1EG9B

Naphthalene 1,2-dioxygenase with indole bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords PROTEIN (NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT)
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eg9B00
3I0YA 3T8NA 3EX9A 3WMDA 3EN1B 1Z1SA 4X2OA 2INXA 2QIYA 3G8ZA 5AIIA 5D82A 3EC9A 1JKGB 2CKFB 3DZLA 3GZRA 4HJLB 3VGNA 4HM0B 5HGRA 4LEHA 4N3VA 3NBRA 4X2HA 2B24B 3JUQA 1ZO2A 1W01A 1U5OA 3EQQB 3K0ZA 5CLKA 5AIFA 2HMLB 1GY5A 3G0KA 3F7SA 3SOAA 1UUWB 3NM2A 1GY7A 1WQLB 1OGXA 2F99A 3OWUA 1OHSA 2IMJA 3FLJA 4WWUC 1EA2A 3LZAA 1JN5A 1JB2A 1OF5A 5KP3A 3SEDA 1OCVA 2HMKB 3HK4A 3LYGA 3KE7A 2K54A 5CXOA 3MSOA 1OH0A 3H3HA 5TGNA 1DMMA 1C7HA 3FSDA 1STDA 1OPYA 2CHCA 3F14A 4XDWA 3B7CA 5IG5A 5AEWB 3FGYA 2HMOB 3FF0A 3OWSA 4XM4A 3NUVA 1OGZA 4HZ9B 5FW5A 2UX0A 1JN5B 3NXJA 3MG3A 4LGQA 2XR8B 3CNMA 2JQ5A 4MJDA 4OVMA 1BUQA 2B1XB 4XBYA 3GZXB 5BXQA 1ULJB 2GXFA 3CU3A 5IG4A 1OHPA 3DXOA 3SOYA 4CDLA 4WYKA 3OXAA 3GWRA 2Z77A 3B8LA 4FCJA 5DREA 5STDA 5KP4A 4IIAA 5D81A 1NDOB 2HMMB 3NHXA 3OV4A 2Z76A 3IPTA 1UUVB 1Q40A 2Z7AA 2PZVA 3Q90A 4HM8B 3JUNA 3ECFA 5IERA 3EF8A 3D9RA 3MKIA 5D83A 2A15A 2HMNB 1Q42A 5IEOA 2BMRB 2YFLB 7STDA 3NV0A 5AIGA 1HKXA 1OHOA 3FH1A 3OX9A 3ROBA 1ASKA 4H3UA 5EVHA 5CF1A 1E3VA 2BMQB 1EG9B 3CPOA 3DM8A 3EN8A 1Q40B 1QJGA 3EBYA 3F8XA 3JUMA 3GZBA 4WP5A 5CF2A 1A2KA 3BB9A 4R9LA 3FF2A 4L8OA 4HM4B 4L8PA 2XSOB 3JUPA 5AI1A 3FZWA 3H51A 4HM1B 1O7GB 3HZPA 1DMNA 2HMJB 4FCMA 1TP6A 3UNLA 4J9AA 1O7PB 3B4OA 3RGRA 1E97A 1QMAA 1S5AA 4HM2B 4HM3B 4I4KA 3KSPA 5AIHA 1ZX2A 3JUOA 1O7WB 2RFRA 3RGAA 2W2CA 3M8CA 3MG1A 4L7KA 5KP1A 4HM7B 1OF5B 3F7XA 3E99A 2XSHB 3VSYA 2RCDA 4U13A 2R4IA 3F40A 2QGUA 3MG2A 3MHEA 2YFIB 4ORLA 3FKAA 4R9KA 4R1KA 1AR0A 5IG0A 6STDA 3OWYA 5JPPA 1ISKA 3CNXA 2GEXA 3ER7A 4XBXA 1NWWA 1W02A 1O7MB 4HKVB 5IEPA 1JKGA 4K1UA 3T8UA 3GRDA 3UJMA 1O7NB 3GZYB 3NV0B 3EBTA 1GY6A 2GEYA 1W00A 2STDA 4HVNA 2BNGA 4J8TA 4HZBB 2F98A 4XDVA 5IENA 5G2GA 2YFJB 5JPUA 1TUHA 1OUNA 2RGQA 3MYTA 1ULIB 3K7CA 1K41A 3EHCA 4XB5A 5AEUB 5DRVA 3KZTA 4HM5B 2I9WA 4KVHA 3BLZA 3B4PA 4STDA 4GB5A 3DMCA 4RZMA 5IF6A 1W6YA 3KKGA 4WYKB 2BMOB 4LMIA 1VZZA 5IG3A 1GYBA 2GBXB 2OWPA 3EJVA 3F8HA 3A76A 4K1VA 5BVBA 2GBWB 3STDA 4OUQA 4PEJA 4Q53A 5CK6A 4XBTA 3HX8A 8CHOA 1E3RA 2F86B 1GS3A 1NU3A 1O7HB 4HM6B 1JB5A 1JB4A 3F9SA 3S5CA 3G16A 1IDPA 2XRXB 1CQSA 1SJWA 3DUKA 1DMQA
chains in the Genus database with same CATH superfamily
2O3OA 2BO9B 1B2SA 2W56B 2K3DA 3G8ZA 1OACA 2ZA4A 2OOVA 1JNQA 3BNCA 5G1KA 4IPBA 1N8QA 3WA2X 3BNBA 4HJLB 2MF7A 4LEHA 1ZO2A 3ZG0A 3K0ZA 1R4CA 1W2ZA 5AIFA 1IQ8A 3SOAA 1UUWB 1GY7A 1WQLB 2F99A 2XFTA 4BIRA 2IMJA 3FLJA 5KP1A 1EA2A 3LZAA 3NX0A 2RBIA 4KT3B 2CFDA 2K54A 3G713 1N5HA 1JZOA 2WGQA 1YIJ3 1OPYA 2CHCA 5IG5A 2E2VA 4GHOA 5AEWB 2HMOB 3LMLA 1I8VA 3X3YA 7RNTA 1IVWA 2XR8B 3FG1A 4OVMA 1WNHA 1K28A 4WHAA 1YI23 1LQMB 3VF1A 3PCRA 1D6ZA 3LTBA 1AQZA 1B2UA 1IV9A 3V92A 9RNTA 1I2GA 3SOYA 2P09A 3J7Yd 1RCLA 4JF8A 3GWRA 2Z77A 4KFDA 5ELJA 1JRQA 1RHLA 2P0XA 3JVCA 1BNIA 3NHXA 2Z76A 1UUVB 1Q40A 2Z7AA 5BU4A 4HM8B 3QRDA 3ECFA 1LRAA 3DGNA 3MKIA 3X3ZA 2GU1A 2WOFA 1VQ73 3NV0A 1B2ZA 1OHOA 1BRKA 1KD14 1PYLA 2IUKA 1RLSA 4IT7A 1B21A 2R41A 1RGCA 1Q40B 1HZ1A 3F8XA 5IERA 3PGBA 1DVDA 3CCE3 2SARA 1FUSA 1GOYA 4HM4B 4N6MA 3G6E3 1N8R4 2UUGC 1AY7A 3H51A 4AKYA 4HM1B 1QVG2 1O7GB 4FCMA 1LOYA 1TIJA 1X1YA 3HI7A 3UNLA 1TU5A 1BNJA 3KSED 1DE3A 4HM2B 3O8YA 4HM3B 3ROBA 1BRIA 1O7WB 3RGAA 2W2CA 3RNTA 1RN1A 1RCKA 4HAAA 2C4BA 2XSHB 3OW22 2RCDA 2QGUA 2YFIB 4R9KA 5IG0A 1UI8A 1MWUA 2GU3A 3DY5A 5GSPA 4XBXA 1NWWA 3S29A 3QK9A 1TFOA 4HKVB 3X42A 5IEPA 3K9MC 3Q3FA 3SVAA 1BIRA 3SEDA 2OCTA 2GEYA 1A67A 1LQGC 4R80A 2Y74A 1JJ22 3PCSA 5IENA 3K5TA 2YFJB 5JPUA 5RNTA 2FXTA 1K41A 4DKIA 2O9UX 3NBJA 8RNTA 4HOHA 3D5IA 3B4PA 1VQ53 1MWSA 3NM7A 4WYKB 4LMIA 1IQYA 1NB3I 3HIGA 3Q2PA 5A0OB 2LQVA 1FYSA 3SXXA 3LH4A 1TRPA 2RNTA 3V98A 1R4YA 1V74A 3D5GA 2W6JH 2GBWB 2P05A 4RBNA 2BU4A 3GAXA 1VQ83 1NU3A 1O7HB 1GMRA 2IY2A 2CFLA 1HU9A 4HM6B 3U97A 1VQO3 3F9SA 3G16A 1GSPA 1FZUA 1SIHA 1CQSA 1GOUA 2XRXB 3D4AA 3UJMA 1SARA 1M1XB 1S723 1UGIA 1Z1SA 1YGEA 1BSBA 5D82A 1IK3A 1WMOA 2CKFB 3UL6A 1C54A 2CH9A 1RGLA 4HM0B 3WODG 4EXRA 1BRGA 3WHOA 3JUQA 1V57A 3KIIA 4K90B 1GD4A 2HMLB 1YGWA 3G0KA 1G0TA 3NM2A 4EV2A 4J5KA 4KFEA 1RNBA 1OHSA 3N9HA 