1EG9B

Naphthalene 1,2-dioxygenase with indole bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT)
publication title Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eg9B00
2CHCA 3NBRA 2BMOB 7STDA 3VSYA 4ORLA 5AEUB 3RGRA 5CF2A 3JUOA 2QGUA 1OHOA 4H3UA 4HZ9B 2F98A 3GZXB 4HM8B 5G2GA 3T8NA 1TP6A 3MG1A 2JQ5A 2RFRA 4FCMA 3CNMA 3CNXA 2GBXB 4HM1B 1Q40B 3Q90A 3E99A 4LEHA 1O7WB 1Q40A 4MJDA 3EBTA 1ZO2A 2W2CA 3EF8A 2Z77A 1A2KA 2OWPA 5TGNA 3MG3A 1QJGA 3NM2A 3JUPA 2R4IA 3GWRA 3LYGA 3GZYB 3BB9A 5FW5A 4L8PA 4KVHA 2HMLB 5BXQA 4J9AA 1JN5B 1O7HB 1JN5A 2K54A 4HM4B 3F8HA 1ULJB 2GXFA 1W6YA 3JUNA 3JUMA 3K0ZA 1O7GB 3G16A 1S5AA 2HMMB 3UJMA 4GB5A 2QIYA 1ULIB 3STDA 3GZRA 1E97A 2UX0A 4OVMA 1TUHA 3F7SA 3EBYA 5IERA 1OHPA 3KE7A 4HZBB 3KZTA 4X2HA 3T8UA 1JKGA 1OF5B 3EX9A 1K41A 3EQQB 5AIFA 1STDA 5KP3A 3B4OA 3CU3A 3HK4A 3FH1A 1E3RA 5IEOA 3FSDA 3FGYA 5EVHA 3DXOA 4IIAA 3GRDA 1OUNA 3G8ZA 3JUQA 2IMJA 5IEPA 1EG9B 3F14A 2PZVA 3SOYA 4X2OA 3OXAA 3FKAA 3ROBA 5CLKA 1GY5A 4R9LA 3MHEA 4R1KA 1C7HA 1JB4A 1O7MB 3BLZA 4HM7B 1GY7A 3NHXA 3B8LA 5IG3A 5D82A 1W01A 2HMJB 3FF2A 3NXJA 5IG4A 4PEJA 3FLJA 5KP1A 1OGXA 5AIHA 2XSOB 2I9WA 3NUVA 3M8CA 4HM3B 2F99A 5DRVA 2XRXB 4WWUC 1JB5A 3MSOA 4OUQA 3F7XA 5AIIA 5D81A 1ZX2A 4K1UA 1O7PB 4N3VA 4U13A 1OH0A 1Z1SA 1BUQA 3LZAA 3UNLA 2HMOB 4STDA 2BMQB 3B4PA 4HM0B 3IPTA 4K1VA 3ECFA 1AR0A 3KKGA 5IG5A 4WYKB 4HM6B 3MKIA 3SOAA 3VGNA 1DMNA 3FF0A 3RGAA 3K7CA 1EA2A 3WMDA 2GEXA 1OF5A 3OX9A 4RZMA 5IENA 3DUKA 3I0YA 1JB2A 4FCJA 2GBWB 2XR8B 5BVBA 3H3HA 6STDA 2F86B 1QMAA 2XSHB 4HVNA 4XDVA 5AIGA 2BNGA 3F8XA 3EN8A 5D83A 3EN1B 4CDLA 3OWYA 4I4KA 4WP5A 5CF1A 4J8TA 4XB5A 1IDPA 4HKVB 1OPYA 1CQSA 2YFJB 1UUWB 3EHCA 2RGQA 4HJLB 4XBXA 3DMCA 2INXA 3B7CA 3F9SA 3GZBA 1GYBA 5CK6A 1WQLB 4Q53A 5AEWB 2CKFB 1E3VA 3DZLA 1OCVA 3EJVA 4R9KA 3DM8A 1O7NB 4LMIA 3A76A 3CPOA 5KP4A 2YFIB 3HZPA 3F40A 1NWWA 1ASKA 1OGZA 2YFLB 1GY6A 4L7KA 2RCDA 3SEDA 4XM4A 4XDWA 5AI1A 5HGRA 3OWSA 1W02A 3MG2A 4WYKA 1DMQA 3S5CA 5JPPA 1ISKA 5STDA 5JPUA 5IF6A 3H51A 1NU3A 3KSPA 1Q42A 8CHOA 5CXOA 4HM2B 2A15A 2B24B 4HM5B 5DREA 3OV4A 2HMNB 3MYTA 1W00A 1OHSA 2Z76A 3EC9A 2STDA 3G0KA 2HMKB 4LGQA 5IG0A 2Z7AA 1JKGB 1VZZA 3HX8A 4XBTA 2BMRB 1U5OA 3NV0B 1GS3A 2B1XB 3ER7A 1HKXA 3NV0A 3FZWA 4L8OA 2GEYA 4XBYA 3OWUA 1SJWA 1UUVB 1DMMA 3D9RA 1NDOB
chains in the Genus database with same CATH superfamily
3O8YA 2CHCA 1CYVA 4OK0A 3NBRA 1BRKA 3DGYA 1B21A 1WMPA 2L4VA 3WODG 2BMOB 1W6GA 3HIIA 8RNTA 4BTYA 7STDA 2OQEC 1YIJ3 1IYYA 1N8QA 1BSEA 4ORLA 2KF4A 3VSYA 5AEUB 1W2ZA 2P38A 3RGRA 5CF2A 7GSPA 3JUOA 3S67A 1F8NA 1RGKA 1Q7Y4 3PYJA 2RBIA 2QGUA 2CX1A 1DVCA 1I70A 2H0IA 3S28A 1OHOA 1M1K4 4H3UA 3CC23 5M1AA 4RNYA 4HZ9B 2W6JH 2F98A 4N6V0 1YI23 2IA7A 4KFEA 1I0VA 1RJOA 2BIRA 4K90B 4EXRA 3GZXB 1VQQA 4HM8B 5G2GA 3T8NA 1Y4KA 1JJ22 1TP6A 1ZGXA 4J5GA 2H0GA 3MG1A 5GSPA 2JQ5A 1Q7HA 2RFRA 3G713 3NQZA 4FCMA 3CNMA 1HYFA 1RGFA 1HU9A 3CNXA 3PCRA 1RGLA 2GBXB 1VQO3 4HM1B 1TFOA 1D6ZA 4R80A 1Q40B 2P0XA 1FW7A 1TRPA 1BGSA 3Q90A 3E99A 4LEHA 1N8R4 1O7WB 1Q40A 1IT8A 1R4YA 4MJDA 1BSCA 3IJEB 3CCU3 3N8BA 1JRQA 1X1WA 3EBTA 4LZIA 1ZO2A 2W2CA 3EF8A 1RTUA 1A90A 5BU4A 1IQXA 2H0HA 1YIT3 3A5EA 1QVG2 2Z77A 1A2KA 3T0UA 2OWPA 2XH9A 5TGNA 1IV9A 1BNFA 3MG3A 1UUGB 2R41A 1QJGA 2BHMA 1M904 3NM2A 2BU4A 5AYSC 1K8A4 2E2VA 1FGQA 3JUPA 1IK3A 2R4IA 2CWVA 1RGHA 1OACA 1GD4A 3GWRA 3LYGA 3GZYB 4HBRA 1W2B2 3KIIA 4QWTA 3BB9A 1BNSA 5FW5A 4L8PA 4GSPA 3AGOA 4KVHA 3D79A 3WA2X 1C54A 2HMLB 5BXQA 3CCL3 2FGTA 4EYCA 4J9AA 3TDGA 1JN5B 1UGHI 2WO0A 5I97A 1O7HB 2KF6A 2O9UX 4AKZA 6GSPA 1TJDA 1I3FA 3DH2A 1JN5A 2L1SA 3CME3 1SPUA 2K54A 1T3BA 4HM4B 3F8HA 1ULJB 4EBGA 1GD3A 2GXFA 1W6YA 3JUNA 1CYUA 1EKMA 2D1WA 4BTXA 1DVDA 2WOHA 3DGNA 5G1LA 3JUMA 3K0ZA 1B27A 1NB5I 1RNBA 1B20A 3LT9A 1VQ83 4N6TA 5HOHA 1TRQA 1L5GB 1O7GB 3G16A 4KT3B 2IUJA 1S5AA 2HMMB 3UJMA 2WOFA 9RNTA 3DGLA 4GB5A 1QAKA 2M7OA 2QIYA 3LTDA 1RMSA 1ULIB 2F5MA 1JNQA 2XFSA 1I8VA 3STDA 3GZRA 6RNTA 1E97A 2UX0A 1YJW3 4OVMA 1SIHA 1TUHA 3F7SA 3EBYA 4BIRA 5IERA 1UCIA 3LT8A 3LXUX 4ZM8A 1OHPA 2OQEA 3KE7A 4HZBB 2QEX3 1YGEA 4FR9A 2OOVC 3KZTA 1RKYA 4BTWA 2V1LA 2C10A 3HOHA 4X2HA 2W56A 3T8UA 2CG0A 1IV7A 1JKGA 1OF5B 1UDII 2CC3A 1K41A 3EQQB 3EX9A 1TTOA 3U1WA 1RGCA 1KC84 1R4CA 3LOYA 1VQM3 2K3DA 5AIFA 4JF8A 1LQMB 3CC73 