1EG9B

Naphthalene 1,2-dioxygenase with indole bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PROTEIN (NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT)
publication title Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eg9B00
4K1UA 3FF0A 3K0ZA 1OF5B 5CK6A 1JKGA 1NDOB 1NU3A 5D81A 3UNLA 4HM6B 3I0YA 4XBYA 2HMOB 4U13A 1JN5B 4CDLA 3EHCA 1E3RA 4HM5B 1SJWA 3GZBA 3SOAA 4HKVB 1S5AA 5IG4A 4XBXA 1HKXA 5JPPA 3ER7A 3EBYA 2JQ5A 2GBWB 1Z1SA 3NHXA 2XSHB 1W00A 2XR8B 3B7CA 3F7XA 3B4PA 2STDA 4KVHA 3RGAA 1W02A 3OXAA 3F8XA 3BLZA 3OX9A 2R4IA 3NV0B 5AIIA 4HM3B 3KZTA 3CU3A 5D83A 3NBRA 4X2HA 4XB5A 3GWRA 2K54A 3SOYA 5HGRA 1E3VA 5IF6A 2CKFB 3JUNA 3SEDA 3F7SA 2RGQA 5IEPA 4J8TA 3E99A 5AIHA 3STDA 3F14A 4HVNA 4XDVA 3OWUA 3VSYA 3MG3A 5AEWB 5JPUA 2OWPA 1JB4A 4HM2B 3F8HA 4LEHA 4XBTA 3MKIA 1O7GB 1GS3A 3G16A 3S5CA 3A76A 1GY6A 3ROBA 1OGZA 3D9RA 2HMMB 2W2CA 5IENA 1Q42A 1WQLB 2GXFA 3B8LA 3JUOA 1W6YA 2GBXB 3OV4A 3K7CA 1Q40B 4HZ9B 3LZAA 5STDA 4R9KA 1DMMA 1BUQA 2BMQB 3JUQA 4WWUC 5EVHA 1STDA 3FLJA 2Z7AA 1OF5A 3DZLA 2GEXA 2Z76A 2XRXB 4X2OA 3FF2A 3DMCA 3GZRA 4R1KA 1OHOA 2HMKB 8CHOA 3Q90A 3UJMA 2BNGA 3KE7A 5BXQA 1JN5A 3G8ZA 2XSOB 1OPYA 3DUKA 1UUWB 3HK4A 2YFIB 3FSDA 5TGNA 4K1VA 5KP4A 5CF1A 4IIAA 4J9AA 1UUVB 3T8UA 4I4KA 1EG9B 4LGQA 2RFRA 5DREA 1ZX2A 1QMAA 4PEJA 2CHCA 1O7WB 1AR0A 1EA2A 4WYKA 6STDA 4HM4B 2PZVA 1GY5A 2F86B 3RGRA 1K41A 4LMIA 1QJGA 3NV0A 3DXOA 1ASKA 3HX8A 1OHSA 5DRVA 1JKGB 2F98A 5AIFA 3JUPA 5G2GA 3JUMA 4OVMA 1OUNA 3KKGA 4HZBB 2QGUA 2I9WA 4XM4A 3EBTA 4MJDA 3NUVA 1GY7A 4ORLA 3F9SA 3H3HA 3EX9A 3MG1A 5CLKA 2RCDA 4Q53A 1E97A 5KP3A 3ECFA 5BVBA 1NWWA 5IERA 3DM8A 2UX0A 3NXJA 2A15A 2YFJB 4FCJA 3OWSA 5IEOA 5FW5A 3NM2A 3CNMA 1OHPA 3G0KA 5AEUB 2BMOB 3CNXA 3FZWA 3MYTA 2Z77A 3GRDA 1OGXA 3HZPA 3MSOA 3GZYB 5KP1A 3FGYA 4FCMA 1ZO2A 2IMJA 3MHEA 4OUQA 4L7KA 1OCVA 5IG5A 1OH0A 2B1XB 3EQQB 1IDPA 4L8OA 3WMDA 5CF2A 5AI1A 1O7MB 4R9LA 3EC9A 7STDA 2F99A 4STDA 1O7PB 3EN8A 1Q40A 3EJVA 1ULIB 3BB9A 5CXOA 5IG3A 3GZXB 2HMLB 1TP6A 4WYKB 4HM0B 3VGNA 2HMNB 5AIGA 2QIYA 3MG2A 4H3UA 1TUHA 3IPTA 3FH1A 1JB2A 2INXA 3H51A 1VZZA 4WP5A 1W01A 1DMNA 3M8CA 3B4OA 3T8NA 2BMRB 5IG0A 3EN1B 4L8PA 5D82A 2B24B 4HM7B 2YFLB 1ULJB 4N3VA 3LYGA 3EF8A 3KSPA 4HM8B 1JB5A 3F40A 3CPOA 3FKAA 1CQSA 2GEYA 1GYBA 1DMQA 4RZMA 1O7HB 1U5OA 1ISKA 4XDWA 4HM1B 1O7NB 4GB5A 1C7HA 2HMJB 1A2KA 3OWYA 4HJLB
chains in the Genus database with same CATH superfamily
1W5ZA 1M1K4 1QAKA 1SIIA 4K1UA 1GOUA 1T2IA 2BU4A 1GOVA 3FF0A 3K0ZA 3URPA 3DGNA 3LXUX 1I3IA 2P05A 3TDGA 3AGNA 1OF5B 1N5PA 1OACA 2OTL3 3NX0A 5CK6A 1JKGA 4LZIA 1NDOB 1NU3A 1BUJA 5D81A 1JZDA 3UNLA 1Q7HA 1BNIA 4HM6B 1RTUA 4AEQA 1IVUA 4BTYA 3RNTA 1RDSA 3N54B 4FCZA 3K63A 3CCU3 2UGIA 3I0YA 4N6TA 4XBYA 3S27A 2HMOB 3GSPA 4U13A 1JN5B 2C11A 4CDLA 3EHCA 1E3RA 4HM5B 3V98A 1SJWA 3GZBA 3SOAA 3DGOA 4HKVB 1AVKA 1S5AA 3AGOA 5A0OB 5IW9A 5IG4A 4IT7A 2W9QA 1HKXA 1T2HA 4XBXA 5M1AA 4BU4A 1MOLA 4EYCA 5JPPA 3ER7A 1U8CB 3EBYA 4N6MA 2JQ5A 1KWIA 2CFKA 9RNTA 1MGWA 4EC6A 1X1UA 3UL6A 3V99A 2GBWB 1AV4A 1G02A 1Z1SA 3PGBA 4NREA 5ELUA 4N6UA 1FYSA 5RNTA 3KSED 1GMQA 3NHXA 3WA3A 2XSHB 1GD3A 3WOFB 2CG0A 3J7Yd 1W00A 2IUJA 1BRNL 2XR8B 1RN4A 1D6ZA 2H0GA 4GL6A 1N8R4 3G6E3 2W03A 2OQEC 3B7CA 1YVSA 3LTDA 3F7XA 3B4PA 1Q9EA 4J5KA 1CH0A 2STDA 4KVHA 3I563 3RGAA 1US1A 1W02A 2E2UA 3OXAA 1YIJ3 2GU1A 1VQ43 4J5GA 5ELJA 1IVWA 1LNHA 4AKZA 3F8XA 4BTWA 1Q7Y4 1MGRA 1UW1A 3BLZA 1ZS7A 4NPBA 1FA3A 3OX9A 1A67A 1S723 4RNTA 1Y4KA 2D42A 2R4IA 1LQGC 2K0MA 3NV0B 5AIIA 3WA2X 1K9M4 1JBSA 4G1MB 1C54A 4HM3B 3KZTA 8RNTA 3CU3A 3JVCA 5D83A 3S29A 3LOYA 3NBRA 4FR9A 4X2HA 4BTXA 3DGYA 2RSXA 1B2MA 3CME3 4XB5A 3GWRA 2QA43 2L4VA 1SIHA 2K54A 1BNRA 1IV7A 1LOYA 4KFEA 1IT8A 3SOYA 1BRKA 5HGRA 1VQ73 2F56A 4FMBA 6RNTA 2UUGC 3D5GA 1E3VA 1BRHA 2IY2A 1TFKA 1IQ8A 5IF6A 3AMOB 1X1WA 4ZM8A 2CKFB 3JUNA 4BL3A 1B27A 2XFSA 1GOYA 4EW5A 1AQZA 3SEDA 4CJNA 3F7SA 2E2VA 1SARA 1RN1A 1KQS2 2IYJA 2RGQA 1RMSA 1W6CA 2CX0A 2ZDJA 2ZHXB 3BIRA 5AYSC 3LT9A 5IEPA 3NBJA 3QRDA 4J8TA 3E99A 1X1XA 3KFQC 5AIHA 3ALAA 3STDA 3F14A 4HVNA 3LT8A 4XDVA 1B2XA 1RCLA 3IMAB 3IJEB 3OWUA 3VSYA 3LTBA 3X3ZA 4MMXB 3MG3A 5AEWB 1MNLA 2GSPA 2HOHA 5JPUA 3WDGB 2XF3A 2OWPA 4RNZA 1N9EA 2P38A 1N9JA 1JB4A 4FMCA 1CEWI 6GSPA 5JBSA 2KF6A 4HM2B 1RGHA 3F8HA 2XH9A 4LEHA 