5KP3A 1JN5A 3V99A 2M7OA 1OCVA 1X1WA 3KE7A 2KF4A 1RGGA 2E2TA 1OH0A 1T3BA 3H3HA 4KZ1A 3I553 4XDWA 1I2FA 4CJNA 3OWSA 3ALAA 1OGZA 5FW5A 2UX0A 2BT3A 3MG3A 1IVVA 3CNMA 2W0QA 2JQ5A 4MJDA 3DGOA 1X1XA 7GSPA 1BRNL 2B1XB 1M9GA 1Q7HA 2FGTA 3GZXB 1GOVA 4XBYA 1ULJB 2CC3A 3AHWA 3CU3A 4QWTA 4EC6A 1EQKA 3DXOA 3CCR3 3OXAA 4R4KA 3EE1A 5KP4A 2XFSA 5D81A 1W4NA 3OV4A 1B27A 2MC8A 2XGNA 4FMAA 3WR2A 1X1UA 3JUNA 1YJW3 2XGLA 3FG3A 2HMNB 3CD63 2IA7A 1ROAA 2CIUA 3CME3 1HKXA 3OX9A 2HOHA 2PNCA 1BSEA 1BUJA 1BOXA 1PY3A 1EG9B 3CPOA 4ZM8A 1BNFA 5CF2A 4O3VA 3FCSB 1M904 4L8OA 3CCV3 2XSOB 3FZWA 1TFKA 4N6V0 3HZPA 3WDGB 2CK3H 3CCM3 1DYUA 4J9AA 5I97A 3B4OA 1A2VA 1B20A 2KXGA 1S5AA 4O02B 5AIHA 1BSCA 3KSPA 1ZX2A 2H0GA 1FGRA 1UI7A 2Y73A 3DGLA 3MPHA 1OF5B 3CC23 1Q9EA 1IVUA 2K0MA 2OQEC 2XEPA 3E99A 3F7XA 3RDEA 3VSYA 3WOFB 3MHEA 4N6LA 1ISKA 1AR0A 1BU4A 1QAFA 1TJDA 3D79A 4BTXA 1RGHA 3ER7A 1JKGA 3T8UA 3GRDA 1EUIC 1O7NB 3EBTA 2STDA 2BNGA 1QVF2 5EQLA 3CXC2 1D6YA 5G2GA 1CH0A 2SBLA 3L0RA 3DGMA 3MYTA 1ULIB 3K7CA 4XB5A 5AEUB 1LXEA 1BRJA 5DRVA 3KZTA 4HM5B 2I9WA 4KVHA 3PYJA 2CFKA 1MWRA 4GB5A 4NHFA 4EYCA 5IF6A 1B2XA 4GSPA 1I70A 4N6TA 1JV2B 2KF3A 1D6UA 4CCVA 3BNDA 4K1VA 5M1AA 4O8SA 5BVBA 2C11A 3N8BA 3AHSA 1BSDA 1RSNA 1I3FA 3KCHA 1EEJA 4O2HA 1K734 1SIIA 5LC7A 1AVLA 3DUKA 3HOHA 4RNTA 4RZMA 3CMA3 3I0YA 4KFFA 4MMZB 2QEX3 4X2OA 4EW5A 1RRHA 1RN7A 2ZDJA 1LOWA 2IYJA 3EC9A 1JKGB 1JBRA 1YJ93 1UCJA 3DZLA 4H61A 3GZRA 3BU4A 3NBRA 4X2HA 2B24B 6RNTA 1VQ93 1W01A 4HBRA 4N6UA 3CPW2 4K61A 4G1MB 1UCKA 4WWUC 1IYYA 3T0UA 1GMPA 2F5MA 1IT8A 1RMSA 1JB2A 1PFPA 2HMKB 3LYGA 1CEWI 3A5EA 5CXOA 1STDA 3F14A 1JZDA 3B7CA 1MGRA 1M1K4 3FF0A 3CCS3 4XM4A 1WTHA 1RGEA 1JN5B 3NXJA 4LGQA 2WOHA 2KF6A 2KRTA 2Q07A 4OK0A 3U1WA 1BUQA 3LTCA 3SYUA 1B3SA 1IU7A 1MWTA 2W56A 4TX4A 4BTWA 1W6GA 2GXFA 3S28A 3BIRA 5IG4A 2JDIH 3WOEB 1YIT3 2F5WA 4CDLA 2CWUA 4WYKA 1I3IA 4FCJA 3UB1A 1T2HA 5STDA 4AKZA 1UGHI 4IIAA 2UGIA 1HYFA 4CPKA 3PXMA 3D9RA 3DGYA 5D83A 2A15A 3AMOA 1Q42A 2YFLB 1Q864 7STDA 3GSPA 1RKYA 3FH1A 1FGOA 1AV4A 1N5PA 5CF1A 1I2EA 2XH9A 3DM8A 3LT8A 1I0XA 2CG1A 1QJGA 1GD3A 3AGNA 3GZBA 3JUMA 4LZIA 4RNYA 5G1LA 1W2B2 3BB9A 4L8PA 2H0IA 3JUPA 5AI1A 3I563 3NQZA 1BRSA 4LYLB 1RGKA 2WGOA 3CCJ3 1DMNA 2HMJB 4HYZA 1TP6A 1BNEA 2XF3A 2W9QA 1O7PB 1L5GB 4BL2A 1Y4KA 4I4KA 2ZHXB 4L7KA 2ZL8A 1MOLA 2C10A 3ZFZA 4U13A 2R4IA 3MG2A 2L1SA 4ORLA 3D3LA 1FGTA 3FKAA 5ELUA 6STDA 2W03A 5JPPA 3OWYA 4WFOA 1ZS7A 3CNXA 1DETA 1G96A 1O7MB 4J5GA 1UCIA 3G4S3 4K1UA 4FMDA 1GMQA 1QALA 2CW9A 1W5ZA 3NV0B 1W00A 4HZBB 4XDVA 5FGOA 1T5YA 1UDII 2L4VA 3LTAA 1CYVA 2CFWA 1OUNA 2RGQA 2AADA 1FUTA 4FMCA 5BIRA 1RNTA 3EHCA 5M18A 4MMYB 3DH2A 1V58A 4STDA 1BGSA 3CCL3 1IVXA 1VZZA 1LNHA 5IG3A 1GYBA 2GBXB 1Q814 4EBGA 1N9JA 1FUWA 1FGQA 5HOHA 3LXUX 3F8HA 2BIRA 3A76A 4N6NB 8CHOA 4PEJA 4XBTA 1SQWA 1E3RA 2F86B 1KC84 1CYUA 4BTYA 1MNLA 1JB5A 2OTL3 1JB4A 3S5CA 3NQYA 3OWUA 1B2MA 1YNVX 1J2BA 1WMPA 2H0HA 3T8NA 2CX0A 3EX9A 1KQS2 3WMDA 3EN1B 3UL5A 1VQ43 2INXA 4GL6A 2QIYA 4AEQA 5AIIA 3CCU3 3NBBA 1UW1A 5JBSA 2J8XB 3VGNA 5HGRA 4N3VA 3EB8A 1IQXA 1FGMA 1Q824 1Q7Y4 3EQQB 1U5OA 5CLKA 1A2PA 1I0VA 3AMOB 1BNRA 1GY5A 1G02A 3F7SA 3PZWA 1YVBI 3PS8A 1OGXA 3AGOA 4FCZA 5AYSC 1FA3A 2AAEA 1OF5A 1W7CA 1VQP3 1JBSA 3HK4A 3KFQC 3N54B 2P0MA 1JBTA 2RSXA 3MSOA 2D42A 3HIIA 5TGNA 1YVSA 1DMMA 1C7HA 2P38A 3FSDA 1W6CA 2KF5A 1VQM3 3FGYA 3NUVA 4HZ9B 3TDGA 1NJI4 5AYRB 4MEIA 2W04A 5BXQA 2D1WA 2ML6A 2Z6BA 1NNVA 1BAOA 1OHPA 1TRQA 2F4YA 1BSAA 2V1LA 2CWTA 1KSIA 4NPBA 1VQN3 4I5QA 1QAKA 1FW7A 3B8LA 3K63A 5DREA 1YHQ3 4FMBA 2IUJA 1RTUA 1BANA 1NDOB 2HMMB 2ML5A 3KN4A 3BNEA 3IPTA 5EEOA 1BRHA 1TTOA 3Q90A 4N6OB 6GSPA 1STFI 2BHMA 3EF8A 3URPA 5IEOA 1DVCA 2BMRB 3LTDA 1DMQA 1NO3A 5AIGA 1ASKA 2F56A 4H3UA 5EVHA 1E3VA 1F8NA 1AVKA 2BMQB 3EN8A 1LOXA 3EBYA 3MWZA 2KAAA 4WP5A 3RGRA 3X3XA 1VQK3 1IV7A 1A2KA 2LYXA 3FG4A 2W9PA 3FF2A 4R9LA 2YX9A 1RN4A 2WO0A 1RRLA 3ZG5A 1RDSA 3CCQ3 1A90A 3Q1CA 3SX1A 3S67A 1K9M4 1E97A 1QMAA 4BL3A 5M19A 3SLUA 2CFGA 2E2UA 3JUOA 2RFRA 4FR9A 1PU4A 3M8CA 3MG1A 1ROVA 2CWVA 4HM7B 4MMXB 1IT7A 2OTJ3 1SPUA 1VQ63 3IJEB 3F40A 4RNZA 4R1KA 3CC43 1K8A4 2GEXA 3LOYA 1W02A 1NB5I 2OQEA 2QA43 2FNQA 2OOVC 3CC73 3GZYB 4HVNA 1GY6A 1KWIA 4J8TA 1ZGXA 2F98A 1VQL3 4NREA 1TUHA 3IMAB 2CG0A 1MGWA 4BU4A 4EV5A 1YJN3 3BLZA 1RGFA 1LNIA 1VQQA 3DMCA 1BNGA 1W6YA 3KKGA 2BMOB 1LVNA 1BVIA 3LT9A 3X40A 1WMNA 2OWPA 1UUGB 3EJVA 1N9EA 1EKMA 1T2IA 1US1A 3X41A 2KCDA 5IW9A 3WA3A 3STDA 4OUQA 4Q53A 5CK6A 2GSPA 3HX8A 1GS3A 1LOVA 1U8CB 4ILFA 1RGAA 2CX1A 5LC6A 3S27A 1IDPA 1BNSA 2PZVA 1SJWA 4LSOA 1UCLA 1RJOA 4JRFA
