1EG9B

Naphthalene 1,2-dioxygenase with indole bound in the active site.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT)
publication title Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eg9B00
2R4IA 4L7KA 3EQQB 4OUQA 3H51A 3MYTA 5IG3A 3NHXA 2XRXB 1O7MB 2INXA 3RGAA 3VSYA 3UJMA 1O7HB 1JB5A 3G8ZA 3CU3A 3BB9A 1DMQA 3F8HA 4PEJA 4STDA 4J8TA 3BLZA 3GZYB 1A2KA 3GZBA 5CXOA 1OUNA 3MG3A 3ROBA 3FF0A 5AIGA 2GEYA 5G2GA 1ISKA 1U5OA 3LZAA 3JUMA 3NBRA 1UUVB 3H3HA 3HK4A 2BNGA 1ASKA 3JUNA 4HZ9B 3FLJA 2BMQB 3SOAA 1W6YA 4HM4B 1W02A 4HM7B 3FKAA 3MKIA 3MSOA 2GBXB 3CNMA 2GBWB 3T8NA 4HM8B 1C7HA 3GZRA 3EN1B 4K1VA 4KVHA 1ZX2A 4LGQA 2STDA 3SEDA 3FH1A 3DXOA 4XDWA 1DMNA 2Z77A 3RGRA 3OXAA 4LEHA 4HZBB 5IEPA 3EC9A 1STDA 2HMNB 5TGNA 5DREA 5CLKA 1OF5B 3E99A 1E3VA 5KP1A 5JPPA 3MG1A 3EF8A 4HJLB 4K1UA 1OF5A 6STDA 1OCVA 7STDA 4HM6B 1O7PB 2RFRA 3FGYA 4R9KA 4XBTA 5JPUA 4CDLA 3EBYA 2QIYA 4HM2B 2RCDA 5KP3A 4OVMA 8CHOA 3JUQA 3IPTA 3SOYA 5AIHA 2OWPA 3HX8A 2HMLB 3OX9A 5BVBA 4ORLA 4LMIA 1GY6A 1JKGB 3NM2A 1E3RA 5IENA 2QGUA 1W00A 5AI1A 3KZTA 5D83A 4HM0B 3WMDA 2UX0A 3EX9A 1JKGA 2PZVA 3JUOA 3OV4A 1GS3A 4L8PA 1TUHA 4Q53A 1OPYA 4X2HA 3F7SA 1ZO2A 1GY5A 1NWWA 1BUQA 1OH0A 4I4KA 2XR8B 1WQLB 3OWUA 2F86B 3F8XA 1EG9B 2Z76A 4WYKB 5BXQA 4H3UA 5IG4A 1SJWA 2HMKB 3EN8A 3D9RA 4XBYA 1OGZA 4GB5A 4WYKA 1AR0A 2HMMB 4IIAA 5IERA 1QMAA 1TP6A 1OHPA 3EBTA 3K0ZA 2B1XB 5AIIA 1ULJB 1ULIB 3CPOA 1JB2A 3STDA 3T8UA 5KP4A 2F99A 4R9LA 5CF2A 5CK6A 5STDA 5FW5A 1O7GB 5EVHA 3UNLA 1HKXA 5IEOA 3LYGA 4X2OA 3EHCA 1JN5B 3F7XA 5HGRA 1GYBA 4XM4A 1GY7A 3CNXA 4WWUC 4U13A 2YFIB 1JN5A 3S5CA 5CF1A 2HMJB 1Q40B 3Q90A 1S5AA 1OHSA 2W2CA 3ECFA 3MG2A 2B24B 2RGQA 3K7CA 1Q40A 3DMCA 1W01A 