4LSOA 1RGKA 2KXGA 3GAXA 3DGMA 3HIGA 2OOVA 3UL5A 1MWSA 3X3YA 5I97A 4XBTA 2W6JH 3MKIA 1TIJA 1FW7A 1O7GB 1D6YA 1GS3A 1BRIA 2CC3A 3G16A 1UCKA 3S5CA 1ROAA 1FUTA 3A76A 1IVXA 1GY6A 2P09A 3ROBA 1VQM3 1EQKA 1OGZA 2ZA4A 3D9RA 2HMMB 2KRTA 2OCTA 1WMOA 1FGMA 3CCR3 2W2CA 1YGWA 1RGLA 3S67A 5IENA 1Q42A 2R41A 1WQLB 2D1WA 2ZL8A 2GXFA 1AVLA 1R4YA 4N6LA 2CFLA 1UDII 3B8LA 2RBIA 1PU4A 3JUOA 2CX1A 1JZOA 1KC84 2CWTA 1W6YA 2GBXB 1BSCA 3OV4A 3K7CA 1Q40B 4HZ9B 3LZAA 1RN7A 1LXEA 2Q07A 1FGTA 2CWUA 3HOHA 4R9KA 5STDA 1UCLA 2AAEA 1DMMA 2LYXA 1RHLA 4LYLB 3T0UA 1BUQA 2BMQB 3JUQA 3SX1A 3KIIA 4WWUC 5EVHA 1STDA 3FLJA 1IQXA 3EE1A 3PCRA 3BNBA 2Z7AA 1HU9A 1B2UA 3WOEB 1OF5A 1RGFA 1BNFA 1L5GB 3DZLA 1PYLA 4RBNA 2GEXA 1NB5I 1JV2B 2Z76A 2XRXB 4X2OA 3FF2A 5G1KA 1X1YA 3DMCA 3CCL3 3GZRA 1QVG2 2O9UX 4R1KA 1OHOA 2PNCA 2HMKB 8CHOA 3CXC2 1VQQA 3Q90A 1FUWA 1K734 1I2FA 3PXMA 3UJMA 3CC23 2BNGA 3KE7A 3Q3FA 1RGCA 2W56B 3NBBA 5BXQA 1JN5A 5BIRA 3G8ZA 2XSOB 2CFDA 1OPYA 3LH4A 3DUKA 1UUWB 1G96A 4K61A 5HOHA 1B3SA 1NNVA 3CCQ3 3HK4A 2YFIB 3FSDA 2RNTA 4AKYA 5TGNA 3A5EA 3SYUA 3Q1CA 1IVVA 4K1VA 5KP4A 5CF1A 3L0RA 2WGOA 4IIAA 4IPBA 1A90A 1A2VA 1BSDA 4J9AA 1WTHA 1LRAA 1J2BA 1I2GA 1ROVA 1UUVB 1UGIA 2CIUA 1V74A 2F4YA 1BSAA 2Y73A 1EG9B 3NQZA 4I4KA 2M7OA 4LGQA 3LTCA 1I0VA 2RFRA 5DREA 2L1SA 1BNGA 1F8NA 1ZX2A 1QMAA 4PEJA 2CHCA 3WHOA 1DE3A 3CC73 1JNQA 3D79A 1O7WB 2XFTA 3CCE3 3LMLA 1FGRA 1AR0A 1EA2A 3X42A 3AHSA 2FGTA 3PZWA 1Q814 1BSBA 4WYKA 4HOHA 6STDA 1SQWA 1YHQ3 1I8VA 3FG4A 1RCKA 3NM7A 3BNCA 1ZGXA 1R4CA 4HYZA 1FZUA 1NO3A 1I2EA 1LOVA 1UCJA 5LC7A 3CCM3 1N5HA 1RRLA 1BAOA 4HM4B 1B2ZA 1YJN3 1CYUA 1BRSA 2F5WA 2PZVA 1GY5A 2F86B 3U97A 1RNTA 1TU5A 3RGRA 1K41A 3N8BA 3CD63 4LMIA 2BHMA 1VQP3 2OOVC 1QJGA 1I0XA 3T8UA 3CMA3 4GHOA 4RNYA 3NV0A 3DXOA 2SARA 4WHAA 1M904 4MMYB 1ASKA 2FNQA 3HX8A 4QWTA 2P0XA 1Q864 1OHSA 1VQ53 3X40A 5M19A 4HBRA 3VF1A 1RKYA 1EEJA 5DRVA 3V92A 2SBLA 1JKGB 2F98A 5AIFA 3JUPA 5G2GA 3JUMA 1RGEA 3BU4A 4CCVA 4OVMA 1OUNA 1STFI 3KKGA 4HZBB 1TJDA 1YGEA 2QGUA 3QK9A 2I9WA 4I5QA 4XM4A 4N6V0 3EBTA 4MJDA 1PY3A 3NUVA 1TRPA 1GY7A 3CCJ3 1VQ83 1KSIA 1UCIA 3AMOA 4N6OB 4ORLA 3F9SA 1BOXA 3H3HA 2W9PA 1W2B2 3EX9A 4EBGA 1TTOA 2H0HA 5LC6A 3CPW2 1BNEA 3MG1A 4GSPA 1WNHA 3ZG0A 1VQK3 5CLKA 1NJI4 2RCDA 4Q53A 2CWVA 1VQL3 1BSEA 1E97A 2GU3A 5KP3A 1YNVX 2E2TA 1BNSA 3ECFA 5GSPA 5BVBA 1NWWA 4FMAA 5IERA 2QEX3 3DM8A 2UX0A 3FG3A 3NXJA 4O8SA 3DH2A 1VQ93 2FXTA 3DY5A 2A15A 2YFJB 1MWRA 1I70A 2WO0A 3D3LA 3DGLA 3OWSA 4FCJA 5IEOA 3ZG5A 3G4S3 1LQMB 5AYRB 4O3VA 5FGOA 1BRJA 2ML5A 4HAAA 4MMZB 1SPUA 1T5YA 3K9MC 2BIRA 1VQO3 1IT7A 5FW5A 1W7CA 2W04A 3NM2A 3CNMA 1OHPA 3G0KA 1MWTA 3SXXA 1IU7A 5AEUB 3MPHA 2BMOB 3CNXA 3FZWA 3O8YA 3MYTA 2CFGA 1IV9A 5BU4A 2Z77A 1RLSA 4KFFA 3GRDA 4EXRA 1OGXA 1IK3A 3NQYA 3HI7A 3HZPA 3MSOA 3CCV3 3GZYB 5KP1A 2XGLA 3FGYA 1LOXA 1LVNA 2XEPA 4JF8A 3PYJA 4FCMA 1ZO2A 2IMJA 3MHEA 4OUQA 3EB8A 1RRHA 7RNTA 3PS8A 4L7KA 5M18A 1RNBA 1JBRA 1OCVA 3FG1A 5IG5A 1OH0A 2B1XB 3EQQB 1RSNA 3KCHA 1IDPA 4ILFA 4L8OA 2OTJ3 1Q824 1UI8A 1NB3I 1TRQA 2C4BA 1BVIA 2J8XB 3WMDA 1RJOA 5CF2A 1IQYA 1O7MB 5AI1A 1UGHI 4R9LA 3D5IA 2LQVA 3EC9A 2CG1A 7STDA 1VQ63 1B20A 2MF7A 4KT3B 2F99A 4STDA 3OW22 3K5TA 2H0IA 1O7PB 2WOHA 4R80A 3EN8A 1Q40A 1WMNA 3EJVA 1ULIB 2IUKA 3BB9A 5CXOA 3WODG 2KF5A 4KZ1A 4TX4A 3CC43 3SLUA 1GSPA 1VQN3 4MEIA 5IG3A 2W0QA 1G0TA 3GZXB 1HZ1A 4BL2A 1LOWA 1A2PA 1FGOA 2HMLB 2KF4A 1TP6A 2Y74A 2KCDA 1TFOA 4WYKB 1B21A 1DVDA 4H61A 1MWUA 2Z6BA 2WGQA 4JRFA 4HM0B 3VGNA 2HMNB 5AIGA 2QIYA 2YX9A 3MG2A 2CH9A 1UUGB 4H3UA 1GD4A 1RGAA 1TUHA 3IPTA 3N9HA 3PCSA 3FH1A 1K8A4 7GSPA 1JB2A 2INXA 3H51A 4O02B 1JRQA 1EUIC 1M9GA 3HIIA 3MWZA 2BT3A 1VZZA 4NHFA 3Q2PA 4KFDA 4WP5A 1LNIA 2W56A 3X41A 4R4KA 1AY7A 4EV5A 1DVCA 1QALA 3BNEA 1W01A 1RGGA 4FMDA 1DMNA 3M8CA 4N6NB 5EQLA 2V1LA 1BIRA 2OQEA 1YJW3 1A2KA 3B4OA 3S28A 1BANA 1I3FA 2JDIH 2BO9B 3T8NA 4K90B 1W2ZA 2BMRB 1V57A 3EN1B 1B2SA 4L8PA 4OK0A 5IG0A 5D82A 1BGSA 2B24B 2CW9A 1DETA 3D4AA 4HM7B 1K28A 5EEOA 2WOFA 2YFLB 5G1LA 4CPKA 1ULJB 1W4NA 4N3VA 1FGQA 1YJ93 2F5MA 2MC8A 1YIT3 3LYGA 3FCSB 3EF8A 3KSPA 3SVAA 1YI23 4WFOA 2XGNA 3I553 2C10A 4HM8B 1JB5A 1DYUA 1EKMA 1BNJA 2ML6A 3F40A 2KF3A 3LTAA 3CPOA 1GMRA 2KAAA 1IYYA 1WMPA 3U1WA 3FKAA 1N8QA 1W6GA 1CQSA 3WR2A 4EV2A 2AADA 1M1XB 2K3DA 1HYFA 2GEYA 1GYBA 1CYVA 1DMQA 3AHWA 3UB1A 4RZMA 1BRGA 3X3XA 1JBTA 1YVBI 1D6UA 1O7HB 1U5OA 1ISKA 2CK3H 1BU4A 4O2HA 2CFWA 1V58A 2O3OA 4XDWA 1T3BA 1PFPA 2IA7A 3BNDA 3ZFZA 2P0MA 4HM1B 3KN4A 3RDEA 1QAFA 3CCS3 4BIRA 4DKIA 1FUSA 1JJ22 1KD14 1O7NB 4GB5A 1C7HA 2HMJB 1GMPA 1QVF2 1UI7A 3OWYA 3G713 4HJLB