chains in the Genus database with same CATH topology
2O3OA 2BO9B 2W56B 3G8ZA 1OACA 2OOVA 1JNQA 3BNCA 4IPBA 1N8QA 3WA2X 3BNBA 4HJLB 2MF7A 4LEHA 1ZO2A 3K0ZA 1R4CA 1W2ZA 5AIFA 1IQ8A 3SOAA 1UUWB 1GY7A 1WQLB 2F99A 2XFTA 2IMJA 3FLJA 5KP1A 1EA2A 3LZAA 3NX0A 2CFDA 2K54A 3G713 1N5HA 2WGQA 1YIJ3 1OPYA 2CHCA 5IG5A 2E2VA 5AEWB 2HMOB 3LMLA 3X3YA 1IVWA 2XR8B 3FG1A 4OVMA 1WNHA 1K28A 4WHAA 1YI23 3VF1A 3PCRA 1D6ZA 3LTBA 1IV9A 3V92A 3SOYA 2P09A 3J7Yd 4JF8A 3GWRA 2Z77A 4KFDA 5ELJA 1JRQA 2P0XA 3JVCA 3NHXA 2Z76A 1UUVB 1Q40A 2Z7AA 4HM8B 3QRDA 3ECFA 3DGNA 3MKIA 3X3ZA 2GU1A 2WOFA 1VQ73 3NV0A 1OHOA 1KD14 2IUKA 4IT7A 5IERA 1Q40B 3F8XA 3PGBA 1DVDA 3CCE3 4HM4B 3G6E3 1N8R4 4N6MA 3H51A 4AKYA 4HM1B 1QVG2 1O7GB 4FCMA 1TIJA 3UNLA 3HI7A 1TU5A 3KSED 4HM2B 3O8YA 4HM3B 3ROBA 1O7WB 3RGAA 2W2CA 2XSHB 3OW22 2RCDA 2QGUA 2YFIB 4R9KA 5IG0A 1UI8A 2GU3A 3DY5A 4XBXA 1NWWA 3S29A 3QK9A 1TFOA 4HKVB 3X42A 5IEPA 3K9MC 3SVAA 3SEDA 2OCTA 2GEYA 1A67A 4R80A 2Y74A 1JJ22 3PCSA 5IENA 3K5TA 2YFJB 5JPUA 2FXTA 1K41A 2O9UX 3NBJA 1VQ53 3B4PA 3NM7A 4WYKB 4LMIA 1IQYA 1NB3I 3HIGA 3Q2PA 5A0OB 2LQVA 3SXXA 3LH4A 3V98A 1V74A 2W6JH 2GBWB 2P05A 4RBNA 3GAXA 1VQ83 1NU3A 1O7HB 4HM6B 3U97A 1HU9A 2CFLA 1VQO3 3F9SA 3G16A 1SIHA 1CQSA 2XRXB 3UJMA 1M1XB 1S723 1Z1SA 1YGEA 5D82A 1IK3A 1WMOA 2CKFB 3UL6A 2CH9A 4HM0B 3WODG 4EXRA 3JUQA 3KIIA 4K90B 1GD4A 2HMLB 3G0KA 3NM2A 4EV2A 4KFEA 1OHSA 3N9HA 5KP3A 1JN5A 3V99A 2M7OA 1OCVA 3KE7A 2E2TA 1OH0A 3H3HA 4KZ1A 3I553 4XDWA 3OWSA 3ALAA 1OGZA 5FW5A 2UX0A 2BT3A 3MG3A 1IVVA 3CNMA 2W0QA 2JQ5A 4MJDA 3DGOA 2B1XB 1M9GA 4XBYA 2FGTA 3GZXB 1ULJB 2CC3A 3CU3A 4QWTA 4EC6A 1EQKA 3DXOA 3CCR3 3OXAA 4R4KA 3EE1A 5KP4A 2XFSA 5D81A 1W4NA 3OV4A 2MC8A 2XGNA 4FMAA 3JUNA 1YJW3 2XGLA 3FG3A 2HMNB 3CD63 2IA7A 1ROAA 2CIUA 3CME3 1HKXA 3OX9A 2PNCA 1EG9B 3CPOA 4ZM8A 5CF2A 4O3VA 3FCSB 1M904 4L8OA 3CCV3 2XSOB 3FZWA 1TFKA 4N6V0 3HZPA 3WDGB 2CK3H 3CCM3 1DYUA 4J9AA 5I97A 3B4OA 1A2VA 2KXGA 1S5AA 4O02B 5AIHA 3KSPA 1ZX2A 1FGRA 1UI7A 2Y73A 3DGLA 3MPHA 1OF5B 3CC23 2OQEC 1IVUA 2K0MA 2XEPA 3E99A 3F7XA 3RDEA 3VSYA 3WOFB 3MHEA 4N6LA 1ISKA 1AR0A 1QAFA 4BTXA 3ER7A 1JKGA 3T8UA 3GRDA 1O7NB 3EBTA 2STDA 2BNGA 1QVF2 5EQLA 3CXC2 1D6YA 5G2GA 2SBLA 3L0RA 3DGMA 3MYTA 1ULIB 3K7CA 4XB5A 5AEUB 1LXEA 5DRVA 3KZTA 4HM5B 2I9WA 4KVHA 3PYJA 2CFKA 4GB5A 4NHFA 4EYCA 5IF6A 4N6TA 1JV2B 1D6UA 4CCVA 3BNDA 4K1VA 5BVBA 4O8SA 2C11A 3N8BA 4O2HA 1K734 1SIIA 5LC7A 1AVLA 3DUKA 4RZMA 3CMA3 3I0YA 4KFFA 4MMZB 2QEX3 4X2OA 1RRHA 1RN7A 2ZDJA 3EC9A 1JKGB 1YJ93 4H61A 3DZLA 3GZRA 3NBRA 4X2HA 2B24B 1VQ93 1W01A 4HBRA 4N6UA 3CPW2 4K61A 4G1MB 4WWUC 3T0UA 1IT8A 1JB2A 1PFPA 2HMKB 3LYGA 1CEWI 5CXOA 1STDA 3F14A 3B7CA 1M1K4 3FF0A 3CCS3 4XM4A 1WTHA 1JN5B 3NXJA 4LGQA 2WOHA 2KRTA 2Q07A 4OK0A 3U1WA 1BUQA 3LTCA 1IU7A 2W56A 4TX4A 4BTWA 1W6GA 2GXFA 3S28A 5IG4A 2JDIH 3WOEB 1YIT3 4CDLA 2CWUA 4WYKA 4FCJA 3UB1A 5STDA 4AKZA 4IIAA 3PXMA 3D9RA 5D83A 2A15A 3AMOA 1Q42A 2YFLB 1Q864 7STDA 1RKYA 3FH1A 1FGOA 1AV4A 1N5PA 5CF1A 2XH9A 3DM8A 3LT8A 2CG1A 1QJGA 1GD3A 3JUMA 3GZBA 4LZIA 4RNYA 1W2B2 3BB9A 4L8PA 3JUPA 5AI1A 3I563 3NQZA 3CCJ3 2WGOA 1DMNA 2HMJB 4HYZA 1TP6A 2XF3A 2W9QA 1O7PB 1L5GB 1Y4KA 4I4KA 4L7KA 2ZL8A 1MOLA 2C10A 4U13A 2R4IA 3MG2A 4ORLA 3D3LA 1FGTA 3FKAA 5ELUA 6STDA 2W03A 5JPPA 3OWYA 4WFOA 3CNXA 1G96A 1O7MB 3G4S3 4K1UA 4FMDA 1QALA 2CW9A 1W5ZA 3NV0B 1W00A 4HZBB 4XDVA 5FGOA 1T5YA 2L4VA 3LTAA 1CYVA 2CFWA 1OUNA 2RGQA 4FMCA 3EHCA 4MMYB 4STDA 3CCL3 1IVXA 1VZZA 1LNHA 5IG3A 1GYBA 2GBXB 1Q814 4EBGA 1N9JA 1FUWA 1FGQA 3LXUX 3F8HA 4N6NB 3A76A 8CHOA 4PEJA 4XBTA 1SQWA 1E3RA 2F86B 1KC84 1CYUA 4BTYA 1MNLA 1JB5A 2OTL3 1JB4A 3S5CA 3NQYA 3OWUA 1J2BA 1WMPA 3T8NA 3EX9A 1KQS2 3WMDA 3EN1B 3UL5A 1VQ43 2INXA 4GL6A 2QIYA 4AEQA 5AIIA 3CCU3 3NBBA 1UW1A 5JBSA 3VGNA 5HGRA 4N3VA 3EB8A 1IQXA 1FGMA 1Q824 1Q7Y4 3EQQB 1U5OA 5CLKA 3AMOB 1GY5A 3F7SA 3PZWA 1YVBI 3PS8A 1OGXA 4FCZA 1FA3A 5AYSC 1OF5A 1W7CA 1VQP3 3HK4A 3KFQC 3N54B 2P0MA 2RSXA 3MSOA 2D42A 3HIIA 5TGNA 1DMMA 1C7HA 2P38A 3FSDA 1W6CA 