1EG9B

Naphthalene 1,2-dioxygenase with indole bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
b'MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT)
publication title Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eg9B00
3EX9A 5IG0A 3T8UA 1Q40A 2I9WA 1S5AA 3BB9A 3EN1B 3CU3A 3NUVA 3D9RA 4HM6B 1CQSA 1GY6A 3SOYA 3H3HA 3GRDA 4WWUC 1TP6A 3T8NA 2OWPA 5D82A 2GBXB 4KVHA 3DXOA 5KP4A 2YFLB 5FW5A 2UX0A 4HJLB 3B8LA 5KP3A 2JQ5A 3CPOA 5JPPA 3WMDA 2BMQB 1O7PB 2F98A 2Z7AA 3MYTA 4HZ9B 1STDA 1UUVB 1OGXA 5CF2A 3H51A 3LYGA 1K41A 1O7HB 3ER7A 4WYKB 4U13A 1JKGB 4LEHA 4CDLA 1JB2A 3NBRA 3NM2A 3FSDA 4H3UA 3EQQB 3ROBA 5AIHA 3DZLA 1Q40B 5BVBA 1W00A 3FF2A 1JB5A 3NHXA 5AIFA 3MG2A 3FZWA 4J9AA 4RZMA 6STDA 1OHPA 2BMRB 2PZVA 3EJVA 3M8CA 3DUKA 1W6YA 2HMOB 4HVNA 1JKGA 2QIYA 1ISKA 3EHCA 1SJWA 5D81A 4IIAA 3LZAA 1ULJB 5IG3A 4L8PA 3KKGA 3SOAA 1GY5A 3OXAA 1NDOB 4XBXA 1IDPA 3Q90A 3EBYA 5D83A 1HKXA 3VGNA 2CKFB 3FF0A 3EC9A 5IEOA 3A76A 1GY7A 1ZX2A 2K54A 1GS3A 3K7CA 5CK6A 4HM1B 4XBTA 3JUMA 5TGNA 1ASKA 3F7XA 4OUQA 2CHCA 2F86B 4K1UA 4XBYA 3STDA 5CXOA 3GZXB 3K0ZA 4HM4B 3I0YA 2W2CA 1UUWB 5IG5A 5CF1A 4XM4A 3RGRA 1DMNA 1WQLB 2HMNB 5IG4A 3SEDA 4R9LA 5IERA 1AR0A 4L7KA 1W01A 5DREA 2F99A 1OHSA 5AEUB 1DMQA 4PEJA 2YFIB 3IPTA 3FKAA 2HMJB 2RCDA 1VZZA 3EF8A 3FGYA 2B1XB 3F9SA 3OV4A 3NXJA 1OPYA 4ORLA 8CHOA 4XB5A 1Q42A 3JUQA 2INXA 1O7WB 1E3RA 1O7MB 4MJDA 3GZRA 5BXQA 3B7CA 3F14A 4J8TA 3F7SA 3UNLA 3G0KA 4K1VA 1U5OA 4OVMA 2IMJA 1BUQA 3GZBA 5JPUA 1C7HA 4LMIA 3OWSA 3KE7A 1QJGA 3E99A 1ZO2A 3F8XA 3JUOA 5IEPA 2GXFA 3RGAA 3G16A 5G2GA 4LGQA 4X2HA 2HMLB 3HZPA 3S5CA 2XSHB 3KZTA 3MG1A 5HGRA 2XSOB 3CNMA 3ECFA 4HM0B 3UJMA 1OGZA 5IF6A 1DMMA 2Z77A 1JN5A 4HM5B 2RFRA 3GWRA 5IENA 4HM7B 2GEXA 3OX9A 2BNGA 4FCJA 3HX8A 3GZYB 3OWUA 3EN8A 3CNXA 4Q53A 1JB4A 3DMCA 4R9KA 3B4OA 5KP1A 1O7GB 4GB5A 1A2KA 4HKVB 2GEYA 1EG9B 1GYBA 3MHEA 4XDVA 3KSPA 3MG3A 2BMOB 3NV0B 1ULIB 3EBTA 3FH1A 1W02A 4HM3B 2YFJB 3DM8A 1E3VA 3MKIA 3MSOA 5AIIA 1OUNA 7STDA 3BLZA 2QGUA 4STDA 4N3VA 2B24B 2GBWB 1QMAA 4WP5A 1TUHA 2XRXB 1NU3A 1OF5B 5AIGA 3JUPA 4L8OA 3HK4A 5CLKA 1OH0A 4FCMA 5EVHA 3F8HA 3FLJA 1Z1SA 2HMMB 2R4IA 3F40A 4HM2B 4HZBB 1JN5B 2XR8B 4X2OA 3NV0A 5AI1A 2A15A 2HMKB 1OCVA 3JUNA 1NWWA 4R1KA 3G8ZA 5STDA 3OWYA 1O7NB 2RGQA 4HM8B 4WYKA 1EA2A 2Z76A 3VSYA 2STDA 4I4KA 5AEWB 1E97A 4XDWA 3B4PA 1OF5A 1OHOA 5DRVA
chains in the Genus database with same CATH superfamily
2CIUA 3EE1A 3EX9A 5IG0A 4K90B 3T8UA 1RN4A 3D5GA 1Q40A 1B2UA 2I9WA 3LT8A 5JBSA 1L5GB 1S5AA 1UCKA 3BB9A 3EN1B 3FG4A 2E2VA 3CU3A 3NUVA 2CX1A 1WMOA 3D9RA 1HYFA 4HM6B 1CQSA 1UCJA 1GY6A 1W2ZA 3SOYA 1IVWA 3WR2A 1FGQA 1VQL3 3H3HA 2OQEA 2E2UA 3GRDA 3WOFB 4RNYA 3WODG 2W03A 4MMYB 2IUKA 1RCKA 4WWUC 1TP6A 3PCRA 3T8NA 1QVG2 2CG0A 2W0QA 1RMSA 2L4VA 2LYXA 2OWPA 3GAXA 1RN1A 1AVKA 5D82A 3LTCA 2F56A 2GBXB 3QRDA 4KVHA 1DVCA 3DXOA 5KP4A 2YFLB 1M904 1RGFA 4ILFA 2RNTA 1CYUA 1RGAA 3CD63 1N8QA 5FW5A 1IQ8A 2UX0A 4HJLB 4MMXB 1IU7A 4FMDA 1BIRA 1MWTA 3B8LA 3LTDA 5RNTA 4N6OB 5KP3A 4WHAA 1VQ83 4HYZA 2IA7A 3PS8A 2JQ5A 2O3OA 3CPOA 5JPPA 3NX0A 1MNLA 1R4CA 2SARA 4N6MA 4EYCA 2CWTA 3WMDA 1BNRA 1JBRA 1BVIA 1RHLA 1YGWA 1IQXA 2BMQB 1OACA 1Q7HA 2OTL3 1LQMB 3WA2X 1LNHA 2F4YA 1RN7A 1UW1A 1BRNL 1O7PB 2BO9B 3JVCA 3ZG5A 2F98A 3N8BA 2Z7AA 3MYTA 3AHWA 1G02A 3G4S3 5EEOA 1DYUA 1IVXA 3UB1A 2V1LA 2CK3H 5G1LA 3AGNA 4HZ9B 5BIRA 3U1WA 4CCVA 2IUJA 4KFDA 4GHOA 3CPW2 1D6YA 1STDA 1NB5I 1B27A 1BRSA 1IT8A 1UUVB 1GOUA 4J5GA 4AKZA 1OGXA 1VQN3 1DE3A 3NBBA 5CF2A 3SX1A 3HI7A 3H51A 3LYGA 7GSPA 4RBNA 4K61A 3IMAB 1K41A 1O7HB 1BANA 2CFKA 3ER7A 4WYKB 4BTWA 3CCE3 4U13A 1B2ZA 1JKGB 3CC43 4RNTA 3Q2PA 4LEHA 4CDLA 1VQ43 1I2FA 1KD14 1JB2A 3NBRA 1BRGA 2CFGA 2LQVA 3NM2A 4LZIA 1BRIA 3FSDA 5FGOA 4H3UA 2GU3A 3EQQB 3ROBA 5AIHA 2KCDA 2W56B 3D79A 3DZLA 1HU9A 3IJEB 4O3VA 1KQS2 2C11A 1FW7A 1Q40B 1RGLA 4O02B 1UGIA 4N6V0 3D3LA 5BVBA 2FNQA 2W04A 3UL5A 1W00A 3DGNA 1Y4KA 3FF2A 1JB5A 3NM7A 1EUIC 3NHXA 1N9JA 4IPBA 5AIFA 3NQZA 3MG2A 3UL6A 1A90A 2R41A 2XH9A 3FZWA 4J9AA 3N9HA 3S27A 4RZMA 1W6CA 1B2MA 1MGWA 1I2EA 6STDA 2C10A 4IT7A 1VQ93 1LNIA 4BTYA 1JJ22 1OHPA 2BMRB 4GSPA 2PZVA 4EV5A 3EJVA 3M8CA 1F8NA 4H61A 3GSPA 1YVSA 3DUKA 1W6YA 2HMOB 3DGOA 2P0XA 6GSPA 1MWUA 4HVNA 1LQGC 4BIRA 1I3IA 2BT3A 3WDGB 1JKGA 2C4BA 2WGOA 2QIYA 