1EG9B

Naphthalene 1,2-dioxygenase with indole bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords PROTEIN (NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT)
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eg9B00
4PEJA 4J9AA 4LGQA 4X2OA 2K54A 4IIAA 2Z7AA 2YFJB 3FF2A 4Q53A 1OPYA 2STDA 5FW5A 5STDA 3UNLA 3G8ZA 2UX0A 2BMOB 3OXAA 3CNXA 1ZO2A 5AIGA 2GXFA 4XM4A 3F7SA 5IG0A 3MHEA 1Q40A 1OUNA 2YFLB 3ECFA 3F8XA 5IEOA 3ER7A 2GBXB 5TGNA 3GZBA 4K1UA 4R9KA 2R4IA 3KKGA 3DMCA 4XBTA 5CF1A 1SJWA 2XR8B 4XDWA 3OX9A 5D82A 4J8TA 5AEWB 2HMLB 3E99A 4R1KA 5D83A 5IF6A 2A15A 1JB4A 1GYBA 1W01A 3NHXA 4HKVB 5CF2A 4WYKB 3GWRA 3H51A 4RZMA 2I9WA 3HK4A 3EN8A 3LZAA 5DRVA 1A2KA 3F14A 4HZ9B 4HJLB 6STDA 3GZXB 1OHOA 1GY6A 2HMKB 3HX8A 3KSPA 3IPTA 3EQQB 1JB2A 4L7KA 5IERA 2BMRB 1W02A 1AR0A 1UUWB 2XSOB 3B7CA 4HM1B 3T8UA 3F8HA 4GB5A 4WYKA 2GEYA 1WQLB 4U13A 3FLJA 4CDLA 4X2HA 4LMIA 5AEUB 1GS3A 1VZZA 2HMJB 3DM8A 4H3UA 1U5OA 5AIIA 1CQSA 3FKAA 4FCJA 5DREA 1EA2A 4HM2B 1NU3A 5CXOA 3EX9A 1OH0A 3CNMA 1OF5B 1DMNA 1TP6A 2B1XB 2CHCA 3D9RA 3M8CA 1ULIB 3MG3A 4HM6B 4I4KA 1OCVA 2RGQA 3JUQA 1Z1SA 4K1VA 5AI1A 5EVHA 3EBYA 1JB5A 2HMMB 2JQ5A 2W2CA 2Z76A 4HM5B 4HM4B 4WP5A 5IEPA 2HMOB 2QIYA 3EF8A 1OGXA 3BB9A 3JUOA 3SOAA 2QGUA 1HKXA 4HM7B 1OF5A 1OHSA 1W00A 5CK6A 4R9LA 5CLKA 5JPPA 1O7MB 1DMMA 2F98A 3DUKA 1QJGA 5KP4A 2OWPA 3A76A 3B4OA 2BMQB 2RFRA 3GZYB 4FCMA 3K0ZA 3GZRA 1JKGB 1O7NB 2HMNB 1NDOB 1W6YA 2Z77A 2INXA 3JUNA 2GEXA 4XBYA 1UUVB 3B4PA 2F99A 1JN5B 5AIHA 1TUHA 1O7WB 4L8OA 2YFIB 3NM2A 3OWUA 3CPOA 3T8NA 3MYTA 1OHPA 3B8LA 7STDA 4HM3B 4OVMA 1O7PB 4HM0B 1E97A 4OUQA 3EJVA 3S5CA 3WMDA 3RGRA 4L8PA 1GY5A 2XSHB 3KE7A 3FF0A 1STDA 3MG1A 3MSOA 2IMJA 3K7CA 2XRXB 1OGZA 3CU3A 5IG3A 4KVHA 3FZWA 1Q42A 3FGYA 1O7HB 1S5AA 3F9SA 3OV4A 2BNGA 1K41A 3HZPA 1BUQA 3MG2A 5IG5A 5AIFA 3G0KA 3JUPA 1C7HA 5D81A 5HGRA 3VSYA 1Q40B 4XBXA 3STDA 3KZTA 5BVBA 1ISKA 3EN1B 1E3RA 1DMQA 8CHOA 5IENA 2CKFB 2GBWB 5JPUA 3F40A 1NWWA 3UJMA 3EBTA 1ASKA 4XDVA 4HM8B 3EC9A 3FSDA 3GRDA 1QMAA 4HVNA 3ROBA 3G16A 3Q90A 3SEDA 3SOYA 3RGAA 3VGNA 3MKIA 5IG4A 3F7XA 5BXQA 4ORLA 2RCDA 3BLZA 3DZLA 1JN5A 3NXJA 4LEHA 5G2GA 5KP1A 1ZX2A 3NBRA 4MJDA 4WWUC 3H3HA 2B24B 3OWSA 1JKGA 3NV0B 2F86B 1IDPA 3NV0A 4N3VA 3DXOA 4STDA 1GY7A 4XB5A 3FH1A 1E3VA 3OWYA 4HZBB 5KP3A 3I0YA 3LYGA 1EG9B 3EHCA 1ULJB 2PZVA 3NUVA 3JUMA 1O7GB
chains in the Genus database with same CATH superfamily
4PEJA 2CWUA 3PS8A 1NB3I 2K54A 4IIAA 1UDII 1IV9A 4MMXB 1JJ22 3UNLA 1BIRA 1TIJA 3FG3A 2P0XA 4NHFA 3S28A 1FGRA 1BNFA 1X1WA 3MHEA 1OUNA 4N6LA 3Q3FA 3ZFZA 4N6TA 1QAKA 5IEOA 3HIIA 4ILFA 1MWTA 1FUWA 3GZBA 4K1UA 4R9KA 3PCRA 1A2VA 2HMLB 5IF6A 4LZIA 1ZS7A 4HKVB 3LH4A 4WYKB 1TRQA 3H51A 3URPA 4CPKA 4HYZA 1YI23 6GSPA 3X40A 1A2KA 1M1K4 3HX8A 1BU4A 2HMKB 4N6OB 3IPTA 2K3DA 4CJNA 3D4AA 1SIIA 5I97A 1AR0A 1N5PA 3LTBA 4MEIA 1KQS2 3KSED 3CCE3 3IJEB 2GEYA 4WYKA 4X2HA 4LMIA 1G96A 1GS3A 3I563 3KN4A 3DM8A 1CQSA 1PFPA 5G1LA 1EA2A 1PY3A 1NU3A 3CCJ3 1OACA 3LT8A 1VQ73 3EX9A 1JV2B 1YHQ3 1UGHI 2B1XB 3WODG 4QWTA 3MG3A 4I4KA 4EV2A 3G713 4IPBA 2CWTA 1OCVA 2RGQA 3EBYA 1JB5A 2JQ5A 4HM5B 2Z76A 2XH9A 1TFKA 1B2ZA 1FZUA 1HU9A 1QAFA 2CWVA 1BNGA 2QIYA 3EF8A 1HKXA 2L4VA 5JBSA 1JBRA 3DUKA 1DETA 3K5TA 2BMQB 1G02A 2IYJA 3GZYB 1BSEA 2CW9A 3TDGA 1VQP3 1I3FA 1JKGB 2Z77A 3B4PA 1RN4A 1TUHA 1RGLA 1YJW3 1PYLA 1U8CB 4EV5A 1YIT3 4AEQA 3DGNA 1IV7A 2FXTA 3D3LA 4IT7A 3T8NA 2XEPA 4EBGA 3N54B 3L0RA 3UL5A 7STDA 1O7PB 1RRLA 5EQLA 3EJVA 3X3ZA 2UGIA 3S5CA 3WMDA 4L8PA 3LT9A 2XSHB 1RHLA 3KE7A 2HOHA 2H0GA 1BOXA 1BRIA 1BSDA 1OGZA 3X41A 3CCQ3 2OOVA 2IA7A 3FGYA 1SQWA 1RNTA 1FGQA 1RCLA 1BRSA 1N5HA 2L1SA 3MG2A 4BTWA 2QEX3 1BUQA 5AIFA 3VSYA 4N6MA 1RN1A 1Q40B 1VQQA 3STDA 2O9UX 4KFEA 2XGNA 2GBWB 5JPUA 5BU4A 1NWWA 4FCZA 1N9JA 3AGNA 3K9MC 4XDVA 1I0XA 4WHAA 1A90A 3LMLA 3X42A 1QMAA 1AVKA 3IMAB 3Q90A 4FMDA 3SOYA 4WFOA 3BU4A 5IG4A 5BXQA 4RNYA 1VQK3 1RJOA 1WMOA 1R4CA 2RCDA 3BLZA 3DZLA 1RGGA 4LEHA 4O3VA 1AQZA 3NBRA 1ROAA 3G4S3 2B24B 1JKGA 2F86B 1W2ZA 1MGWA 4H61A 4STDA 1GY7A 1K734 4ZM8A 3OWYA 4K61A 1HYFA 1LQGC 1W6CA 3I0YA 3LYGA 4DKIA 1PU4A 3CPW2 1NJI4 1ULJB 1YNVX 3NUVA 3JUMA 1LNHA 3MYTA 1BANA 3LTDA 4J9AA 4X2OA 2Z7AA 2YFJB 4Q53A 2W6JH 2STDA 4TX4A 2BMOB 3QRDA 1CEWI 3FG4A 5AYRB 1FGMA 3HIGA 7RNTA 2KXGA 3CCV3 1VQ93 