1VQM3 3FGYA 3NUVA 4HZ9B 3TDGA 1NJI4 5AYRB 4MEIA 2W04A 5BXQA 2D1WA 2ML6A 2Z6BA 1OHPA 2V1LA 2CWTA 1KSIA 1VQN3 1QAKA 3B8LA 3K63A 5DREA 1YHQ3 4FMBA 2IUJA 1NDOB 2HMMB 2ML5A 3KN4A 3BNEA 3IPTA 5EEOA 3Q90A 4N6OB 1STFI 2BHMA 3EF8A 5IEOA 1DVCA 2BMRB 3LTDA 1NO3A 5AIGA 1ASKA 4H3UA 5EVHA 1E3VA 1F8NA 1AVKA 2BMQB 3EN8A 1LOXA 3EBYA 3MWZA 3RGRA 4WP5A 3X3XA 1VQK3 1IV7A 1A2KA 2LYXA 3FG4A 2W9PA 3FF2A 4R9LA 2YX9A 2WO0A 1RRLA 3CCQ3 1A90A 3Q1CA 3SX1A 3S67A 1K9M4 1E97A 1QMAA 3SLUA 2CFGA 2E2UA 3JUOA 2RFRA 4FR9A 1PU4A 3M8CA 3MG1A 1ROVA 2CWVA 4HM7B 4MMXB 1IT7A 2OTJ3 1SPUA 1VQ63 3IJEB 3F40A 4RNZA 4R1KA 3CC43 1K8A4 2GEXA 3LOYA 1W02A 1NB5I 2OQEA 2QA43 2FNQA 2OOVC 3CC73 3GZYB 4HVNA 1GY6A 1KWIA 4J8TA 2F98A 1VQL3 4NREA 1TUHA 3IMAB 2CG0A 4EV5A 1YJN3 3BLZA 3DMCA 1W6YA 3KKGA 3LT9A 1LVNA 2BMOB 3X40A 1WMNA 2OWPA 3EJVA 1N9EA 1EKMA 1US1A 3X41A 5IW9A 2KCDA 3WA3A 3STDA 4OUQA 4Q53A 5CK6A 3HX8A 1GS3A 1U8CB 5LC6A 3S27A 1IDPA 4LSOA 2PZVA 1SJWA 1DMQA 1RJOA 4JRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0Y A;  3T8N A;  3EX9 A;  3WMD A;  3EN1 B;  1Z1S A;  4X2O A;  2INX A;  2QIY A;  3G8Z A;  5AII A;  5D82 A;  3EC9 A;  1JKG B;  2CKF B;  3DZL A;  3GZR A;  4HJL B;  3VGN A;  4HM0 B;  5HGR A;  4LEH A;  4N3V A;  3NBR A;  4X2H A;  2B24 B;  3JUQ A;  1ZO2 A;  1W01 A;  1U5O A;  3EQQ B;  3K0Z A;  5CLK A;  5AIF A;  2HML B;  1GY5 A;  3G0K A;  3F7S A;  3SOA A;  1UUW B;  3NM2 A;  1GY7 A;  1WQL B;  1OGX A;  2F99 A;  3OWU A;  1OHS A;  2IMJ A;  3FLJ A;  4WWU C;  1EA2 A;  3LZA A;  1JN5 A;  1JB2 A;  1OF5 A;  5KP3 A;  3SED A;  1OCV A;  2HMK B;  3HK4 A;  3LYG A;  3KE7 A;  2K54 A;  5CXO A;  3MSO A;  1OH0 A;  3H3H A;  5TGN A;  1DMM A;  1C7H A;  3FSD A;  1STD A;  1OPY A;  2CHC A;  3F14 A;  4XDW A;  3B7C A;  5IG5 A;  5AEW B;  3FGY A;  2HMO B;  3FF0 A;  3OWS A;  4XM4 A;  3NUV A;  1OGZ A;  4HZ9 B;  5FW5 A;  2UX0 A;  1JN5 B;  3NXJ A;  3MG3 A;  4LGQ A;  2XR8 B;  3CNM A;  2JQ5 A;  4MJD A;  4OVM A;  1BUQ A;  2B1X B;  4XBY A;  3GZX B;  5BXQ A;  1ULJ B;  2GXF A;  3CU3 A;  5IG4 A;  1OHP A;  3DXO A;  3SOY A;  4CDL A;  4WYK A;  3OXA A;  3GWR A;  2Z77 A;  3B8L A;  4FCJ A;  5DRE A;  5STD A;  5KP4 A;  4IIA A;  5D81 A;  1NDO B;  2HMM B;  3NHX A;  3OV4 A;  2Z76 A;  3IPT A;  1UUV B;  1Q40 A;  2Z7A A;  2PZV A;  3Q90 A;  4HM8 B;  3JUN A;  3ECF A;  5IER A;  3EF8 A;  3D9R A;  3MKI A;  5D83 A;  2A15 A;  2HMN B;  1Q42 A;  5IEO A;  2BMR B;  2YFL B;  7STD A;  3NV0 A;  5AIG A;  1HKX A;  1OHO A;  3FH1 A;  3OX9 A;  3ROB A;  1ASK A;  4H3U A;  5EVH A;  5CF1 A;  1E3V A;  2BMQ B;  1EG9 B;  3CPO A;  3DM8 A;  3EN8 A;  1Q40 B;  1QJG A;  3EBY A;  3F8X A;  3JUM A;  3GZB A;  4WP5 A;  5CF2 A;  1A2K A;  3BB9 A;  4R9L A;  3FF2 A;  4L8O A;  4HM4 B;  4L8P A;  2XSO B;  3JUP A;  5AI1 A;  3FZW A;  3H51 A;  4HM1 B;  1O7G B;  3HZP A;  1DMN A;  2HMJ B;  4FCM A;  1TP6 A;  3UNL A;  4J9A A;  1O7P B;  3B4O A;  3RGR A;  1E97 A;  1QMA A;  1S5A A;  4HM2 B;  4HM3 B;  4I4K A;  3KSP A;  5AIH A;  1ZX2 A;  3JUO A;  1O7W B;  2RFR A;  3RGA A;  2W2C A;  3M8C A;  3MG1 A;  4L7K A;  5KP1 A;  4HM7 B;  1OF5 B;  3F7X A;  3E99 A;  2XSH B;  3VSY A;  2RCD A;  4U13 A;  2R4I A;  3F40 A;  2QGU A;  3MG2 A;  3MHE A;  2YFI B;  4ORL A;  3FKA A;  4R9K A;  4R1K A;  1AR0 A;  5IG0 A;  6STD A;  3OWY A;  5JPP A;  1ISK A;  3CNX A;  2GEX A;  3ER7 A;  4XBX A;  1NWW A;  1W02 A;  1O7M B;  4HKV B;  5IEP A;  1JKG A;  4K1U A;  3T8U A;  3GRD A;  3UJM A;  1O7N B;  3GZY B;  3NV0 B;  3EBT A;  1GY6 A;  2GEY A;  1W00 A;  2STD A;  4HVN A;  2BNG A;  4J8T A;  4HZB B;  2F98 A;  4XDV A;  5IEN A;  5G2G A;  2YFJ B;  5JPU A;  1TUH A;  1OUN A;  2RGQ A;  3MYT A;  1ULI B;  3K7C A;  1K41 A;  3EHC A;  4XB5 A;  5AEU B;  5DRV A;  3KZT A;  4HM5 B;  2I9W A;  4KVH A;  3BLZ A;  3B4P A;  4STD A;  4GB5 A;  3DMC A;  4RZM A;  5IF6 A;  1W6Y A;  3KKG A;  4WYK B;  2BMO B;  4LMI A;  1VZZ A;  5IG3 A;  1GYB A;  2GBX B;  2OWP A;  3EJV A;  3F8H A;  3A76 A;  4K1V A;  5BVB A;  2GBW B;  3STD A;  4OUQ A;  4PEJ A;  4Q53 A;  5CK6 A;  4XBT A;  3HX8 A;  8CHO A;  1E3R A;  2F86 B;  1GS3 A;  1NU3 A;  1O7H B;  4HM6 B;  1JB5 A;  1JB4 A;  3F9S A;  3S5C A;  3G16 A;  1IDP A;  2XRX B;  1CQS A;  1SJW A;  3DUK A;  1DMQ A; 
#chains in the Genus database with same CATH topology