1RSNA 2CFWA 1ISKA 2L1SA 1X1UA 1LXEA 3EHCA 1SJWA 5A0OB 1DVDA 5D81A 1BUJA 7RNTA 3WA3A 1EQKA 4IIAA 3LZAA 1ULJB 5G1KA 4WFOA 1WMNA 2W56A 5IG3A 4L8PA 1LOWA 1TIJA 3CME3 3KKGA 2CFLA 2WO0A 3SOAA 2CW9A 1GY5A 3A5EA 3OXAA 1NDOB 3CC73 4FMBA 3CCS3 3ALAA 1IDPA 2P09A 3DY5A 4XBXA 1HZ1A 3Q90A 3URPA 1V74A 3CCM3 5M1AA 1GOVA 3EBYA 1JRQA 5D83A 1HKXA 4EW5A 3VGNA 2CH9A 1VQM3 1VQ63 2CKFB 1IYYA 1FGOA 3FF0A 1MWRA 3EC9A 5IEOA 2H0IA 4EC6A 1RRLA 2XFTA 1UCLA 3A76A 1GY7A 1ZX2A 1YIJ3 3SYUA 2K54A 5HOHA 1MOLA 1GS3A 3Q3FA 2SBLA 3K7CA 4N6UA 3X41A 5CK6A 1PFPA 1PYLA 1W6GA 2BHMA 1QAKA 2KF3A 1V57A 1QAFA 1RGGA 1CEWI 2KAAA 1TJDA 1LOVA 3JUMA 1YVBI 1UI7A 4HM1B 2W6JH 4LSOA 4LYLB 5EQLA 5AYRB 5TGNA 3PYJA 1ASKA 4HOHA 3F7XA 1BSCA 1X1YA 4OUQA 2CHCA 2F86B 3D5IA 1YJW3 4K1UA 1BNFA 4XBYA 3STDA 5CXOA 1FUTA 2Y74A 3GZXB 1D6UA 3K0ZA 1T3BA 4HM4B 3I0YA 4MMZB 2W2CA 1N5PA 1UUWB 2MC8A 5IG5A 5CF1A 1GMQA 1UCIA 4XM4A 2PNCA 1ROAA 3RGRA 1ROVA 1IK3A 1DMNA 1PU4A 2D42A 1WQLB 2IY2A 4NPBA 4EBGA 2H0GA 1I8VA 5GSPA 2HMNB 1BGSA 5IG4A 2BIRA 3SEDA 3T0UA 4R9LA 5IERA 1TU5A 1AR0A 1BSEA 1CYVA 2AAEA 4L7KA 1W01A 3BNCA 4MEIA 2F99A 2ZL8A 5DREA 1IV9A 1I0XA 2CWVA 4O2HA 1OHSA 5AEUB 1LVNA 1DMQA 4EV2A 1BOXA 2XGNA 1WMPA 4PEJA 3TDGA 2YFIB 3IPTA 1UGHI 3LH4A 2ML6A 2ZHXB 1TFKA 1US1A 2WOHA 2KF5A 3K63A 1RGEA 1SQWA 1U8CB 3FKAA 3U97A 2HMJB 2RCDA 1FGRA 1IVUA 4FMAA 1FYSA 1VZZA 3EF8A 1VQ73 3FGYA 2B1XB 3SVAA 1RNBA 2P0MA 3L0RA 1JNQA 3KFQC 1IT7A 3F9SA 1RGCA 4R80A 4I5QA 3OV4A 3NXJA 1OPYA 3KN4A 1EKMA 4ORLA 8CHOA 4OK0A 4KFEA 3LTAA 1Q824 1TRQA 4XB5A 1Q42A 3JUQA 1G0TA 1YNVX 2INXA 1O7WB 1E3RA 1O7MB 2FGTA 4KZ1A 4MJDA 3V92A 3GZRA 3NBJA 1FA3A 1S723 3AMOA 1FGMA 2RSXA 5BXQA 1ZS7A 1RGKA 3CCU3 1KSIA 3B7CA 1ZGXA 3F14A 4CJNA 4J8TA 2IYJA 3V98A 1FZUA 2AADA 2QA43 3F7SA 2P05A 3UNLA 3G0KA 1UI8A 4K1VA 1U5OA 2Z6BA 1BSBA 1NB3I 1RCLA 1YJN3 1IV7A 3V99A 4OVMA 2IMJA 1M1K4 3K9MC 3FCSB 1A67A 1BUQA 3GZBA 3I563 5JPUA 1C7HA 2CFDA 3OWSA 3KE7A 2CWUA 4LMIA 1Q814 1NJI4 4O8SA 1QJGA 1TRPA 3BU4A 3MWZA 4BL3A 3CMA3 4AKYA 4BL2A 8RNTA 3E99A 2O9UX 1ZO2A 1YGEA 3F8XA 3JUOA 2F5WA 5IEPA 3O8YA 4XBTA 1AVLA 2GU1A 3CXC2 2GXFA 3N54B 3DGYA 3RGAA 3G16A 3HIIA 5AYSC 3BNDA 4ZM8A 1N5HA 2KF4A 2ZA4A 5G2GA 2JDIH 6RNTA 1Q7Y4 5M18A 4LGQA 4X2HA 1T2HA 2K3DA 2OCTA 2HMLB 3HZPA 3S5CA 2XEPA 1KC84 2XSHB 3KZTA 3MG1A 2J8XB 4N6LA 1RLSA 5HGRA 2XSOB 3CNMA 3ECFA 2Y73A 3DGMA 4HM0B 4RNZA 4TX4A 3KCHA 5ELUA 2GSPA 2XF3A 1B2SA 3UJMA 1B3SA 1T2IA 4QWTA 3S28A 3S67A 2MF7A 1GSPA 3RDEA 3X3XA 1SIIA 4HBRA 5BU4A 1I2GA 1FUSA 1WTHA 3LT9A 1I70A 1QALA 1OGZA 5IF6A 3BNBA 1DMMA 1B21A 2Z77A 1C54A 2UUGC 3PXMA 1AV4A 1GOYA 4BTXA 1JN5A 1JBTA 2ZDJA 5LC7A 2D1WA 3HIGA 1YJ93 1RNTA 3ZFZA 1TTOA 3PZWA 3OW22 3CCL3 1RTUA 2QEX3 1BNGA 1TFOA 1VQK3 4HM5B 2RFRA 4FR9A 3GWRA 1JZDA 1PY3A 5IENA 1T5YA 1JZOA 2WGQA 3PGBA 4HM7B 1M9GA 2GEXA 3OX9A 1BNEA 2BNGA 4FCJA 3HX8A 1K734 3GZYB 4CPKA 5ELJA 3SXXA 1N9EA 3OWUA 2WOFA 3I553 3LMLA 3EN8A 4KFFA 1VQ53 1B2XA 2ML5A 3CNXA 3X3YA 1BNJA 4Q53A 3J7Yd 3PCSA 3DH2A 4JRFA 1JB4A 1EEJA 2CX0A 3AMOB 3DMCA 4EXRA 4R9KA 1D6ZA 3B4OA 5KP1A 1RDSA 2Q07A 1O7GB 4GB5A 3WHOA 3AHSA 1I3FA 1A2KA 1B20A 2KXGA 3CCR3 5I97A 1VQQA 1J2BA 4HKVB 2GEYA 1EG9B 4JF8A 1GYBA 3MHEA 1W2B2 3KIIA 4XDVA 1UDII 1JV2B 2F5MA 3KSPA 2OOVC 3MG3A 4J5KA 2BMOB 3NV0B 3EB8A 1ULIB 4AEQA 3EBTA 1SIHA 2UGIA 4DKIA 1RKYA 4NREA 1YHQ3 3FH1A 2CG1A 1BRHA 5LC6A 1W02A 4G1MB 4HM3B 2YFJB 1STFI 3DM8A 4N6TA 1E3VA 3MKIA 3MSOA 1GD3A 3ZG0A 2HOHA 5AIIA 3CCV3 3CCQ3 1K9M4 1LOXA 2OTJ3 1OUNA 7STDA 3BLZA 1I0VA 1KWIA 1BU4A 2BU4A 2QGUA 3MPHA 1K8A4 4STDA 1GD4A 4N3VA 2B24B 3Q1CA 2OOVA 2GBWB 3S29A 1QMAA 3VF1A 3X3ZA 3G713 3WOEB 1W5ZA 4WP5A 1GMPA 1K28A 4R4KA 1SPUA 1TUHA 1MWSA 1NO3A 1Q9EA 2W9PA 2XRXB 1NU3A 1BSAA 2E2TA 1A2PA 1BRKA 1RJOA 1OF5B 2RBIA 5AIGA 3JUPA 5IW9A 3DGLA 1BNIA 3BNEA 3D4AA 4L8OA 3X40A 1AQZA 3HK4A 5CLKA 2W9QA 1OH0A 2K0MA 1IVVA 2P38A 3F8HA 3LOYA 4FCMA 4FCZA 5EVHA 1YIT3 1JBSA 1QVF2 1FGTA 3FG1A 1BNSA 1IQYA 1LOYA 1X1WA 2XGLA 3FLJA 3RNTA 1Z1SA 1DETA 2HMMB 1BSDA 2R4IA 1RGHA 1JN5B 3F40A 2XR8B 4HM2B 4HZBB 1VQP3 3K5TA 1Q864 3CCJ3 1CH0A 4X2OA 3NV0A 2XFSA 5AI1A 2A15A 3G6E3 2CC3A 2HMKB 3AGOA 1R4YA 1OCVA 1X1XA 3JUNA 1SARA 1NWWA 4R1KA 3G8ZA 1MGRA 4N6NB 4FMCA 3LTBA 1RRHA 3QK9A 1FUWA 3KSED 1V58A 5M19A 5STDA 1VQO3 1GMRA 3OWYA 1UUGB 1O7NB 4NHFA 9RNTA 1A2VA 2RGQA 2KRTA 4HM8B 3CC23 1NNVA 1YI23 4WYKA 2KF6A 1N8R4 3SLUA 4KT3B 1EA2A 1M1XB 2YX9A 3LXUX 2Z76A 3VSYA 3X42A 4HAAA 2M7OA 2FXTA 1AY7A 1G96A 2STDA 4I4KA 1WNHA 5AEWB 3NQYA 2H0HA 2OQEC 1E97A 4GL6A 4XDWA 3HOHA 3B4PA 1BRJA 3BIRA 1LRAA 1W7CA 4BU4A 1OF5A 1W4NA 3FG3A 1OHOA 1BAOA 5DRVA