3A76A 1EA2A 2YFJB 3OWYA 3KE7A 3F9SA 4XDVA 2GXFA 3DZLA 1O7NB 2XSHB 3M8CA 4XBXA 2I9WA 3B4OA 3HZPA 2BMRB 4FCMA 1Q42A 4R1KA 5AEUB 3GRDA 5IG5A 2XSOB 5D81A 2BMOB 4MJDA 2F98A 3GZXB 1VZZA 5AEWB 1NU3A 3I0YA 4L8OA 2JQ5A 3NXJA 1Z1SA 4HKVB 4RZMA 1NDOB 4HM5B 3G0KA 1O7WB 3FF2A 2CKFB 3DM8A 3GWRA 4N3VA 2K54A 3DUKA 3JUPA 3FZWA 5AIFA 1K41A 3MHEA 4XB5A 1UUWB 5IG0A 2YFLB 3G16A 3OWSA 5IF6A 4HM3B 3KSPA 3EJVA 3NV0B 5DRVA 1DMMA 4J9AA 4HVNA 3B4PA 3ER7A 3F40A 3FSDA 2A15A 2CHCA 3NV0A 3F14A 5D82A 3KKGA 1IDPA 3VGNA 1OHOA 3B7CA 4FCJA 1OGXA 1E97A 2IMJA 2Z7AA 3B8LA 4HM1B 1JB4A 1QJGA 2GEXA 2HMOB 3NUVA 4WP5A 1CQSA
chains in the Genus database with same CATH superfamily
4BTWA 2R4IA 4L7KA 2XFTA 1W5ZA 1FGOA 1RGHA 4RBNA 3EQQB 4KZ1A 1GMRA 3FG4A 1B2MA 4OUQA 1WMNA 3N9HA 3O8YA 1HYFA 3H51A 3MYTA 4GL6A 3D3LA 3K5TA 1M1K4 5IG3A 2RNTA 4EV5A 1BSAA 3KCHA 3NHXA 4HBRA 1QAFA 2CWVA 3BIRA 1EUIC 2P0MA 2XRXB 3KIIA 1O7MB 2INXA 2KCDA 1G02A 1BRHA 2M7OA 3AGOA 4NPBA 1BNIA 1I3IA 1FW7A 3RGAA 3VSYA 2K3DA 3UJMA 2WGOA 1LQGC 1O7HB 2H0GA 1JB5A 2F4YA 3CU3A 3G8ZA 1IQYA 2CK3H 2BT3A 1YVBI 3BB9A 1DMQA 3F8HA 4PEJA 3QK9A 4STDA 1TJDA 4J8TA 1RGKA 1TRPA 3BLZA 1MGWA 3FG3A 3GZYB 4FR9A 1A2KA 3GZBA 5CXOA 1WMPA 1OUNA 1BSEA 3MG3A 3ROBA 1LOXA 3FF0A 2WOHA 2IA7A 1YHQ3 1B2ZA 2GU3A 5AIGA 2P0XA 2RSXA 4R80A 2GEYA 1B3SA 5G2GA 1RN7A 1QAKA 1YJ93 2F5WA 1LVNA 1RNBA 2E2VA 1ISKA 3WDGB 1U5OA 3PXMA 1RRHA 3SLUA 3LZAA 2WO0A 3JUMA 3UL6A 3DGYA 3SXXA 1EQKA 3NBRA 3AHWA 1RGLA 3CCR3 1LNHA 3LOYA 3PCRA 3S67A 1UUVB 3H3HA 1AVKA 3U1WA 3HK4A 2BNGA 1ASKA 3JUNA 1JV2B 2C4BA 2BO9B 5M19A 1VQ53 4HZ9B 3FLJA 2BMQB 2CX0A 4HOHA 3SOAA 1W6YA 4HM4B 3CCQ3 1FZUA 2R41A 4FMDA 1W02A 3SYUA 2IYJA 1X1XA 1YGEA 4MMXB 3X42A 