1STDA 3ZG0A 3CCQ3 5JBSA 1KQS2 3PCSA 3B4OA 2O3OA 5KP3A 3CU3A 1YVBI 3HK4A 3FH1A 4N6OB 3CCR3 3CD63 1X1YA 1E3RA 5IEOA 2UUGC 5AYRB 3FSDA 1G0TA 1AQZA 1KWIA 1VQ53 2LYXA 4CJNA 3FGYA 5RNTA 5EVHA 4RBNA 1RSNA 1W6CA 3DXOA 1HZ1A 4IIAA 3S29A 1UCJA 2Y73A 3KSED 3GRDA 1OUNA 1BRHA 3G8ZA 1G02A 3Q3FA 3JUQA 5G1KA 5M19A 1GOVA 1M1XB 2IMJA 5IEPA 1LNIA 1EG9B 4FMAA 3SYUA 3SXXA 3DGMA 3F14A 3K63A 2ML6A 2PZVA 5LC7A 4X2OA 3SOYA 3V92A 3OXAA 3FKAA 3ROBA 3FCSB 3D5IA 3D3LA 4J5KA 1US1A 2K0MA 5CLKA 3V99A 1GY5A 1LOXA 1B2SA 1VQK3 1I2GA 4KZ1A 1AV4A 2ZA4A 3N54B 3AMOB 2Z6BA 2CK3H 1JZOA 1FUTA 2E2TA 4R9LA 1FGRA 3MHEA 4R1KA 3BU4A 3QK9A 1C7HA 1Q864 1JB4A 1RRHA 1O7MB 4NPBA 3BNEA 1PYLA 1BRSA 3BLZA 4N6LA 1Q9EA 4HM7B 3AHWA 1GY7A 2AAEA 2JDIH 4CCVA 1IVWA 5EQLA 1EEJA 1FZUA 3NHXA 2SBLA 3B8LA 1SIIA 4MMXB 5D82A 5IG3A 1W01A 2HMJB 4FMBA 4EV5A 3FF2A 3QRDA 3NXJA 1BOXA 5IG4A 4PEJA 1VQ43 1WTHA 3FLJA 1K28A 3CCE3 2CG1A 4HAAA 1MWSA 1BANA 3CCM3 3UL5A 2WGOA 1RCKA 3NQYA 3BNCA 1G96A 1FA3A 3NBBA 5KP1A 1CEWI 1OGXA 1I2EA 5AIHA 2XSOB 4JRFA 2I9WA 3NUVA 1I0XA 2KRTA 1SQWA 5M18A 1B2ZA 1AVLA 3MPHA 3M8CA 4HM3B 4IT7A 3CMA3 3X40A 2F99A 4CPKA 3ZG5A 1RN4A 5DRVA 1VQN3 4N6MA 2XRXB 4GHOA 2IUKA 4WWUC 1A67A 1JB5A 3MSOA 4OUQA 3F7XA 5AIIA 2MC8A 3S27A 1DETA 5D81A 2W04A 1MGWA 4HOHA 1ZX2A 4K1UA 1WNHA 1O7PB 2BO9B 3VF1A 4N3VA 2KCDA 4U13A 1OH0A 1EQKA 2OOVA 3PXMA 1QAFA 1MWRA 1Z1SA 1ZS7A 1BUQA 3LZAA 4K61A 3UNLA 3ZFZA 2OTL3 2PNCA 4MMZB 2HMOB 2XF3A 1RN1A 2RNTA 4O2HA 4MMYB 4STDA 3PZWA 1GOUA 1BSDA 4H61A 2BMQB 1FUWA 2UGIA 2XGNA 3GSPA 1IQYA 3B4PA 4HM0B 4LSOA 2MF7A 1IU7A 3IPTA 4K1VA 4N6NB 4O3VA 2CX0A 3ECFA 1D6YA 4BL2A 2GSPA 2IY2A 1BIRA 2CIUA 3D4AA 3FG1A 1AR0A 3KKGA 4I5QA 3OW22 5IG5A 3MWZA 1PFPA 4WYKB 1BRIA 4HM6B 1V58A 3MKIA 1RGGA 3SOAA 4LYLB 1GMRA 4EV2A 3VGNA 3CCV3 4R4KA 4FMDA 4RNTA 1FGOA 1FGMA 1VQ93 2AADA 1PU4A 3BIRA 1DMNA 2W0QA 1YJ93 2C11A 2XGLA 3D5GA 3FF0A 1VQ73 3RGAA 3K7CA 2OTJ3 1STFI 1EA2A 1IVVA 3WMDA 2CFGA 1GOYA 5BIRA 1IQ8A 4BU4A 2GEXA 1OF5A 4FMCA 3OX9A 1FUSA 1B2XA 1T2HA 2HOHA 4RZMA 5IENA 1RLSA 1N5PA 3DUKA 1BRNL 3I0YA 3I563 1JB2A 2CFKA 1LOWA 1S723 4FCJA 1RHLA 2GU1A 2GBWB 3WA3A 2CH9A 1LRAA 2XR8B 3LTBA 4O02B 5BVBA 1WMOA 1B3SA 3H3HA 1K9M4 1BRGA 2F86B 6STDA 1AY7A 1LQGC 1QMAA 2LQVA 4KFFA 1LOVA 2CFDA 1RN7A 1YHQ3 2XSHB 4HVNA 4GL6A 1W4NA 4XDVA 5AIGA 3UB1A 2BNGA 1GMPA 1Q824 1JBRA 3AGNA 1U8CB 3F8XA 7RNTA 1YGWA 2P05A 2FXTA 2P0MA 3EN8A 4KFDA 2ZDJA 3L0RA 5D83A 1SARA 3WOEB 1YNVX 1MWUA 3EN1B 1YVSA 1MGRA 3HI7A 4CDLA 3OWYA 3EB8A 2J8XB 4I4KA 1TFKA 3WR2A 4WP5A 1BRJA 1ROVA 3X3YA 3WOFB 5CF1A 3Q1CA 3CPW2 1UI7A 4J8TA 1T5YA 4XB5A 5ELJA 1IDPA 4TX4A 4HKVB 3V98A 1OPYA 1IVXA 1RRLA 1CQSA 1UW1A 2CFWA 1MNLA 1N5HA 1RCLA 3LMLA 1TIJA 3RNTA 3K9MC 3CC43 2YFJB 1MOLA 1UUWB 2ZHXB 3JVCA 1W5ZA 3KCHA 4NHFA 3EHCA 3AMOA 4O8SA 3WDGB 3HIGA 2RGQA 1LOYA 4HJLB 3EE1A 4HYZA 4NREA 1NO3A 1J2BA 5LC6A 4XBXA 3URPA 3DMCA 3NM7A 3X3XA 2F5WA 2OCTA 2KXGA 2INXA 3B7CA 3F9SA 1JV2B 1KSIA 3GZBA 3Q2PA 1WMNA 3SLUA 3UL6A 5ELUA 3SX1A 3FG4A 1GYBA 5CK6A 1RGEA 1QVF2 1FGTA 1D6UA 1V74A 1WQLB 2SARA 3PGBA 2E2UA 3X42A 1AVKA 4EW5A 2CW9A 3BNDA 2GU3A 1GMQA 1MWTA 1JBSA 4Q53A 1UGIA 4IPBA 5AEWB 2CKFB 3X41A 1LNHA 1A2PA 3U97A 1E3VA 3AHSA 3DZLA 1DYUA 1RNTA 1OCVA 1N9EA 2IYJA 3WHOA 2CWTA 2XFTA 1YJN3 3EJVA 1X1XA 2WGQA 2Y74A 2FNQA 4R9KA 1FYSA 1K734 4G1MB 5IG0A 1BNEA 3DM8A 1LXEA 1O7NB 1UI8A 2CFLA 2KF5A 1EUIC 1JBTA 2XEPA 4LMIA 2KF3A 3A76A 3CPOA 2BT3A 4MEIA 1N9JA 2D42A 3X3ZA 4AKYA 1I2FA 5KP4A 1BNGA 2YFIB 3HZPA 3F40A 2W9QA 1TU5A 3RDEA 1LVNA 1I3IA 1NWWA 1CH0A 1ASKA 1GSPA 1VQL3 3CCJ3 4ILFA 1IVUA 1OGZA 1W7CA 1QALA 2YFLB 1GY6A 4L7KA 1RDSA 2RCDA 3SEDA 3CCS3 1DE3A 1IT7A 4N6UA 3J7Yd 4XM4A 4XDWA 1T2IA 5AI1A 5HGRA 3G4S3 4DKIA 3OWSA 5A0OB 1W02A 3LTCA 3MG2A 4WYKA 1DMQA 3I553 2C4BA 3S5CA 3ALAA 5JPPA 1ISKA 5STDA 5FGOA 5JPUA 3BNBA 2Q07A 3H51A 2W03A 1NU3A 5IF6A 2F56A 1UCKA 3KSPA 1NB3I 4FCZA 1BUJA 1Q42A 8CHOA 4RNZA 5CXOA 4WFOA 1NJI4 4HM2B 1BNJA 1M9GA 4AEQA 1A2VA 2A15A 2B24B 1UCLA 5EEOA 4HM5B 3LTAA 5DREA 3OV4A 3G6E3 2HMNB 3NBJA 3KFQC 2QA43 3PS8A 1PY3A 3CXC2 1BU4A 2ZL8A 1VQP3 1RGAA 1W00A 3MYTA 3SVAA 1OHSA 2Z76A 3EC9A 1X1UA 2F4YA 2STDA 3G0KA 4BL3A 1Q814 2HMKB 3IMAB 4LGQA 2ML5A 2RSXA 1BNIA 1JZDA 2W56B 1JKGB 2Z7AA 3GAXA 5IW9A 1VZZA 1BNRA 3HX8A 1VQ63 1NNVA 1ROAA 2BMRB 1U5OA 3NV0B 4XBTA 2W9PA 3N9HA 1BVIA 1GS3A 1KD14 2B1XB 3ER7A 1HKXA 3NV0A 4EC6A 4WHAA 3FZWA 4L8OA 2CWUA 2GEYA 1BSBA 2YX9A 4XBYA 3OWUA 1SJWA 3DGOA 3KN4A 2KAAA 2P09A 3DY5A 1BAOA 1BSAA 1UUVB 3LH4A 3NX0A 1B2UA 1DMMA 3D9RA 1B2MA 1NDOB 3K5TA 3FG3A 1V57A