 2O3O A;  2BO9 B;  1B2S A;  2W56 B;  2K3D A;  3G8Z A;  1OAC A;  2ZA4 A;  2OOV A;  1JNQ A;  3BNC A;  5G1K A;  4IPB A;  1N8Q A;  3WA2 X;  3BNB A;  4HJL B;  2MF7 A;  4LEH A;  1ZO2 A;  3ZG0 A;  3K0Z A;  1R4C A;  1W2Z A;  5AIF A;  1IQ8 A;  3SOA A;  1UUW B;  1GY7 A;  1WQL B;  2F99 A;  2XFT A;  4BIR A;  2IMJ A;  3FLJ A;  5KP1 A;  1EA2 A;  3LZA A;  3NX0 A;  2RBI A;  4KT3 B;  2CFD A;  2K54 A;  3G71 3;  1N5H A;  1JZO A;  2WGQ A;  1YIJ 3;  1OPY A;  2CHC A;  5IG5 A;  2E2V A;  4GHO A;  5AEW B;  2HMO B;  3LML A;  1I8V A;  3X3Y A;  7RNT A;  1IVW A;  2XR8 B;  3FG1 A;  4OVM A;  1WNH A;  1K28 A;  4WHA A;  1YI2 3;  1LQM B;  3VF1 A;  3PCR A;  1D6Z A;  3LTB A;  1AQZ A;  1B2U A;  1IV9 A;  3V92 A;  9RNT A;  1I2G A;  3SOY A;  2P09 A;  3J7Y d;  1RCL A;  4JF8 A;  3GWR A;  2Z77 A;  4KFD A;  5ELJ A;  1JRQ A;  1RHL A;  2P0X A;  3JVC A;  1BNI A;  3NHX A;  2Z76 A;  1UUV B;  1Q40 A;  2Z7A A;  5BU4 A;  4HM8 B;  3QRD A;  3ECF A;  1LRA A;  3DGN A;  3MKI A;  3X3Z A;  2GU1 A;  2WOF A;  1VQ7 3;  3NV0 A;  1B2Z A;  1OHO A;  1BRK A;  1KD1 4;  1PYL A;  2IUK A;  1RLS A;  4IT7 A;  1B21 A;  2R41 A;  1RGC A;  1Q40 B;  1HZ1 A;  3F8X A;  5IER A;  3PGB A;  1DVD A;  3CCE 3;  2SAR A;  1FUS A;  1GOY A;  4HM4 B;  4N6M A;  3G6E 3;  1N8R 4;  2UUG C;  1AY7 A;  3H51 A;  4AKY A;  4HM1 B;  1QVG 2;  1O7G B;  4FCM A;  1LOY A;  1TIJ A;  1X1Y A;  3HI7 A;  3UNL A;  1TU5 A;  1BNJ A;  3KSE D;  1DE3 A;  4HM2 B;  3O8Y A;  4HM3 B;  3ROB A;  1BRI A;  1O7W B;  3RGA A;  2W2C A;  3RNT A;  1RN1 A;  1RCK A;  4HAA A;  2C4B A;  2XSH B;  3OW2 2;  2RCD A;  2QGU A;  2YFI B;  4R9K A;  5IG0 A;  1UI8 A;  1MWU A;  2GU3 A;  3DY5 A;  5GSP A;  4XBX A;  1NWW A;  3S29 A;  3QK9 A;  1TFO A;  4HKV B;  3X42 A;  5IEP A;  3K9M C;  3Q3F A;  3SVA A;  1BIR A;  3SED A;  2OCT A;  2GEY A;  1A67 A;  1LQG C;  4R80 A;  2Y74 A;  1JJ2 2;  3PCS A;  5IEN A;  3K5T A;  2YFJ B;  5JPU A;  5RNT A;  2FXT A;  1K41 A;  4DKI A;  2O9U X;  3NBJ A;  8RNT A;  4HOH A;  3D5I A;  3B4P A;  1VQ5 3;  1MWS A;  3NM7 A;  4WYK B;  4LMI A;  1IQY A;  1NB3 I;  3HIG A;  3Q2P A;  5A0O B;  2LQV A;  1FYS A;  3SXX A;  3LH4 A;  1TRP A;  2RNT A;  3V98 A;  1R4Y A;  1V74 A;  3D5G A;  2W6J H;  2GBW B;  2P05 A;  4RBN A;  2BU4 A;  3GAX A;  1VQ8 3;  1NU3 A;  1O7H B;  1GMR A;  2IY2 A;  2CFL A;  1HU9 A;  4HM6 B;  3U97 A;  1VQO 3;  3F9S A;  3G16 A;  1GSP A;  1FZU A;  1SIH A;  1CQS A;  1GOU A;  2XRX B;  3D4A A;  3UJM A;  1SAR A;  1M1X B;  1S72 3;  1UGI A;  1Z1S A;  1YGE A;  1BSB A;  5D82 A;  1IK3 A;  1WMO A;  2CKF B;  3UL6 A;  1C54 A;  2CH9 A;  1RGL A;  4HM0 B;  3WOD G;  4EXR A;  1BRG A;  3WHO A;  3JUQ A;  1V57 A;  3KII A;  4K90 B;  1GD4 A;  2HML B;  1YGW A;  3G0K A;  1G0T A;  3NM2 A;  4EV2 A;  4J5K A;  4KFE A;  1RNB A;  1OHS A;  3N9H A;  5KP3 A;  1JN5 A;  3V99 A;  2M7O A;  1OCV A;  1X1W A;  3KE7 A;  2KF4 A;  1RGG A;  2E2T A;  1OH0 A;  1T3B A;  3H3H A;  4KZ1 A;  3I55 3;  4XDW A;  1I2F A;  4CJN A;  3OWS A;  3ALA A;  1OGZ A;  5FW5 A;  2UX0 A;  2BT3 A;  3MG3 A;  1IVV A;  3CNM A;  2W0Q A;  2JQ5 A;  4MJD A;  3DGO A;  1X1X A;  7GSP A;  1BRN L;  2B1X B;  1M9G A;  1Q7H A;  2FGT A;  3GZX B;  1GOV A;  4XBY A;  1ULJ B;  2CC3 A;  3AHW A;  3CU3 A;  4QWT A;  4EC6 A;  1EQK A;  3DXO A;  3CCR 3;  3OXA A;  4R4K A;  3EE1 A;  5KP4 A;  2XFS A;  5D81 A;  1W4N A;  3OV4 A;  1B27 A;  2MC8 A;  2XGN A;  4FMA A;  3WR2 A;  1X1U A;  3JUN A;  1YJW 3;  2XGL A;  3FG3 A;  2HMN B;  3CD6 3;  2IA7 A;  1ROA A;  2CIU A;  3CME 3;  1HKX A;  3OX9 A;  2HOH A;  2PNC A;  1BSE A;  1BUJ A;  1BOX A;  1PY3 A;  1EG9 B;  3CPO A;  4ZM8 A;  1BNF A;  5CF2 A;  4O3V A;  3FCS B;  1M90 4;  4L8O A;  3CCV 3;  2XSO B;  3FZW A;  1TFK A;  4N6V 0;  3HZP A;  3WDG B;  2CK3 H;  3CCM 3;  1DYU A;  4J9A A;  5I97 A;  3B4O A;  1A2V A;  1B20 A;  2KXG A;  1S5A A;  4O02 B;  5AIH A;  1BSC A;  3KSP A;  1ZX2 A;  2H0G A;  1FGR A;  1UI7 A;  2Y73 A;  3DGL A;  3MPH A;  1OF5 B;  3CC2 3;  1Q9E A;  1IVU A;  2K0M A;  2OQE C;  2XEP A;  3E99 A;  3F7X A;  3RDE A;  3VSY A;  3WOF B;  3MHE A;  4N6L A;  1ISK A;  1AR0 A;  1BU4 A;  1QAF A;  1TJD A;  3D79 A;  4BTX A;  1RGH A;  3ER7 A;  1JKG A;  3T8U A;  3GRD A;  1EUI C;  1O7N B;  3EBT A;  2STD A;  2BNG A;  1QVF 2;  5EQL A;  3CXC 2;  1D6Y A;  5G2G A;  1CH0 A;  2SBL A;  3L0R