4HM7B 4O02B 3FKAA 2D42A 3NM7A 4MMYB 4ZM8A 3MKIA 3MSOA 1B27A 1FGRA 1HZ1A 2KF3A 4WHAA 2GBXB 2KF4A 4AKZA 3HIIA 1RNTA 3LT8A 3LXUX 1BNJA 3FG1A 4N6TA 1PY3A 1RJOA 2Z6BA 3CNMA 2GBWB 3T8NA 1N9JA 3ZG5A 3CC73 4HM8B 1B2UA 1FUWA 4EV2A 1C7HA 3GZRA 3D79A 2OTL3 3EN1B 1PFPA 4K1VA 4K90B 4KVHA 5EQLA 3URPA 1X1YA 1ZX2A 4R4KA 1W4NA 4LGQA 3CCM3 5LC6A 4HAAA 1IVWA 1US1A 2STDA 4QWTA 3CME3 3SEDA 3FH1A 2QA43 1NB5I 1AY7A 5AYSC 1TRQA 3DXOA 1BRNL 2HOHA 4XDWA 1DMNA 2C10A 2Z77A 1Q864 3RGRA 3AMOB 2W03A 1JRQA 1V57A 3BNBA 2CIUA 5LC7A 1BRKA 3OXAA 4LEHA 3LT9A 1I0XA 2Y73A 1BNGA 4HZBB 4K61A 3RNTA 5IEPA 3EC9A 5AYRB 1STDA 3K9MC 1NJI4 2ZA4A 1RGEA 2HMNB 3AMOA 5TGNA 3NX0A 1DVDA 4GHOA 5DREA 1Q7Y4 3CD63 2CG1A 1LNIA 5CLKA 1UW1A 1IU7A 2CFKA 1OF5B 3E99A 1RN4A 2BU4A 1E3VA 5KP1A 4O3VA 1RSNA 5JPPA 1IT7A 2KXGA 3DGLA 3MG1A 3EF8A 4HJLB 4K1UA 1RMSA 1Q7HA 1BANA 3WA3A 4FMAA 1OF5A 1VQ43 5G1LA 2OQEC 2CFWA 1WTHA 1SARA 2UGIA 1DYUA 1I8VA 1OCVA 6STDA 1K9M4 1MWSA 2BIRA 7STDA 1D6YA 3G713 4HM6B 4BTYA 1N5PA 1O7PB 1EKMA 2RFRA 3FGYA 4R9KA 3AGNA 3PZWA 3A5EA 1MWUA 2W9QA 2SARA 3UL5A 4XBTA 4BIRA 1SIHA 5JPUA 3DGMA 4CDLA 1IYYA 3EBYA 2QIYA 1AVLA 3LTCA 3ZFZA 4HM2B 2RCDA 5KP3A 3CCV3 4OK0A 5G1KA 1DETA 3LTAA 1TTOA 4OVMA 4EBGA 4KFFA 8CHOA 1N5HA 1W2B2 3JUQA 1IT8A 1W6GA 2H0IA 3IPTA 1MOLA 3SOYA 2CC3A 5AIHA 2OWPA 3HX8A 2HMLB 3BNDA 3WOFB 5I97A 4FMCA 4RNYA 3S28A 1GMPA 7RNTA 1KC84 3MPHA 3OX9A 4O2HA 1UCKA 3RDEA 5BVBA 3CC43 1CYUA 3CCJ3 4ORLA 1JBSA 4LMIA 1FGMA 1GY6A 4H61A 4KFDA 1JKGB 1AQZA 1GOVA 5M1AA 1KQS2 5GSPA 4KT3B 3UB1A 1QALA 3NM2A 1E3RA 2W04A 4WFOA 2LQVA 5IENA 1S723 2QGUA 3X41A 1W00A 1UCIA 3K63A 5AI1A 3PCSA 1FGQA 3KZTA 1BU4A 2IUKA 3CXC2 5D83A 4HM0B 5ELUA 1A2PA 2UX0A 3WMDA 5BIRA 