chains in the Genus database with same CATH topology
2CIUA 3EE1A 3EX9A 5IG0A 4K90B 3T8UA 3LT8A 1Q40A 2I9WA 5JBSA 1L5GB 1S5AA 3BB9A 3EN1B 3FG4A 2E2VA 3CU3A 3NUVA 3D9RA 1WMOA 4HM6B 1CQSA 1GY6A 1W2ZA 3SOYA 1IVWA 1VQL3 1FGQA 3H3HA 2OQEA 2E2UA 3GRDA 3WOFB 4RNYA 3WODG 2W03A 4MMYB 2IUKA 4WWUC 1TP6A 3PCRA 3T8NA 1QVG2 2CG0A 2W0QA 2L4VA 2LYXA 3GAXA 2OWPA 1AVKA 5D82A 3LTCA 2GBXB 3QRDA 4KVHA 1DVCA 3DXOA 5KP4A 2YFLB 1M904 1CYUA 3CD63 1N8QA 5FW5A 1IQ8A 2UX0A 4HJLB 4MMXB 1IU7A 4FMDA 3LTDA 3B8LA 1VQ83 4N6OB 5KP3A 4WHAA 4HYZA 2IA7A 3PS8A 2JQ5A 2O3OA 3CPOA 5JPPA 3NX0A 1MNLA 1R4CA 4N6MA 4EYCA 2CWTA 3WMDA 1IQXA 2BMQB 1OACA 2OTL3 3WA2X 1LNHA 1RN7A 1UW1A 1O7PB 2BO9B 3JVCA 2F98A 3N8BA 2Z7AA 3MYTA 3G4S3 5EEOA 1DYUA 1IVXA 3UB1A 2V1LA 2CK3H 4HZ9B 3U1WA 4CCVA 2IUJA 4KFDA 3CPW2 1D6YA 1STDA 1NB5I 1IT8A 1UUVB 4AKZA 1VQN3 1OGXA 3NBBA 5CF2A 3SX1A 3HI7A 3H51A 3LYGA 4RBNA 4K61A 3IMAB 1K41A 1O7HB 3ER7A 2CFKA 4WYKB 4BTWA 3CCE3 4U13A 1JKGB 3CC43 3Q2PA 4LEHA 4CDLA 1VQ43 1KD14 1JB2A 3NBRA 2CFGA 2LQVA 3NM2A 4LZIA 3FSDA 5FGOA 4H3UA 2GU3A 3EQQB 3ROBA 5AIHA 2KCDA 2W56B 3DZLA 3IJEB 1HU9A 4O3VA 1KQS2 2C11A 1Q40B 4O02B 5BVBA 4N6V0 3D3LA 2FNQA 2W04A 3UL5A 1W00A 3DGNA 1Y4KA 3FF2A 1JB5A 3NM7A 3NHXA 1N9JA 4IPBA 5AIFA 3NQZA 3MG2A 3UL6A 1A90A 2XH9A 3FZWA 4J9AA 3N9HA 3S27A 4RZMA 1W6CA 6STDA 2C10A 4IT7A 1VQ93 4BTYA 1JJ22 1OHPA 2BMRB 2PZVA 4EV5A 3EJVA 3M8CA 1F8NA 4H61A 3DUKA 1W6YA 2HMOB 3DGOA 2P0XA 4HVNA 2BT3A 3WDGB 1JKGA 2WGOA 2QIYA 2CFWA 1ISKA 1LXEA 3EHCA 1SJWA 5A0OB 1DVDA 5D81A 3WA3A 1EQKA 4IIAA 3LZAA 1ULJB 4WFOA 1WMNA 2W56A 5IG3A 4L8PA 1TIJA 3CME3 3KKGA 2CFLA 2WO0A 3SOAA 2CW9A 1GY5A 3OXAA 1NDOB 3CC73 4FMBA 3CCS3 3ALAA 1IDPA 2P09A 3DY5A 4XBXA 3Q90A 3CCM3 1V74A 3EBYA 1JRQA 5D83A 1HKXA 3VGNA 2CH9A 1VQM3 1VQ63 2CKFB 1FGOA 3FF0A 3EC9A 5IEOA 4EC6A 1RRLA 2XFTA 3A76A 1GY7A 1ZX2A 1YIJ3 2K54A 1MOLA 1GS3A 4N6UA 2SBLA 3K7CA 3X41A 5CK6A 1PFPA 1W6GA 2BHMA 1QAKA 1QAFA 1CEWI 4HM1B 4XBTA 3JUMA 5AYRB 1YVBI 1UI7A 4LSOA 2W6JH 5EQLA 5TGNA 3PYJA 1ASKA 3F7XA 4OUQA 2CHCA 2F86B 1YJW3 4K1UA 4XBYA 3STDA 5CXOA 2Y74A 3GZXB 1D6UA 3K0ZA 4HM4B 3I0YA 4MMZB 2W2CA 1N5PA 1UUWB 2MC8A 5IG5A 5CF1A 4XM4A 2PNCA 1ROAA 3RGRA 1ROVA 1IK3A 1DMNA 1PU4A 2D42A 1WQLB 4EBGA 2HMNB 5IG4A 3SEDA 3T0UA 4R9LA 5IERA 1TU5A 1AR0A 1CYVA 4L7KA 1W01A 3BNCA 4MEIA 2F99A 2ZL8A 5DREA 1IV9A 2CWVA 4O2HA 1OHSA 5AEUB 1LVNA 1DMQA 4EV2A 2XGNA 3TDGA 1WMPA 4PEJA 2YFIB 3IPTA 3LH4A 2ML6A 1TFKA 1US1A 2WOHA 3K63A 1SQWA 1U8CB 3FKAA 3U97A 2HMJB 2RCDA 1FGRA 1IVUA 4FMAA 1VZZA 3EF8A 1VQ73 3FGYA 2B1XB 3SVAA 2P0MA 3L0RA 1JNQA 3KFQC 1IT7A 3F9SA 4R80A 3OV4A 3NXJA 1OPYA 3KN4A 1EKMA 4ORLA 8CHOA 4OK0A 4KFEA 3LTAA 1Q824 4XB5A 1Q42A 3JUQA 2INXA 1O7WB 1E3RA 1O7MB 2FGTA 4KZ1A 4MJDA 3V92A 3GZRA 3NBJA 1S723 3AMOA 1FGMA 2RSXA 5BXQA 3CCU3 1KSIA 3B7CA 3F14A 4J8TA 3V98A 2QA43 3F7SA 2P05A 3UNLA 3G0KA 1UI8A 4K1VA 1U5OA 2Z6BA 1NB3I 1YJN3 1IV7A 3V99A 4OVMA 2IMJA 1M1K4 3K9MC 3FCSB 1A67A 1BUQA 3GZBA 3I563 5JPUA 1C7HA 2CFDA 3OWSA 3KE7A 2CWUA 4LMIA 1Q814 1NJI4 4O8SA 1QJGA 3MWZA 3CMA3 4AKYA 3E99A 2O9UX 1ZO2A 1YGEA 3F8XA 3JUOA 5IEPA 3O8YA 1AVLA 2GU1A 3CXC2 2GXFA 3N54B 3RGAA 3G16A 3HIIA 5AYSC 3BNDA 4ZM8A 1N5HA 1Q7Y4 5G2GA 2JDIH 4LGQA 4X2HA 2OCTA 2HMLB 3HZPA 3S5CA 2XEPA 1KC84 2XSHB 3KZTA 3MG1A 4N6LA 5HGRA 2XSOB 3CNMA 3ECFA 2Y73A 3DGMA 4HM0B 4RNZA 4TX4A 5ELUA 3CCL3 1FA3A 2XF3A 3UJMA 4QWTA 3S28A 3S67A 2MF7A 3RDEA 3X3XA 1SIIA 4HBRA 1WTHA 3LT9A 1QALA 1OGZA 5IF6A 3BNBA 1DMMA 2Z77A 3PXMA 1AV4A 4BTXA 1JN5A 2ZDJA 5LC7A 2D1WA 3HIGA 1YJ93 3PZWA 3OW22 2QEX3 1TFOA 1VQK3 4HM5B 2RFRA 4FR9A 3GWRA 5IENA 1T5YA 2WGQA 3PGBA 4HM7B 1M9GA 2GEXA 3OX9A 2BNGA 4FCJA 3HX8A 1K734 3GZYB 5ELJA 3SXXA 1N9EA 3OWUA 2WOFA 3I553 3LMLA 3EN8A 4KFFA 1VQ53 2ML5A 3CNXA 3X3YA 4Q53A 3J7Yd 3PCSA 4JRFA 1JB4A 3DMCA 3AMOB 4EXRA 4R9KA 1D6ZA 3B4OA 5KP1A 2Q07A 1O7GB 4GB5A 1A2KA 2KXGA 3CCR3 5I97A 1J2BA 4HKVB 2GEYA 1EG9B 4JF8A 1GYBA 3MHEA 1W2B2 3KIIA 4XDVA 1JV2B 3KSPA 2OOVC 3MG3A 2BMOB 3NV0B 3EB8A 1ULIB 4AEQA 