1R4YA 3F8XA 3ER7A 2GBXB 1I2FA 2QA43 4XBTA 3KKGA 3HI7A 3CCU3 1N8R4 3S27A 2XR8B 2OTL3 3OX9A 2CFWA 2C4BA 1JB4A 1GYBA 2FGTA 2F4YA 3KCHA 3KIIA 3GWRA 2LQVA 1T2HA 3BIRA 4RZMA 1RNBA 2OTJ3 2KF4A 2C11A 3F14A 6STDA 4HZ9B 3SX1A 2H0IA 3J7Yd 1M9GA 3EQQB 4L7KA 2F5MA 3S67A 1MWRA 1V74A 2KCDA 1W02A 2XSOB 2GSPA 4J5KA 4NREA 4GB5A 3AMOA 4O8SA 1CH0A 2Y74A 3FLJA 2CK3H 2XFTA 1RTUA 4JRFA 3FKAA 1B21A 1BGSA 1STFI 3WR2A 1SIHA 1BNJA 3CNMA 2WOFA 1DVCA 2CIUA 1DMNA 1RGKA 1TP6A 3M8CA 4BU4A 4EYCA 1BRJA 5AI1A 3CD63 1Z1SA 1BNIA 1AY7A 4WP5A 1AVLA 1SPUA 1TRPA 1NO3A 3AGOA 2BO9B 3BB9A 3Q2PA 4KZ1A 1LOWA 4R9LA 1DMMA 2F98A 1QJGA 2MF7A 2SBLA 1GD3A 2BHMA 4LYLB 3PZWA 3LTAA 1FA3A 1YJN3 4BL2A 1B2SA 1O7NB 1NDOB 1W6YA 4HOHA 4XBYA 5M18A 1IVWA 1UUVB 3BNBA 1B2MA 1T2IA 1HZ1A 1TFOA 2Z6BA 1IT8A 1UI7A 2Y73A 3Q1CA 4AKZA 3D5IA 3V98A 3I553 3CME3 2W9QA 2WOHA 1BVIA 3V92A 3OW22 3B8LA 4HM3B 1BNSA 4HM0B 1E97A 1FGTA 4LSOA 2F5WA 1VQ53 1SARA 3CCL3 3FCSB 3KFQC 3CCM3 5IG3A 1UI8A 2KAAA 2R41A 1UCIA 3BNDA 2UUGC 3FZWA 5AYSC 2CG1A 3SLUA 4BL3A 1KSIA 1LOVA 1S5AA 2GU3A 4OK0A 3K63A 1EUIC 3NQZA 4R80A 4AKYA 1IVVA 5HGRA 1F8NA 3G0KA 8RNTA 4XBXA 3KZTA 5HOHA 3GAXA 1UUGB 2CKFB 4BTXA 4FR9A 1DYUA 3EBTA 5RNTA 3S29A 3FSDA 3ZG0A 2ZHXB 3ROBA 1BNEA 2OCTA 3G16A 2CX1A 1X1UA 3RGAA 3VGNA 2YX9A 3CC23 1I3IA 2V1LA 5G2GA 1GD4A 2P38A 2CFLA 1N8QA 9RNTA 3U1WA 2KF5A 1IDPA 1A2PA 3DXOA 1IT7A 3NBBA 2W56A 5M1AA 4HZBB 1TTOA 2GU1A 2ML6A 2CFKA 2XF3A 2CC3A 1WMNA 4LGQA 3FF2A 3N9HA 1LQMB 3G6E3 3CCS3 3D79A 1YVSA 5STDA 1WTHA 2OQEA 3X3YA 5AIGA 1ZO2A 1Q7Y4 4XM4A 1VQO3 2OOVC 1ROVA 5IG0A 1RSNA 2C10A 1VQ63 4EXRA 1DVDA 1W4NA 1EKMA 2ML5A 5TGNA 2R4IA 4GSPA 1SJWA 4XDWA 2WO0A 3NBJA 1GMRA 4J8TA 5D82A 2AAEA 1LOYA 3E99A 1A67A 1K8A4 3RDEA 2WGQA 1BNRA 2A15A 3FG1A 3NHXA 3JVCA 5CF2A 2CFGA 1YJ93 1D6UA 2RSXA 2I9WA 4HAAA 4FMCA 4HJLB 1IU7A 1FGOA 1LOXA 1W7CA 5IW9A 4EC6A 1DE3A 1UUWB 3B7CA 4HM1B 2RNTA 3F8HA 4NPBA 3V99A 1UCJA 4U13A 1WQLB 2BT3A 4K90B 3ZG5A 2OQEC 7GSPA 5DREA 3DGLA 4H3UA 3SYUA 3UB1A 1V58A 4HM2B 1B20A 4CCVA 2RBIA 1RCKA 5CXOA 4RNZA 1OH0A 2E2VA 2XFSA 2CHCA 1YIJ3 2BU4A 3D9RA 1W6GA 4HM6B 1RGFA 1V57A 2HMMB 3WOEB 2HMOB 5FGOA 3JUOA 3SOAA 1K28A 1I70A 1OF5A 5CK6A 5CLKA 1I2EA 1MNLA 4BTYA 1RGHA 1TJDA 5GSPA 2OWPA 3A76A 5KP4A 1Y4KA 3AHSA 2RFRA 1X1XA 1B27A 4I5QA 3DGOA 1FUTA 3GSPA 3WHOA 2HMNB 1RN7A 3JUNA 2INXA 5AIHA 1RMSA 1BSBA 3AMOB 4N6V0 2D42A 3WA3A 1UW1A 1GMQA 1O7WB 3RNTA 5LC6A 4L8OA 2YFIB 1S723 1UCKA 2CG0A 2KF3A 1BRGA 3EE1A 3CPOA 1VQ43 1GOVA 1QVF2 5ELJA 3D5GA 1OHPA 3LOYA 5G1KA 4OVMA 1VQN3 1RDSA 1RGAA 3RGRA 1JNQA 1US1A 4O02B 1IVXA 1B2XA 1STDA 3MG1A 1JBSA 3CU3A 1BUJA 4KVHA 1UGIA 1BRNL 1Q42A 3OV4A 3F9SA 1JZDA 2BNGA 1WMPA 1QALA 1FW7A 5M19A 3DY5A 5IG5A 3JUPA 1M1XB 5BVBA 3EB8A 5BIRA 4RBNA 2KF6A 1E3RA 2E2UA 1W5ZA 2O3OA 3EN1B 5IENA 3UJMA 1ASKA 3PGBA 1L5GB 1RRHA 2E2TA 1GOYA 4HVNA 1LXEA 4MMZB 3SEDA 1I0VA 1JBTA 1VQ83 1C54A 1FYSA 4MMYB 3DGMA 3PCSA 1LVNA 4ORLA 3NXJA 4R4KA 4BIRA 5KP1A 1ZX2A 4WWUC 3PXMA 6RNTA 3NV0B 4KT3B 3NV0A 4N3VA 1JZOA 2MC8A 3LTCA 1NB5I 2PNCA 3QK9A 4KFFA 3EHCA 3SVAA 3X3XA 3WA2X 1GOUA 3N8BA 1O7GB 1GMPA 2CFDA 2WGOA 3MSOA 4XB5A 3BNCA 1M904 3CC73 1K9M4 2W0QA 1OPYA 5FW5A 1Q864 3G8ZA 2UX0A 3OXAA 3CNXA 3MPHA 3A5EA 2GXFA 2P05A 1BSAA 1WNHA 3F7SA 3HOHA 2LYXA 1Q40A 2YFLB 1MWUA 3ECFA 1YGEA 1KD14 3CMA3 1NNVA 1IK3A 4JF8A 1KWIA 1KC84 4N6UA 4GHOA 2ZL8A 3DMCA 5CF1A 1RGCA 1T3BA 5LC7A 5AEWB 4R1KA 2W03A 5D83A 1D6ZA 3WDGB 1W01A 2ZDJA 1ZGXA 1IVUA 1I2GA 3HK4A 4HBRA 3EN8A 3LZAA 5DRVA 3CXC2 1Q824 1UCLA 2W04A 4J5GA 2ZA4A 3GZXB 1GY6A 1OHOA 3KSPA 3LXUX 1BRKA 1JB2A 5IERA 2BMRB 2CX0A 3T8UA 3UL6A 1QVG2 3WOFB 5AEUB 4CDLA 1I8VA 1VZZA 2HMJB 1U5OA 3AHWA 4FCJA 5AIIA 1JRQA 1VQM3 1D6YA 2D1WA 3NQYA 4KFDA 1B2UA 1RLSA 3MWZA 1CYUA 1IQXA 1IQYA 1OF5B 1AV4A 1ULIB 3CC43 2H0HA 3JUQA 4K1VA 5EVHA 2P09A 3NM7A 4HM4B 2W2CA 5IEPA 1FUSA 1OGXA 3VF1A 1EEJA 1GSPA 2F56A 1OHSA 1W00A 2QGUA 2K0MA 4HM7B 4O2HA 5JPPA 1O7MB 1IYYA 2W56B 3B4OA 1Q7HA 3T0UA 4FCMA 1BRHA 3K0ZA 3GZRA 5ELUA 2GEXA 2F99A 1JN5B 1N9EA 3PYJA 4EW5A 2J8XB 2FNQA 4G1MB 3NM2A 3OWUA 3DGYA 2IY2A 2IUJA 1TU5A 1J2BA 1MOLA 3ALAA 1YGWA 4OUQA 1RKYA 2AADA 1GY5A 1Q9EA 2SARA 3FF0A 2IMJA 3K7CA 2XRXB 3O8YA 1O7HB 3NX0A 1IQ8A 1K41A 1BSCA 3BNEA 1B3SA 3HZPA 1VQL3 1C7HA 2M7OA 5D81A 1ISKA 2KRTA 1Q814 2XGLA 1DMQA 1MGRA 8CHOA 3DH2A 4GL6A 1LNIA 3F40A 1W2B2 4FMBA 4HM8B 3EC9A 4RNTA 1X1YA 2IUKA 3GRDA 1EQKA 1YVBI 2Q07A 5EEOA 3U97A 4N6NB 1G0TA 2BIRA 3F7XA 2P0MA 3MKIA 4FMAA 2CH9A 1JN5A 4MJDA 3H3HA 3OWSA 2JDIH 1CYVA 5A0OB 1MWSA 1T5YA 2W9PA 3FH1A 1E3VA 5KP3A 3SXXA 3CCR3 1EG9B 1LRAA 2PZVA 1BAOA 1RGEA