chains in the Genus database with same CATH topology
3O8YA 2CHCA 1CYVA 4OK0A 3NBRA 1WMPA 2L4VA 3WODG 2BMOB 1W6GA 3HIIA 4BTYA 7STDA 2OQEC 1YIJ3 1N8QA 4ORLA 3VSYA 5AEUB 1W2ZA 2P38A 3RGRA 5CF2A 3JUOA 3S67A 1F8NA 1Q7Y4 3PYJA 2QGUA 1DVCA 1M1K4 3S28A 1OHOA 4H3UA 3CC23 4RNYA 4HZ9B 2W6JH 2F98A 4N6V0 1YI23 2IA7A 4KFEA 4EV2A 1RJOA 4K90B 4EXRA 3GZXB 4HM8B 5G2GA 3T8NA 1Y4KA 1JJ22 1TP6A 3MG1A 2JQ5A 2RFRA 3G713 3NQZA 4FCMA 3CNMA 1HU9A 3CNXA 3PCRA 2GBXB 1VQO3 4HM1B 1TFOA 1D6ZA 4R80A 1Q40B 2P0XA 3Q90A 3E99A 4LEHA 1N8R4 1O7WB 1IT8A 1Q40A 4MJDA 3IJEB 3CCU3 3N8BA 1JRQA 3EBTA 4LZIA 1ZO2A 2W2CA 3EF8A 1A90A 1IQXA 1YIT3 1QVG2 2Z77A 1A2KA 3T0UA 2OWPA 2XH9A 5TGNA 1IV9A 3MG3A 1QJGA 2BHMA 1M904 3NM2A 1K8A4 5AYSC 2E2VA 1FGQA 3JUPA 1IK3A 2R4IA 2CWVA 1OACA 1GD4A 3GWRA 3LYGA 3GZYB 4HBRA 1W2B2 3KIIA 4QWTA 3BB9A 5FW5A 4L8PA 4KVHA 3WA2X 2HMLB 5BXQA 3CCL3 2FGTA 4EYCA 4J9AA 3TDGA 1JN5B 2WO0A 5I97A 1O7HB 2O9UX 4AKZA 1JN5A 3CME3 1SPUA 2K54A 4HM4B 3F8HA 1ULJB 4EBGA 1GD3A 2GXFA 1W6YA 3JUNA 1CYUA 1EKMA 2D1WA 4BTXA 1DVDA 2WOHA 3DGNA 3JUMA 3K0ZA 1NB5I 3LT9A 1VQ83 4N6TA 1L5GB 1O7GB 3G16A 2IUJA 1S5AA 2HMMB 3UJMA 2WOFA 3DGLA 4GB5A 1QAKA 2M7OA 2QIYA 3LTDA 1ULIB 2XFSA 1JNQA 3STDA 3GZRA 1YJW3 1E97A 2UX0A 4OVMA 1SIHA 1TUHA 3F7SA 3EBYA 5IERA 3LT8A 4ZM8A 3LXUX 1OHPA 2OQEA 3KE7A 4HZBB 2QEX3 1YGEA 4FR9A 2OOVC 3KZTA 1RKYA 4BTWA 2V1LA 2C10A 4X2HA 2W56A 3T8UA 2CG0A 1IV7A 1JKGA 1OF5B 3EX9A 2CC3A 1K41A 3EQQB 3U1WA 1KC84 1R4CA 3LOYA 1VQM3 5AIFA 4JF8A 3CC73 1STDA 3CCQ3 1KQS2 5JBSA 3PCSA 3B4OA 2O3OA 5KP3A 3CU3A 1YVBI 3HK4A 3FH1A 4N6OB 3CCR3 3CD63 1E3RA 5IEOA 5AYRB 3FSDA 1KWIA 1VQ53 2LYXA 3FGYA 5EVHA 4RBNA 1W6CA 3DXOA 4IIAA 3S29A 2Y73A 3KSED 3GRDA 1OUNA 3G8ZA 3JUQA 1M1XB 2IMJA 5IEPA 4FMAA 1EG9B 3SXXA 3DGMA 3F14A 3K63A 2ML6A 2PZVA 5LC7A 4X2OA 3SOYA 3V92A 3OXAA 3FKAA 3ROBA 3FCSB 3D3LA 1US1A 2K0MA 5CLKA 3V99A 1GY5A 1LOXA 1VQK3 4KZ1A 1AV4A 3N54B 3AMOB 2Z6BA 2CK3H 2E2TA 4R9LA 1FGRA 3MHEA 4R1KA 3QK9A 1C7HA 1Q864 1JB4A 1RRHA 1O7MB 3BNEA 3BLZA 4N6LA 4HM7B 1GY7A 2JDIH 4CCVA 1IVWA 5EQLA 3NHXA 2SBLA 3B8LA 1SIIA 4MMXB 5D82A 5IG3A 1W01A 2HMJB 4FMBA 4EV5A 3FF2A 3QRDA 3NXJA 5IG4A 4PEJA 1VQ43 1WTHA 3FLJA 1K28A 3CCE3 2CG1A 3CCM3 3UL5A 2WGOA 3NQYA 3BNCA 1G96A 1FA3A 3NBBA 5KP1A 1CEWI 1OGXA 5AIHA 2XSOB 4JRFA 2I9WA 3NUVA 2KRTA 1SQWA 1AVLA 3MPHA 3M8CA 4HM3B 4IT7A 3CMA3 3X40A 2F99A 5DRVA 1VQN3 4N6MA 2XRXB 2IUKA 4WWUC 1A67A 1JB5A 3MSOA 4OUQA 3F7XA 5AIIA 2MC8A 3S27A 5D81A 2W04A 1ZX2A 4K1UA 1WNHA 1O7PB 2BO9B 3VF1A 4N3VA 2KCDA 4U13A 1OH0A 1EQKA 2OOVA 3PXMA 1QAFA 1Z1SA 1BUQA 3LZAA 4K61A 3UNLA 2OTL3 2PNCA 4MMZB 2HMOB 2XF3A 4O2HA 4MMYB 4STDA 3PZWA 4H61A 2BMQB 1FUWA 2XGNA 1IQYA 3B4PA 4HM0B 4LSOA 2MF7A 1IU7A 3IPTA 4K1VA 4N6NB 4O3VA 3ECFA 1D6YA 2CIUA 3FG1A 1AR0A 3KKGA 3OW22 5IG5A 3MWZA 1PFPA 4WYKB 4HM6B 3MKIA 3SOAA 3VGNA 3CCV3 4R4KA 4FMDA 1FGOA 1FGMA 1VQ93 1PU4A 1DMNA 2W0QA 1YJ93 2C11A 2XGLA 3FF0A 1VQ73 3RGAA 3K7CA 2OTJ3 1STFI 1EA2A 1IVVA 3WMDA 2CFGA 1IQ8A 2GEXA 1OF5A 4FMCA 3OX9A 4RZMA 5IENA 1N5PA 3DUKA 3I0YA 3I563 1JB2A 2CFKA 1S723 4FCJA 2GU1A 3WA3A 2GBWB 2CH9A 2XR8B 3LTBA 4O02B 5BVBA 1WMOA 3H3HA 1K9M4 6STDA 2F86B 1QMAA 4KFFA 2LQVA 2CFDA 1YHQ3 1RN7A 2XSHB 4HVNA 4GL6A 1W4NA 4XDVA 5AIGA 3UB1A 2BNGA 1Q824 1U8CB 3F8XA 2P05A 2P0MA 2FXTA 3EN8A 4KFDA 2ZDJA 3L0RA 5D83A 3WOEB 3EN1B 3HI7A 4CDLA 3OWYA 3EB8A 4I4KA 1TFKA 4WP5A 1ROVA 3X3YA 5CF1A 3Q1CA 3CPW2 1UI7A 4J8TA 1T5YA 4XB5A 5ELJA 1IDPA 4TX4A 4HKVB 3V98A 1OPYA 1IVXA 1RRLA 1CQSA 1UW1A 2CFWA 1MNLA 1N5HA 3LMLA 1TIJA 3K9MC 3CC43 2YFJB 1MOLA 1UUWB 3JVCA 1W5ZA 4NHFA 3EHCA 3AMOA 4O8SA 3WDGB 3HIGA 2RGQA 4HYZA 4HJLB 3EE1A 4NREA 1J2BA 1NO3A 5LC6A 4XBXA 3DMCA 3NM7A 3X3XA 2OCTA 2KXGA 2INXA 3B7CA 3F9SA 1JV2B 1KSIA 3GZBA 3Q2PA 1WMNA 3SLUA 3UL6A 5ELUA 3SX1A 3FG4A 1GYBA 5CK6A 1QVF2 1FGTA 1D6UA 1V74A 1WQLB 3PGBA 3X42A 2E2UA 1AVKA 2CW9A 3BNDA 2GU3A 4Q53A 4IPBA 5AEWB 2CKFB 3X41A 1LNHA 3U97A 1E3VA 3DZLA 1DYUA 1OCVA 1N9EA 2CWTA 2XFTA 1YJN3 3EJVA 2WGQA 2Y74A 2FNQA 4R9KA 1K734 4G1MB 3DM8A 1LXEA 1O7NB 1UI8A 