chains in the Genus database with same CATH topology
1W5ZA 1M1K4 1QAKA 1SIIA 4K1UA 3FF0A 3K0ZA 3DGNA 3LXUX 2P05A 3TDGA 1OF5B 1N5PA 1OACA 2OTL3 3NX0A 5CK6A 1JKGA 4LZIA 1NDOB 1NU3A 5D81A 3UNLA 4HM6B 4AEQA 1IVUA 4BTYA 3N54B 4FCZA 3K63A 3I0YA 4N6TA 4XBYA 3S27A 2HMOB 4U13A 1JN5B 2C11A 4CDLA 3EHCA 1E3RA 4HM5B 3V98A 1SJWA 3GZBA 3SOAA 3DGOA 4HKVB 1AVKA 1S5AA 5A0OB 5IW9A 5IG4A 4IT7A 2W9QA 1HKXA 4XBXA 1YI23 1MOLA 4EYCA 5JPPA 3ER7A 1U8CB 3EBYA 4N6MA 2JQ5A 1KWIA 2CFKA 4EC6A 3UL6A 3V99A 2GBWB 1AV4A 5ELUA 1Z1SA 3PGBA 4NREA 4N6UA 3KSED 3NHXA 3WA3A 2XSHB 1GD3A 3WOFB 2CG0A 3J7Yd 1W00A 2IUJA 2XR8B 1D6ZA 4GL6A 1N8R4 3G6E3 2W03A 2OQEC 3B7CA 3LTDA 3F7XA 3B4PA 2STDA 4KVHA 3I563 3RGAA 1US1A 1W02A 2E2UA 3OXAA 1YIJ3 2GU1A 1VQ43 5ELJA 1IVWA 1LNHA 4AKZA 3F8XA 4BTWA 1Q7Y4 1UW1A 3BLZA 1FA3A 3OX9A 1A67A 1S723 1Y4KA 2D42A 2R4IA 3NV0B 2K0MA 5AIIA 3WA2X 1K9M4 4G1MB 4HM3B 3KZTA 3CU3A 3JVCA 5D83A 3S29A 3LOYA 3NBRA 4FR9A 4X2HA 4BTXA 2RSXA 3CME3 4XB5A 3GWRA 2QA43 2L4VA 1SIHA 2K54A 1IV7A 4KFEA 1IT8A 3SOYA 5HGRA 1VQ73 4FMBA 1E3VA 1TFKA 1IQ8A 5IF6A 3AMOB 4ZM8A 2CKFB 3JUNA 2XFSA 3SEDA 3F7SA 2E2VA 1KQS2 2RGQA 5AYSC 1W6CA 2ZDJA 3LT9A 5IEPA 3NBJA 3QRDA 4J8TA 3E99A 3KFQC 5AIHA 3ALAA 3STDA 3F14A 4HVNA 3LT8A 4XDVA 3IMAB 3IJEB 3OWUA 3VSYA 3LTBA 3X3ZA 4MMXB 3MG3A 5AEWB 1MNLA 5JPUA 3WDGB 2XF3A 2OWPA 4RNZA 1N9EA 2P38A 1N9JA 1JB4A 4FMCA 1CEWI 5JBSA 4HM2B 3F8HA 2XH9A 4LEHA 4LSOA 3GAXA 2KXGA 3HIGA 3DGMA 2OOVA 3UL5A 3X3YA 5I97A 4XBTA 2W6JH 3MKIA 1TIJA 1O7GB 1D6YA 1GS3A 2CC3A 3G16A 3S5CA 1ROAA 3A76A 1IVXA 1GY6A 2P09A 3ROBA 1VQM3 1EQKA 1OGZA 3D9RA 2HMMB 2KRTA 2OCTA 1WMOA 1FGMA 3CCR3 2W2CA 5IENA 3S67A 1Q42A 1WQLB 2D1WA 2ZL8A 2GXFA 1AVLA 4N6LA 2CFLA 3B8LA 1PU4A 3JUOA 1KC84 2CWTA 1W6YA 2GBXB 3OV4A 3K7CA 1Q40B 4HZ9B 3LZAA 1RN7A 1LXEA 2Q07A 1FGTA 2CWUA 4R9KA 5STDA 1DMMA 2LYXA 1BUQA 3T0UA 2BMQB 3JUQA 3SX1A 3KIIA 4WWUC 5EVHA 1STDA 3FLJA 1IQXA 3EE1A 3PCRA 3BNBA 2Z7AA 1HU9A 3WOEB 1OF5A 1L5GB 3DZLA 4RBNA 2GEXA 1NB5I 1JV2B 2Z76A 2XRXB 4X2OA 3FF2A 3CCL3 3DMCA 3GZRA 1QVG2 2O9UX 4R1KA 1OHOA 2PNCA 2HMKB 8CHOA 3CXC2 3Q90A 1FUWA 1K734 3PXMA 3UJMA 3CC23 2BNGA 3KE7A 2W56B 3NBBA 5BXQA 1JN5A 3G8ZA 2XSOB 2CFDA 1OPYA 3LH4A 3DUKA 1UUWB 1G96A 4K61A 3CCQ3 3HK4A 2YFIB 3FSDA 4AKYA 5TGNA 3Q1CA 1IVVA 4K1VA 5KP4A 5CF1A 3L0RA 2WGOA 4IIAA 4IPBA 1A90A 1A2VA 4J9AA 1WTHA 1J2BA 1UUVB 1ROVA 2CIUA 3NQZA 3T8UA 1V74A 2Y73A 1EG9B 4I4KA 2M7OA 4LGQA 3LTCA 2RFRA 5DREA 1F8NA 1ZX2A 1QMAA 4PEJA 2CHCA 3CC73 1JNQA 1O7WB 2XFTA 3CCE3 3LMLA 1FGRA 1AR0A 1EA2A 3X42A 2FGTA 3PZWA 1Q814 4WYKA 6STDA 1SQWA 3FG4A 3NM7A 3BNCA 1R4CA 4HYZA 1NO3A 5LC7A 3CCM3 1N5HA 1RRLA 4HM4B 1YJN3 1CYUA 2PZVA 3U97A 1GY5A 2F86B 1TU5A 3RGRA 1K41A 3N8BA 3CD63 4LMIA 2BHMA 1VQP3 2OOVC 1QJGA 3CMA3 4RNYA 3NV0A 3DXOA 4WHAA 1M904 4MMYB 1ASKA 2FNQA 3HX8A 4QWTA 2P0XA 1Q864 1OHSA 1VQ53 3X40A 4HBRA 3VF1A 1RKYA 3V92A 5DRVA 2SBLA 1JKGB 2F98A 5AIFA 3JUPA 5G2GA 3JUMA 4CCVA 4OVMA 1OUNA 1STFI 3KKGA 4HZBB 1YGEA 2QGUA 3QK9A 2I9WA 4XM4A 4N6V0 3EBTA 4MJDA 3CCJ3 3NUVA 1GY7A 1VQ83 1KSIA 3AMOA 4N6OB 4ORLA 3F9SA 1W2B2 3H3HA 2W9PA 3EX9A 4EBGA 5LC6A 3CPW2 3MG1A 1VQK3 1WNHA 5CLKA 1NJI4 2RCDA 4Q53A 2CWVA 1VQL3 1E97A 2GU3A 5KP3A 2E2TA 3ECFA 5BVBA 1NWWA 4FMAA 5IERA 2QEX3 3DM8A 2UX0A 3FG3A 3NXJA 4O8SA 1VQ93 2FXTA 3DY5A 2A15A 2YFJB 3D3LA 3DGLA 2WO0A 3OWSA 4FCJA 3G4S3 5IEOA 5AYRB 4O3VA 5FGOA 2ML5A 4MMZB 1SPUA 1T5YA 3K9MC 1VQO3 1IT7A 5FW5A 1W7CA 2W04A 3NM2A 3CNMA 1OHPA 3G0KA 3SXXA 1IU7A 5AEUB 3MPHA 2BMOB 3CNXA 3FZWA 3O8YA 3MYTA 2CFGA 1IV9A 2Z77A 4KFFA 3GRDA 4EXRA 1OGXA 1IK3A 3NQYA 3HI7A 3HZPA 3MSOA 3CCV3 3GZYB 5KP1A 2XGLA 3FGYA 2XEPA 1LOXA 1LVNA 4JF8A 3PYJA 4FCMA 1ZO2A 2IMJA 3MHEA 4OUQA 3EB8A 1RRHA 3PS8A 4L7KA 1OCVA 3FG1A 5IG5A 1OH0A 2B1XB 3EQQB 1IDPA 4L8OA 2OTJ3 1Q824 1UI8A 1NB3I 3WMDA 1RJOA 5CF2A 1IQYA 1O7MB 5AI1A 4R9LA 3EC9A 2LQVA 1VQ63 2CG1A 7STDA 2MF7A 2F99A 4STDA 3OW22 3K5TA 1O7PB 2WOHA 4R80A 3EN8A 1Q40A 1WMNA 3EJVA 1ULIB 2IUKA 3BB9A 5CXOA 3WODG 4KZ1A 4TX4A 3CC43 