chains in the Genus database with same CATH topology
4PEJA 2CWUA 3PS8A 1NB3I 2K54A 4IIAA 1IV9A 4MMXB 1JJ22 3UNLA 1TIJA 3FG3A 2P0XA 4NHFA 3S28A 1FGRA 3MHEA 1OUNA 4N6LA 4N6TA 1QAKA 5IEOA 3HIIA 1FUWA 3GZBA 4K1UA 4R9KA 3PCRA 1A2VA 2HMLB 5IF6A 4LZIA 4HKVB 3LH4A 4WYKB 3H51A 4HYZA 1YI23 3X40A 1A2KA 1M1K4 3HX8A 2HMKB 4N6OB 3IPTA 5I97A 1SIIA 1AR0A 1N5PA 3LTBA 4MEIA 1KQS2 3KSED 3CCE3 3IJEB 2GEYA 4WYKA 4X2HA 4LMIA 1G96A 1GS3A 3I563 3KN4A 3DM8A 1CQSA 1PFPA 1EA2A 1NU3A 3CCJ3 1OACA 3LT8A 1VQ73 3EX9A 1JV2B 1YHQ3 2B1XB 3WODG 4QWTA 3MG3A 4I4KA 4EV2A 3G713 4IPBA 2CWTA 1OCVA 2RGQA 3EBYA 1JB5A 2JQ5A 4HM5B 2Z76A 2XH9A 1TFKA 1HU9A 1QAFA 2QIYA 2CWVA 3EF8A 1HKXA 2L4VA 5JBSA 3DUKA 3K5TA 2BMQB 3GZYB 2CW9A 3TDGA 1VQP3 1JKGB 2Z77A 3B4PA 1TUHA 1YJW3 1U8CB 4EV5A 1YIT3 4AEQA 3DGNA 1IV7A 2FXTA 3D3LA 4IT7A 3T8NA 2XEPA 4EBGA 3N54B 3L0RA 3UL5A 7STDA 1O7PB 1RRLA 5EQLA 3EJVA 3X3ZA 3S5CA 3WMDA 4L8PA 3LT9A 2XSHB 3KE7A 2PZVA 1OGZA 3X41A 3CCQ3 2OOVA 2IA7A 3FGYA 1SQWA 1FGQA 2QEX3 1N5HA 4BTWA 1BUQA 3MG2A 5AIFA 3VSYA 4N6MA 1Q40B 3STDA 2O9UX 4KFEA 2XGNA 2GBWB 5JPUA 1NWWA 4FCZA 1N9JA 3K9MC 4XDVA 4WHAA 1A90A 3LMLA 3X42A 1QMAA 1AVKA 3IMAB 3Q90A 4FMDA 3SOYA 4WFOA 5IG4A 5BXQA 4RNYA 1VQK3 1RJOA 3DZLA 3BLZA 1WMOA 1R4CA 2RCDA 4LEHA 4O3VA 3CCU3 3NBRA 1ROAA 3G4S3 2B24B 1JKGA 2F86B 1W2ZA 4H61A 4STDA 1GY7A 1K734 4ZM8A 3OWYA 4K61A 1NJI4 1W6CA 3I0YA 3LYGA 1PU4A 3CPW2 1ULJB 3NUVA 3JUMA 1LNHA 3MYTA 4X2OA 3LTDA 4J9AA 2Z7AA 2YFJB 4Q53A 2W6JH 2STDA 4TX4A 2BMOB 3QRDA 1CEWI 3FG4A 5AYRB 1FGMA 3HIGA 1VQ93 2KXGA 3CCV3 3F8XA 3ER7A 2GBXB 2QA43 4XBTA 3KKGA 3HI7A 1N8R4 3S27A 2XR8B 2OTL3 3OX9A 2CFWA 1JB4A 1GYBA 2FGTA 3KIIA 3GWRA 2LQVA 4RZMA 2OTJ3 2C11A 3F14A 6STDA 4HZ9B 3SX1A 3J7Yd 1M9GA 3EQQB 4L7KA 3S67A 1V74A 2KCDA 1W02A 2XSOB 4NREA 4GB5A 3AMOA 4O8SA 2Y74A 3FLJA 2CK3H 2XFTA 4JRFA 3FKAA 1STFI 1SIHA 3CNMA 2WOFA 1DVCA 1DMNA 1TP6A 2CIUA 3M8CA 4EYCA 5AI1A 3CD63 1Z1SA 4WP5A 1AVLA 1SPUA 1NO3A 3BB9A 2BO9B 3Q2PA 4KZ1A 4R9LA 1DMMA 2F98A 1QJGA 2MF7A 2SBLA 1GD3A 2BHMA 3PZWA 3LTAA 1FA3A 1YJN3 1O7NB 1NDOB 1W6YA 4XBYA 1IVWA 1UUVB 3BNBA 2Z6BA 1TFOA 1IT8A 1UI7A 2Y73A 3Q1CA 4AKZA 3V98A 3I553 3CME3 2W9QA 2WOHA 3V92A 3OW22 3B8LA 4HM3B 4HM0B 1E97A 1FGTA 4LSOA 1VQ53 3CCL3 3FCSB 3KFQC 3CCM3 5IG3A 1UI8A 1QVG2 2CG1A 3BNDA 3SLUA 3FZWA 5AYSC 1KSIA 1S5AA 2GU3A 4R80A 4OK0A 3K63A 3NQZA 4AKYA 1IVVA 5HGRA 1F8NA 3G0KA 4XBXA 3KZTA 3GAXA 2CKFB 4BTXA 4FR9A 1DYUA 3EBTA 3S29A 3FSDA 3ROBA 2OCTA 3G16A 3RGAA 3VGNA 2YX9A 3CC23 2V1LA 5G2GA 1GD4A 2P38A 2CFLA 1N8QA 3U1WA 1IDPA 3DXOA 1IT7A 3NBBA 2W56A 4HZBB 2GU1A 2ML6A 2CFKA 2XF3A 2CC3A 1WMNA 4LGQA 3FF2A 3N9HA 3G6E3 3CCS3 5STDA 3X3YA 1WTHA 2OQEA 5AIGA 1ZO2A 1Q7Y4 4XM4A 1VQO3 2OOVC 1ROVA 5IG0A 2C10A 1VQ63 1DVDA 4EXRA 1W4NA 1EKMA 2ML5A 5TGNA 2R4IA 1SJWA 4XDWA 2WO0A 3NBJA 4J8TA 5D82A 3E99A 1A67A 1K8A4 3RDEA 2WGQA 2A15A 3FG1A 3NHXA 3JVCA 5CF2A 2CFGA 1YJ93 1D6UA 2RSXA 2I9WA 4FMCA 4HJLB 1IU7A 1FGOA 1LOXA 1W7CA 5IW9A 4EC6A 1UUWB 3B7CA 4HM1B 3F8HA 3V99A 4U13A 1WQLB 2BT3A 4K90B 2OQEC 5DREA 3DGLA 4H3UA 3UB1A 4HM2B 4CCVA 5CXOA 4RNZA 1OH0A 2E2VA 2XFSA 2CHCA 1YIJ3 3D9RA 1W6GA 4HM6B 2HMMB 3WOEB 2HMOB 5FGOA 3JUOA 3SOAA 1K28A 1OF5A 5CK6A 5CLKA 4BTYA 1MNLA 5KP4A 2OWPA 3A76A 1Y4KA 2RFRA 3DGOA 2HMNB 1RN7A 3JUNA 2INXA 5AIHA 3AMOB 4N6V0 2D42A 3WA3A 1UW1A 1O7WB 5LC6A 4L8OA 2YFIB 1S723 2CG0A 3EE1A 3CPOA 1VQ43 1QVF2 5ELJA 1OHPA 3LOYA 4OVMA 1VQN3 3RGRA 1JNQA 1US1A 4O02B 1IVXA 1STDA 3MG1A 3CU3A 4KVHA 1Q42A 3OV4A 3F9SA 2BNGA 1WMPA 1QALA 3DY5A 5IG5A 3JUPA 1M1XB 5BVBA 3EB8A 4RBNA 3EN1B 1E3RA 2E2UA 1W5ZA 2O3OA 5IENA 3UJMA 1ASKA 3PGBA 1L5GB 1RRHA 2E2TA 4HVNA 3SEDA 1LXEA 4MMZB 1VQ83 4MMYB 3DGMA 3PCSA 1LVNA 4ORLA 3NXJA 4R4KA 5KP1A 1ZX2A 4WWUC 3PXMA 3NV0B 4N3VA 3NV0A 2MC8A 3LTCA 1NB5I 2PNCA 3QK9A 4KFFA 3EHCA 3SVAA 3X3XA 3WA2X 3N8BA 2WGOA 1O7GB 2CFDA 3MSOA 4XB5A 3BNCA 1M904 3CC73 1K9M4 2W0QA 1OPYA 5FW5A 1Q864 3G8ZA 2UX0A 3OXAA 3CNXA 3MPHA 2GXFA 2P05A 1WNHA 3F7SA 2LYXA 1Q40A 2YFLB 3ECFA 1YGEA 1KD14 3CMA3 