2CFLA 2XEPA 4LMIA 3A76A 3CPOA 2BT3A 4MEIA 1N9JA 2D42A 3X3ZA 4AKYA 5KP4A 2YFIB 3HZPA 3F40A 2W9QA 1TU5A 3RDEA 1LVNA 1NWWA 1VQL3 1ASKA 3CCJ3 1IVUA 1OGZA 1W7CA 1QALA 2YFLB 1GY6A 4L7KA 2RCDA 3SEDA 3CCS3 1IT7A 4N6UA 3J7Yd 4XM4A 4XDWA 5AI1A 5HGRA 3G4S3 3OWSA 5A0OB 1W02A 3LTCA 3MG2A 4WYKA 1DMQA 3I553 3S5CA 3ALAA 5JPPA 1ISKA 5STDA 5FGOA 5JPUA 3BNBA 2Q07A 3H51A 2W03A 1NU3A 5IF6A 3KSPA 1NB3I 4FCZA 1Q42A 8CHOA 4RNZA 5CXOA 4WFOA 1NJI4 4HM2B 1M9GA 4AEQA 1A2VA 2A15A 2B24B 5EEOA 4HM5B 3LTAA 5DREA 3OV4A 3G6E3 2HMNB 3NBJA 3KFQC 2QA43 3PS8A 3CXC2 2ZL8A 1VQP3 3MYTA 1W00A 3SVAA 1OHSA 2Z76A 3EC9A 2STDA 3G0KA 1Q814 2HMKB 3IMAB 4LGQA 2ML5A 2RSXA 2W56B 2Z7AA 5IG0A 1JKGB 3GAXA 5IW9A 1VZZA 3HX8A 1VQ63 1ROAA 2BMRB 1U5OA 3NV0B 4XBTA 2W9PA 3N9HA 1GS3A 1KD14 2B1XB 3ER7A 1HKXA 3NV0A 4EC6A 4WHAA 3FZWA 4L8OA 2CWUA 2GEYA 2YX9A 4XBYA 3OWUA 1SJWA 3DGOA 3KN4A 2P09A 3DY5A 1UUVB 3LH4A 3NX0A 1DMMA 3D9RA 1NDOB 3K5TA 3FG3A 3WOFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHC A;  3NBR A;  2BMO B;  7STD A;  3VSY A;  4ORL A;  5AEU B;  3RGR A;  5CF2 A;  3JUO A;  2QGU A;  1OHO A;  4H3U A;  4HZ9 B;  2F98 A;  3GZX B;  4HM8 B;  5G2G A;  3T8N A;  1TP6 A;  3MG1 A;  2JQ5 A;  2RFR A;  4FCM A;  3CNM A;  3CNX A;  2GBX B;  4HM1 B;  1Q40 B;  3Q90 A;  3E99 A;  4LEH A;  1O7W B;  1Q40 A;  4MJD A;  3EBT A;  1ZO2 A;  2W2C A;  3EF8 A;  2Z77 A;  1A2K A;  2OWP A;  5TGN A;  3MG3 A;  1QJG A;  3NM2 A;  3JUP A;  2R4I A;  3GWR A;  3LYG A;  3GZY B;  3BB9 A;  5FW5 A;  4L8P A;  4KVH A;  2HML B;  5BXQ A;  4J9A A;  1JN5 B;  1O7H B;  1JN5 A;  2K54 A;  4HM4 B;  3F8H A;  1ULJ B;  2GXF A;  1W6Y A;  3JUN A;  3JUM A;  3K0Z A;  1O7G B;  3G16 A;  1S5A A;  2HMM B;  3UJM A;  4GB5 A;  2QIY A;  1ULI B;  3STD A;  3GZR A;  1E97 A;  2UX0 A;  4OVM A;  1TUH A;  3F7S A;  3EBY A;  5IER A;  1OHP A;  3KE7 A;  4HZB B;  3KZT A;  4X2H A;  3T8U A;  1JKG A;  1OF5 B;  3EX9 A;  1K41 A;  3EQQ B;  5AIF A;  1STD A;  5KP3 A;  3B4O A;  3CU3 A;  3HK4 A;  3FH1 A;  1E3R A;  5IEO A;  3FSD A;  3FGY A;  5EVH A;  3DXO A;  4IIA A;  3GRD A;  1OUN A;  3G8Z A;  3JUQ A;  2IMJ A;  5IEP A;  1EG9 B;  3F14 A;  2PZV A;  3SOY A;  4X2O A;  3OXA A;  3FKA A;  3ROB A;  5CLK A;  1GY5 A;  4R9L A;  3MHE A;  4R1K A;  1C7H A;  1JB4 A;  1O7M B;  3BLZ A;  4HM7 B;  1GY7 A;  3NHX A;  3B8L A;  5IG3 A;  5D82 A;  1W01 A;  2HMJ B;  3FF2 A;  3NXJ A;  5IG4 A;  4PEJ A;  3FLJ A;  5KP1 A;  1OGX A;  5AIH A;  2XSO B;  2I9W A;  3NUV A;  3M8C A;  4HM3 B;  2F99 A;  5DRV A;  2XRX B;  4WWU C;  1JB5 A;  3MSO A;  4OUQ A;  3F7X A;  5AII A;  5D81 A;  1ZX2 A;  4K1U A;  1O7P B;  4N3V A;  4U13 A;  1OH0 A;  1Z1S A;  1BUQ A;  3LZA A;  3UNL A;  2HMO B;  4STD A;  2BMQ B;  3B4P A;  4HM0 B;  3IPT A;  4K1V A;  3ECF A;  1AR0 A;  3KKG A;  5IG5 A;  4WYK B;  4HM6 B;  3MKI A;  3SOA A;  3VGN A;  1DMN A;  3FF0 A;  3RGA A;  3K7C A;  1EA2 A;  3WMD A;  2GEX A;  1OF5 A;  3OX9 A;  4RZM A;  5IEN A;  3DUK A;  3I0Y A;  1JB2 A;  4FCJ A;  2GBW B;  2XR8 B;  5BVB A;  3H3H A;  6STD A;  2F86 B;  1QMA A;  2XSH B;  4HVN A;  4XDV A;  5AIG A;  2BNG A;  3F8X A;  3EN8 A;  5D83 A;  3EN1 B;  4CDL A;  3OWY A;  4I4K A;  4WP5 A;  5CF1 A;  4J8T A;  4XB5 A;  1IDP A;  4HKV B;  1OPY A;  1CQS A;  2YFJ B;  1UUW B;  3EHC A;  2RGQ A;  4HJL B;  4XBX A;  3DMC A;  2INX A;  3B7C A;  3F9S A;  3GZB A;  1GYB A;  5CK6 A;  1WQL B;  4Q53 A;  5AEW B;  2CKF B;  1E3V A;  3DZL A;  1OCV A;  3EJV A;  4R9K A;  3DM8 A;  1O7N B;  4LMI A;  3A76 A;  3CPO A;  5KP4 A;  2YFI B;  3HZP A;  3F40 A;  1NWW A;  1ASK A;  1OGZ A;  2YFL B;  1GY6 A;  4L7K A;  2RCD A;  3SED A;  4XM4 A;  4XDW A;  5AI1 A;  5HGR A;  3OWS A;  1W02 A;  3MG2 A;  4WYK A;  1DMQ A;  3S5C A;  5JPP A;  1ISK A;  5STD A;  5JPU A;  5IF6 A;  3H51 A;  1NU3 A;  3KSP A;  1Q42 A;  8CHO A;  5CXO A;  4HM2 B;  2A15 A;  2B24 B;  4HM5 B;  5DRE A;  3OV4 A;  2HMN B;  3MYT A;  1W00 A;  1OHS A;  2Z76 A;  3EC9 A;  2STD A;  3G0K A;  2HMK B;  4LGQ A;  5IG0 A;  2Z7A A;  1JKG B;  1VZZ A;  3HX8 A;  4XBT A;  2BMR B;  1U5O A;  3NV0 B;  1GS3 A;  2B1X B;  3ER7 A;  1HKX A;  3NV0 A;  3FZW A;  4L8O A;  2GEY A;  4XBY A;  3OWU A;  1SJW A;  1UUV B;  1DMM A;  3D9R A;  1NDO B; 
#chains in the Genus database with same CATH topology