3S27A 3EX9A 4AEQA 4N6LA 1JKGA 3V99A 1DVCA 2PZVA 3EE1A 3CCU3 1SPUA 3JUOA 3NBJA 2OCTA 2V1LA 3OV4A 1GS3A 4L8PA 1GOUA 1B2XA 1Y4KA 1GSPA 4EYCA 2F56A 2FNQA 1TFOA 1TUHA 2PNCA 3DGNA 4CPKA 4Q53A 5HOHA 1OPYA 4X2HA 2XGNA 1MWRA 3F7SA 1ZO2A 2CFGA 2FXTA 3CPW2 1GY5A 2XFSA 1QVG2 1MGRA 1YVSA 1NWWA 3SVAA 1BUQA 3D5IA 1GD3A 2C11A 1VQO3 1OH0A 1KSIA 1TFKA 4I4KA 2XR8B 1RLSA 1BSBA 1FYSA 1V58A 1WQLB 1RKYA 1RDSA 2KRTA 2WOFA 3DH2A 1VQM3 3OWUA 2F86B 1UGIA 3F8XA 1T3BA 1BNSA 4LSOA 3VF1A 1VQQA 8RNTA 1EG9B 4J5KA 2Z76A 2RBIA 1Q824 4WYKB 1VQL3 2ZDJA 5BXQA 1D6ZA 2OOVC 1K734 3L0RA 2ML6A 4H3UA 2ZL8A 3HIGA 2QEX3 5IG4A 2AADA 1RGFA 4CJNA 1SJWA 2HMKB 1YI23 3TDGA 3EN8A 3I553 2ZHXB 3D9RA 1KWIA 2H0HA 4XBYA 1ZGXA 1ROVA 3Q3FA 1OGZA 4GB5A 4BL3A 4WYKA 1AR0A 3LTBA 2ML5A 4N6UA 2HMMB 1CH0A 4IIAA 5IERA 1EEJA 2CFDA 4GSPA 4I5QA 1PYLA 1QMAA 3WHOA 5RNTA 1Q814 1TP6A 4BTXA 1I0VA 2CH9A 2CG0A 1VQ73 1JBTA 2W0QA 1OHPA 1RCLA 1BUJA 1M1XB 3EBTA 3CCE3 3X3ZA 3K0ZA 1KD14 2MC8A 1T5YA 1TU5A 1YJN3 1PU4A 2B1XB 1UI7A 4NHFA 3LTDA 5AIIA 1UCLA 4EXRA 1ULJB 1ULIB 1LOYA 3CPOA 1JB2A 1LOVA 3QRDA 4N6NB 2OQEA 3STDA 3T8UA 1IVUA 3DY5A 3KSED 3LH4A 3DGOA 1VQ63 1B20A 1D6UA 4LZIA 5KP4A 1OACA 1CYVA 2F99A 4R9LA 5CF2A 1Q9EA 3OW22 5CK6A 1VQP3 3S29A 5STDA 1K8A4 5FW5A 1O7GB 5EVHA 2E2TA 4RNTA 3NBBA 1A67A 3X3YA 3G4S3 1F8NA 3UNLA 1HKXA 4J5GA 5IEOA 4IPBA 1RGCA 1RHLA 1GMQA 2L1SA 3LYGA 2CWTA 4X2OA 3EB8A 3EHCA 1JN5B 1N8R4 1WMOA 1DE3A 1VQK3 3F7XA 1ZS7A 5HGRA 1A2VA 1GYBA 4XM4A 1GY7A 1BSDA 1X1WA 3CNXA 4O8SA 3X40A 4WWUC 2K0MA 4U13A 2YFIB 1GOYA 3NQYA 3WA2X 1JN5A 1IV9A 1SIIA 1IK3A 1HU9A 4JF8A 1M9GA 1N9EA 2J8XB 1ROAA 1I70A 2XGLA 6GSPA 3S5CA 1UI8A 2Q07A 5CF1A 1I2GA 1IVVA 2KF6A 2XH9A 2HMJB 3ZG0A 1BNEA 