1R4C A;  1G96 A;  2ML6 A;  4R9K A;  5IG4 A;  3RDE A;  1EEJ A;  2GU3 A;  4N6O B;  1M1K 4;  3HK4 A;  4GHO A;  6GSP A;  1ZS7 A;  1JRQ A;  2YFI B;  2GEX A;  4KFF A;  1DYU A;  4CCV A;  1RJO A;  2SAR A;  3A76 A;  3NV0 A;  1W4N A;  4HBR A;  1OGX A;  3LXU X;  3X40 A;  1OF5 B;  3SED A;  1K41 A;  3F8X A;  2BMQ B;  1GMQ A;  1LQM B;  2CWT A;  3GZB A;  4KVH A;  1FW7 A;  1IQY A;  1RLS A;  2KCD A;  4L8O A;  1MGW A;  4NRE A;  2A15 A;  1RGH A;  1Z1S A;  2ML5 A;  3FKA A;  4HM5 B;  1ULJ B;  2CFL A;  1RGE A;  5JBS A;  1UDI I;  5DRE A;  1E3V A;  1U5O A;  2CFD A;  2IA7 A;  1K8A 4;  2HML B;  1PU4 A;  3Q90 A;  3NM2 A;  4IPB A;  1BNF A;  2OOV C;  4R1K A;  4WP5 A;  2F98 A;  1E97 A;  1CH0 A;  3PYJ A;  1VQO 3;  3SOA A;  3BLZ A;  2E2T A;  1BNJ A;  2KXG A;  2FXT A;  3CCQ 3;  5AIG A;  1PFP A;  3EBY A;  2FNQ A;  2D42 A;  3H3H A;  1BSB A;  1R4Y A;  2UGI A;  1UUV B;  1X1W A;  3JUN A;  3S67 A;  4N6V 0;  1S72 3;  3I56 3;  3IMA B;  1EQK A;  4HYZ A;  4HM6 B;  1BVI A;  2CIU A;  2HMJ B;  3ZFZ A;  2K0M A;  1LOY A;  3HIG A;  2B24 B;  3O8Y A;  3RNT A;  1OHO A;  1UCL A;  3GRD A;  3WHO A;  4FR9 A;  4L8P A;  2JDI H;  1X1U A;  2I9W A;  5IF6 A;  1OGZ A;  2BHM A;  3GZX B;  2J8X B;  2CFW A;  3K0Z A;  2YX9 A;  2E2U A;  3OX9 A;  4OUQ A;  2OTJ 3;  2XGL A;  1ROA A;  4FMA A;  1WMO A;  2OWP A;  4NPB A;  2CFG A;  3EN8 A;  1FYS A;  4WFO A;  5BXQ A;  1GY7 A;  1A2P A;  1FGO A;  1E3R A;  1I3F A;  2C10 A;  5JPP A;  1VQ7 3;  1FUT A;  1CYV A;  1NWW A;  4J5G A;  5D82 A;  2CX0 A;  1CEW I;  3DZL A;  1IQ8 A;  4HVN A;  1VQ5 3;  4EV5 A;  1AV4 A;  2GU1 A;  1Q40 A;  3EX9 A;  4J5K A;  3VGN A;  2H0I A;  3F9S A;  4HZ9 B;  2KF3 A;  3H51 A;  1RGA A;  1NU3 A;  1T5Y A;  1T3B A;  1BRJ A;  1CQS A;  3KSE D;  3UB1 A;  1MWR A;  1DE3 A;  1AVL A;  2QEX 3;  3NXJ A;  1B2U A;  4WWU C;  3UL5 A;  3DXO A;  1YJN 3;  1KSI A;  4OVM A;  3ZG5 A;  3CCR 3;  3X3X A;  3SOY A;  5GSP A;  1IVV A;  1TIJ A;  3CXC 2;  1TRP A;  1CYU A;  3FG4 A;  4J8T A;  4TX4 A;  3PCS A;  4AEQ A;  3DH2 A;  3CCS 3;  2W6J H;  2BU4 A;  5D83 A;  3K7C A;  1MNL A;  3CME 3;  5TGN A;  3S27 A;  3CCL 3;  2RFR A;  1WQL B;  1KC8 4;  2WGO A;  5AIF A;  3FG3 A;  3U97 A;  1C54 A;  5IW9 A;  4X2H A;  1TU5 A;  3OWY A;  2SBL A;  1RN7 A;  3PXM A;  3STD A;  1BIR A;  4HM7 B;  2CWU A;  2WOH A;  4KFD A;  3ALA A;  1QAF