 3O8Y A;  2CHC A;  1CYV A;  4OK0 A;  3NBR A;  1BRK A;  3DGY A;  1B21 A;  1WMP A;  2L4V A;  3WOD G;  2BMO B;  1W6G A;  3HII A;  8RNT A;  4BTY A;  7STD A;  2OQE C;  1YIJ 3;  1IYY A;  1N8Q A;  1BSE A;  4ORL A;  2KF4 A;  3VSY A;  5AEU B;  1W2Z A;  2P38 A;  3RGR A;  5CF2 A;  7GSP A;  3JUO A;  3S67 A;  1F8N A;  1RGK A;  1Q7Y 4;  3PYJ A;  2RBI A;  2QGU A;  2CX1 A;  1DVC A;  1I70 A;  2H0I A;  3S28 A;  1OHO A;  1M1K 4;  4H3U A;  3CC2 3;  5M1A A;  4RNY A;  4HZ9 B;  2W6J H;  2F98 A;  4N6V 0;  1YI2 3;  2IA7 A;  4KFE A;  1I0V A;  1RJO A;  2BIR A;  4K90 B;  4EXR A;  3GZX B;  1VQQ A;  4HM8 B;  5G2G A;  3T8N A;  1Y4K A;  1JJ2 2;  1TP6 A;  1ZGX A;  4J5G A;  2H0G A;  3MG1 A;  5GSP A;  2JQ5 A;  1Q7H A;  2RFR A;  3G71 3;  3NQZ A;  4FCM A;  3CNM A;  1HYF A;  1RGF A;  1HU9 A;  3CNX A;  3PCR A;  1RGL A;  2GBX B;  1VQO 3;  4HM1 B;  1TFO A;  1D6Z A;  4R80 A;  1Q40 B;  2P0X A;  1FW7 A;  1TRP A;  1BGS A;  3Q90 A;  3E99 A;  4LEH A;  1N8R 4;  1O7W B;  1Q40 A;  1IT8 A;  1R4Y A;  4MJD A;  1BSC A;  3IJE B;  3CCU 3;  3N8B A;  1JRQ A;  1X1W A;  3EBT A;  4LZI A;  1ZO2 A;  2W2C A;  3EF8 A;  1RTU A;  1A90 A;  5BU4 A;  1IQX A;  2H0H A;  1YIT 3;  3A5E A;  1QVG 2;  2Z77 A;  1A2K A;  3T0U A;  2OWP A;  2XH9 A;  5TGN A;  1IV9 A;  1BNF A;  3MG3 A;  1UUG B;  2R41 A;  1QJG A;  2BHM A;  1M90 4;  3NM2 A;  2BU4 A;  5AYS C;  1K8A 4;  2E2V A;  1FGQ A;  3JUP A;  1IK3 A;  2R4I A;  2CWV A;  1RGH A;  1OAC A;  1GD4 A;  3GWR A;  3LYG A;  3GZY B;  4HBR A;  1W2B 2;  3KII A;  4QWT A;  3BB9 A;  1BNS A;  5FW5 A;  4L8P A;  4GSP A;  3AGO A;  4KVH A;  3D79 A;  3WA2 X;  1C54 A;  2HML B;  5BXQ A;  3CCL 3;  2FGT A;  4EYC A;  4J9A A;  3TDG A;  1JN5 B;  1UGH I;  2WO0 A;  5I97 A;  1O7H B;  2KF6 A;  2O9U X;  4AKZ A;  6GSP A;  1TJD A;  1I3F A;  3DH2 A;  1JN5 A;  2L1S A;  3CME 3;  1SPU A;  2K54 A;  1T3B A;  4HM4 B;  3F8H A;  1ULJ B;  4EBG A;  1GD3 A;  2GXF A;  1W6Y A;  3JUN A;  1CYU A;  1EKM A;  2D1W A;  4BTX A;  1DVD A;  2WOH A;  3DGN A;  5G1L A;  3JUM A;  3K0Z A;  1B27 A;  1NB5 I;  1RNB A;  1B20 A;  3LT9 A;  1VQ8 3;  4N6T A;  5HOH A;  1TRQ A;  1L5G B;  1O7G B;  3G16 A;  4KT3 B;  2IUJ A;  1S5A A;  2HMM B;  3UJM A;  2WOF A;  9RNT A;  3DGL A;  4GB5 A;  1QAK A;  2M7O A;  2QIY A;  3LTD A;  1RMS A;  1ULI B;  2F5M A;  1JNQ A;  2XFS A;  1I8V A;  3STD A;  3GZR A;  6RNT A;  1E97 A;  2UX0 A;  1YJW 3;  4OVM A;  1SIH A;  1TUH A;  3F7S A;  3EBY A;  4BIR A;  5IER A;  1UCI A;  3LT8 A;  3LXU X;  4ZM8 A;  1OHP A;  2OQE A;  3KE7 A;  4HZB B;  2QEX 3;  1YGE A;  4FR9 A;  2OOV C;  3KZT A;  1RKY A;  4BTW A;  2V1L A;  2C10 A;  3HOH A;  4X2H A;  2W56 A;  3T8U A;  2CG0 A;  1IV7 A;  1JKG A;  1OF5 B;  1UDI I;  2CC3 A;  1K41 A;  3EQQ B;  3EX9 A;  1TTO A;  3U1W A;  1RGC A;  1KC8 4;  1R4C A;  3LOY A;  1VQM 3;  2K3D A;  5AIF A;  4JF8 A;  1LQM B;  3CC7 3;  1STD A;  3ZG0 A;  3CCQ 3;  5JBS A;  1KQS 2;  3PCS A;  3B4O A;  2O3O A;  5KP3 A;  3CU3 A;  1YVB I;  3HK4 A;  3FH1 A;  4N6O B;  3CCR 3;  3CD6 3;  1X1Y A;  1E3R A;  5IEO A;  2UUG C;  5AYR B;  3FSD A;  1G0T A;  1AQZ A;  1KWI A;  1VQ5 3;  2LYX A;  4CJN A;  3FGY A;  5RNT A;  5EVH A;  4RBN A;  1RSN A;  1W6C A;  3DXO A;  1HZ1 A;  4IIA A;  3S29 A;  1UCJ A;  2Y73 A;  3KSE D;  3GRD A;  1OUN A;  1BRH A;  3G8Z A;  1G02 A;  3Q3F A;  3JUQ A;  5G1K A;  5M19 A;  1GOV A;  1M1X B;  2IMJ A;  5IEP A;  1LNI A;  1EG9 B;  4FMA A;  3SYU A;  3SXX A;  3DGM A;  3F14 A;  3K63 A;  2ML6 A;  2PZV A;  5LC7 A;  4X2O A;  3SOY A;  3V92 A;  3OXA A;  3FKA A;  3ROB A;  3FCS B;  3D5I A;  3D3L A;  4J5K A;  1US1 A;  2K0M A;  5CLK A;  3V99 A;  1GY5 A;  1LOX A;  1B2S A;  1VQK 3;  1I2G A;  4KZ1 A;  1AV4 A;  2ZA4 A;  3N54 B;  3AMO B;  2Z6B A;  2CK3 H;  1JZO A;  1FUT A;  2E2T A;  4R9L A;  1FGR A;  3MHE A;  4R1K A;  3BU4 A;  3QK9 A;  1C7H A;  1Q86 4;  1JB4 A;  1RRH A;  1O7M B;  4NPB A;  3BNE A;  1PYL A;  1BRS A;  3BLZ A;  4N6L A;  1Q9E A;  4HM7 B;  3AHW A;  1GY7 A;  2AAE A;  2JDI H;  4CCV A;  1IVW A;  5EQL A;  1EEJ A;  1FZU A;  3NHX A;  2SBL A;  3B8L A;  1SII A;  4MMX B;  5D82 A;  5IG3 A;  1W01 A;  2HMJ B;  4FMB A;  4EV5 A;  3FF2 A;  3QRD A;  3NXJ A;  1BOX A;  5IG4 A;  4PEJ A;  1VQ4 3;  1WTH A;  3FLJ A;  1K28 A;  3CCE 3;  2CG1 A;  4HAA A;  1MWS A;  1BAN A;  3CCM 3;  3UL5 A;  2WGO A;  1RCK A;  3NQY