A;  3DGM A;  3MYT A;  1ULI B;  3K7C A;  4XB5 A;  5AEU B;  1LXE A;  1BRJ A;  5DRV A;  3KZT A;  4HM5 B;  2I9W A;  4KVH A;  3PYJ A;  2CFK A;  1MWR A;  4GB5 A;  4NHF A;  4EYC A;  5IF6 A;  1B2X A;  4GSP A;  1I70 A;  4N6T A;  1JV2 B;  2KF3 A;  1D6U A;  4CCV A;  3BND A;  4K1V A;  5M1A A;  4O8S A;  5BVB A;  2C11 A;  3N8B A;  3AHS A;  1BSD A;  1RSN A;  1I3F A;  3KCH A;  1EEJ A;  4O2H A;  1K73 4;  1SII A;  5LC7 A;  1AVL A;  3DUK A;  3HOH A;  4RNT A;  4RZM A;  3CMA 3;  3I0Y A;  4KFF A;  4MMZ B;  2QEX 3;  4X2O A;  4EW5 A;  1RRH A;  1RN7 A;  2ZDJ A;  1LOW A;  2IYJ A;  3EC9 A;  1JKG B;  1JBR A;  1YJ9 3;  1UCJ A;  3DZL A;  4H61 A;  3GZR A;  3BU4 A;  3NBR A;  4X2H A;  2B24 B;  6RNT A;  1VQ9 3;  1W01 A;  4HBR A;  4N6U A;  3CPW 2;  4K61 A;  4G1M B;  1UCK A;  4WWU C;  1IYY A;  3T0U A;  1GMP A;  2F5M A;  1IT8 A;  1RMS A;  1JB2 A;  1PFP A;  2HMK B;  3LYG A;  1CEW I;  3A5E A;  5CXO A;  1STD A;  3F14 A;  1JZD A;  3B7C A;  1MGR A;  1M1K 4;  3FF0 A;  3CCS 3;  4XM4 A;  1WTH A;  1RGE A;  1JN5 B;  3NXJ A;  4LGQ A;  2WOH A;  2KF6 A;  2KRT A;  2Q07 A;  4OK0 A;  3U1W A;  1BUQ A;  3LTC A;  3SYU A;  1B3S A;  1IU7 A;  1MWT A;  2W56 A;  4TX4 A;  4BTW A;  1W6G A;  2GXF A;  3S28 A;  3BIR A;  5IG4 A;  2JDI H;  3WOE B;  1YIT 3;  2F5W A;  4CDL A;  2CWU A;  4WYK A;  1I3I A;  4FCJ A;  3UB1 A;  1T2H A;  5STD A;  4AKZ A;  1UGH I;  4IIA A;  2UGI A;  1HYF A;  4CPK A;  3PXM A;  3D9R A;  3DGY A;  5D83 A;  2A15 A;  3AMO A;  1Q42 A;  2YFL B;  1Q86 4;  7STD A;  3GSP A;  1RKY A;  3FH1 A;  1FGO A;  1AV4 A;  1N5P A;  5CF1 A;  1I2E A;  2XH9 A;  3DM8 A;  3LT8 A;  1I0X A;  2CG1 A;  1QJG A;  1GD3 A;  3AGN A;  3GZB A;  3JUM A;  4LZI A;  4RNY A;  5G1L A;  1W2B 2;  3BB9 A;  4L8P A;  2H0I A;  3JUP A;  5AI1 A;  3I56 3;  3NQZ A;  1BRS A;  4LYL B;  1RGK A;  2WGO A;  3CCJ 3;  1DMN A;  2HMJ B;  4HYZ A;  1TP6 A;  1BNE A;  2XF3 A;  2W9Q A;  1O7P B;  1L5G B;  4BL2 A;  1Y4K A;  4I4K A;  2ZHX B;  4L7K A;  2ZL8 A;  1MOL A;  2C10 A;  3ZFZ A;  4U13 A;  2R4I A;  3MG2 A;  2L1S A;  4ORL A;  3D3L A;  1FGT A;  3FKA A;  5ELU A;  6STD A;  2W03 A;  5JPP A;  3OWY A;  4WFO A;  1ZS7 A;  3CNX A;  1DET A;  1G96 A;  1O7M B;  4J5G A;  1UCI A;  3G4S 3;  4K1U A;  4FMD A;  1GMQ A;  1QAL A;  2CW9 A;  1W5Z A;  3NV0 B;  1W00 A;  4HZB B;  4XDV A;  5FGO A;  1T5Y A;  1UDI I;  2L4V A;  3LTA A;  1CYV A;  2CFW A;  1OUN A;  2RGQ A;  2AAD A;  1FUT A;  4FMC A;  5BIR A;  1RNT A;  3EHC A;  5M18 A;  4MMY B;  3DH2 A;  1V58 A;  4STD A;  1BGS A;  3CCL 3;  1IVX A;  1VZZ A;  1LNH A;  5IG3 A;  1GYB A;  2GBX B;  1Q81 4;  4EBG A;  1N9J A;  1FUW A;  1FGQ A;  5HOH A;  3LXU X;  3F8H A;  2BIR A;  3A76 A;  4N6N B;  8CHO A;  4PEJ A;  4XBT A;  1SQW A;  1E3R A;  2F86 B;  1KC8 4;  1CYU A;  4BTY A;  1MNL A;  1JB5 A;  2OTL 3;  1JB4 A;  3S5C A;  3NQY A;  3OWU A;  1B2M A;  1YNV X;  1J2B A;  1WMP A;  2H0H A;  3T8N A;  2CX0 A;  3EX9 A;  1KQS 2;  3WMD A;  3EN1 B;  3UL5 A;  1VQ4 3;  2INX A;  4GL6 A;  2QIY A;  4AEQ A;  5AII A;  3CCU 3;  3NBB A;  1UW1 A;  5JBS A;  2J8X B;  3VGN A;  5HGR A;  4N3V A;  3EB8 A;  1IQX A;  1FGM A;  1Q82 4;  1Q7Y 4;  3EQQ B;  1U5O A;  5CLK A;  1A2P A;  1I0V A;  3AMO B;  1BNR A;  1GY5 A;  1G02 A;  3F7S A;  3PZW A;  1YVB I;  3PS8 A;  1OGX A;  3AGO A;  4FCZ A;  5AYS C;  1FA3 A;  2AAE A;  1OF5 A;  1W7C A;  1VQP 3;  1JBS A;  3HK4 A;  3KFQ C;  3N54 B;  2P0M A;  1JBT A;  2RSX A;  3MSO A;  2D42 A;  3HII A;  5TGN A;  1YVS A;  1DMM A;  1C7H A;  2P38 A;  3FSD A;  1W6C A;  2KF5 A;  1VQM 3;  3FGY A;  3NUV A;  4HZ9 B;  3TDG A;  1NJI 4;  5AYR B;  4MEI A;  2W04 A;  5BXQ A;  2D1W A;  2ML6 A;  2Z6B A;  1NNV A;  1BAO A;  1OHP A;  1TRQ A;  2F4Y A;  1BSA A;  2V1L A;  2CWT A;  1KSI A;  4NPB A;  1VQN 3;  4I5Q A;  1QAK A;  1FW7 A;  3B8L A;  3K63 A;  5DRE A;  1YHQ 3;  4FMB A;  2IUJ A;  1RTU A;  1BAN A;  1NDO B;  2HMM B;  2ML5 A;  3KN4 A;  3BNE A;  3IPT A;  5EEO A;  1BRH A;  1TTO A;  3Q90 A;  4N6O B;  6GSP A;  1STF I;  2BHM A;  3EF8 A;  3URP A;  5IEO A;  1DVC A;  2BMR B;  3LTD A;  1DMQ A;  1NO3 A;  5AIG A;  1ASK A;  2F56 A;  4H3U A;  5EVH A;  1E3V A;  1F8N A;  1AVK A;  2BMQ B;  3EN8 A;  1LOX A;  3EBY A;  3MWZ A;  2KAA A;  4WP5 A;  3RGR A;  3X3X A;  1VQK 3;  1IV7 A;  1A2K A;  2LYX A;  3FG4 A;  2W9P A;  