1IK3A 4JF8A 1KWIA 1KC84 4N6UA 2ZL8A 3DMCA 5CF1A 5LC7A 5AEWB 4R1KA 2W03A 5D83A 1D6ZA 3WDGB 1W01A 2ZDJA 1IVUA 4HBRA 3HK4A 3EN8A 3LZAA 5DRVA 3CXC2 1Q824 2W04A 3GZXB 1GY6A 1OHOA 3KSPA 3LXUX 1JB2A 5IERA 2BMRB 3T8UA 3UL6A 3WOFB 5AEUB 4CDLA 1VZZA 2HMJB 1U5OA 5AIIA 4FCJA 1VQM3 1JRQA 1D6YA 2D1WA 3NQYA 4KFDA 3MWZA 1CYUA 1IQXA 1IQYA 1OF5B 1AV4A 1ULIB 3CC43 3JUQA 4K1VA 5EVHA 2P09A 3NM7A 4HM4B 5IEPA 1OGXA 3VF1A 2QGUA 4HM7B 1OHSA 1W00A 5JPPA 2K0MA 4O2HA 1O7MB 2W56B 3B4OA 3T0UA 4FCMA 3K0ZA 3GZRA 5ELUA 2GEXA 2F99A 1JN5B 1N9EA 3PYJA 4G1MB 2FNQA 3NM2A 3OWUA 2IUJA 1J2BA 1TU5A 1MOLA 3ALAA 4OUQA 1RKYA 1GY5A 3FF0A 2IMJA 3K7CA 2XRXB 3O8YA 1O7HB 3NX0A 1IQ8A 1K41A 3BNEA 3HZPA 1VQL3 1C7HA 2M7OA 5D81A 1ISKA 2KRTA 1Q814 2XGLA 1DMQA 8CHOA 4GL6A 3F40A 1W2B2 4FMBA 4HM8B 3EC9A 2IUKA 3GRDA 1EQKA 1YVBI 2Q07A 5EEOA 3U97A 4N6NB 3MKIA 3F7XA 2P0MA 4FMAA 2CH9A 1JN5A 4MJDA 3H3HA 3OWSA 2JDIH 1CYVA 5A0OB 1T5YA 2W9PA 3FH1A 1E3VA 5KP3A 3SXXA 3CCR3 1EG9B 2W2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PEJ A;  4J9A A;  4LGQ A;  4X2O A;  2K54 A;  4IIA A;  2Z7A A;  2YFJ B;  3FF2 A;  4Q53 A;  1OPY A;  2STD A;  5FW5 A;  5STD A;  3UNL A;  3G8Z A;  2UX0 A;  2BMO B;  3OXA A;  3CNX A;  1ZO2 A;  5AIG A;  2GXF A;  4XM4 A;  3F7S A;  5IG0 A;  3MHE A;  1Q40 A;  1OUN A;  2YFL B;  3ECF A;  3F8X A;  5IEO A;  3ER7 A;  2GBX B;  5TGN A;  3GZB A;  4K1U A;  4R9K A;  2R4I A;  3KKG A;  3DMC A;  4XBT A;  5CF1 A;  1SJW A;  2XR8 B;  4XDW A;  3OX9 A;  5D82 A;  4J8T A;  5AEW B;  2HML B;  3E99 A;  4R1K A;  5D83 A;  5IF6 A;  2A15 A;  1JB4 A;  1GYB A;  1W01 A;  3NHX A;  4HKV B;  5CF2 A;  4WYK B;  3GWR A;  3H51 A;  4RZM A;  2I9W A;  3HK4 A;  3EN8 A;  3LZA A;  5DRV A;  1A2K A;  3F14 A;  4HZ9 B;  4HJL B;  6STD A;  3GZX B;  1OHO A;  1GY6 A;  2HMK B;  3HX8 A;  3KSP A;  3IPT A;  3EQQ B;  1JB2 A;  4L7K A;  5IER A;  2BMR B;  1W02 A;  1AR0 A;  1UUW B;  2XSO B;  3B7C A;  4HM1 B;  3T8U A;  3F8H A;  4GB5 A;  4WYK A;  2GEY A;  1WQL B;  4U13 A;  3FLJ A;  4CDL A;  4X2H A;  4LMI A;  5AEU B;  1GS3 A;  1VZZ A;  2HMJ B;  3DM8 A;  4H3U A;  1U5O A;  5AII A;  1CQS A;  3FKA A;  4FCJ A;  5DRE A;  1EA2 A;  4HM2 B;  1NU3 A;  5CXO A;  3EX9 A;  1OH0 A;  3CNM A;  1OF5 B;  1DMN A;  1TP6 A;  2B1X B;  2CHC A;  3D9R A;  3M8C A;  1ULI B;  3MG3 A;  4HM6 B;  4I4K A;  1OCV A;  2RGQ A;  3JUQ A;  1Z1S A;  4K1V A;  5AI1 A;  5EVH A;  3EBY A;  1JB5 A;  2HMM B;  2JQ5 A;  2W2C A;  2Z76 A;  4HM5 B;  4HM4 B;  4WP5 A;  5IEP A;  2HMO B;  2QIY A;  3EF8 A;  1OGX A;  3BB9 A;  3JUO A;  3SOA A;  2QGU A;  1HKX A;  4HM7 B;  1OF5 A;  1OHS A;  1W00 A;  5CK6 A;  4R9L A;  5CLK A;  5JPP A;  1O7M B;  1DMM A;  2F98 A;  3DUK A;  1QJG A;  5KP4 A;  2OWP A;  3A76 A;  3B4O A;  2BMQ B;  2RFR A;  3GZY B;  4FCM A;  3K0Z A;  3GZR A;  1JKG B;  1O7N B;  2HMN B;  1NDO B;  1W6Y A;  2Z77 A;  2INX A;  3JUN A;  2GEX A;  4XBY A;  1UUV B;  3B4P A;  2F99 A;  1JN5 B;  5AIH A;  1TUH A;  1O7W B;  4L8O A;  2YFI B;  3NM2 A;  3OWU A;  3CPO A;  3T8N A;  3MYT A;  1OHP A;  3B8L A;  7STD A;  4HM3 B;  4OVM A;  1O7P B;  4HM0 B;  1E97 A;  4OUQ A;  3EJV A;  3S5C A;  3WMD A;  3RGR A;  4L8P A;  1GY5 A;  2XSH B;  3KE7 A;  3FF0 A;  1STD A;  3MG1 A;  3MSO A;  2IMJ A;  3K7C A;  2XRX B;  1OGZ A;  3CU3 A;  5IG3 A;  4KVH A;  3FZW A;  1Q42 A;  3FGY A;  1O7H B;  1S5A A;  3F9S A;  3OV4 A;  2BNG A;  1K41 A;  3HZP A;  1BUQ A;  3MG2 A;  5IG5 A;  5AIF A;  3G0K A;  3JUP A;  1C7H A;  5D81 A;  5HGR A;  3VSY A;  1Q40 B;  4XBX A;  3STD A;  3KZT A;  5BVB A;  1ISK A;  3EN1 B;  1E3R A;  1DMQ A;  8CHO A;  5IEN A;  2CKF B;  2GBW B;  5JPU A;  3F40 A;  1NWW A;  3UJM A;  3EBT A;  1ASK A;  4XDV A;  4HM8 B;  3EC9 A;  3FSD A;  3GRD A;  1QMA A;  4HVN A;  3ROB A;  3G16 A;  3Q90 A;  3SED A;  3SOY A;  3RGA A;  3VGN A;  3MKI A;  5IG4 A;  3F7X A;  5BXQ A;  4ORL A;  2RCD A;  3BLZ A;  3DZL A;  1JN5 A;  3NXJ A;  4LEH A;  5G2G A;  5KP1 A;  1ZX2 A;  3NBR A;  4MJD A;  4WWU C;  3H3H A;  2B24 B;  3OWS A;  1JKG A;  3NV0 B;  2F86 B;  1IDP A;  3NV0 A;  4N3V A;  3DXO A;  4STD A;  1GY7 A;  4XB5 A;  3FH1 A;  1E3V A;  3OWY A;  4HZB B;  5KP3 A;  3I0Y A;  3LYG A;  1EG9 B;  3EHC A;  1ULJ B;  2PZV A;  3NUV A;  3JUM A;  1O7G B; 
#chains in the Genus database with same CATH topology