A;  3BNC A;  1G96 A;  1FA3 A;  3NBB A;  5KP1 A;  1CEW I;  1OGX A;  1I2E A;  5AIH A;  2XSO B;  4JRF A;  2I9W A;  3NUV A;  1I0X A;  2KRT A;  1SQW A;  5M18 A;  1B2Z A;  1AVL A;  3MPH A;  3M8C A;  4HM3 B;  4IT7 A;  3CMA 3;  3X40 A;  2F99 A;  4CPK A;  3ZG5 A;  1RN4 A;  5DRV A;  1VQN 3;  4N6M A;  2XRX B;  4GHO A;  2IUK A;  4WWU C;  1A67 A;  1JB5 A;  3MSO A;  4OUQ A;  3F7X A;  5AII A;  2MC8 A;  3S27 A;  1DET A;  5D81 A;  2W04 A;  1MGW A;  4HOH A;  1ZX2 A;  4K1U A;  1WNH A;  1O7P B;  2BO9 B;  3VF1 A;  4N3V A;  2KCD A;  4U13 A;  1OH0 A;  1EQK A;  2OOV A;  3PXM A;  1QAF A;  1MWR A;  1Z1S A;  1ZS7 A;  1BUQ A;  3LZA A;  4K61 A;  3UNL A;  3ZFZ A;  2OTL 3;  2PNC A;  4MMZ B;  2HMO B;  2XF3 A;  1RN1 A;  2RNT A;  4O2H A;  4MMY B;  4STD A;  3PZW A;  1GOU A;  1BSD A;  4H61 A;  2BMQ B;  1FUW A;  2UGI A;  2XGN A;  3GSP A;  1IQY A;  3B4P A;  4HM0 B;  4LSO A;  2MF7 A;  1IU7 A;  3IPT A;  4K1V A;  4N6N B;  4O3V A;  2CX0 A;  3ECF A;  1D6Y A;  4BL2 A;  2GSP A;  2IY2 A;  1BIR A;  2CIU A;  3D4A A;  3FG1 A;  1AR0 A;  3KKG A;  4I5Q A;  3OW2 2;  5IG5 A;  3MWZ A;  1PFP A;  4WYK B;  1BRI A;  4HM6 B;  1V58 A;  3MKI A;  1RGG A;  3SOA A;  4LYL B;  1GMR A;  4EV2 A;  3VGN A;  3CCV 3;  4R4K A;  4FMD A;  4RNT A;  1FGO A;  1FGM A;  1VQ9 3;  2AAD A;  1PU4 A;  3BIR A;  1DMN A;  2W0Q A;  1YJ9 3;  2C11 A;  2XGL A;  3D5G A;  3FF0 A;  1VQ7 3;  3RGA A;  3K7C A;  2OTJ 3;  1STF I;  1EA2 A;  1IVV A;  3WMD A;  2CFG A;  1GOY A;  5BIR A;  1IQ8 A;  4BU4 A;  2GEX A;  1OF5 A;  4FMC A;  3OX9 A;  1FUS A;  1B2X A;  1T2H A;  2HOH A;  4RZM A;  5IEN A;  1RLS A;  1N5P A;  3DUK A;  1BRN L;  3I0Y A;  3I56 3;  1JB2 A;  2CFK A;  1LOW A;  1S72 3;  4FCJ A;  1RHL A;  2GU1 A;  2GBW B;  3WA3 A;  2CH9 A;  1LRA A;  2XR8 B;  3LTB A;  4O02 B;  5BVB A;  1WMO A;  1B3S A;  3H3H A;  1K9M 4;  1BRG A;  2F86 B;  6STD A;  1AY7 A;  1LQG C;  1QMA A;  2LQV A;  4KFF A;  1LOV A;  2CFD A;  1RN7 A;  1YHQ 3;  2XSH B;  4HVN A;  4GL6 A;  1W4N A;  4XDV A;  5AIG A;  3UB1 A;  2BNG A;  1GMP A;  1Q82 4;  1JBR A;  3AGN A;  1U8C B;  3F8X A;  7RNT A;  1YGW A;  2P05 A;  2FXT A;  2P0M A;  3EN8 A;  4KFD A;  2ZDJ A;  3L0R A;  5D83 A;  1SAR A;  3WOE B;  1YNV X;  1MWU A;  3EN1 B;  1YVS A;  1MGR A;  3HI7 A;  4CDL A;  3OWY A;  3EB8 A;  2J8X B;  4I4K A;  1TFK A;  3WR2 A;  4WP5 A;  1BRJ A;  1ROV A;  3X3Y A;  3WOF B;  5CF1 A;  3Q1C A;  3CPW 2;  1UI7 A;  4J8T A;  1T5Y A;  4XB5 A;  5ELJ A;  1IDP A;  4TX4 A;  4HKV B;  3V98 A;  1OPY A;  1IVX A;  1RRL A;  1CQS A;  1UW1 A;  2CFW A;  1MNL A;  1N5H A;  1RCL A;  3LML A;  1TIJ A;  3RNT A;  3K9M C;  3CC4 3;  2YFJ B;  1MOL A;  1UUW B;  2ZHX B;  3JVC A;  1W5Z A;  3KCH A;  4NHF A;  3EHC A;  3AMO A;  4O8S A;  3WDG B;  3HIG A;  2RGQ A;  1LOY A;  4HJL B;  3EE1 A;  4HYZ A;  4NRE A;  1NO3 A;  1J2B A;  5LC6 A;  4XBX A;  3URP A;  3DMC A;  3NM7 A;  3X3X A;  2F5W A;  2OCT A;  2KXG A;  2INX A;  3B7C A;  3F9S A;  1JV2 B;  1KSI A;  3GZB A;  3Q2P A;  1WMN A;  3SLU A;  3UL6 A;  5ELU A;  3SX1 A;  3FG4 A;  1GYB A;  5CK6 A;  1RGE A;  1QVF 2;  1FGT A;  1D6U A;  1V74 A;  1WQL B;  2SAR A;  3PGB A;  2E2U A;  3X42 A;  1AVK A;  4EW5 A;  2CW9 A;  3BND A;  2GU3 A;  1GMQ A;  1MWT A;  1JBS A;  4Q53 A;  1UGI A;  4IPB A;  5AEW B;  2CKF B;  3X41 A;  1LNH A;  1A2P A;  3U97 A;  1E3V A;  3AHS A;  3DZL A;  1DYU A;  1RNT A;  1OCV A;  1N9E A;  2IYJ A;  3WHO A;  2CWT A;  2XFT A;  1YJN 3;  3EJV A;  1X1X A;  2WGQ A;  2Y74 A;  2FNQ A;  4R9K A;  1FYS A;  1K73 4;  4G1M B;  5IG0 A;  1BNE A;  3DM8 A;  1LXE A;  1O7N B;  1UI8 A;  2CFL A;  2KF5 A;  1EUI C;  1JBT A;  2XEP A;  4LMI A;  2KF3 A;  3A76 A;  3CPO A;  2BT3 A;  4MEI A;  1N9J A;  2D42 A;  3X3Z A;  4AKY A;  1I2F A;  5KP4 A;  1BNG A;  2YFI B;  3HZP A;  3F40 A;  2W9Q A;  1TU5 A;  3RDE A;  1LVN A;  1I3I A;  1NWW A;  1CH0 A;  1ASK A;  1GSP A;  1VQL 3;  3CCJ 3;  4ILF A;  1IVU A;  1OGZ A;  1W7C A;  1QAL A;  2YFL B;  1GY6 A;  4L7K A;  1RDS A;  2RCD A;  3SED A;  3CCS 3;  1DE3 A;  1IT7 A;  4N6U A;  3J7Y d;  4XM4 A;  4XDW A;  1T2I A;  5AI1 A;  5HGR A;  3G4S 3;  4DKI A;  3OWS A;  5A0O B;  1W02 A;  3LTC A;  3MG2 A;  4WYK A;  1DMQ A;  3I55 3;  2C4B A;  3S5C A;  3ALA A;  5JPP A;  1ISK A;  5STD A;  5FGO A;  5JPU A;  3BNB A;  2Q07 A;  3H51 A;  2W03 