3EBTA 1SIHA 1RKYA 1YHQ3 4NREA 3FH1A 2CG1A 5LC6A 1W02A 4G1MB 4HM3B 2YFJB 1STFI 3DM8A 4N6TA 1E3VA 3MKIA 3MSOA 1GD3A 5AIIA 3CCV3 3CCQ3 1K9M4 1LOXA 2OTJ3 1OUNA 7STDA 3BLZA 1KWIA 2QGUA 3MPHA 1K8A4 4STDA 1GD4A 4N3VA 2B24B 3Q1CA 2OOVA 2GBWB 3S29A 1QMAA 3VF1A 3X3ZA 3G713 3WOEB 1W5ZA 4WP5A 1K28A 4R4KA 1SPUA 1TUHA 1NO3A 2W9PA 2XRXB 1NU3A 2E2TA 1RJOA 1OF5B 5AIGA 3JUPA 5IW9A 3DGLA 3BNEA 4L8OA 3X40A 3HK4A 5CLKA 2W9QA 1OH0A 2K0MA 1IVVA 2P38A 3F8HA 3LOYA 4FCMA 4FCZA 5EVHA 1YIT3 1QVF2 1FGTA 3FG1A 1IQYA 2XGLA 3FLJA 1Z1SA 2HMMB 2R4IA 3F40A 4HM2B 4HZBB 1JN5B 2XR8B 1VQP3 3K5TA 1Q864 3CCJ3 4X2OA 3NV0A 2XFSA 5AI1A 2A15A 3G6E3 2CC3A 2HMKB 1OCVA 3JUNA 1NWWA 4R1KA 3G8ZA 4N6NB 4FMCA 3LTBA 1RRHA 3QK9A 1FUWA 3KSED 5STDA 1VQO3 3OWYA 1O7NB 4NHFA 1A2VA 2RGQA 2KRTA 4HM8B 3CC23 1YI23 4WYKA 1N8R4 3SLUA 1EA2A 1M1XB 2YX9A 3LXUX 2Z76A 3VSYA 3X42A 2M7OA 2FXTA 1G96A 2STDA 4I4KA 5AEWB 1WNHA 3NQYA 2OQEC 1E97A 4GL6A 4XDWA 3B4PA 1W7CA 1OF5A 1W4NA 3FG3A 1OHOA 5DRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EX9 A;  5IG0 A;  3T8U A;  1Q40 A;  2I9W A;  1S5A A;  3BB9 A;  3EN1 B;  3CU3 A;  3NUV A;  3D9R A;  4HM6 B;  1CQS A;  1GY6 A;  3SOY A;  3H3H A;  3GRD A;  4WWU C;  1TP6 A;  3T8N A;  2OWP A;  5D82 A;  2GBX B;  4KVH A;  3DXO A;  5KP4 A;  2YFL B;  5FW5 A;  2UX0 A;  4HJL B;  3B8L A;  5KP3 A;  2JQ5 A;  3CPO A;  5JPP A;  3WMD A;  2BMQ B;  1O7P B;  2F98 A;  2Z7A A;  3MYT A;  4HZ9 B;  1STD A;  1UUV B;  1OGX A;  5CF2 A;  3H51 A;  3LYG A;  1K41 A;  1O7H B;  3ER7 A;  4WYK B;  4U13 A;  1JKG B;  4LEH A;  4CDL A;  1JB2 A;  3NBR A;  3NM2 A;  3FSD A;  4H3U A;  3EQQ B;  3ROB A;  5AIH A;  3DZL A;  1Q40 B;  5BVB A;  1W00 A;  3FF2 A;  1JB5 A;  3NHX A;  5AIF A;  3MG2 A;  3FZW A;  4J9A A;  4RZM A;  6STD A;  1OHP A;  2BMR B;  2PZV A;  3EJV A;  3M8C A;  3DUK A;  1W6Y A;  2HMO B;  4HVN A;  1JKG A;  2QIY A;  1ISK A;  3EHC A;  1SJW A;  5D81 A;  4IIA A;  3LZA A;  1ULJ B;  5IG3 A;  4L8P A;  3KKG A;  3SOA A;  1GY5 A;  3OXA A;  1NDO B;  4XBX A;  1IDP A;  3Q90 A;  3EBY A;  5D83 A;  1HKX A;  3VGN A;  2CKF B;  3FF0 A;  3EC9 A;  5IEO A;  3A76 A;  1GY7 A;  1ZX2 A;  2K54 A;  1GS3 A;  3K7C A;  5CK6 A;  4HM1 B;  4XBT A;  3JUM A;  5TGN A;  1ASK A;  3F7X A;  4OUQ A;  2CHC A;  2F86 B;  4K1U A;  4XBY A;  3STD A;  5CXO A;  3GZX B;  3K0Z A;  4HM4 B;  3I0Y A;  2W2C A;  1UUW B;  5IG5 A;  5CF1 A;  4XM4 A;  3RGR A;  1DMN A;  1WQL B;  2HMN B;  5IG4 A;  3SED A;  4R9L A;  5IER A;  1AR0 A;  4L7K A;  1W01 A;  5DRE A;  2F99 A;  1OHS A;  5AEU B;  1DMQ A;  4PEJ A;  2YFI B;  3IPT A;  3FKA A;  2HMJ B;  2RCD A;  1VZZ A;  3EF8 A;  3FGY A;  2B1X B;  3F9S A;  3OV4 A;  3NXJ A;  1OPY A;  4ORL A;  8CHO A;  4XB5 A;  1Q42 A;  3JUQ A;  2INX A;  1O7W B;  1E3R A;  1O7M B;  4MJD A;  3GZR A;  5BXQ A;  3B7C A;  3F14 A;  4J8T A;  3F7S A;  3UNL A;  3G0K A;  4K1V A;  1U5O A;  4OVM A;  2IMJ A;  1BUQ A;  3GZB A;  5JPU A;  1C7H A;  4LMI A;  3OWS A;  3KE7 A;  1QJG A;  3E99 A;  1ZO2 A;  3F8X A;  3JUO A;  5IEP A;  2GXF A;  3RGA A;  3G16 A;  5G2G A;  4LGQ A;  4X2H A;  2HML B;  3HZP A;  3S5C A;  2XSH B;  3KZT A;  3MG1 A;  5HGR A;  2XSO B;  3CNM A;  3ECF A;  4HM0 B;  3UJM A;  1OGZ A;  5IF6 A;  1DMM A;  2Z77 A;  1JN5 A;  4HM5 B;  2RFR A;  3GWR A;  5IEN A;  4HM7 B;  2GEX A;  3OX9 A;  2BNG A;  4FCJ A;  3HX8 A;  3GZY B;  3OWU A;  3EN8 A;  3CNX A;  4Q53 A;  1JB4 A;  3DMC A;  4R9K A;  3B4O A;  5KP1 A;  1O7G B;  4GB5 A;  1A2K A;  4HKV B;  2GEY A;  1EG9 B;  1GYB A;  3MHE A;  4XDV A;  3KSP A;  3MG3 A;  2BMO B;  3NV0 B;  1ULI B;  3EBT A;  3FH1 A;  1W02 A;  4HM3 B;  2YFJ B;  3DM8 A;  1E3V A;  3MKI A;  3MSO A;  5AII A;  1OUN A;  7STD A;  3BLZ A;  2QGU A;  4STD A;  4N3V A;  2B24 B;  2GBW B;  1QMA A;  4WP5 A;  1TUH A;  2XRX B;  1NU3 A;  1OF5 B;  5AIG A;  3JUP A;  4L8O A;  3HK4 A;  5CLK A;  1OH0 A;  4FCM A;  5EVH A;  3F8H A;  3FLJ A;  1Z1S A;  2HMM B;  2R4I A;  3F40 A;  4HM2 B;  4HZB B;  1JN5 B;  2XR8 B;  4X2O A;  3NV0 A;  5AI1 A;  2A15 A;  2HMK B;  1OCV A;  3JUN A;  1NWW A;  4R1K A;  3G8Z A;  5STD A;  3OWY A;  1O7N B;  2RGQ A;  4HM8 B;  4WYK A;  1EA2 A;  2Z76 A;  3VSY A;  2STD A;  4I4K A;  5AEW B;  1E97 A;  4XDW A;  3B4P A;  1OF5 A;  1OHO A;  5DRV A; 
#chains in the Genus database with same CATH topology
 2CIU A;  3EE1 A;  3EX9 A;  5IG0 A;  4K90 B;  3T8U A;  1RN4 A;  3D5G A;  1Q40 A;  1B2U A;  2I9W A;  3LT8 A;  5JBS A;  1L5G B;  1S5A A;  1UCK A;  3BB9 A;  3EN1 B;  3FG4 A;  2E2V A;  3CU3 A;  3NUV A;  2CX1 A;  1WMO A;  3D9R A;  1HYF A;  4HM6 B;  1CQS A;  1UCJ A;  1GY6 A;  1W2Z A;  3SOY A;  1IVW A;  3WR2 A;  1FGQ A;  1VQL 3;  3H3H A;  2OQE A;  2E2U A;  3GRD A;  3WOF B;  4RNY A;  3WOD G;  2W03 A;  4MMY B;  2IUK A;  1RCK A;  4WWU C;  1TP6 A;  3PCR A;  3T8N A;  1QVG 2;  2CG0 A;  2W0Q A;  1RMS A;  2L4V A;  2LYX A;  2OWP A;  3GAX A;  1RN1 A;  1AVK A;  5D82 A;  3LTC A;  2F56 A;  2GBX B;  3QRD A;  4KVH A;  1DVC A;  3DXO A;  5KP4 A;  2YFL B;  1M90 4;  1RGF A;  4ILF A;  2RNT A;  1CYU A;  1RGA A;  3CD6 3;  1N8Q A;  5FW5 A;  1IQ8 A;  2UX0 A;  4HJL B;  4MMX B;  1IU7 A;  4FMD A;  1BIR A;  1MWT A;  3B8L A;  3LTD A;  5RNT A;  4N6O B;  5KP3 A;  4WHA A;  1VQ8 3;  4HYZ A;  2IA7 A;  3PS8 A;  2JQ5 A;  2O3O A;  3CPO A;  5JPP A;  3NX0 A;  1MNL A;  1R4C A;  2SAR A;  4N6M A;  4EYC A;  2CWT A;  3WMD A;  1BNR A;  1JBR A;  1BVI A;  1RHL A;  1YGW A;  1IQX A;  2BMQ B;  1OAC A;  1Q7H A;  2OTL 3;  1LQM B;  3WA2 X;  1LNH A;  2F4Y A;  1RN7 A;  1UW1 A;  1BRN L;  1O7P B;  2BO9 B;  3JVC A;  3ZG5 A;  2F98 A;  3N8B A;  2Z7A A;  3MYT A;  3AHW A;  1G02 A;  3G4S 3;  5EEO A;  1DYU A;  1IVX A;  3UB1 A;  2V1L A;  2CK3 H;  5G1L A;  3AGN A;  4HZ9 B;  5BIR A;  3U1W A;  4CCV A;  2IUJ A;  4KFD A;  4GHO A;  3CPW 2;  1D6Y A;  1STD A;  1NB5 I;  1B27 A;  1BRS A;  1IT8 A;  1UUV B;  1GOU A;  4J5G A;  4AKZ A;  1OGX A;  1VQN 3;  1DE3 A;  3NBB A;  5CF2 A;  3SX1 A;  3HI7 A;  3H51 A;  3LYG A;  7GSP A;  4RBN A;  4K61 A;  3IMA B;  1K41 A;  1O7H B;  1BAN A;  2CFK A;  3ER7 A;  4WYK B;  4BTW A;  3CCE 3;  4U13 A;  1B2Z A;  1JKG B;  3CC4 3;  4RNT A;  3Q2P A;  4LEH A;  4CDL A;  1VQ4 3;  1I2F A;  1KD1 4;  1JB2 A;  3NBR A;  1BRG A;  2CFG A;  2LQV A;  3NM2 A;  4LZI A;  1BRI A;  3FSD A;  5FGO A;  4H3U A;  2GU3 A;  3EQQ B;  3ROB A;  5AIH A;  2KCD A;  2W56 B;  3D79 A;  3DZL A;  1HU9 A;  3IJE B;  4O3V A;  1KQS 2;  2C11 A;  1FW7 A;  1Q40 B;  1RGL A;  4O02 B;  1UGI A;  4N6V 0;  3D3L A;  5BVB A;  2FNQ A;  2W04 A;  3UL5 A;  1W00 A;  3DGN A;  1Y4K A;  3FF2 A;  1JB5 A;  3NM7 A;  1EUI C;  3NHX A;  1N9J A;  4IPB A;  5AIF A;  3NQZ A;  3MG2 A;  3UL6 A;  1A90 A;  2R41 A;  2XH9 A;  3FZW A;  4J9A A;  3N9H A;  3S27 A;  4RZM A;  1W6C A;  1B2M A;  1MGW A;  1I2E A;  6STD A;  2C10 A;  4IT7 A;  1VQ9 3;  1LNI A;  4BTY A;  1JJ2 2;  1OHP A;  2BMR B;  4GSP A;  2PZV A;  4EV5 A;  3EJV A;  3M8C A;  1F8N A;  4H61 A;  3GSP A;  1YVS A;  3DUK A;  1W6Y A;  2HMO B;  3DGO A;  2P0X A;  6GSP A;  1MWU A;  4HVN A;  1LQG C;  4BIR A;  1I3I A;  2BT3 A;  3WDG B;  1JKG A;  2C4B A;  2WGO A;  2QIY A;  1RSN A;  2CFW A;  1ISK A;  2L1S A;  1X1U A;  1LXE A;  3EHC A;  1SJW A;  5A0O B;  1DVD A;  5D81 A;  1BUJ A;  7RNT A;  3WA3 A;  1EQK A;  4IIA A;  3LZA A;  1ULJ B;  5G1K A;  4WFO A;  1WMN A;  2W56 A;  5IG3 A;  4L8P A;  1LOW A;  1TIJ A;  3CME 3;  3KKG A;  2CFL A;  2WO0 A;  3SOA A;  2CW9 A;  1GY5 A;  3A5E A;  3OXA A;  1NDO B;  3CC7 3;  4FMB A;  3CCS 3;  3ALA A;  1IDP A;  2P09 A;  3DY5 A;  4XBX A;  1HZ1 A;  3Q90 A;  3URP A;  1V74 A;  3CCM 3;  5M1A A;  1GOV A;  3EBY A;  1JRQ A;  5D83 A;  1HKX A;  4EW5 A;  3VGN A;  2CH9 A;  1VQM 3;  1VQ6 3;  2CKF B;  1IYY A;  1FGO A;  3FF0 A;  1MWR A;  3EC9 A;  5IEO A;  2H0I A;  4EC6 A;  1RRL A;  2XFT A;  1UCL A;  3A76 A;  1GY7 A;  1ZX2 A;  1YIJ 3;  3SYU A;  2K54 A;  5HOH A;  1MOL A;  1GS3 A;  3Q3F A;  2SBL A;  3K7C A;  4N6U A;  3X41 A;  5CK6 A;  1PFP A;  1PYL A;  1W6G A;  2BHM A;  1QAK A;  2KF3 A;  1V57 A;  1QAF A;  1RGG A;  1CEW I;  2KAA A;  1TJD A;  1LOV A;  3JUM A;  1YVB I;  1UI7 A;  4HM1 B;  2W6J H;  4LSO A;  4LYL B;  5EQL A;  5AYR B;  5TGN A;  3PYJ A;  1ASK A;  4HOH A;  3F7X A;  1BSC A;  1X1Y A;  4OUQ A;  2CHC A;  2F86 B;  3D5I A;  1YJW 3;  4K1U A;  1BNF A;  4XBY A;  3STD A;  5CXO A;  1FUT A;  2Y74 A;  3GZX B;  1D6U A;  3K0Z A;  1T3B A;  4HM4 B;  3I0Y A;  4MMZ B;  2W2C A;  1N5P A;  1UUW B;  2MC8 A;  5IG5 A;  5CF1 A;  1GMQ A;  1UCI A;  4XM4 A;  2PNC A;  1ROA A;  3RGR A;  1ROV A;  1IK3 A;  1DMN A;  1PU4 A;  2D42 A;  1WQL B;  2IY2 A;  4NPB A;  4EBG A;  2H0G A;  1I8V A;  