3FF2 A;  4R9L A;  2YX9 A;  1RN4 A;  2WO0 A;  1RRL A;  3ZG5 A;  1RDS A;  3CCQ 3;  1A90 A;  3Q1C A;  3SX1 A;  3S67 A;  1K9M 4;  1E97 A;  1QMA A;  4BL3 A;  5M19 A;  3SLU A;  2CFG A;  2E2U A;  3JUO A;  2RFR A;  4FR9 A;  1PU4 A;  3M8C A;  3MG1 A;  1ROV A;  2CWV A;  4HM7 B;  4MMX B;  1IT7 A;  2OTJ 3;  1SPU A;  1VQ6 3;  3IJE B;  3F40 A;  4RNZ A;  4R1K A;  3CC4 3;  1K8A 4;  2GEX A;  3LOY A;  1W02 A;  1NB5 I;  2OQE A;  2QA4 3;  2FNQ A;  2OOV C;  3CC7 3;  3GZY B;  4HVN A;  1GY6 A;  1KWI A;  4J8T A;  1ZGX A;  2F98 A;  1VQL 3;  4NRE A;  1TUH A;  3IMA B;  2CG0 A;  1MGW A;  4BU4 A;  4EV5 A;  1YJN 3;  3BLZ A;  1RGF A;  1LNI A;  1VQQ A;  3DMC A;  1BNG A;  1W6Y A;  3KKG A;  2BMO B;  1LVN A;  1BVI A;  3LT9 A;  3X40 A;  1WMN A;  2OWP A;  1UUG B;  3EJV A;  1N9E A;  1EKM A;  1T2I A;  1US1 A;  3X41 A;  2KCD A;  5IW9 A;  3WA3 A;  3STD A;  4OUQ A;  4Q53 A;  5CK6 A;  2GSP A;  3HX8 A;  1GS3 A;  1LOV A;  1U8C B;  4ILF A;  1RGA A;  2CX1 A;  5LC6 A;  3S27 A;  1IDP A;  1BNS A;  2PZV A;  1SJW A;  4LSO A;  1UCL A;  1RJO A;  4JRF A; 
#chains in the Genus database with same CATH homology
 2O3O A;  2BO9 B;  2W56 B;  3G8Z A;  1OAC A;  2OOV A;  1JNQ A;  3BNC A;  4IPB A;  1N8Q A;  3WA2 X;  3BNB A;  4HJL B;  2MF7 A;  4LEH A;  1ZO2 A;  3K0Z A;  1R4C A;  1W2Z A;  5AIF A;  1IQ8 A;  3SOA A;  1UUW B;  1GY7 A;  1WQL B;  2F99 A;  2XFT A;  2IMJ A;  3FLJ A;  5KP1 A;  1EA2 A;  3LZA A;  3NX0 A;  2CFD A;  2K54 A;  3G71 3;  1N5H A;  2WGQ A;  1YIJ 3;  1OPY A;  2CHC A;  5IG5 A;  2E2V A;  5AEW B;  2HMO B;  3LML A;  3X3Y A;  1IVW A;  2XR8 B;  3FG1 A;  4OVM A;  1WNH A;  1K28 A;  4WHA A;  1YI2 3;  3VF1 A;  3PCR A;  1D6Z A;  3LTB A;  1IV9 A;  3V92 A;  3SOY A;  2P09 A;  3J7Y d;  4JF8 A;  3GWR A;  2Z77 A;  4KFD A;  5ELJ A;  1JRQ A;  2P0X A;  3JVC A;  3NHX A;  2Z76 A;  1UUV B;  1Q40 A;  2Z7A A;  4HM8 B;  3QRD A;  3ECF A;  3DGN A;  3MKI A;  3X3Z A;  2GU1 A;  2WOF A;  1VQ7 3;  3NV0 A;  1OHO A;  1KD1 4;  2IUK A;  4IT7 A;  5IER A;  1Q40 B;  3F8X A;  3PGB A;  1DVD A;  3CCE 3;  4HM4 B;  3G6E 3;  1N8R 4;  4N6M A;  3H51 A;  4AKY A;  4HM1 B;  1QVG 2;  1O7G B;  4FCM A;  1TIJ A;  3UNL A;  3HI7 A;  1TU5 A;  3KSE D;  4HM2 B;  3O8Y A;  4HM3 B;  3ROB A;  1O7W B;  3RGA A;  2W2C A;  2XSH B;  3OW2 2;  2RCD A;  2QGU A;  2YFI B;  4R9K A;  5IG0 A;  1UI8 A;  2GU3 A;  3DY5 A;  4XBX A;  1NWW A;  3S29 A;  3QK9 A;  1TFO A;  4HKV B;  3X42 A;  5IEP A;  3K9M C;  3SVA A;  3SED A;  2OCT A;  2GEY A;  1A67 A;  4R80 A;  2Y74 A;  1JJ2 2;  3PCS A;  5IEN A;  3K5T A;  2YFJ B;  5JPU A;  2FXT A;  1K41 A;  2O9U X;  3NBJ A;  1VQ5 3;  3B4P A;  3NM7 A;  4WYK B;  4LMI A;  1IQY A;  1NB3 I;  3HIG A;  3Q2P A;  5A0O B;  2LQV A;  3SXX A;  3LH4 A;  3V98 A;  1V74 A;  2W6J H;  2GBW B;  2P05 A;  4RBN A;  3GAX A;  1VQ8 3;  1NU3 A;  1O7H B;  4HM6 B;  3U97 A;  1HU9 A;  2CFL A;  1VQO 3;  3F9S A;  3G16 A;  1SIH A;  1CQS A;  2XRX B;  3UJM A;  1M1X B;  1S72 3;  1Z1S A;  1YGE A;  5D82 A;  1IK3 A;  1WMO A;  2CKF B;  3UL6 A;  2CH9 A;  4HM0 B;  3WOD G;  4EXR A;  3JUQ A;  3KII A;  4K90 B;  1GD4 A;  2HML B;  3G0K A;  3NM2 A;  4EV2 A;  4KFE A;  1OHS A;  3N9H A;  5KP3 A;  1JN5 A;  3V99 A;  2M7O A;  1OCV A;  3KE7 A;  2E2T A;  1OH0 A;  3H3H A;  4KZ1 A;  3I55 3;  4XDW A;  3OWS A;  3ALA A;  1OGZ A;  5FW5 A;  2UX0 A;  2BT3 A;  3MG3 A;  1IVV A;  3CNM A;  2W0Q A;  2JQ5 A;  4MJD A;  3DGO A;  2B1X B;  1M9G A;  4XBY A;  2FGT A;  3GZX B;  1ULJ B;  2CC3 A;  3CU3 A;  4QWT A;  4EC6 A;  1EQK A;  3DXO A;  3CCR 3;  3OXA A;  4R4K A;  3EE1 A;  5KP4 A;  2XFS A;  5D81 A;  1W4N A;  3OV4 A;  2MC8 A;  2XGN A;  4FMA A;  3JUN A;  1YJW 3;  2XGL A;  3FG3 A;  2HMN B;  3CD6 3;  2IA7 A;  1ROA A;  2CIU A;  3CME 3;  1HKX A;  3OX9 A;  2PNC A;  1EG9 B;  3CPO A;  4ZM8 A;  5CF2 A;  4O3V A;  3FCS B;  1M90 4;  4L8O A;  3CCV 3;  2XSO B;  3FZW A;  1TFK A;  4N6V 0;  3HZP A;  3WDG B;  2CK3 H;  3CCM 3;  1DYU A;  4J9A A;  5I97 A;  3B4O A;  1A2V A;  2KXG A;  1S5A A;  4O02 B;  5AIH A;  3KSP A;  1ZX2 A;  1FGR A;  1UI7 A;  2Y73 A;  3DGL A;  3MPH A;  1OF5 B;  3CC2 3;  2OQE C;  1IVU A;  2K0M A;  2XEP A;  3E99 A;  3F7X A;  3RDE A;  3VSY A;  3WOF B;  3MHE A;  4N6L A;  1ISK A;  1AR0 A;  1QAF A;  4BTX A;  3ER7 A;  1JKG A;  3T8U A;  3GRD A;  1O7N B;  3EBT A;  