A;  1NU3 A;  5IF6 A;  2F56 A;  1UCK A;  3KSP A;  1NB3 I;  4FCZ A;  1BUJ A;  1Q42 A;  8CHO A;  4RNZ A;  5CXO A;  4WFO A;  1NJI 4;  4HM2 B;  1BNJ A;  1M9G A;  4AEQ A;  1A2V A;  2A15 A;  2B24 B;  1UCL A;  5EEO A;  4HM5 B;  3LTA A;  5DRE A;  3OV4 A;  3G6E 3;  2HMN B;  3NBJ A;  3KFQ C;  2QA4 3;  3PS8 A;  1PY3 A;  3CXC 2;  1BU4 A;  2ZL8 A;  1VQP 3;  1RGA A;  1W00 A;  3MYT A;  3SVA A;  1OHS A;  2Z76 A;  3EC9 A;  1X1U A;  2F4Y A;  2STD A;  3G0K A;  4BL3 A;  1Q81 4;  2HMK B;  3IMA B;  4LGQ A;  2ML5 A;  2RSX A;  1BNI A;  1JZD A;  2W56 B;  1JKG B;  2Z7A A;  3GAX A;  5IW9 A;  1VZZ A;  1BNR A;  3HX8 A;  1VQ6 3;  1NNV A;  1ROA A;  2BMR B;  1U5O A;  3NV0 B;  4XBT A;  2W9P A;  3N9H A;  1BVI A;  1GS3 A;  1KD1 4;  2B1X B;  3ER7 A;  1HKX A;  3NV0 A;  4EC6 A;  4WHA A;  3FZW A;  4L8O A;  2CWU A;  2GEY A;  1BSB A;  2YX9 A;  4XBY A;  3OWU A;  1SJW A;  3DGO A;  3KN4 A;  2KAA A;  2P09 A;  3DY5 A;  1BAO A;  1BSA A;  1UUV B;  3LH4 A;  3NX0 A;  1B2U A;  1DMM A;  3D9R A;  1B2M A;  1NDO B;  3K5T A;  3FG3 A;  1V57 A; 
#chains in the Genus database with same CATH homology
 3O8Y A;  2CHC A;  1CYV A;  4OK0 A;  3NBR A;  1WMP A;  2L4V A;  3WOD G;  2BMO B;  1W6G A;  3HII A;  4BTY A;  7STD A;  2OQE C;  1YIJ 3;  1N8Q A;  4ORL A;  3VSY A;  5AEU B;  1W2Z A;  2P38 A;  3RGR A;  5CF2 A;  3JUO A;  3S67 A;  1F8N A;  1Q7Y 4;  3PYJ A;  2QGU A;  1DVC A;  1M1K 4;  3S28 A;  1OHO A;  4H3U A;  3CC2 3;  4RNY A;  4HZ9 B;  2W6J H;  2F98 A;  4N6V 0;  1YI2 3;  2IA7 A;  4KFE A;  4EV2 A;  1RJO A;  4K90 B;  4EXR A;  3GZX B;  4HM8 B;  5G2G A;  3T8N A;  1Y4K A;  1JJ2 2;  1TP6 A;  3MG1 A;  2JQ5 A;  2RFR A;  3G71 3;  3NQZ A;  4FCM A;  3CNM A;  1HU9 A;  3CNX A;  3PCR A;  2GBX B;  1VQO 3;  4HM1 B;  1TFO A;  1D6Z A;  4R80 A;  1Q40 B;  2P0X A;  3Q90 A;  3E99 A;  4LEH A;  1N8R 4;  1O7W B;  1IT8 A;  1Q40 A;  4MJD A;  3IJE B;  3CCU 3;  3N8B A;  1JRQ A;  3EBT A;  4LZI A;  1ZO2 A;  2W2C A;  3EF8 A;  1A90 A;  1IQX A;  1YIT 3;  1QVG 2;  2Z77 A;  1A2K A;  3T0U A;  2OWP A;  2XH9 A;  5TGN A;  1IV9 A;  3MG3 A;  1QJG A;  2BHM A;  1M90 4;  3NM2 A;  1K8A 4;  5AYS C;  2E2V A;  1FGQ A;  3JUP A;  1IK3 A;  2R4I A;  2CWV A;  1OAC A;  1GD4 A;  3GWR A;  3LYG A;  3GZY B;  4HBR A;  1W2B 2;  3KII A;  4QWT A;  3BB9 A;  5FW5 A;  4L8P A;  4KVH A;  3WA2 X;  2HML B;  5BXQ A;  3CCL 3;  2FGT A;  4EYC A;  4J9A A;  3TDG A;  1JN5 B;  2WO0 A;  5I97 A;  1O7H B;  2O9U X;  4AKZ A;  1JN5 A;  3CME 3;  1SPU A;  2K54 A;  4HM4 B;  3F8H A;  1ULJ B;  4EBG A;  1GD3 A;  2GXF A;  1W6Y A;  3JUN A;  1CYU A;  1EKM A;  2D1W A;  4BTX A;  1DVD A;  2WOH A;  3DGN A;  3JUM A;  3K0Z A;  1NB5 I;  3LT9 A;  1VQ8 3;  4N6T A;  1L5G B;  1O7G B;  3G16 A;  2IUJ A;  1S5A A;  2HMM B;  3UJM A;  2WOF A;  3DGL A;  4GB5 A;  1QAK A;  2M7O A;  2QIY A;  3LTD A;  1ULI B;  2XFS A;  1JNQ A;  3STD A;  3GZR A;  1YJW 3;  1E97 A;  2UX0 A;  4OVM A;  1SIH A;  1TUH A;  3F7S A;  3EBY A;  5IER A;  3LT8 A;  4ZM8 A;  3LXU X;  1OHP A;  2OQE A;  3KE7 A;  4HZB B;  2QEX 3;  1YGE A;  4FR9 A;  2OOV C;  3KZT A;  1RKY A;  4BTW A;  2V1L A;  2C10 A;  4X2H A;  2W56 A;  3T8U A;  2CG0 A;  1IV7 A;  1JKG A;  1OF5 B;  3EX9 A;  2CC3 A;  1K41 A;  3EQQ B;  3U1W A;  1KC8 4;  1R4C A;  3LOY A;  1VQM 3;  5AIF A;  4JF8 A;  3CC7 3;  1STD A;  3CCQ 3;  1KQS 2;  5JBS A;  3PCS A;  3B4O A;  2O3O A;  5KP3 A;  3CU3 A;  1YVB I;  3HK4 A;  3FH1 A;  4N6O B;  3CCR 3;  3CD6 3;  1E3R A;  5IEO A;  5AYR B;  3FSD A;  1KWI A;  1VQ5 3;  2LYX A;  3FGY A;  5EVH A;  4RBN A;  1W6C A;  3DXO A;  4IIA A;  3S29 A;  2Y73 A;  3KSE D;  3GRD A;  1OUN A;  3G8Z A;  3JUQ A;  1M1X B;  2IMJ A;  5IEP A;  4FMA A;  1EG9 B;  3SXX A;  3DGM A;  3F14 A;  3K63 A;  2ML6 A;  2PZV A;  5LC7 A;  4X2O A;  3SOY A;  3V92 A;  3OXA A;  3FKA A;  3ROB A;  3FCS B;  3D3L A;  1US1 A;  2K0M A;  5CLK A;  3V99 A;  1GY5 A;  1LOX A;  1VQK 3;  4KZ1 A;  1AV4 A;  3N54 B;  3AMO B;  2Z6B A;  2CK3 H;  2E2T A;  4R9L A;  1FGR A;  3MHE A;  4R1K A;  3QK9 A;  1C7H A;  1Q86 4;  1JB4 A;  1RRH A;  1O7M B;  3BNE A;  3BLZ A;  4N6L A;  4HM7 B;  1GY7 A;  2JDI H;  4CCV A;  1IVW A;  5EQL A;  3NHX A;  2SBL A;  3B8L A;  1SII A;  4MMX B;  5D82 A;  5IG3 A;  1W01 A;  2HMJ B;  4FMB A;  4EV5 A;  3FF2 A;  3QRD A;  3NXJ A;  5IG4 A;  4PEJ A;  1VQ4 3;  1WTH A;  3FLJ A;  1K28 A;  3CCE 3;  2CG1 A;  3CCM 3;  3UL5 A;  2WGO A;  3NQY A;  3BNC A;  1G96 A;  1FA3 A;  3NBB A;  5KP1 A;  1CEW I;  1OGX A;  5AIH A;  2XSO B;  4JRF A;  2I9W A;  3NUV A;  2KRT A;  1SQW A;  1AVL A;  3MPH A;  3M8C A;  4HM3 B;  4IT7 A;  3CMA 3;  3X40 A;  2F99 A;  5DRV A;  1VQN 3;  4N6M A;  2XRX B;  2IUK A;  4WWU C;  1A67 A;  1JB5 A;  3MSO A;  4OUQ A;  3F7X A;  5AII A;  2MC8 A;  3S27 A;  5D81 A;  2W04 A;  1ZX2 A;  4K1U A;  1WNH A;  1O7P B;  2BO9 B;  3VF1 A;  4N3V A;  2KCD A;  4U13 A;  1OH0 A;  1EQK A;  2OOV A;  3PXM A;  1QAF A;  1Z1S A;  1BUQ A;  3LZA A;  4K61 A;  3UNL A;  2OTL 3;  2PNC A;  4MMZ B;  2HMO B;  2XF3 A;  4O2H A;  4MMY B;  4STD A;  3PZW A;  4H61 A;  2BMQ B;  1FUW A;  2XGN A;  1IQY A;  3B4P A;  4HM0 B;  4LSO A;  2MF7 A;  1IU7 A;  3IPT A;  4K1V A;  4N6N B;  4O3V A;  3ECF A;  1D6Y A;  2CIU A;  3FG1 A;  1AR0 A;  3KKG A;  3OW2 2;  5IG5 A;  3MWZ A;  1PFP A;  4WYK B;  4HM6 B;  3MKI A;  3SOA A;  3VGN A;  3CCV 3;  4R4K A;  4FMD A;  1FGO A;  1FGM A;  1VQ9 3;  1PU4 A;  1DMN A;  2W0Q A;  1YJ9 3;  2C11 A;  2XGL A;  3FF0 A;  1VQ7 3;  3RGA A;  3K7C A;  2OTJ 3;  1STF I;  1EA2 A;  1IVV A;  3WMD A;  2CFG A;  1IQ8 A;  2GEX A;  1OF5 A;  4FMC A;  3OX9 A;  4RZM A;  5IEN A;  1N5P A;  3DUK A;  3I0Y A;  3I56 3;  1JB2 A;  2CFK A;  1S72 3;  4FCJ A;  2GU1 A;  3WA3 A;  2GBW B;  2CH9 A;  2XR8 B;  3LTB A;  4O02 B;  5BVB A;  1WMO A;  3H3H A;  1K9M 4;  6STD A;  2F86 B;  1QMA A;  4KFF A;  2LQV A;  2CFD A;  1YHQ 3;  1RN7 A;  2XSH B;  4HVN A;  4GL6 A;  1W4N A;  4XDV A;  5AIG A;  3UB1 A;  2BNG A;  1Q82 4;  1U8C B;  3F8X A;  2P05 A;  2P0M A;  2FXT A;  3EN8 A;  4KFD A;  2ZDJ A;  3L0R A;  5D83 A;  3WOE B;  3EN1 B;  3HI7 A;  4CDL A;  3OWY A;  3EB8 A;  4I4K A;  1TFK A;  4WP5 A;  1ROV A;  3X3Y A;  5CF1 A;  3Q1C A;  3CPW 2;  1UI7 A;  4J8T A;  1T5Y A;  4XB5 A;  5ELJ A;  1IDP A;  4TX4 A;  4HKV B;  3V98 A;  1OPY A;  1IVX A;  1RRL A;  1CQS A;  1UW1 A;  2CFW A;  1MNL A;  1N5H A;  3LML A;  1TIJ A;  3K9M C;  3CC4 3;  2YFJ B;  1MOL A;  1UUW B;  3JVC A;  1W5Z A;  4NHF A;  3EHC A;  3AMO A;  4O8S A;  3WDG B;  3HIG A;  2RGQ A;  4HYZ A;  4HJL B;  3EE1 A;  4NRE A;  1J2B A;  1NO3 A;  5LC6 A;  4XBX A;  3DMC A;  3NM7 A;  3X3X A;  2OCT A;  2KXG A;  2INX A;  3B7C A;  3F9S A;  1JV2 B;  1KSI A;  3GZB A;  3Q2P A;  1WMN A;  3SLU A;  3UL6 A;  5ELU A;  3SX1 A;  3FG4 A;  1GYB A;  5CK6 A;  1QVF 2;  1FGT A;  1D6U A;  1V74 A;  1WQL B;  3PGB A;  3X42 A;  2E2U A;  1AVK A;  2CW9 A;  3BND A;  2GU3 A;  4Q53 A;  4IPB A;  5AEW B;  2CKF B;  3X41 A;  1LNH A;  3U97 A;  1E3V A;  3DZL A;  1DYU A;  1OCV A;  1N9E A;  2CWT A;  2XFT A;  1YJN 3;  3EJV A;  2WGQ A;  2Y74 A;  2FNQ A;  4R9K A;  1K73 4;  4G1M B;  3DM8 A;  1LXE A;  1O7N B;  1UI8 A;  2CFL A;  2XEP A;  4LMI A;  3A76 A;  3CPO A;  2BT3 A;  4MEI A;  1N9J A;  2D42 A;  3X3Z A;  4AKY A;  5KP4 A;  2YFI B;  3HZP A;  3F40 A;  2W9Q A;  1TU5 A;  3RDE A;  1LVN A;  1NWW A;  1VQL 3;  1ASK A;  3CCJ 3;  1IVU A;  1OGZ A;  1W7C A;  1QAL A;  2YFL B;  1GY6 A;  4L7K A;  2RCD A;  3SED A;  3CCS 3;  1IT7 A;  4N6U A;  3J7Y d;  4XM4 A;  4XDW A;  5AI1 A;  5HGR A;  3G4S 3;  3OWS A;  5A0O B;  1W02 A;  3LTC A;  3MG2 A;  4WYK A;  1DMQ A;  3I55 3;  3S5C A;  3ALA A;  5JPP A;  1ISK A;  5STD A;  5FGO A;  5JPU A;  3BNB A;  2Q07 A;  3H51 A;  2W03 A;  1NU3 A;  5IF6 A;  3KSP A;  1NB3 I;  4FCZ A;  1Q42 A;  8CHO A;  4RNZ A;  5CXO A;  4WFO A;  1NJI 4;  4HM2 B;  1M9G A;  4AEQ A;  1A2V A;  2A15 A;  2B24 B;  5EEO A;  4HM5 B;  3LTA A;  5DRE A;  3OV4 A;  3G6E 3;  2HMN B;  3NBJ A;  3KFQ C;  2QA4 3;  3PS8 A;  3CXC 2;  2ZL8 A;  1VQP 3;  3MYT A;  1W00 A;  3SVA A;  1OHS A;  2Z76 A;  3EC9 A;  2STD A;  3G0K A;  1Q81 4;  2HMK B;  3IMA B;  4LGQ A;  2ML5 A;  2RSX A;  2W56 B;  2Z7A A;  5IG0 A;  1JKG B;  3GAX A;  5IW9 A;  1VZZ A;  3HX8 A;  1VQ6 3;  1ROA A;  2BMR B;  1U5O A;  3NV0 B;  4XBT A;  2W9P A;  3N9H A;  1GS3 A;  1KD1 4;  2B1X B;  3ER7 A;  1HKX A;  3NV0 A;  4EC6 A;  4WHA A;  3FZW A;  4L8O A;  2CWU A;  2GEY A;  2YX9 A;  4XBY A;  3OWU A;  1SJW A;  3DGO A;  3KN4 A;  2P09 A;  3DY5 A;  1UUV B;  3LH4 A;  3NX0 A;  1DMM A;  3D9R A;  1NDO B;  3K5T A;  3FG3 A;  3WOF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...