A;  2RSX A;  1BNR A;  2K54 A;  3FH1 A;  3CC7 3;  3JUQ A;  4GSP A;  1JKG A;  2RCD A;  2AAD A;  3GZY B;  7RNT A;  5BVB A;  5LC7 A;  3L0R A;  4K90 B;  4FMB A;  1Q7H A;  3Q3F A;  3WA3 A;  1OHP A;  1UW1 A;  3CCJ 3;  1BRK A;  1HKX A;  5M19 A;  4KT3 B;  1Q81 4;  2LQV A;  1FUS A;  2KF4 A;  4MMZ B;  1MOL A;  1MWU A;  2IUK A;  3K5T A;  5ELU A;  3EJV A;  1HU9 A;  2Y73 A;  1HYF A;  1B2X A;  2W56 B;  1W01 A;  3AHS A;  1VQ9 3;  2ZL8 A;  5CK6 A;  4EXR A;  1O7N B;  2F4Y A;  3V92 A; 
#chains in the Genus database with same CATH homology
 1JBS A;  1BNF A;  1CH0 A;  1G02 A;  3SYU A;  1BNJ A;  1B2S A;  1GOY A;  1B20 A;  1UCJ A;  1B2Z A;  6RNT A;  1RTU A;  1BSB A;  1GSP A;  1R4Y A;  1X1W A;  2KF5 A;  3D5I A;  1T2I A;  1YGW A;  5HOH A;  1I2F A;  1BVI A;  2F5W A;  2AAE A;  1B3S A;  1LOY A;  1RNB A;  1RHL A;  3RNT A;  1Q9E A;  1UCL A;  3WHO A;  1B2M A;  2KF6 A;  5RNT A;  1AQZ A;  2ZA4 A;  1IYY A;  1GMP A;  1UCK A;  1X1U A;  2BIR A;  1BSD A;  1BRI A;  1I8V A;  1FZU A;  1TTO A;  5BIR A;  1T2H A;  3A5E A;  4HAA A;  1B27 A;  1RCK A;  1BSA A;  1ZGX A;  1BGS A;  2F5M A;  1BSE A;  1BU4 A;  1FYS A;  1BRS A;  1LOV A;  1A2P A;  1BAO A;  1I3F A;  1FUT A;  4J5G A;  1BNE A;  1BNG A;  1SAR A;  2HOH A;  1RCL A;  2RNT A;  1RSN A;  3D4A A;  4J5K A;  1RDS A;  3GSP A;  2KF3 A;  1RGA A;  1I0V A;  2KAA A;  1B21 A;  1X1X A;  1BRJ A;  3BIR A;  1RN1 A;  1DE3 A;  1BNS A;  2RBI A;  1RN4 A;  1B2U A;  1MGR A;  1I3I A;  1I0X A;  1I2E A;  1RGC A;  1YVS A;  3AHW A;  3KCH A;  7GSP A;  3WR2 A;  1DET A;  1I2G A;  5GSP A;  3URP A;  1RGK A;  1AY7 A;  1TRP A;  1X1Y A;  3D5G A;  9RNT A;  3DGY A;  1GMR A;  1BRH A;  4BU4 A;  3DH2 A;  1RMS A;  1YNV X;  2BU4 A;  1LOW A;  4HOH A;  3HOH A;  1BSC A;  1BNI A;  1BRN L;  3BU4 A;  1PYL A;  1C54 A;  1TRQ A;  1BRG A;  1LRA A;  1UCI A;  2GSP A;  1BOX A;  3AGN A;  4BIR A;  1BIR A;  1JBT A;  8RNT A;  4GHO A;  6GSP A;  1BNR A;  1JBR A;  1LNI A;  1GOV A;  4GSP A;  1PY3 A;  2AAD A;  7RNT A;  1HZ1 A;  5BU4 A;  2SAR A;  3Q3F A;  1GOU A;  1FW7 A;  1BRK A;  1GMQ A;  1RLS A;  1BAN A;  1I70 A;  1FUS A;  1BUJ A;  1RGL A;  1MGW A;  1RGG A;  2KF4 A;  1RGH A;  3AGO A;  1RGE A;  1HYF A;  1B2X A;  1RGF A;  4RNT A;  3AHS A;  2C4B A;  2F56 A;  1RNT A;  2F4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...