 4PEJ A;  2CWU A;  3PS8 A;  1NB3 I;  2K54 A;  4IIA A;  1UDI I;  1IV9 A;  4MMX B;  1JJ2 2;  3UNL A;  1BIR A;  1TIJ A;  3FG3 A;  2P0X A;  4NHF A;  3S28 A;  1FGR A;  1BNF A;  1X1W A;  3MHE A;  1OUN A;  4N6L A;  3Q3F A;  3ZFZ A;  4N6T A;  1QAK A;  5IEO A;  3HII A;  4ILF A;  1MWT A;  1FUW A;  3GZB A;  4K1U A;  4R9K A;  3PCR A;  1A2V A;  2HML B;  5IF6 A;  4LZI A;  1ZS7 A;  4HKV B;  3LH4 A;  4WYK B;  1TRQ A;  3H51 A;  3URP A;  4CPK A;  4HYZ A;  1YI2 3;  6GSP A;  3X40 A;  1A2K A;  1M1K 4;  3HX8 A;  1BU4 A;  2HMK B;  4N6O B;  3IPT A;  2K3D A;  4CJN A;  3D4A A;  1SII A;  5I97 A;  1AR0 A;  1N5P A;  3LTB A;  4MEI A;  1KQS 2;  3KSE D;  3CCE 3;  3IJE B;  2GEY A;  4WYK A;  4X2H A;  4LMI A;  1G96 A;  1GS3 A;  3I56 3;  3KN4 A;  3DM8 A;  1CQS A;  1PFP A;  5G1L A;  1EA2 A;  1PY3 A;  1NU3 A;  3CCJ 3;  1OAC A;  3LT8 A;  1VQ7 3;  3EX9 A;  1JV2 B;  1YHQ 3;  1UGH I;  2B1X B;  3WOD G;  4QWT A;  3MG3 A;  4I4K A;  4EV2 A;  3G71 3;  4IPB A;  2CWT A;  1OCV A;  2RGQ A;  3EBY A;  1JB5 A;  2JQ5 A;  4HM5 B;  2Z76 A;  2XH9 A;  1TFK A;  1B2Z A;  1FZU A;  1HU9 A;  1QAF A;  2CWV A;  1BNG A;  2QIY A;  3EF8 A;  1HKX A;  2L4V A;  5JBS A;  1JBR A;  3DUK A;  1DET A;  3K5T A;  2BMQ B;  1G02 A;  2IYJ A;  3GZY B;  1BSE A;  2CW9 A;  3TDG A;  1VQP 3;  1I3F A;  1JKG B;  2Z77 A;  3B4P A;  1RN4 A;  1TUH A;  1RGL A;  1YJW 3;  1PYL A;  1U8C B;  4EV5 A;  1YIT 3;  4AEQ A;  3DGN A;  1IV7 A;  2FXT A;  3D3L A;  4IT7 A;  3T8N A;  2XEP A;  4EBG A;  3N54 B;  3L0R A;  3UL5 A;  7STD A;  1O7P B;  1RRL A;  5EQL A;  3EJV A;  3X3Z A;  2UGI A;  3S5C A;  3WMD A;  4L8P A;  3LT9 A;  2XSH B;  1RHL A;  3KE7 A;  2HOH A;  2H0G A;  1BOX A;  1BRI A;  1BSD A;  1OGZ A;  3X41 A;  3CCQ 3;  2OOV A;  2IA7 A;  3FGY A;  1SQW A;  1RNT A;  1FGQ A;  1RCL A;  1BRS A;  1N5H A;  2L1S A;  3MG2 A;  4BTW A;  2QEX 3;  1BUQ A;  5AIF A;  3VSY A;  4N6M A;  1RN1 A;  1Q40 B;  1VQQ A;  3STD A;  2O9U X;  4KFE A;  2XGN A;  2GBW B;  5JPU A;  5BU4 A;  1NWW A;  4FCZ A;  1N9J A;  3AGN A;  3K9M C;  4XDV A;  1I0X A;  4WHA A;  1A90 A;  3LML A;  3X42 A;  1QMA A;  1AVK A;  3IMA B;  3Q90 A;  4FMD A;  3SOY A;  4WFO A;  3BU4 A;  5IG4 A;  5BXQ A;  4RNY A;  1VQK 3;  1RJO A;  1WMO A;  1R4C A;  2RCD A;  3BLZ A;  3DZL A;  1RGG A;  4LEH A;  4O3V A;  1AQZ A;  3NBR A;  1ROA A;  3G4S 3;  2B24 B;  1JKG A;  2F86 B;  1W2Z A;  1MGW A;  4H61 A;  4STD A;  1GY7 A;  1K73 4;  4ZM8 A;  3OWY A;  4K61 A;  1HYF A;  1LQG C;  1W6C A;  3I0Y A;  3LYG A;  4DKI A;  1PU4 A;  3CPW 2;  1NJI 4;  1ULJ B;  1YNV X;  3NUV A;  3JUM A;  1LNH A;  3MYT A;  1BAN A;  3LTD A;  4J9A A;  4X2O A;  2Z7A A;  2YFJ B;  4Q53 A;  2W6J H;  2STD A;  4TX4 A;  2BMO B;  3QRD A;  1CEW I;  3FG4 A;  5AYR B;  1FGM A;  3HIG A;  7RNT A;  2KXG A;  3CCV 3;  1VQ9 3;  1R4Y A;  3F8X A;  3ER7 A;  2GBX B;  1I2F A;  2QA4 3;  4XBT A;  3KKG A;  3HI7 A;  3CCU 3;  1N8R 4;  3S27 A;  2XR8 B;  2OTL 3;  3OX9 A;  2CFW A;  2C4B A;  1JB4 A;  1GYB A;  2FGT A;  2F4Y A;  3KCH A;  3KII A;  3GWR A;  2LQV A;  1T2H A;  3BIR A;  4RZM A;  1RNB A;  2OTJ 3;  2KF4 A;  2C11 A;  3F14 A;  6STD A;  4HZ9 B;  3SX1 A;  2H0I A;  3J7Y d;  1M9G A;  3EQQ B;  4L7K A;  2F5M A;  3S67 A;  1MWR A;  1V74 A;  2KCD A;  1W02 A;  2XSO B;  2GSP A;  4J5K A;  4NRE A;  4GB5 A;  3AMO A;  4O8S A;  1CH0 A;  2Y74 A;  3FLJ A;  2CK3 H;  2XFT A;  1RTU A;  4JRF A;  3FKA A;  1B21 A;  1BGS A;  1STF I;  3WR2 A;  1SIH A;  1BNJ A;  3CNM A;  2WOF A;  1DVC A;  2CIU A;  1DMN A;  1RGK A;  1TP6 A;  3M8C A;  4BU4 A;  4EYC A;  1BRJ A;  5AI1 A;  3CD6 3;  1Z1S A;  1BNI A;  1AY7 A;  4WP5 A;  1AVL A;  1SPU A;  1TRP A;  1NO3 A;  3AGO A;  2BO9 B;  3BB9 A;  3Q2P A;  4KZ1 A;  1LOW A;  4R9L A;  1DMM A;  2F98 A;  1QJG A;  2MF7 A;  2SBL A;  1GD3 A;  2BHM A;  4LYL B;  3PZW A;  3LTA A;  1FA3 A;  1YJN 3;  4BL2 A;  1B2S A;  1O7N B;  1NDO B;  1W6Y A;  4HOH A;  4XBY A;  5M18 A;  1IVW A;  1UUV B;  3BNB A;  1B2M A;  1T2I A;  1HZ1 A;  1TFO A;  2Z6B A;  1IT8 A;  1UI7 A;  2Y73 A;  3Q1C A;  4AKZ A;  3D5I A;  3V98 A;  3I55 3;  3CME 3;  2W9Q A;  2WOH A;  1BVI A;  3V92 A;  3OW2 2;  3B8L A;  4HM3 B;  1BNS A;  4HM0 B;  1E97 A;  1FGT A;  4LSO A;  2F5W A;  1VQ5 3;  1SAR A;  3CCL 3;  3FCS B;  3KFQ C;  3CCM 3;  5IG3 A;  1UI8 A;  2KAA A;  2R41 A;  1UCI A;  3BND