3SLUA 1VQN3 4MEIA 5IG3A 2W0QA 3GZXB 2HMLB 1FGOA 2Y74A 1TP6A 2KCDA 1TFOA 4WYKB 1DVDA 4H61A 2Z6BA 2WGQA 4JRFA 4HM0B 3VGNA 2HMNB 5AIGA 2QIYA 2YX9A 3MG2A 2CH9A 4H3UA 1GD4A 1TUHA 3IPTA 3N9HA 3PCSA 3FH1A 1K8A4 1JB2A 2INXA 3H51A 4O02B 1JRQA 1M9GA 3HIIA 3MWZA 2BT3A 1VZZA 4NHFA 3Q2PA 4KFDA 4WP5A 2W56A 3X41A 4R4KA 4EV5A 1DVCA 1QALA 3BNEA 1W01A 4FMDA 2OQEA 1DMNA 3M8CA 4N6NB 5EQLA 2V1LA 1YJW3 1A2KA 3B4OA 3S28A 2JDIH 2BO9B 3T8NA 4K90B 1W2ZA 2BMRB 5IG0A 3EN1B 4L8PA 4OK0A 5D82A 2B24B 2CW9A 4HM7B 1K28A 5EEOA 2WOFA 2YFLB 1ULJB 1W4NA 4N3VA 1FGQA 1YJ93 2MC8A 1YIT3 3LYGA 3FCSB 3EF8A 3KSPA 3SVAA 4WFOA 2XGNA 3I553 2C10A 4HM8B 1JB5A 1DYUA 1EKMA 2ML6A 3F40A 3LTAA 3CPOA 1WMPA 3U1WA 3FKAA 1N8QA 1W6GA 1CQSA 4EV2A 1M1XB 3CCU3 2GEYA 3UB1A 1GYBA 1CYVA 1DMQA 1YHQ3 3X3XA 4RZMA 1YVBI 1D6UA 1O7HB 1U5OA 1ISKA 2CK3H 4O2HA 2CFWA 2O3OA 4XDWA 1PFPA 2IA7A 3BNDA 2P0MA 4HM1B 3KN4A 3RDEA 1QAFA 3CCS3 1JJ22 1KD14 1O7NB 4GB5A 1C7HA 2HMJB 1QVF2 1UI7A 3OWYA 3G713 4HJLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1U A;  3FF0 A;  3K0Z A;  1OF5 B;  5CK6 A;  1JKG A;  1NDO B;  1NU3 A;  5D81 A;  3UNL A;  4HM6 B;  3I0Y A;  4XBY A;  2HMO B;  4U13 A;  1JN5 B;  4CDL A;  3EHC A;  1E3R A;  4HM5 B;  1SJW A;  3GZB A;  3SOA A;  4HKV B;  1S5A A;  5IG4 A;  4XBX A;  1HKX A;  5JPP A;  3ER7 A;  3EBY A;  2JQ5 A;  2GBW B;  1Z1S A;  3NHX A;  2XSH B;  1W00 A;  2XR8 B;  3B7C A;  3F7X A;  3B4P A;  2STD A;  4KVH A;  3RGA A;  1W02 A;  3OXA A;  3F8X A;  3BLZ A;  3OX9 A;  2R4I A;  3NV0 B;  5AII A;  4HM3 B;  3KZT A;  3CU3 A;  5D83 A;  3NBR A;  4X2H A;  4XB5 A;  3GWR A;  2K54 A;  3SOY A;  5HGR A;  1E3V A;  5IF6 A;  2CKF B;  3JUN A;  3SED A;  3F7S A;  2RGQ A;  5IEP A;  4J8T A;  3E99 A;  5AIH A;  3STD A;  3F14 A;  4HVN A;  4XDV A;  3OWU A;  3VSY A;  3MG3 A;  5AEW B;  5JPU A;  2OWP A;  1JB4 A;  4HM2 B;  3F8H A;  4LEH A;  4XBT A;  3MKI A;  1O7G B;  1GS3 A;  3G16 A;  3S5C A;  3A76 A;  1GY6 A;  3ROB A;  1OGZ A;  3D9R A;  2HMM B;  2W2C A;  5IEN A;  1Q42 A;  1WQL B;  2GXF A;  3B8L A;  3JUO A;  1W6Y A;  2GBX B;  3OV4 A;  3K7C A;  1Q40 B;  4HZ9 B;  3LZA A;  5STD A;  4R9K A;  1DMM A;  1BUQ A;  2BMQ B;  3JUQ A;  4WWU C;  5EVH A;  1STD A;  3FLJ A;  2Z7A A;  1OF5 A;  3DZL A;  2GEX A;  2Z76 A;  2XRX B;  4X2O A;  3FF2 A;  3DMC A;  3GZR A;  4R1K A;  1OHO A;  2HMK B;  8CHO A;  3Q90 A;  3UJM A;  2BNG A;  3KE7 A;  5BXQ A;  1JN5 A;  3G8Z A;  2XSO B;  1OPY A;  3DUK A;  1UUW B;  3HK4 A;  2YFI B;  3FSD A;  5TGN A;  4K1V A;  5KP4 A;  5CF1 A;  4IIA A;  4J9A A;  1UUV B;  3T8U A;  4I4K A;  1EG9 B;  4LGQ A;  2RFR A;  5DRE A;  1ZX2 A;  1QMA A;  4PEJ A;  2CHC A;  1O7W B;  1AR0 A;  1EA2 A;  4WYK A;  6STD A;  4HM4 B;  2PZV A;  1GY5 A;  2F86 B;  3RGR A;  1K41 A;  4LMI A;  1QJG A;  3NV0 A;  3DXO A;  1ASK A;  3HX8 A;  1OHS A;  5DRV A;  1JKG B;  2F98 A;  5AIF A;  3JUP A;  5G2G A;  3JUM A;  4OVM A;  1OUN A;  3KKG A;  4HZB B;  2QGU A;  2I9W A;  4XM4 A;  3EBT A;  4MJD A;  3NUV A;  1GY7 A;  4ORL A;  3F9S A;  3H3H A;  3EX9 A;  3MG1 A;  5CLK A;  2RCD A;  4Q53 A;  1E97 A;  5KP3 A;  3ECF A;  5BVB A;  1NWW A;  5IER A;  3DM8 A;  2UX0 A;  3NXJ A;  2A15 A;  2YFJ B;  4FCJ A;  3OWS A;  5IEO A;  5FW5 A;  3NM2 A;  3CNM A;  1OHP A;  3G0K A;  5AEU B;  2BMO B;  3CNX A;  3FZW A;  3MYT A;  2Z77 A;  3GRD A;  1OGX A;  3HZP A;  3MSO A;  3GZY B;  5KP1 A;  3FGY A;  4FCM A;  1ZO2 A;  2IMJ A;  3MHE A;  4OUQ A;  4L7K A;  1OCV A;  5IG5 A;  1OH0 A;  2B1X B;  3EQQ B;  1IDP A;  4L8O A;  3WMD A;  5CF2 A;  5AI1 A;  1O7M B;  4R9L A;  3EC9 A;  7STD A;  2F99 A;  4STD A;  1O7P B;  3EN8 A;  1Q40 A;  3EJV A;  1ULI B;  3BB9 A;  5CXO A;  5IG3 A;  3GZX B;  2HML B;  1TP6 A;  4WYK B;  4HM0 B;  3VGN A;  2HMN B;  5AIG A;  2QIY A;  3MG2 A;  4H3U A;  1TUH A;  3IPT A;  3FH1 A;  1JB2 A;  2INX A;  3H51 A;  1VZZ A;  4WP5 A;  1W01 A;  1DMN A;  3M8C A;  3B4O A;  3T8N A;  2BMR B;  5IG0 A;  3EN1 B;  4L8P A;  5D82 A;  2B24 B;  4HM7 B;  2YFL B;  1ULJ B;  4N3V A;  3LYG A;  3EF8 A;  3KSP A;  4HM8 B;  1JB5 A;  3F40 A;  3CPO A;  3FKA A;  1CQS A;  2GEY A;  1GYB A;  1DMQ A;  4RZM A;  1O7H B;  1U5O A;  1ISK A;  4XDW A;  4HM1 B;  1O7N B;  4GB5 A;  1C7H A;  2HMJ B;  1A2K A;  3OWY A;  4HJL B; 
#chains in the Genus database with same CATH topology