2STD A;  2BNG A;  1QVF 2;  5EQL A;  3CXC 2;  1D6Y A;  5G2G A;  2SBL A;  3L0R A;  3DGM A;  3MYT A;  1ULI B;  3K7C A;  4XB5 A;  5AEU B;  1LXE A;  5DRV A;  3KZT A;  4HM5 B;  2I9W A;  4KVH A;  3PYJ A;  2CFK A;  4GB5 A;  4NHF A;  4EYC A;  5IF6 A;  4N6T A;  1JV2 B;  1D6U A;  4CCV A;  3BND A;  4K1V A;  5BVB A;  4O8S A;  2C11 A;  3N8B A;  4O2H A;  1K73 4;  1SII A;  5LC7 A;  1AVL A;  3DUK A;  4RZM A;  3CMA 3;  3I0Y A;  4KFF A;  4MMZ B;  2QEX 3;  4X2O A;  1RRH A;  1RN7 A;  2ZDJ A;  3EC9 A;  1JKG B;  1YJ9 3;  4H61 A;  3DZL A;  3GZR A;  3NBR A;  4X2H A;  2B24 B;  1VQ9 3;  1W01 A;  4HBR A;  4N6U A;  3CPW 2;  4K61 A;  4G1M B;  4WWU C;  3T0U A;  1IT8 A;  1JB2 A;  1PFP A;  2HMK B;  3LYG A;  1CEW I;  5CXO A;  1STD A;  3F14 A;  3B7C A;  1M1K 4;  3FF0 A;  3CCS 3;  4XM4 A;  1WTH A;  1JN5 B;  3NXJ A;  4LGQ A;  2WOH A;  2KRT A;  2Q07 A;  4OK0 A;  3U1W A;  1BUQ A;  3LTC A;  1IU7 A;  2W56 A;  4TX4 A;  4BTW A;  1W6G A;  2GXF A;  3S28 A;  5IG4 A;  2JDI H;  3WOE B;  1YIT 3;  4CDL A;  2CWU A;  4WYK A;  4FCJ A;  3UB1 A;  5STD A;  4AKZ A;  4IIA A;  3PXM A;  3D9R A;  5D83 A;  2A15 A;  3AMO A;  1Q42 A;  2YFL B;  1Q86 4;  7STD A;  1RKY A;  3FH1 A;  1FGO A;  1AV4 A;  1N5P A;  5CF1 A;  2XH9 A;  3DM8 A;  3LT8 A;  2CG1 A;  1QJG A;  1GD3 A;  3JUM A;  3GZB A;  4LZI A;  4RNY A;  1W2B 2;  3BB9 A;  4L8P A;  3JUP A;  5AI1 A;  3I56 3;  3NQZ A;  3CCJ 3;  2WGO A;  1DMN A;  2HMJ B;  4HYZ A;  1TP6 A;  2XF3 A;  2W9Q A;  1O7P B;  1L5G B;  1Y4K A;  4I4K A;  4L7K A;  2ZL8 A;  1MOL A;  2C10 A;  4U13 A;  2R4I A;  3MG2 A;  4ORL A;  3D3L A;  1FGT A;  3FKA A;  5ELU A;  6STD A;  2W03 A;  5JPP A;  3OWY A;  4WFO A;  3CNX A;  1G96 A;  1O7M B;  3G4S 3;  4K1U A;  4FMD A;  1QAL A;  2CW9 A;  1W5Z A;  3NV0 B;  1W00 A;  4HZB B;  4XDV A;  5FGO A;  1T5Y A;  2L4V A;  3LTA A;  1CYV A;  2CFW A;  1OUN A;  2RGQ A;  4FMC A;  3EHC A;  4MMY B;  4STD A;  3CCL 3;  1IVX A;  1VZZ A;  1LNH A;  5IG3 A;  1GYB A;  2GBX B;  1Q81 4;  4EBG A;  1N9J A;  1FUW A;  1FGQ A;  3LXU X;  3F8H A;  4N6N B;  3A76 A;  8CHO A;  4PEJ A;  4XBT A;  1SQW A;  1E3R A;  2F86 B;  1KC8 4;  1CYU A;  4BTY A;  1MNL A;  1JB5 A;  2OTL 3;  1JB4 A;  3S5C A;  3NQY A;  3OWU A;  1J2B A;  1WMP A;  3T8N A;  3EX9 A;  1KQS 2;  3WMD A;  3EN1 B;  3UL5 A;  1VQ4 3;  2INX A;  4GL6 A;  2QIY A;  4AEQ A;  5AII A;  3CCU 3;  3NBB A;  1UW1 A;  5JBS A;  3VGN A;  5HGR A;  4N3V A;  3EB8 A;  1IQX A;  1FGM A;  1Q82 4;  1Q7Y 4;  3EQQ B;  1U5O A;  5CLK A;  3AMO B;  1GY5 A;  3F7S A;  3PZW A;  1YVB I;  3PS8 A;  1OGX A;  4FCZ A;  1FA3 A;  5AYS C;  1OF5 A;  1W7C A;  1VQP 3;  3HK4 A;  3KFQ C;  3N54 B;  2P0M A;  2RSX A;  3MSO A;  2D42 A;  3HII A;  5TGN A;  1DMM A;  1C7H A;  2P38 A;  3FSD A;  1W6C A;  1VQM 3;  3FGY A;  3NUV A;  4HZ9 B;  3TDG A;  1NJI 4;  5AYR B;  4MEI A;  2W04 A;  5BXQ A;  2D1W A;  2ML6 A;  2Z6B A;  1OHP A;  2V1L A;  2CWT A;  1KSI A;  1VQN 3;  1QAK A;  3B8L A;  3K63 A;  5DRE A;  1YHQ 3;  4FMB A;  2IUJ A;  1NDO B;  2HMM B;  2ML5 A;  3KN4 A;  3BNE A;  3IPT A;  5EEO A;  3Q90 A;  4N6O B;  1STF I;  2BHM A;  3EF8 A;  5IEO A;  1DVC A;  2BMR B;  3LTD A;  1NO3 A;  5AIG A;  1ASK A;  4H3U A;  5EVH A;  1E3V A;  1F8N A;  1AVK A;  2BMQ B;  3EN8 A;  1LOX A;  3EBY A;  3MWZ A;  3RGR A;  4WP5 A;  3X3X A;  1VQK 3;  1IV7 A;  1A2K A;  2LYX A;  3FG4 A;  2W9P A;  3FF2 A;  4R9L A;  2YX9 A;  2WO0 A;  1RRL A;  3CCQ 3;  1A90 A;  3Q1C A;  3SX1 A;  3S67 A;  1K9M 4;  1E97 A;  1QMA A;  3SLU A;  2CFG A;  2E2U A;  3JUO A;  2RFR A;  4FR9 A;  1PU4 A;  3M8C A;  3MG1 A;  1ROV A;  2CWV A;  4HM7 B;  4MMX B;  1IT7 A;  2OTJ 3;  1SPU A;  1VQ6 3;  3IJE B;  3F40 A;  4RNZ A;  4R1K A;  3CC4 3;  1K8A 4;  2GEX A;  3LOY A;  1W02 A;  1NB5 I;  2OQE A;  2QA4 3;  2FNQ A;  2OOV C;  3CC7 3;  3GZY B;  4HVN A;  1GY6 A;  1KWI A;  4J8T A;  2F98 A;  1VQL 3;  4NRE A;  1TUH A;  3IMA B;  2CG0 A;  4EV5 A;  1YJN 3;  3BLZ A;  3DMC A;  1W6Y A;  3KKG A;  3LT9 A;  1LVN A;  2BMO B;  3X40 A;  1WMN A;  2OWP A;  3EJV A;  1N9E A;  1EKM A;  1US1 A;  3X41 A;  5IW9 A;  2KCD A;  3WA3 A;  3STD A;  4OUQ A;  4Q53 A;  5CK6 A;  3HX8 A;  1GS3 A;  1U8C B;  5LC6 A;  3S27 A;  1IDP A;  4LSO A;  2PZV A;  1SJW A;  1DMQ A;  1RJO A;  4JRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...