5GSP A;  2HMN B;  1BGS A;  5IG4 A;  2BIR A;  3SED A;  3T0U A;  4R9L A;  5IER A;  1TU5 A;  1AR0 A;  1BSE A;  1CYV A;  2AAE A;  4L7K A;  1W01 A;  3BNC A;  4MEI A;  2F99 A;  2ZL8 A;  5DRE A;  1IV9 A;  1I0X A;  2CWV A;  4O2H A;  1OHS A;  5AEU B;  1LVN A;  1DMQ A;  4EV2 A;  1BOX A;  2XGN A;  1WMP A;  4PEJ A;  3TDG A;  2YFI B;  3IPT A;  1UGH I;  3LH4 A;  2ML6 A;  2ZHX B;  1TFK A;  1US1 A;  2WOH A;  2KF5 A;  3K63 A;  1RGE A;  1SQW A;  1U8C B;  3FKA A;  3U97 A;  2HMJ B;  2RCD A;  1FGR A;  1IVU A;  4FMA A;  1FYS A;  1VZZ A;  3EF8 A;  1VQ7 3;  3FGY A;  2B1X B;  3SVA A;  1RNB A;  2P0M A;  3L0R A;  1JNQ A;  3KFQ C;  1IT7 A;  3F9S A;  1RGC A;  4R80 A;  4I5Q A;  3OV4 A;  3NXJ A;  1OPY A;  3KN4 A;  1EKM A;  4ORL A;  8CHO A;  4OK0 A;  4KFE A;  3LTA A;  1Q82 4;  1TRQ A;  4XB5 A;  1Q42 A;  3JUQ A;  1G0T A;  1YNV X;  2INX A;  1O7W B;  1E3R A;  1O7M B;  2FGT A;  4KZ1 A;  4MJD A;  3V92 A;  3GZR A;  3NBJ A;  1FA3 A;  1S72 3;  3AMO A;  1FGM A;  2RSX A;  5BXQ A;  1ZS7 A;  1RGK A;  3CCU 3;  1KSI A;  3B7C A;  1ZGX A;  3F14 A;  4CJN A;  4J8T A;  2IYJ A;  3V98 A;  1FZU A;  2AAD A;  2QA4 3;  3F7S A;  2P05 A;  3UNL A;  3G0K A;  1UI8 A;  4K1V A;  1U5O A;  2Z6B A;  1BSB A;  1NB3 I;  1RCL A;  1YJN 3;  1IV7 A;  3V99 A;  4OVM A;  2IMJ A;  1M1K 4;  3K9M C;  3FCS B;  1A67 A;  1BUQ A;  3GZB A;  3I56 3;  5JPU A;  1C7H A;  2CFD A;  3OWS A;  3KE7 A;  2CWU A;  4LMI A;  1Q81 4;  1NJI 4;  4O8S A;  1QJG A;  1TRP A;  3BU4 A;  3MWZ A;  4BL3 A;  3CMA 3;  4AKY A;  4BL2 A;  8RNT A;  3E99 A;  2O9U X;  1ZO2 A;  1YGE A;  3F8X A;  3JUO A;  2F5W A;  5IEP A;  3O8Y A;  4XBT A;  1AVL A;  2GU1 A;  3CXC 2;  2GXF A;  3N54 B;  3DGY A;  3RGA A;  3G16 A;  3HII A;  5AYS C;  3BND A;  4ZM8 A;  1N5H A;  2KF4 A;  2ZA4 A;  5G2G A;  2JDI H;  6RNT A;  1Q7Y 4;  5M18 A;  4LGQ A;  4X2H A;  1T2H A;  2K3D A;  2OCT A;  2HML B;  3HZP A;  3S5C A;  2XEP A;  1KC8 4;  2XSH B;  3KZT A;  3MG1 A;  2J8X B;  4N6L A;  1RLS A;  5HGR A;  2XSO B;  3CNM A;  3ECF A;  2Y73 A;  3DGM A;  4HM0 B;  4RNZ A;  4TX4 A;  3KCH A;  5ELU A;  2GSP A;  2XF3 A;  1B2S A;  3UJM A;  1B3S A;  1T2I A;  4QWT A;  3S28 A;  3S67 A;  2MF7 A;  1GSP A;  3RDE A;  3X3X A;  1SII A;  4HBR A;  5BU4 A;  1I2G A;  1FUS A;  1WTH A;  3LT9 A;  1I70 A;  1QAL A;  1OGZ A;  5IF6 A;  3BNB A;  1DMM A;  1B21 A;  2Z77 A;  1C54 A;  2UUG C;  3PXM A;  1AV4 A;  1GOY A;  4BTX A;  1JN5 A;  1JBT A;  2ZDJ A;  5LC7 A;  2D1W A;  3HIG A;  1YJ9 3;  1RNT A;  3ZFZ A;  1TTO A;  3PZW A;  3OW2 2;  3CCL 3;  1RTU A;  2QEX 3;  1BNG A;  1TFO A;  1VQK 3;  4HM5 B;  2RFR A;  4FR9 A;  3GWR A;  1JZD A;  1PY3 A;  5IEN A;  1T5Y A;  1JZO A;  2WGQ A;  3PGB A;  4HM7 B;  1M9G A;  2GEX A;  3OX9 A;  1BNE A;  2BNG A;  4FCJ A;  3HX8 A;  1K73 4;  3GZY B;  4CPK A;  5ELJ A;  3SXX A;  1N9E A;  3OWU A;  2WOF A;  3I55 3;  3LML A;  3EN8 A;  4KFF A;  1VQ5 3;  1B2X A;  2ML5 A;  3CNX A;  3X3Y A;  1BNJ A;  4Q53 A;  3J7Y d;  3PCS A;  3DH2 A;  4JRF A;  1JB4 A;  1EEJ A;  2CX0 A;  3AMO B;  3DMC A;  4EXR A;  4R9K A;  1D6Z A;  3B4O A;  5KP1 A;  1RDS A;  2Q07 A;  1O7G B;  4GB5 A;  3WHO A;  3AHS A;  1I3F A;  1A2K A;  1B20 A;  2KXG A;  3CCR 3;  5I97 A;  1VQQ A;  1J2B A;  4HKV B;  2GEY A;  1EG9 B;  4JF8 A;  1GYB A;  3MHE A;  1W2B 2;  3KII A;  4XDV A;  1UDI I;  1JV2 B;  2F5M A;  3KSP A;  2OOV C;  3MG3 A;  4J5K A;  2BMO B;  3NV0 B;  3EB8 A;  1ULI B;  4AEQ A;  3EBT A;  1SIH A;  2UGI A;  4DKI A;  1RKY A;  4NRE A;  1YHQ 3;  3FH1 A;  2CG1 A;  1BRH A;  5LC6 A;  1W02 A;  4G1M B;  4HM3 B;  2YFJ B;  1STF I;  3DM8 A;  4N6T A;  1E3V A;  3MKI A;  3MSO A;  1GD3 A;  3ZG0 A;  2HOH A;  5AII A;  3CCV 3;  3CCQ 3;  1K9M 4;  1LOX A;  2OTJ 3;  1OUN A;  7STD A;  3BLZ A;  1I0V A;  1KWI A;  1BU4 A;  2BU4 A;  2QGU A;  3MPH A;  1K8A 4;  4STD A;  1GD4 A;  4N3V A;  2B24 B;  3Q1C A;  2OOV A;  2GBW B;  3S29 A;  1QMA A;  3VF1 A;  3X3Z A;  3G71 3;  3WOE B;  1W5Z A;  4WP5 A;  1GMP A;  1K28 A;  4R4K A;  1SPU A;  1TUH A;  1MWS A;  1NO3 A;  1Q9E A;  2W9P A;  2XRX B;  1NU3 A;  1BSA A;  2E2T A;  1A2P A;  1BRK A;  1RJO A;  1OF5 B;  2RBI A;  5AIG A;  3JUP A;  5IW9 A;  3DGL A;  1BNI A;  3BNE A;  3D4A A;  4L8O A;  3X40 A;  1AQZ A;  3HK4 A;  5CLK A;  2W9Q A;  1OH0 A;  2K0M A;  1IVV A;  2P38 A;  3F8H A;  3LOY A;  