 1W5Z A;  1M1K 4;  1QAK A;  1SII A;  4K1U A;  1GOU A;  1T2I A;  2BU4 A;  1GOV A;  3FF0 A;  3K0Z A;  3URP A;  3DGN A;  3LXU X;  1I3I A;  2P05 A;  3TDG A;  3AGN A;  1OF5 B;  1N5P A;  1OAC A;  2OTL 3;  3NX0 A;  5CK6 A;  1JKG A;  4LZI A;  1NDO B;  1NU3 A;  1BUJ A;  5D81 A;  1JZD A;  3UNL A;  1Q7H A;  1BNI A;  4HM6 B;  1RTU A;  4AEQ A;  1IVU A;  4BTY A;  3RNT A;  1RDS A;  3N54 B;  4FCZ A;  3K63 A;  3CCU 3;  2UGI A;  3I0Y A;  4N6T A;  4XBY A;  3S27 A;  2HMO B;  3GSP A;  4U13 A;  1JN5 B;  2C11 A;  4CDL A;  3EHC A;  1E3R A;  4HM5 B;  3V98 A;  1SJW A;  3GZB A;  3SOA A;  3DGO A;  4HKV B;  1AVK A;  1S5A A;  3AGO A;  5A0O B;  5IW9 A;  5IG4 A;  4IT7 A;  2W9Q A;  1HKX A;  1T2H A;  4XBX A;  5M1A A;  4BU4 A;  1MOL A;  4EYC A;  5JPP A;  3ER7 A;  1U8C B;  3EBY A;  4N6M A;  2JQ5 A;  1KWI A;  2CFK A;  9RNT A;  1MGW A;  4EC6 A;  1X1U A;  3UL6 A;  3V99 A;  2GBW B;  1AV4 A;  1G02 A;  1Z1S A;  3PGB A;  4NRE A;  5ELU A;  4N6U A;  1FYS A;  5RNT A;  3KSE D;  1GMQ A;  3NHX A;  3WA3 A;  2XSH B;  1GD3 A;  3WOF B;  2CG0 A;  3J7Y d;  1W00 A;  2IUJ A;  1BRN L;  2XR8 B;  1RN4 A;  1D6Z A;  2H0G A;  4GL6 A;  1N8R 4;  3G6E 3;  2W03 A;  2OQE C;  3B7C A;  1YVS A;  3LTD A;  3F7X A;  3B4P A;  1Q9E A;  4J5K A;  1CH0 A;  2STD A;  4KVH A;  3I56 3;  3RGA A;  1US1 A;  1W02 A;  2E2U A;  3OXA A;  1YIJ 3;  2GU1 A;  1VQ4 3;  4J5G A;  5ELJ A;  1IVW A;  1LNH A;  4AKZ A;  3F8X A;  4BTW A;  1Q7Y 4;  1MGR A;  1UW1 A;  3BLZ A;  1ZS7 A;  4NPB A;  1FA3 A;  3OX9 A;  1A67 A;  1S72 3;  4RNT A;  1Y4K A;  2D42 A;  2R4I A;  1LQG C;  2K0M A;  3NV0 B;  5AII A;  3WA2 X;  1K9M 4;  1JBS A;  4G1M B;  1C54 A;  4HM3 B;  3KZT A;  8RNT A;  3CU3 A;  3JVC A;  5D83 A;  3S29 A;  3LOY A;  3NBR A;  4FR9 A;  4X2H A;  4BTX A;  3DGY A;  2RSX A;  1B2M A;  3CME 3;  4XB5 A;  3GWR A;  2QA4 3;  2L4V A;  1SIH A;  2K54 A;  1BNR A;  1IV7 A;  1LOY A;  4KFE A;  1IT8 A;  3SOY A;  1BRK A;  5HGR A;  1VQ7 3;  2F56 A;  4FMB A;  6RNT A;  2UUG C;  3D5G A;  1E3V A;  1BRH A;  2IY2 A;  1TFK A;  1IQ8 A;  5IF6 A;  3AMO B;  1X1W A;  4ZM8 A;  2CKF B;  3JUN A;  4BL3 A;  1B27 A;  2XFS A;  1GOY A;  4EW5 A;  1AQZ A;  3SED A;  4CJN A;  3F7S A;  2E2V A;  1SAR A;  1RN1 A;  1KQS 2;  2IYJ A;  2RGQ A;  1RMS A;  1W6C A;  2CX0 A;  2ZDJ A;  2ZHX B;  3BIR A;  5AYS C;  3LT9 A;  5IEP A;  3NBJ A;  3QRD A;  4J8T A;  3E99 A;  1X1X A;  3KFQ C;  5AIH A;  3ALA A;  3STD A;  3F14 A;  4HVN A;  3LT8 A;  4XDV A;  1B2X A;  1RCL A;  3IMA B;  3IJE B;  3OWU A;  3VSY A;  3LTB A;  3X3Z A;  4MMX B;  3MG3 A;  5AEW B;  1MNL A;  2GSP A;  2HOH A;  5JPU A;  3WDG B;  2XF3 A;  2OWP A;  4RNZ A;  1N9E A;  2P38 A;  1N9J A;  1JB4 A;  4FMC A;  1CEW I;  6GSP A;  5JBS A;  2KF6 A;  4HM2 B;  1RGH A;  3F8H A;  2XH9 A;  4LEH A;  4LSO A;  1RGK A;  2KXG A;  3GAX A;  3DGM A;  3HIG A;  2OOV A;  3UL5 A;  1MWS A;  3X3Y A;  5I97 A;  4XBT A;  2W6J H;  3MKI A;  1TIJ A;  1FW7 A;  1O7G B;  1D6Y A;  1GS3 A;  1BRI A;  2CC3 A;  3G16 A;  1UCK A;  3S5C A;  1ROA A;  1FUT A;  3A76 A;  1IVX A;  1GY6 A;  2P09 A;  3ROB A;  1VQM 3;  1EQK A;  1OGZ A;  2ZA4 A;  3D9R A;  2HMM B;  2KRT A;  2OCT A;  1WMO A;  1FGM A;  3CCR 3;  2W2C A;  1YGW A;  1RGL A;  3S67 A;  5IEN A;  1Q42 A;  2R41 A;  1WQL B;  2D1W A;  2ZL8 A;  2GXF A;  1AVL A;  1R4Y A;  4N6L A;  2CFL A;  1UDI I;  3B8L A;  2RBI A;  1PU4 A;  3JUO A;  2CX1 A;  1JZO A;  1KC8 4;  2CWT A;  1W6Y A;  2GBX B;  1BSC A;  3OV4 A;  3K7C A;  1Q40 B;  4HZ9 B;  3LZA A;  1RN7 A;  1LXE A;  2Q07 A;  1FGT A;  2CWU A;  3HOH A;  4R9K A;  5STD A;  1UCL A;  2AAE A;  1DMM A;  2LYX A;  1RHL A;  4LYL B;  3T0U A;  1BUQ A;  2BMQ B;  3JUQ A;  3SX1 A;  3KII A;  4WWU C;  5EVH A;  1STD A;  3FLJ A;  1IQX A;  3EE1 A;  3PCR A;  3BNB A;  2Z7A A;  1HU9 A;  1B2U A;  3WOE B;  1OF5 A;  1RGF A;  1BNF A;  1L5G B;  3DZL A;  1PYL A;  4RBN A;  2GEX A;  1NB5 I;  1JV2 B;  2Z76 A;  2XRX B;  4X2O A;  3FF2 A;  5G1K A;  1X1Y A;  3DMC A;  3CCL 3;  3GZR A;  1QVG 2;  2O9U X;  4R1K A;  1OHO A;  2PNC A;  2HMK B;  8CHO A;  3CXC 2;  1VQQ A;  3Q90 A;  1FUW A;  1K73 4;  1I2F A;  3PXM A;  3UJM A;  3CC2 3;  2BNG A;  3KE7 A;  3Q3F A;  1RGC A;  2W56 B;  3NBB A;  5BXQ A;  1JN5 A;  5BIR A;  3G8Z A;  2XSO B;  2CFD A;  1OPY A;  3LH4 A;  3DUK A;  1UUW B;  1G96 A;  4K61 A;  