A;  2UUG C;  3FZW A;  5AYS C;  2CG1 A;  3SLU A;  4BL3 A;  1KSI A;  1LOV A;  1S5A A;  2GU3 A;  4OK0 A;  3K63 A;  1EUI C;  3NQZ A;  4R80 A;  4AKY A;  1IVV A;  5HGR A;  1F8N A;  3G0K A;  8RNT A;  4XBX A;  3KZT A;  5HOH A;  3GAX A;  1UUG B;  2CKF B;  4BTX A;  4FR9 A;  1DYU A;  3EBT A;  5RNT A;  3S29 A;  3FSD A;  3ZG0 A;  2ZHX B;  3ROB A;  1BNE A;  2OCT A;  3G16 A;  2CX1 A;  1X1U A;  3RGA A;  3VGN A;  2YX9 A;  3CC2 3;  1I3I A;  2V1L A;  5G2G A;  1GD4 A;  2P38 A;  2CFL A;  1N8Q A;  9RNT A;  3U1W A;  2KF5 A;  1IDP A;  1A2P A;  3DXO A;  1IT7 A;  3NBB A;  2W56 A;  5M1A A;  4HZB B;  1TTO A;  2GU1 A;  2ML6 A;  2CFK A;  2XF3 A;  2CC3 A;  1WMN A;  4LGQ A;  3FF2 A;  3N9H A;  1LQM B;  3G6E 3;  3CCS 3;  3D79 A;  1YVS A;  5STD A;  1WTH A;  2OQE A;  3X3Y A;  5AIG A;  1ZO2 A;  1Q7Y 4;  4XM4 A;  1VQO 3;  2OOV C;  1ROV A;  5IG0 A;  1RSN A;  2C10 A;  1VQ6 3;  4EXR A;  1DVD A;  1W4N A;  1EKM A;  2ML5 A;  5TGN A;  2R4I A;  4GSP A;  1SJW A;  4XDW A;  2WO0 A;  3NBJ A;  1GMR A;  4J8T A;  5D82 A;  2AAE A;  1LOY A;  3E99 A;  1A67 A;  1K8A 4;  3RDE A;  2WGQ A;  1BNR A;  2A15 A;  3FG1 A;  3NHX A;  3JVC A;  5CF2 A;  2CFG A;  1YJ9 3;  1D6U A;  2RSX A;  2I9W A;  4HAA A;  4FMC A;  4HJL B;  1IU7 A;  1FGO A;  1LOX A;  1W7C A;  5IW9 A;  4EC6 A;  1DE3 A;  1UUW B;  3B7C A;  4HM1 B;  2RNT A;  3F8H A;  4NPB A;  3V99 A;  1UCJ A;  4U13 A;  1WQL B;  2BT3 A;  4K90 B;  3ZG5 A;  2OQE C;  7GSP A;  5DRE A;  3DGL A;  4H3U A;  3SYU A;  3UB1 A;  1V58 A;  4HM2 B;  1B20 A;  4CCV A;  2RBI A;  1RCK A;  5CXO A;  4RNZ A;  1OH0 A;  2E2V A;  2XFS A;  2CHC A;  1YIJ 3;  2BU4 A;  3D9R A;  1W6G A;  4HM6 B;  1RGF A;  1V57 A;  2HMM B;  3WOE B;  2HMO B;  5FGO A;  3JUO A;  3SOA A;  1K28 A;  1I70 A;  1OF5 A;  5CK6 A;  5CLK A;  1I2E A;  1MNL A;  4BTY A;  1RGH A;  1TJD A;  5GSP A;  2OWP A;  3A76 A;  5KP4 A;  1Y4K A;  3AHS A;  2RFR A;  1X1X A;  1B27 A;  4I5Q A;  3DGO A;  1FUT A;  3GSP A;  3WHO A;  2HMN B;  1RN7 A;  3JUN A;  2INX A;  5AIH A;  1RMS A;  1BSB A;  3AMO B;  4N6V 0;  2D42 A;  3WA3 A;  1UW1 A;  1GMQ A;  1O7W B;  3RNT A;  5LC6 A;  4L8O A;  2YFI B;  1S72 3;  1UCK A;  2CG0 A;  2KF3 A;  1BRG A;  3EE1 A;  3CPO A;  1VQ4 3;  1GOV A;  1QVF 2;  5ELJ A;  3D5G A;  1OHP A;  3LOY A;  5G1K A;  4OVM A;  1VQN 3;  1RDS A;  1RGA A;  3RGR A;  1JNQ A;  1US1 A;  4O02 B;  1IVX A;  1B2X A;  1STD A;  3MG1 A;  1JBS A;  3CU3 A;  1BUJ A;  4KVH A;  1UGI A;  1BRN L;  1Q42 A;  3OV4 A;  3F9S A;  1JZD A;  2BNG A;  1WMP A;  1QAL A;  1FW7 A;  5M19 A;  3DY5 A;  5IG5 A;  3JUP A;  1M1X B;  5BVB A;  3EB8 A;  5BIR A;  4RBN A;  2KF6 A;  1E3R A;  2E2U A;  1W5Z A;  2O3O A;  3EN1 B;  5IEN A;  3UJM A;  1ASK A;  3PGB A;  1L5G B;  1RRH A;  2E2T A;  1GOY A;  4HVN A;  1LXE A;  4MMZ B;  3SED A;  1I0V A;  1JBT A;  1VQ8 3;  1C54 A;  1FYS A;  4MMY B;  3DGM A;  3PCS A;  1LVN A;  4ORL A;  3NXJ A;  4R4K A;  4BIR A;  5KP1 A;  1ZX2 A;  4WWU C;  3PXM A;  6RNT A;  3NV0 B;  4KT3 B;  3NV0 A;  4N3V A;  1JZO A;  2MC8 A;  3LTC A;  1NB5 I;  2PNC A;  3QK9 A;  4KFF A;  3EHC A;  3SVA A;  3X3X A;  3WA2 X;  1GOU A;  3N8B A;  1O7G B;  1GMP A;  2CFD A;  2WGO A;  3MSO A;  4XB5 A;  3BNC A;  1M90 4;  3CC7 3;  1K9M 4;  2W0Q A;  1OPY A;  5FW5 A;  1Q86 4;  3G8Z A;  2UX0 A;  3OXA A;  3CNX A;  3MPH A;  3A5E A;  2GXF A;  2P05 A;  1BSA A;  1WNH A;  3F7S A;  3HOH A;  2LYX A;  1Q40 A;  2YFL B;  1MWU A;  3ECF A;  1YGE A;  1KD1 4;  3CMA 3;  1NNV A;  1IK3 A;  4JF8 A;  1KWI A;  1KC8 4;  4N6U A;  4GHO A;  2ZL8 A;  3DMC A;  5CF1 A;  1RGC A;  1T3B A;  5LC7 A;  5AEW B;  4R1K A;  2W03 A;  5D83 A;  1D6Z A;  3WDG B;  1W01 A;  2ZDJ A;  1ZGX A;  1IVU A;  1I2G A;  3HK4 A;  4HBR A;  3EN8 A;  3LZA A;  5DRV A;  3CXC 2;  1Q82 4;  1UCL A;  2W04 A;  4J5G A;  2ZA4 A;  3GZX B;  1GY6 A;  1OHO A;  3KSP A;  3LXU X;  1BRK A;  1JB2 A;  5IER A;  2BMR B;  2CX0 A;  3T8U A;  3UL6 A;  1QVG 2;  3WOF B;  5AEU B;  4CDL A;  1I8V A;  1VZZ A;  2HMJ B;  1U5O A;  3AHW A;  4FCJ A;  5AII A;  1JRQ A;  1VQM 3;  1D6Y A;  2D1W A;  3NQY A;  4KFD A;  1B2U A;  1RLS A;  3MWZ A;  1CYU A;  1IQX A;  1IQY A;  1OF5 B;  1AV4 A;  1ULI B;  3CC4 3;  2H0H A;  3JUQ A;  4K1V A;  5EVH A;  2P09 A;  3NM7 A;  4HM4 B;  2W2C A;  5IEP A;  1FUS A;  1OGX A;  3VF1 A;  1EEJ A;  1GSP A;  