4FCM A;  4FCZ A;  5EVH A;  1YIT 3;  1JBS A;  1QVF 2;  1FGT A;  3FG1 A;  1BNS A;  1IQY A;  1LOY A;  1X1W A;  2XGL A;  3FLJ A;  3RNT A;  1Z1S A;  1DET A;  2HMM B;  1BSD A;  2R4I A;  1RGH A;  1JN5 B;  3F40 A;  2XR8 B;  4HM2 B;  4HZB B;  1VQP 3;  3K5T A;  1Q86 4;  3CCJ 3;  1CH0 A;  4X2O A;  3NV0 A;  2XFS A;  5AI1 A;  2A15 A;  3G6E 3;  2CC3 A;  2HMK B;  3AGO A;  1R4Y A;  1OCV A;  1X1X A;  3JUN A;  1SAR A;  1NWW A;  4R1K A;  3G8Z A;  1MGR A;  4N6N B;  4FMC A;  3LTB A;  1RRH A;  3QK9 A;  1FUW A;  3KSE D;  1V58 A;  5M19 A;  5STD A;  1VQO 3;  1GMR A;  3OWY A;  1UUG B;  1O7N B;  4NHF A;  9RNT A;  1A2V A;  2RGQ A;  2KRT A;  4HM8 B;  3CC2 3;  1NNV A;  1YI2 3;  4WYK A;  2KF6 A;  1N8R 4;  3SLU A;  4KT3 B;  1EA2 A;  1M1X B;  2YX9 A;  3LXU X;  2Z76 A;  3VSY A;  3X42 A;  4HAA A;  2M7O A;  2FXT A;  1AY7 A;  1G96 A;  2STD A;  4I4K A;  1WNH A;  5AEW B;  3NQY A;  2H0H A;  2OQE C;  1E97 A;  4GL6 A;  4XDW A;  3HOH A;  3B4P A;  1BRJ A;  3BIR A;  1LRA A;  1W7C A;  4BU4 A;  1OF5 A;  1W4N A;  3FG3 A;  1OHO A;  1BAO A;  5DRV A; 
#chains in the Genus database with same CATH homology
 2CIU A;  3EE1 A;  3EX9 A;  5IG0 A;  4K90 B;  3T8U A;  3LT8 A;  1Q40 A;  2I9W A;  5JBS A;  1L5G B;  1S5A A;  3BB9 A;  3EN1 B;  3FG4 A;  2E2V A;  3CU3 A;  3NUV A;  3D9R A;  1WMO A;  4HM6 B;  1CQS A;  1GY6 A;  1W2Z A;  3SOY A;  1IVW A;  1VQL 3;  1FGQ A;  3H3H A;  2OQE A;  2E2U A;  3GRD A;  3WOF B;  4RNY A;  3WOD G;  2W03 A;  4MMY B;  2IUK A;  4WWU C;  1TP6 A;  3PCR A;  3T8N A;  1QVG 2;  2CG0 A;  2W0Q A;  2L4V A;  2LYX A;  3GAX A;  2OWP A;  1AVK A;  5D82 A;  3LTC A;  2GBX B;  3QRD A;  4KVH A;  1DVC A;  3DXO A;  5KP4 A;  2YFL B;  1M90 4;  1CYU A;  3CD6 3;  1N8Q A;  5FW5 A;  1IQ8 A;  2UX0 A;  4HJL B;  4MMX B;  1IU7 A;  4FMD A;  3LTD A;  3B8L A;  1VQ8 3;  4N6O B;  5KP3 A;  4WHA A;  4HYZ A;  2IA7 A;  3PS8 A;  2JQ5 A;  2O3O A;  3CPO A;  5JPP A;  3NX0 A;  1MNL A;  1R4C A;  4N6M A;  4EYC A;  2CWT A;  3WMD A;  1IQX A;  2BMQ B;  1OAC A;  2OTL 3;  3WA2 X;  1LNH A;  1RN7 A;  1UW1 A;  1O7P B;  2BO9 B;  3JVC A;  2F98 A;  3N8B A;  2Z7A A;  3MYT A;  3G4S 3;  5EEO A;  1DYU A;  1IVX A;  3UB1 A;  2V1L A;  2CK3 H;  4HZ9 B;  3U1W A;  4CCV A;  2IUJ A;  4KFD A;  3CPW 2;  1D6Y A;  1STD A;  1NB5 I;  1IT8 A;  1UUV B;  4AKZ A;  1VQN 3;  1OGX A;  3NBB A;  5CF2 A;  3SX1 A;  3HI7 A;  3H51 A;  3LYG A;  4RBN A;  4K61 A;  3IMA B;  1K41 A;  1O7H B;  3ER7 A;  2CFK A;  4WYK B;  4BTW A;  3CCE 3;  4U13 A;  1JKG B;  3CC4 3;  3Q2P A;  4LEH A;  4CDL A;  1VQ4 3;  1KD1 4;  1JB2 A;  3NBR A;  2CFG A;  2LQV A;  3NM2 A;  4LZI A;  3FSD A;  5FGO A;  4H3U A;  2GU3 A;  3EQQ B;  3ROB A;  5AIH A;  2KCD A;  2W56 B;  3DZL A;  3IJE B;  1HU9 A;  4O3V A;  1KQS 2;  2C11 A;  1Q40 B;  4O02 B;  5BVB A;  4N6V 0;  3D3L A;  2FNQ A;  2W04 A;  3UL5 A;  1W00 A;  3DGN A;  1Y4K A;  3FF2 A;  1JB5 A;  3NM7 A;  3NHX A;  1N9J A;  4IPB A;  5AIF A;  3NQZ A;  3MG2 A;  3UL6 A;  1A90 A;  2XH9 A;  3FZW A;  4J9A A;  3N9H A;  3S27 A;  4RZM A;  1W6C A;  6STD A;  2C10 A;  4IT7 A;  1VQ9 3;  4BTY A;  1JJ2 2;  1OHP A;  2BMR B;  2PZV A;  4EV5 A;  3EJV A;  3M8C A;  1F8N A;  4H61 A;  3DUK A;  1W6Y A;  2HMO B;  3DGO A;  2P0X A;  4HVN A;  2BT3 A;  3WDG B;  1JKG A;  2WGO A;  2QIY A;  2CFW A;  1ISK A;  1LXE A;  3EHC A;  1SJW A;  5A0O B;  1DVD A;  5D81 A;  3WA3 A;  1EQK A;  4IIA A;  3LZA A;  1ULJ B;  4WFO A;  1WMN A;  2W56 A;  5IG3 A;  4L8P A;  1TIJ A;  3CME 3;  3KKG A;  2CFL A;  2WO0 A;  3SOA A;  2CW9 A;  1GY5 A;  3OXA A;  1NDO B;  3CC7 3;  4FMB A;  3CCS 3;  3ALA A;  1IDP A;  2P09 A;  3DY5 A;  4XBX A;  3Q90 A;  3CCM 3;  1V74 A;  3EBY A;  1JRQ A;  5D83 A;  1HKX A;  3VGN A;  2CH9 A;  1VQM 3;  1VQ6 3;  2CKF B;  1FGO A;  3FF0 A;  3EC9 A;  5IEO A;  4EC6 A;  1RRL A;  2XFT A;  3A76 A;  1GY7 A;  1ZX2 A;  1YIJ 3;  2K54 A;  1MOL A;  1GS3 A;  4N6U A;  2SBL A;  3K7C A;  3X41 A;  5CK6 A;  1PFP A;  1W6G A;  2BHM A;  1QAK A;  1QAF A;  1CEW I;  4HM1 B;  4XBT A;  3JUM A;  5AYR B;  1YVB I;  1UI7 A;  4LSO A;  2W6J H;  5EQL A;  5TGN A;  3PYJ A;  1ASK A;  3F7X A;  4OUQ A;  2CHC A;  2F86 B;  1YJW 3;  4K1U A;  4XBY A;  3STD A;  5CXO A;  2Y74 A;  3GZX B;  1D6U A;  3K0Z A;  4HM4 B;  3I0Y A;  4MMZ B;  2W2C A;  1N5P A;  1UUW B;  2MC8 A;  5IG5 