5HOH A;  1B3S A;  1NNV A;  3CCQ 3;  3HK4 A;  2YFI B;  3FSD A;  2RNT A;  4AKY A;  5TGN A;  3A5E A;  3SYU A;  3Q1C A;  1IVV A;  4K1V A;  5KP4 A;  5CF1 A;  3L0R A;  2WGO A;  4IIA A;  4IPB A;  1A90 A;  1A2V A;  1BSD A;  4J9A A;  1WTH A;  1LRA A;  1J2B A;  1I2G A;  1ROV A;  1UUV B;  1UGI A;  2CIU A;  1V74 A;  2F4Y A;  1BSA A;  2Y73 A;  1EG9 B;  3NQZ A;  4I4K A;  2M7O A;  4LGQ A;  3LTC A;  1I0V A;  2RFR A;  5DRE A;  2L1S A;  1BNG A;  1F8N A;  1ZX2 A;  1QMA A;  4PEJ A;  2CHC A;  3WHO A;  1DE3 A;  3CC7 3;  1JNQ A;  3D79 A;  1O7W B;  2XFT A;  3CCE 3;  3LML A;  1FGR A;  1AR0 A;  1EA2 A;  3X42 A;  3AHS A;  2FGT A;  3PZW A;  1Q81 4;  1BSB A;  4WYK A;  4HOH A;  6STD A;  1SQW A;  1YHQ 3;  1I8V A;  3FG4 A;  1RCK A;  3NM7 A;  3BNC A;  1ZGX A;  1R4C A;  4HYZ A;  1FZU A;  1NO3 A;  1I2E A;  1LOV A;  1UCJ A;  5LC7 A;  3CCM 3;  1N5H A;  1RRL A;  1BAO A;  4HM4 B;  1B2Z A;  1YJN 3;  1CYU A;  1BRS A;  2F5W A;  2PZV A;  1GY5 A;  2F86 B;  3U97 A;  1RNT A;  1TU5 A;  3RGR A;  1K41 A;  3N8B A;  3CD6 3;  4LMI A;  2BHM A;  1VQP 3;  2OOV C;  1QJG A;  1I0X A;  3T8U A;  3CMA 3;  4GHO A;  4RNY A;  3NV0 A;  3DXO A;  2SAR A;  4WHA A;  1M90 4;  4MMY B;  1ASK A;  2FNQ A;  3HX8 A;  4QWT A;  2P0X A;  1Q86 4;  1OHS A;  1VQ5 3;  3X40 A;  5M19 A;  4HBR A;  3VF1 A;  1RKY A;  1EEJ A;  5DRV A;  3V92 A;  2SBL A;  1JKG B;  2F98 A;  5AIF A;  3JUP A;  5G2G A;  3JUM A;  1RGE A;  3BU4 A;  4CCV A;  4OVM A;  1OUN A;  1STF I;  3KKG A;  4HZB B;  1TJD A;  1YGE A;  2QGU A;  3QK9 A;  2I9W A;  4I5Q A;  4XM4 A;  4N6V 0;  3EBT A;  4MJD A;  1PY3 A;  3NUV A;  1TRP A;  1GY7 A;  3CCJ 3;  1VQ8 3;  1KSI A;  1UCI A;  3AMO A;  4N6O B;  4ORL A;  3F9S A;  1BOX A;  3H3H A;  2W9P A;  1W2B 2;  3EX9 A;  4EBG A;  1TTO A;  2H0H A;  5LC6 A;  3CPW 2;  1BNE A;  3MG1 A;  4GSP A;  1WNH A;  3ZG0 A;  1VQK 3;  5CLK A;  1NJI 4;  2RCD A;  4Q53 A;  2CWV A;  1VQL 3;  1BSE A;  1E97 A;  2GU3 A;  5KP3 A;  1YNV X;  2E2T A;  1BNS A;  3ECF A;  5GSP A;  5BVB A;  1NWW A;  4FMA A;  5IER A;  2QEX 3;  3DM8 A;  2UX0 A;  3FG3 A;  3NXJ A;  4O8S A;  3DH2 A;  1VQ9 3;  2FXT A;  3DY5 A;  2A15 A;  2YFJ B;  1MWR A;  1I70 A;  2WO0 A;  3D3L A;  3DGL A;  3OWS A;  4FCJ A;  5IEO A;  3ZG5 A;  3G4S 3;  1LQM B;  5AYR B;  4O3V A;  5FGO A;  1BRJ A;  2ML5 A;  4HAA A;  4MMZ B;  1SPU A;  1T5Y A;  3K9M C;  2BIR A;  1VQO 3;  1IT7 A;  5FW5 A;  1W7C A;  2W04 A;  3NM2 A;  3CNM A;  1OHP A;  3G0K A;  1MWT A;  3SXX A;  1IU7 A;  5AEU B;  3MPH A;  2BMO B;  3CNX A;  3FZW A;  3O8Y A;  3MYT A;  2CFG A;  1IV9 A;  5BU4 A;  2Z77 A;  1RLS A;  4KFF A;  3GRD A;  4EXR A;  1OGX A;  1IK3 A;  3NQY A;  3HI7 A;  3HZP A;  3MSO A;  3CCV 3;  3GZY B;  5KP1 A;  2XGL A;  3FGY A;  1LOX A;  1LVN A;  2XEP A;  4JF8 A;  3PYJ A;  4FCM A;  1ZO2 A;  2IMJ A;  3MHE A;  4OUQ A;  3EB8 A;  1RRH A;  7RNT A;  3PS8 A;  4L7K A;  5M18 A;  1RNB A;  1JBR A;  1OCV A;  3FG1 A;  5IG5 A;  1OH0 A;  2B1X B;  3EQQ B;  1RSN A;  3KCH A;  1IDP A;  4ILF A;  4L8O A;  2OTJ 3;  1Q82 4;  1UI8 A;  1NB3 I;  1TRQ A;  2C4B A;  1BVI A;  2J8X B;  3WMD A;  1RJO A;  5CF2 A;  1IQY A;  1O7M B;  5AI1 A;  1UGH I;  4R9L A;  3D5I A;  2LQV A;  3EC9 A;  2CG1 A;  7STD A;  1VQ6 3;  1B20 A;  2MF7 A;  4KT3 B;  2F99 A;  4STD A;  3OW2 2;  3K5T A;  2H0I A;  1O7P B;  2WOH A;  4R80 A;  3EN8 A;  1Q40 A;  1WMN A;  3EJV A;  1ULI B;  2IUK A;  3BB9 A;  5CXO A;  3WOD G;  2KF5 A;  4KZ1 A;  4TX4 A;  3CC4 3;  3SLU A;  1GSP A;  1VQN 3;  4MEI A;  5IG3 A;  2W0Q A;  1G0T A;  3GZX B;  1HZ1 A;  4BL2 A;  1LOW A;  1A2P A;  1FGO A;  2HML B;  2KF4 A;  1TP6 A;  2Y74 A;  2KCD A;  1TFO A;  4WYK B;  1B21 A;  1DVD A;  4H61 A;  1MWU A;  2Z6B A;  2WGQ A;  4JRF A;  4HM0 B;  3VGN A;  2HMN B;  5AIG A;  2QIY A;  2YX9 A;  3MG2 A;  2CH9 A;  1UUG B;  4H3U A;  1GD4 A;  1RGA A;  1TUH A;  3IPT A;  3N9H A;  3PCS A;  3FH1 A;  1K8A 4;  7GSP A;  1JB2 A;  2INX A;  3H51 A;  4O02 B;  1JRQ A;  1EUI C;  1M9G A;  3HII A;  3MWZ A;  2BT3 A;  1VZZ A;  4NHF A;  3Q2P A;  4KFD A;  4WP5 A;  1LNI A;  2W56 A;  3X41 A;  4R4K A;  1AY7 A;  4EV5 A;  1DVC A;  1QAL A;  3BNE A;  1W01 A;  1RGG A;  4FMD A;  1DMN A;  3M8C A;  4N6N B;  5EQL A;  2V1L A;  1BIR A;  2OQE A;  1YJW 3;  1A2K A;  3B4O A;  3S28 A;  1BAN A;  1I3F A;  2JDI H;  2BO9 B;  3T8N A;  