2F56 A;  1OHS A;  1W00 A;  2QGU A;  2K0M A;  4HM7 B;  4O2H A;  5JPP A;  1O7M B;  1IYY A;  2W56 B;  3B4O A;  1Q7H A;  3T0U A;  4FCM A;  1BRH A;  3K0Z A;  3GZR A;  5ELU A;  2GEX A;  2F99 A;  1JN5 B;  1N9E A;  3PYJ A;  4EW5 A;  2J8X B;  2FNQ A;  4G1M B;  3NM2 A;  3OWU A;  3DGY A;  2IY2 A;  2IUJ A;  1TU5 A;  1J2B A;  1MOL A;  3ALA A;  1YGW A;  4OUQ A;  1RKY A;  2AAD A;  1GY5 A;  1Q9E A;  2SAR A;  3FF0 A;  2IMJ A;  3K7C A;  2XRX B;  3O8Y A;  1O7H B;  3NX0 A;  1IQ8 A;  1K41 A;  1BSC A;  3BNE A;  1B3S A;  3HZP A;  1VQL 3;  1C7H A;  2M7O A;  5D81 A;  1ISK A;  2KRT A;  1Q81 4;  2XGL A;  1DMQ A;  1MGR A;  8CHO A;  3DH2 A;  4GL6 A;  1LNI A;  3F40 A;  1W2B 2;  4FMB A;  4HM8 B;  3EC9 A;  4RNT A;  1X1Y A;  2IUK A;  3GRD A;  1EQK A;  1YVB I;  2Q07 A;  5EEO A;  3U97 A;  4N6N B;  1G0T A;  2BIR A;  3F7X A;  2P0M A;  3MKI A;  4FMA A;  2CH9 A;  1JN5 A;  4MJD A;  3H3H A;  3OWS A;  2JDI H;  1CYV A;  5A0O B;  1MWS A;  1T5Y A;  2W9P A;  3FH1 A;  1E3V A;  5KP3 A;  3SXX A;  3CCR 3;  1EG9 B;  1LRA A;  2PZV A;  1BAO A;  1RGE A; 
#chains in the Genus database with same CATH homology
 4PEJ A;  2CWU A;  3PS8 A;  1NB3 I;  2K54 A;  4IIA A;  1IV9 A;  4MMX B;  1JJ2 2;  3UNL A;  1TIJ A;  3FG3 A;  2P0X A;  4NHF A;  3S28 A;  1FGR A;  3MHE A;  1OUN A;  4N6L A;  4N6T A;  1QAK A;  5IEO A;  3HII A;  1FUW A;  3GZB A;  4K1U A;  4R9K A;  3PCR A;  1A2V A;  2HML B;  5IF6 A;  4LZI A;  4HKV B;  3LH4 A;  4WYK B;  3H51 A;  4HYZ A;  1YI2 3;  3X40 A;  1A2K A;  1M1K 4;  3HX8 A;  2HMK B;  4N6O B;  3IPT A;  5I97 A;  1SII A;  1AR0 A;  1N5P A;  3LTB A;  4MEI A;  1KQS 2;  3KSE D;  3CCE 3;  3IJE B;  2GEY A;  4WYK A;  4X2H A;  4LMI A;  1G96 A;  1GS3 A;  3I56 3;  3KN4 A;  3DM8 A;  1CQS A;  1PFP A;  1EA2 A;  1NU3 A;  3CCJ 3;  1OAC A;  3LT8 A;  1VQ7 3;  3EX9 A;  1JV2 B;  1YHQ 3;  2B1X B;  3WOD G;  4QWT A;  3MG3 A;  4I4K A;  4EV2 A;  3G71 3;  4IPB A;  2CWT A;  1OCV A;  2RGQ A;  3EBY A;  1JB5 A;  2JQ5 A;  4HM5 B;  2Z76 A;  2XH9 A;  1TFK A;  1HU9 A;  1QAF A;  2QIY A;  2CWV A;  3EF8 A;  1HKX A;  2L4V A;  5JBS A;  3DUK A;  3K5T A;  2BMQ B;  3GZY B;  2CW9 A;  3TDG A;  1VQP 3;  1JKG B;  2Z77 A;  3B4P A;  1TUH A;  1YJW 3;  1U8C B;  4EV5 A;  1YIT 3;  4AEQ A;  3DGN A;  1IV7 A;  2FXT A;  3D3L A;  4IT7 A;  3T8N A;  2XEP A;  4EBG A;  3N54 B;  3L0R A;  3UL5 A;  7STD A;  1O7P B;  1RRL A;  5EQL A;  3EJV A;  3X3Z A;  3S5C A;  3WMD A;  4L8P A;  3LT9 A;  2XSH B;  3KE7 A;  2PZV A;  1OGZ A;  3X41 A;  3CCQ 3;  2OOV A;  2IA7 A;  3FGY A;  1SQW A;  1FGQ A;  2QEX 3;  1N5H A;  4BTW A;  1BUQ A;  3MG2 A;  5AIF A;  3VSY A;  4N6M A;  1Q40 B;  3STD A;  2O9U X;  4KFE A;  2XGN A;  2GBW B;  5JPU A;  1NWW A;  4FCZ A;  1N9J A;  3K9M C;  4XDV A;  4WHA A;  1A90 A;  3LML A;  3X42 A;  1QMA A;  1AVK A;  3IMA B;  3Q90 A;  4FMD A;  3SOY A;  4WFO A;  5IG4 A;  5BXQ A;  4RNY A;  1VQK 3;  1RJO A;  3DZL A;  3BLZ A;  1WMO A;  1R4C A;  2RCD A;  4LEH A;  4O3V A;  3CCU 3;  3NBR A;  1ROA A;  3G4S 3;  2B24 B;  1JKG A;  2F86 B;  1W2Z A;  4H61 A;  4STD A;  1GY7 A;  1K73 4;  4ZM8 A;  3OWY A;  4K61 A;  1NJI 4;  1W6C A;  3I0Y A;  3LYG A;  1PU4 A;  3CPW 2;  1ULJ B;  3NUV A;  3JUM A;  1LNH A;  3MYT A;  4X2O A;  3LTD A;  4J9A A;  2Z7A A;  2YFJ B;  4Q53 A;  2W6J H;  2STD A;  4TX4 A;  2BMO B;  3QRD A;  1CEW I;  3FG4 A;  5AYR B;  1FGM A;  3HIG A;  1VQ9 3;  2KXG A;  3CCV 3;  3F8X A;  3ER7 A;  2GBX B;  2QA4 3;  4XBT A;  3KKG A;  3HI7 A;  1N8R 4;  3S27 A;  2XR8 B;  2OTL 3;  3OX9 A;  2CFW A;  1JB4 A;  1GYB A;  2FGT A;  3KII A;  3GWR A;  2LQV A;  4RZM A;  2OTJ 3;  2C11 A;  3F14 A;  6STD A;  4HZ9 B;  3SX1 A;  3J7Y d;  1M9G A;  3EQQ B;  4L7K A;  3S67 A;  1V74 A;  2KCD A;  1W02 A;  2XSO B;  4NRE A;  4GB5 A;  3AMO A;  4O8S A;  2Y74 A;  3FLJ A;  2CK3 H;  2XFT A;  4JRF A;  3FKA A;  1STF I;  1SIH A;  3CNM A;  2WOF A;  1DVC A;  1DMN A;  1TP6 A;  2CIU A;  3M8C A;  4EYC A;  5AI1 A;  3CD6 3;  1Z1S A;  4WP5 A;  1AVL A;  1SPU A;  1NO3 A;  3BB9 A;  2BO9 B;  3Q2P A;  4KZ1 A;  4R9L A;  1DMM A;  2F98 A;  1QJG A;  2MF7 A;  2SBL A;  1GD3 A;  2BHM A;  3PZW A;  3LTA A;  1FA3 A;  1YJN 3;  1O7N B;  1NDO B;  1W6Y A;  4XBY A;  1IVW A;  1UUV B;  3BNB A;  2Z6B A;  1TFO A;  1IT8 A;  1UI7 A;  2Y73 A;  3Q1C A;  4AKZ A;  3V98 A;  3I55 3;  