A;  5CF1 A;  4XM4 A;  2PNC A;  1ROA A;  3RGR A;  1ROV A;  1IK3 A;  1DMN A;  1PU4 A;  2D42 A;  1WQL B;  4EBG A;  2HMN B;  5IG4 A;  3SED A;  3T0U A;  4R9L A;  5IER A;  1TU5 A;  1AR0 A;  1CYV A;  4L7K A;  1W01 A;  3BNC A;  4MEI A;  2F99 A;  2ZL8 A;  5DRE A;  1IV9 A;  2CWV A;  4O2H A;  1OHS A;  5AEU B;  1LVN A;  1DMQ A;  4EV2 A;  2XGN A;  3TDG A;  1WMP A;  4PEJ A;  2YFI B;  3IPT A;  3LH4 A;  2ML6 A;  1TFK A;  1US1 A;  2WOH A;  3K63 A;  1SQW A;  1U8C B;  3FKA A;  3U97 A;  2HMJ B;  2RCD A;  1FGR A;  1IVU A;  4FMA A;  1VZZ A;  3EF8 A;  1VQ7 3;  3FGY A;  2B1X B;  3SVA A;  2P0M A;  3L0R A;  1JNQ A;  3KFQ C;  1IT7 A;  3F9S A;  4R80 A;  3OV4 A;  3NXJ A;  1OPY A;  3KN4 A;  1EKM A;  4ORL A;  8CHO A;  4OK0 A;  4KFE A;  3LTA A;  1Q82 4;  4XB5 A;  1Q42 A;  3JUQ A;  2INX A;  1O7W B;  1E3R A;  1O7M B;  2FGT A;  4KZ1 A;  4MJD A;  3V92 A;  3GZR A;  3NBJ A;  1S72 3;  3AMO A;  1FGM A;  2RSX A;  5BXQ A;  3CCU 3;  1KSI A;  3B7C A;  3F14 A;  4J8T A;  3V98 A;  2QA4 3;  3F7S A;  2P05 A;  3UNL A;  3G0K A;  1UI8 A;  4K1V A;  1U5O A;  2Z6B A;  1NB3 I;  1YJN 3;  1IV7 A;  3V99 A;  4OVM A;  2IMJ A;  1M1K 4;  3K9M C;  3FCS B;  1A67 A;  1BUQ A;  3GZB A;  3I56 3;  5JPU A;  1C7H A;  2CFD A;  3OWS A;  3KE7 A;  2CWU A;  4LMI A;  1Q81 4;  1NJI 4;  4O8S A;  1QJG A;  3MWZ A;  3CMA 3;  4AKY A;  3E99 A;  2O9U X;  1ZO2 A;  1YGE A;  3F8X A;  3JUO A;  5IEP A;  3O8Y A;  1AVL A;  2GU1 A;  3CXC 2;  2GXF A;  3N54 B;  3RGA A;  3G16 A;  3HII A;  5AYS C;  3BND A;  4ZM8 A;  1N5H A;  1Q7Y 4;  5G2G A;  2JDI H;  4LGQ A;  4X2H A;  2OCT A;  2HML B;  3HZP A;  3S5C A;  2XEP A;  1KC8 4;  2XSH B;  3KZT A;  3MG1 A;  4N6L A;  5HGR A;  2XSO B;  3CNM A;  3ECF A;  2Y73 A;  3DGM A;  4HM0 B;  4RNZ A;  4TX4 A;  5ELU A;  3CCL 3;  1FA3 A;  2XF3 A;  3UJM A;  4QWT A;  3S28 A;  3S67 A;  2MF7 A;  3RDE A;  3X3X A;  1SII A;  4HBR A;  1WTH A;  3LT9 A;  1QAL A;  1OGZ A;  5IF6 A;  3BNB A;  1DMM A;  2Z77 A;  3PXM A;  1AV4 A;  4BTX A;  1JN5 A;  2ZDJ A;  5LC7 A;  2D1W A;  3HIG A;  1YJ9 3;  3PZW A;  3OW2 2;  2QEX 3;  1TFO A;  1VQK 3;  4HM5 B;  2RFR A;  4FR9 A;  3GWR A;  5IEN A;  1T5Y A;  2WGQ A;  3PGB A;  4HM7 B;  1M9G A;  2GEX A;  3OX9 A;  2BNG A;  4FCJ A;  3HX8 A;  1K73 4;  3GZY B;  5ELJ A;  3SXX A;  1N9E A;  3OWU A;  2WOF A;  3I55 3;  3LML A;  3EN8 A;  4KFF A;  1VQ5 3;  2ML5 A;  3CNX A;  3X3Y A;  4Q53 A;  3J7Y d;  3PCS A;  4JRF A;  1JB4 A;  3DMC A;  3AMO B;  4EXR A;  4R9K A;  1D6Z A;  3B4O A;  5KP1 A;  2Q07 A;  1O7G B;  4GB5 A;  1A2K A;  2KXG A;  3CCR 3;  5I97 A;  1J2B A;  4HKV B;  2GEY A;  1EG9 B;  4JF8 A;  1GYB A;  3MHE A;  1W2B 2;  3KII A;  4XDV A;  1JV2 B;  3KSP A;  2OOV C;  3MG3 A;  2BMO B;  3NV0 B;  3EB8 A;  1ULI B;  4AEQ A;  3EBT A;  1SIH A;  1RKY A;  1YHQ 3;  4NRE A;  3FH1 A;  2CG1 A;  5LC6 A;  1W02 A;  4G1M B;  4HM3 B;  2YFJ B;  1STF I;  3DM8 A;  4N6T A;  1E3V A;  3MKI A;  3MSO A;  1GD3 A;  5AII A;  3CCV 3;  3CCQ 3;  1K9M 4;  1LOX A;  2OTJ 3;  1OUN A;  7STD A;  3BLZ A;  1KWI A;  2QGU A;  3MPH A;  1K8A 4;  4STD A;  1GD4 A;  4N3V A;  2B24 B;  3Q1C A;  2OOV A;  2GBW B;  3S29 A;  1QMA A;  3VF1 A;  3X3Z A;  3G71 3;  3WOE B;  1W5Z A;  4WP5 A;  1K28 A;  4R4K A;  1SPU A;  1TUH A;  1NO3 A;  2W9P A;  2XRX B;  1NU3 A;  2E2T A;  1RJO A;  1OF5 B;  5AIG A;  3JUP A;  5IW9 A;  3DGL A;  3BNE A;  4L8O A;  3X40 A;  3HK4 A;  5CLK A;  2W9Q A;  1OH0 A;  2K0M A;  1IVV A;  2P38 A;  3F8H A;  3LOY A;  4FCM A;  4FCZ A;  5EVH A;  1YIT 3;  1QVF 2;  1FGT A;  3FG1 A;  1IQY A;  2XGL A;  3FLJ A;  1Z1S A;  2HMM B;  2R4I A;  3F40 A;  4HM2 B;  4HZB B;  1JN5 B;  2XR8 B;  1VQP 3;  3K5T A;  1Q86 4;  3CCJ 3;  4X2O A;  3NV0 A;  2XFS A;  5AI1 A;  2A15 A;  3G6E 3;  2CC3 A;  2HMK B;  1OCV A;  3JUN A;  1NWW A;  4R1K A;  3G8Z A;  4N6N B;  4FMC A;  3LTB A;  1RRH A;  3QK9 A;  1FUW A;  3KSE D;  5STD A;  1VQO 3;  3OWY A;  1O7N B;  4NHF A;  1A2V A;  2RGQ A;  2KRT A;  4HM8 B;  3CC2 3;  1YI2 3;  4WYK A;  1N8R 4;  3SLU A;  1EA2 A;  1M1X B;  2YX9 A;  3LXU X;  2Z76 A;  3VSY A;  3X42 A;  2M7O A;  2FXT A;  1G96 A;  2STD A;  4I4K A;  5AEW B;  1WNH A;  3NQY A;  2OQE C;  1E97 A;  4GL6 A;  4XDW A;  3B4P A;  1W7C A;  1OF5 A;  1W4N A;  3FG3 A;  1OHO A;  5DRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...