4K90 B;  1W2Z A;  2BMR B;  1V57 A;  3EN1 B;  1B2S A;  4L8P A;  4OK0 A;  5IG0 A;  5D82 A;  1BGS A;  2B24 B;  2CW9 A;  1DET A;  3D4A A;  4HM7 B;  1K28 A;  5EEO A;  2WOF A;  2YFL B;  5G1L A;  4CPK A;  1ULJ B;  1W4N A;  4N3V A;  1FGQ A;  1YJ9 3;  2F5M A;  2MC8 A;  1YIT 3;  3LYG A;  3FCS B;  3EF8 A;  3KSP A;  3SVA A;  1YI2 3;  4WFO A;  2XGN A;  3I55 3;  2C10 A;  4HM8 B;  1JB5 A;  1DYU A;  1EKM A;  1BNJ A;  2ML6 A;  3F40 A;  2KF3 A;  3LTA A;  3CPO A;  1GMR A;  2KAA A;  1IYY A;  1WMP A;  3U1W A;  3FKA A;  1N8Q A;  1W6G A;  1CQS A;  3WR2 A;  4EV2 A;  2AAD A;  1M1X B;  2K3D A;  1HYF A;  2GEY A;  1GYB A;  1CYV A;  1DMQ A;  3AHW A;  3UB1 A;  4RZM A;  1BRG A;  3X3X A;  1JBT A;  1YVB I;  1D6U A;  1O7H B;  1U5O A;  1ISK A;  2CK3 H;  1BU4 A;  4O2H A;  2CFW A;  1V58 A;  2O3O A;  4XDW A;  1T3B A;  1PFP A;  2IA7 A;  3BND A;  3ZFZ A;  2P0M A;  4HM1 B;  3KN4 A;  3RDE A;  1QAF A;  3CCS 3;  4BIR A;  4DKI A;  1FUS A;  1JJ2 2;  1KD1 4;  1O7N B;  4GB5 A;  1C7H A;  2HMJ B;  1GMP A;  1QVF 2;  1UI7 A;  3OWY A;  3G71 3;  4HJL B; 
#chains in the Genus database with same CATH homology
 1W5Z A;  1M1K 4;  1QAK A;  1SII A;  4K1U A;  3FF0 A;  3K0Z A;  3DGN A;  3LXU X;  2P05 A;  3TDG A;  1OF5 B;  1N5P A;  1OAC A;  2OTL 3;  3NX0 A;  5CK6 A;  1JKG A;  4LZI A;  1NDO B;  1NU3 A;  5D81 A;  3UNL A;  4HM6 B;  4AEQ A;  1IVU A;  4BTY A;  3N54 B;  4FCZ A;  3K63 A;  3I0Y A;  4N6T A;  4XBY A;  3S27 A;  2HMO B;  4U13 A;  1JN5 B;  2C11 A;  4CDL A;  3EHC A;  1E3R A;  4HM5 B;  3V98 A;  1SJW A;  3GZB A;  3SOA A;  3DGO A;  4HKV B;  1AVK A;  1S5A A;  5A0O B;  5IW9 A;  5IG4 A;  4IT7 A;  2W9Q A;  1HKX A;  4XBX A;  1YI2 3;  1MOL A;  4EYC A;  5JPP A;  3ER7 A;  1U8C B;  3EBY A;  4N6M A;  2JQ5 A;  1KWI A;  2CFK A;  4EC6 A;  3UL6 A;  3V99 A;  2GBW B;  1AV4 A;  5ELU A;  1Z1S A;  3PGB A;  4NRE A;  4N6U A;  3KSE D;  3NHX A;  3WA3 A;  2XSH B;  1GD3 A;  3WOF B;  2CG0 A;  3J7Y d;  1W00 A;  2IUJ A;  2XR8 B;  1D6Z A;  4GL6 A;  1N8R 4;  3G6E 3;  2W03 A;  2OQE C;  3B7C A;  3LTD A;  3F7X A;  3B4P A;  2STD A;  4KVH A;  3I56 3;  3RGA A;  1US1 A;  1W02 A;  2E2U A;  3OXA A;  1YIJ 3;  2GU1 A;  1VQ4 3;  5ELJ A;  1IVW A;  1LNH A;  4AKZ A;  3F8X A;  4BTW A;  1Q7Y 4;  1UW1 A;  3BLZ A;  1FA3 A;  3OX9 A;  1A67 A;  1S72 3;  1Y4K A;  2D42 A;  2R4I A;  3NV0 B;  2K0M A;  5AII A;  3WA2 X;  1K9M 4;  4G1M B;  4HM3 B;  3KZT A;  3CU3 A;  3JVC A;  5D83 A;  3S29 A;  3LOY A;  3NBR A;  4FR9 A;  4X2H A;  4BTX A;  2RSX A;  3CME 3;  4XB5 A;  3GWR A;  2QA4 3;  2L4V A;  1SIH A;  2K54 A;  1IV7 A;  4KFE A;  1IT8 A;  3SOY A;  5HGR A;  1VQ7 3;  4FMB A;  1E3V A;  1TFK A;  1IQ8 A;  5IF6 A;  3AMO B;  4ZM8 A;  2CKF B;  3JUN A;  2XFS A;  3SED A;  3F7S A;  2E2V A;  1KQS 2;  2RGQ A;  5AYS C;  1W6C A;  2ZDJ A;  3LT9 A;  5IEP A;  3NBJ A;  3QRD A;  4J8T A;  3E99 A;  3KFQ C;  5AIH A;  3ALA A;  3STD A;  3F14 A;  4HVN A;  3LT8 A;  4XDV A;  3IMA B;  3IJE B;  3OWU A;  3VSY A;  3LTB A;  3X3Z A;  4MMX B;  3MG3 A;  5AEW B;  1MNL A;  5JPU A;  3WDG B;  2XF3 A;  2OWP A;  4RNZ A;  1N9E A;  2P38 A;  1N9J A;  1JB4 A;  4FMC A;  1CEW I;  5JBS A;  4HM2 B;  3F8H A;  2XH9 A;  4LEH A;  4LSO A;  3GAX A;  2KXG A;  3HIG A;  3DGM A;  2OOV A;  3UL5 A;  3X3Y A;  5I97 A;  4XBT A;  2W6J H;  3MKI A;  1TIJ A;  1O7G B;  1D6Y A;  1GS3 A;  2CC3 A;  3G16 A;  3S5C A;  1ROA A;  3A76 A;  1IVX A;  1GY6 A;  2P09 A;  3ROB A;  1VQM 3;  1EQK A;  1OGZ A;  3D9R A;  2HMM B;  2KRT A;  2OCT A;  1WMO A;  1FGM A;  3CCR 3;  2W2C A;  5IEN A;  3S67 A;  1Q42 A;  1WQL B;  2D1W A;  2ZL8 A;  2GXF A;  1AVL A;  4N6L A;  2CFL A;  3B8L A;  1PU4 A;  3JUO A;  1KC8 4;  2CWT A;  1W6Y A;  2GBX B;  3OV4 A;  3K7C A;  1Q40 B;  4HZ9 B;  3LZA A;  1RN7 A;  1LXE A;  2Q07 A;  1FGT A;  2CWU A;  4R9K A;  5STD A;  1DMM A;  2LYX A;  1BUQ A;  3T0U A;  2BMQ B;  3JUQ A;  3SX1 A;  3KII A;  4WWU C;  5EVH A;  1STD A;  3FLJ A;  1IQX A;  3EE1 A;  3PCR A;  3BNB A;  2Z7A A;  1HU9 A;  3WOE B;  1OF5 A;  1L5G B;  3DZL A;  4RBN A;  2GEX A;  1NB5 I;  1JV2 B;  2Z76 A;  2XRX B;  4X2O A;  3FF2 A;  3CCL 3;  3DMC A;  3GZR A;  1QVG 2;  2O9U X;  4R1K A;  1OHO A;  2PNC A;  2HMK B;  8CHO A;  3CXC 2;  3Q90 A;  1FUW A;  1K73 4;  3PXM A;  3UJM A;  3CC2 3;  2BNG A;  3KE7 A;  2W56 B;  3NBB