3CME 3;  2W9Q A;  2WOH A;  3V92 A;  3OW2 2;  3B8L A;  4HM3 B;  4HM0 B;  1E97 A;  1FGT A;  4LSO A;  1VQ5 3;  3CCL 3;  3FCS B;  3KFQ C;  3CCM 3;  5IG3 A;  1UI8 A;  1QVG 2;  2CG1 A;  3BND A;  3SLU A;  3FZW A;  5AYS C;  1KSI A;  1S5A A;  2GU3 A;  4R80 A;  4OK0 A;  3K63 A;  3NQZ A;  4AKY A;  1IVV A;  5HGR A;  1F8N A;  3G0K A;  4XBX A;  3KZT A;  3GAX A;  2CKF B;  4BTX A;  4FR9 A;  1DYU A;  3EBT A;  3S29 A;  3FSD A;  3ROB A;  2OCT A;  3G16 A;  3RGA A;  3VGN A;  2YX9 A;  3CC2 3;  2V1L A;  5G2G A;  1GD4 A;  2P38 A;  2CFL A;  1N8Q A;  3U1W A;  1IDP A;  3DXO A;  1IT7 A;  3NBB A;  2W56 A;  4HZB B;  2GU1 A;  2ML6 A;  2CFK A;  2XF3 A;  2CC3 A;  1WMN A;  4LGQ A;  3FF2 A;  3N9H A;  3G6E 3;  3CCS 3;  5STD A;  3X3Y A;  1WTH A;  2OQE A;  5AIG A;  1ZO2 A;  1Q7Y 4;  4XM4 A;  1VQO 3;  2OOV C;  1ROV A;  5IG0 A;  2C10 A;  1VQ6 3;  1DVD A;  4EXR A;  1W4N A;  1EKM A;  2ML5 A;  5TGN A;  2R4I A;  1SJW A;  4XDW A;  2WO0 A;  3NBJ A;  4J8T A;  5D82 A;  3E99 A;  1A67 A;  1K8A 4;  3RDE A;  2WGQ A;  2A15 A;  3FG1 A;  3NHX A;  3JVC A;  5CF2 A;  2CFG A;  1YJ9 3;  1D6U A;  2RSX A;  2I9W A;  4FMC A;  4HJL B;  1IU7 A;  1FGO A;  1LOX A;  1W7C A;  5IW9 A;  4EC6 A;  1UUW B;  3B7C A;  4HM1 B;  3F8H A;  3V99 A;  4U13 A;  1WQL B;  2BT3 A;  4K90 B;  2OQE C;  5DRE A;  3DGL A;  4H3U A;  3UB1 A;  4HM2 B;  4CCV A;  5CXO A;  4RNZ A;  1OH0 A;  2E2V A;  2XFS A;  2CHC A;  1YIJ 3;  3D9R A;  1W6G A;  4HM6 B;  2HMM B;  3WOE B;  2HMO B;  5FGO A;  3JUO A;  3SOA A;  1K28 A;  1OF5 A;  5CK6 A;  5CLK A;  4BTY A;  1MNL A;  5KP4 A;  2OWP A;  3A76 A;  1Y4K A;  2RFR A;  3DGO A;  2HMN B;  1RN7 A;  3JUN A;  2INX A;  5AIH A;  3AMO B;  4N6V 0;  2D42 A;  3WA3 A;  1UW1 A;  1O7W B;  5LC6 A;  4L8O A;  2YFI B;  1S72 3;  2CG0 A;  3EE1 A;  3CPO A;  1VQ4 3;  1QVF 2;  5ELJ A;  1OHP A;  3LOY A;  4OVM A;  1VQN 3;  3RGR A;  1JNQ A;  1US1 A;  4O02 B;  1IVX A;  1STD A;  3MG1 A;  3CU3 A;  4KVH A;  1Q42 A;  3OV4 A;  3F9S A;  2BNG A;  1WMP A;  1QAL A;  3DY5 A;  5IG5 A;  3JUP A;  1M1X B;  5BVB A;  3EB8 A;  4RBN A;  3EN1 B;  1E3R A;  2E2U A;  1W5Z A;  2O3O A;  5IEN A;  3UJM A;  1ASK A;  3PGB A;  1L5G B;  1RRH A;  2E2T A;  4HVN A;  3SED A;  1LXE A;  4MMZ B;  1VQ8 3;  4MMY B;  3DGM A;  3PCS A;  1LVN A;  4ORL A;  3NXJ A;  4R4K A;  5KP1 A;  1ZX2 A;  4WWU C;  3PXM A;  3NV0 B;  4N3V A;  3NV0 A;  2MC8 A;  3LTC A;  1NB5 I;  2PNC A;  3QK9 A;  4KFF A;  3EHC A;  3SVA A;  3X3X A;  3WA2 X;  3N8B A;  2WGO A;  1O7G B;  2CFD A;  3MSO A;  4XB5 A;  3BNC A;  1M90 4;  3CC7 3;  1K9M 4;  2W0Q A;  1OPY A;  5FW5 A;  1Q86 4;  3G8Z A;  2UX0 A;  3OXA A;  3CNX A;  3MPH A;  2GXF A;  2P05 A;  1WNH A;  3F7S A;  2LYX A;  1Q40 A;  2YFL B;  3ECF A;  1YGE A;  1KD1 4;  3CMA 3;  1IK3 A;  4JF8 A;  1KWI A;  1KC8 4;  4N6U A;  2ZL8 A;  3DMC A;  5CF1 A;  5LC7 A;  5AEW B;  4R1K A;  2W03 A;  5D83 A;  1D6Z A;  3WDG B;  1W01 A;  2ZDJ A;  1IVU A;  4HBR A;  3HK4 A;  3EN8 A;  3LZA A;  5DRV A;  3CXC 2;  1Q82 4;  2W04 A;  3GZX B;  1GY6 A;  1OHO A;  3KSP A;  3LXU X;  1JB2 A;  5IER A;  2BMR B;  3T8U A;  3UL6 A;  3WOF B;  5AEU B;  4CDL A;  1VZZ A;  2HMJ B;  1U5O A;  5AII A;  4FCJ A;  1VQM 3;  1JRQ A;  1D6Y A;  2D1W A;  3NQY A;  4KFD A;  3MWZ A;  1CYU A;  1IQX A;  1IQY A;  1OF5 B;  1AV4 A;  1ULI B;  3CC4 3;  3JUQ A;  4K1V A;  5EVH A;  2P09 A;  3NM7 A;  4HM4 B;  5IEP A;  1OGX A;  3VF1 A;  2QGU A;  4HM7 B;  1OHS A;  1W00 A;  5JPP A;  2K0M A;  4O2H A;  1O7M B;  2W56 B;  3B4O A;  3T0U A;  4FCM A;  3K0Z A;  3GZR A;  5ELU A;  2GEX A;  2F99 A;  1JN5 B;  1N9E A;  3PYJ A;  4G1M B;  2FNQ A;  3NM2 A;  3OWU A;  2IUJ A;  1J2B A;  1TU5 A;  1MOL A;  3ALA A;  4OUQ A;  1RKY A;  1GY5 A;  3FF0 A;  2IMJ A;  3K7C A;  2XRX B;  3O8Y A;  1O7H B;  3NX0 A;  1IQ8 A;  1K41 A;  3BNE A;  3HZP A;  1VQL 3;  1C7H A;  2M7O A;  5D81 A;  1ISK A;  2KRT A;  1Q81 4;  2XGL A;  1DMQ A;  8CHO A;  4GL6 A;  3F40 A;  1W2B 2;  4FMB A;  4HM8 B;  3EC9 A;  2IUK A;  3GRD A;  1EQK A;  1YVB I;  2Q07 A;  5EEO A;  3U97 A;  4N6N B;  3MKI A;  3F7X A;  2P0M A;  4FMA A;  2CH9 A;  1JN5 A;  4MJD A;  3H3H A;  3OWS A;  2JDI H;  1CYV A;  5A0O B;  1T5Y A;  2W9P A;  3FH1 A;  1E3V A;  5KP3 A;  3SXX A;  3CCR 3;  1EG9 B;  2W2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...