A;  5BXQ A;  1JN5 A;  3G8Z A;  2XSO B;  2CFD A;  1OPY A;  3LH4 A;  3DUK A;  1UUW B;  1G96 A;  4K61 A;  3CCQ 3;  3HK4 A;  2YFI B;  3FSD A;  4AKY A;  5TGN A;  3Q1C A;  1IVV A;  4K1V A;  5KP4 A;  5CF1 A;  3L0R A;  2WGO A;  4IIA A;  4IPB A;  1A90 A;  1A2V A;  4J9A A;  1WTH A;  1J2B A;  1UUV B;  1ROV A;  2CIU A;  3NQZ A;  3T8U A;  1V74 A;  2Y73 A;  1EG9 B;  4I4K A;  2M7O A;  4LGQ A;  3LTC A;  2RFR A;  5DRE A;  1F8N A;  1ZX2 A;  1QMA A;  4PEJ A;  2CHC A;  3CC7 3;  1JNQ A;  1O7W B;  2XFT A;  3CCE 3;  3LML A;  1FGR A;  1AR0 A;  1EA2 A;  3X42 A;  2FGT A;  3PZW A;  1Q81 4;  4WYK A;  6STD A;  1SQW A;  3FG4 A;  3NM7 A;  3BNC A;  1R4C A;  4HYZ A;  1NO3 A;  5LC7 A;  3CCM 3;  1N5H A;  1RRL A;  4HM4 B;  1YJN 3;  1CYU A;  2PZV A;  3U97 A;  1GY5 A;  2F86 B;  1TU5 A;  3RGR A;  1K41 A;  3N8B A;  3CD6 3;  4LMI A;  2BHM A;  1VQP 3;  2OOV C;  1QJG A;  3CMA 3;  4RNY A;  3NV0 A;  3DXO A;  4WHA A;  1M90 4;  4MMY B;  1ASK A;  2FNQ A;  3HX8 A;  4QWT A;  2P0X A;  1Q86 4;  1OHS A;  1VQ5 3;  3X40 A;  4HBR A;  3VF1 A;  1RKY A;  3V92 A;  5DRV A;  2SBL A;  1JKG B;  2F98 A;  5AIF A;  3JUP A;  5G2G A;  3JUM A;  4CCV A;  4OVM A;  1OUN A;  1STF I;  3KKG A;  4HZB B;  1YGE A;  2QGU A;  3QK9 A;  2I9W A;  4XM4 A;  4N6V 0;  3EBT A;  4MJD A;  3CCJ 3;  3NUV A;  1GY7 A;  1VQ8 3;  1KSI A;  3AMO A;  4N6O B;  4ORL A;  3F9S A;  1W2B 2;  3H3H A;  2W9P A;  3EX9 A;  4EBG A;  5LC6 A;  3CPW 2;  3MG1 A;  1VQK 3;  1WNH A;  5CLK A;  1NJI 4;  2RCD A;  4Q53 A;  2CWV A;  1VQL 3;  1E97 A;  2GU3 A;  5KP3 A;  2E2T A;  3ECF A;  5BVB A;  1NWW A;  4FMA A;  5IER A;  2QEX 3;  3DM8 A;  2UX0 A;  3FG3 A;  3NXJ A;  4O8S A;  1VQ9 3;  2FXT A;  3DY5 A;  2A15 A;  2YFJ B;  3D3L A;  3DGL A;  2WO0 A;  3OWS A;  4FCJ A;  3G4S 3;  5IEO A;  5AYR B;  4O3V A;  5FGO A;  2ML5 A;  4MMZ B;  1SPU A;  1T5Y A;  3K9M C;  1VQO 3;  1IT7 A;  5FW5 A;  1W7C A;  2W04 A;  3NM2 A;  3CNM A;  1OHP A;  3G0K A;  3SXX A;  1IU7 A;  5AEU B;  3MPH A;  2BMO B;  3CNX A;  3FZW A;  3O8Y A;  3MYT A;  2CFG A;  1IV9 A;  2Z77 A;  4KFF A;  3GRD A;  4EXR A;  1OGX A;  1IK3 A;  3NQY A;  3HI7 A;  3HZP A;  3MSO A;  3CCV 3;  3GZY B;  5KP1 A;  2XGL A;  3FGY A;  2XEP A;  1LOX A;  1LVN A;  4JF8 A;  3PYJ A;  4FCM A;  1ZO2 A;  2IMJ A;  3MHE A;  4OUQ A;  3EB8 A;  1RRH A;  3PS8 A;  4L7K A;  1OCV A;  3FG1 A;  5IG5 A;  1OH0 A;  2B1X B;  3EQQ B;  1IDP A;  4L8O A;  2OTJ 3;  1Q82 4;  1UI8 A;  1NB3 I;  3WMD A;  1RJO A;  5CF2 A;  1IQY A;  1O7M B;  5AI1 A;  4R9L A;  3EC9 A;  2LQV A;  1VQ6 3;  2CG1 A;  7STD A;  2MF7 A;  2F99 A;  4STD A;  3OW2 2;  3K5T A;  1O7P B;  2WOH A;  4R80 A;  3EN8 A;  1Q40 A;  1WMN A;  3EJV A;  1ULI B;  2IUK A;  3BB9 A;  5CXO A;  3WOD G;  4KZ1 A;  4TX4 A;  3CC4 3;  3SLU A;  1VQN 3;  4MEI A;  5IG3 A;  2W0Q A;  3GZX B;  2HML B;  1FGO A;  2Y74 A;  1TP6 A;  2KCD A;  1TFO A;  4WYK B;  1DVD A;  4H61 A;  2Z6B A;  2WGQ A;  4JRF A;  4HM0 B;  3VGN A;  2HMN B;  5AIG A;  2QIY A;  2YX9 A;  3MG2 A;  2CH9 A;  4H3U A;  1GD4 A;  1TUH A;  3IPT A;  3N9H A;  3PCS A;  3FH1 A;  1K8A 4;  1JB2 A;  2INX A;  3H51 A;  4O02 B;  1JRQ A;  1M9G A;  3HII A;  3MWZ A;  2BT3 A;  1VZZ A;  4NHF A;  3Q2P A;  4KFD A;  4WP5 A;  2W56 A;  3X41 A;  4R4K A;  4EV5 A;  1DVC A;  1QAL A;  3BNE A;  1W01 A;  4FMD A;  2OQE A;  1DMN A;  3M8C A;  4N6N B;  5EQL A;  2V1L A;  1YJW 3;  1A2K A;  3B4O A;  3S28 A;  2JDI H;  2BO9 B;  3T8N A;  4K90 B;  1W2Z A;  2BMR B;  5IG0 A;  3EN1 B;  4L8P A;  4OK0 A;  5D82 A;  2B24 B;  2CW9 A;  4HM7 B;  1K28 A;  5EEO A;  2WOF A;  2YFL B;  1ULJ B;  1W4N A;  4N3V A;  1FGQ A;  1YJ9 3;  2MC8 A;  1YIT 3;  3LYG A;  3FCS B;  3EF8 A;  3KSP A;  3SVA A;  4WFO A;  2XGN A;  3I55 3;  2C10 A;  4HM8 B;  1JB5 A;  1DYU A;  1EKM A;  2ML6 A;  3F40 A;  3LTA A;  3CPO A;  1WMP A;  3U1W A;  3FKA A;  1N8Q A;  1W6G A;  1CQS A;  4EV2 A;  1M1X B;  3CCU 3;  2GEY A;  3UB1 A;  1GYB A;  1CYV A;  1DMQ A;  1YHQ 3;  3X3X A;  4RZM A;  1YVB I;  1D6U A;  1O7H B;  1U5O A;  1ISK A;  2CK3 H;  4O2H A;  2CFW A;  2O3O A;  4XDW A;  1PFP A;  2IA7 A;  3BND A;  2P0M A;  4HM1 B;  3KN4 A;  3RDE A;  1QAF A;  3CCS 3;  1JJ2 2;  1KD1 4;  1O7N B;  4GB5 A;  1C7H A;  2HMJ B;  1QVF 2;  1UI7 A;  3OWY A;  3G71 3;  4HJL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...