2FGTA 1Q40B 1IV7A 3Q90A 2O9UX 1S5AA 1OHSA 1BNRA 1STFI 4LYLB 1JJ22 1SQWA 1V74A 2W2CA 3ECFA 3MG2A 2CX1A 3N54B 1MNLA 2Y74A 2B24B 2RGQA 3K7CA 2LYXA 2IUJA 1Q40A 3AHSA 1IVXA 2W9PA 3DMCA 4EW5A 3PGBA 2KF5A 1NB3I 3CC23 1W01A 2W6JH 4ILFA 3A76A 1EA2A 2YFJB 3J7Yd 4TX4A 1YNVX 2KAAA 3KN4A 3OWYA 1IQXA 5BU4A 1VQ83 2BHMA 3IJEB 1BOXA 1RTUA 2UUGC 3F9SA 3KE7A 4XDVA 1L5GB 2GXFA 2CWUA 3DZLA 2WGQA 1JBRA 1O7NB 2XSHB 3M8CA 3I563 4XBXA 1G96A 1U8CB 2I9WA 3WOEB 9RNTA 1YIJ3 1J2BA 3BU4A 4CCVA 1NNVA 1A90A 2CW9A 1BNFA 2O3OA 3B4OA 3HZPA 3Q2PA 2BMRB 3D5GA 1RGGA 4FCMA 1Q42A 4R1KA 4EC6A 1T2HA 1VQ93 5AEUB 1T2IA 3GRDA 5IG5A 2OOVA 2W56B 2XSOB 5D81A 2BMOB 4MJDA 4RNZA 2F98A 3GZXB 4BL2A 6RNTA 1VZZA 1RN1A 1UUGB 4N6OB 1NU3A 1RGAA 3I0YA 5AEWB 1AV4A 3PS8A 4L8OA 2JQ5A 1YIT3 1QVF2 3NXJA 1Z1SA 5ELJA 1YGWA 4HKVB 4RZMA 1RCKA 1BAOA 1W6CA 1NDOB 4G1MB 4HM5B 2W56A 3G0KA 1O7WB 3BNCA 3FF2A 2CKFB 3D4AA 3DM8A 3GWRA 4N3VA 2K54A 3U97A 1R4CA 1RRLA 4FMBA 1BRSA 3NQZA 1VQN3 3DUKA 3JUPA 1NO3A 4DKIA 1I2FA 3FZWA 5AIFA 1K41A 3MHEA 4XB5A 1UUWB 5IG0A 1B2SA 2YFLB 3G16A 1R4YA 1W7CA 1GD4A 3OWSA 1BRGA 5IF6A 1LOWA 1BGSA 4HM3B 1JZOA 3KSPA 3V98A 1LRAA 1IQ8A 2XEPA 3EJVA 3NV0B 1BVIA 3CMA3 1TIJA 3X3XA 1BRJA 5DRVA 1I2EA 1FA3A 1BRIA 1DMMA 2D1WA 4J9AA 3T0UA 5A0OB 5EEOA 1CEWI 4HVNA 3B4PA 3ER7A 1UDII 3F40A 3CCL3 3FSDA 1MWTA 2A15A 2SBLA 2CHCA 2E2UA 1UGHI 2OTJ3 3NV0A 2MF7A 3F14A 2F5MA 2P05A 3HI7A 1M904 5D82A 4BU4A 1G0TA 1WNHA 2XF3A 4KFEA 3KKGA 1IDPA 3VGNA 3Q1CA 3SX1A 3FCSB 3IMAB 1YJW3 1OHOA 1BSCA 3JVCA 1UCJA 3WR2A 3B7CA 5IW9A 2JDIH 3BNEA 1LXEA 4HYZA 1BIRA 2GU1A 1JZDA 4FCJA 1FUSA 1OGXA 2P38A 3GAXA 1E97A 3HOHA 2YX9A 1N8QA 3WODG 2L4VA 3GSPA 2IMJA 3G6E3 1W2ZA 2Z7AA 3LMLA 3B8LA 3CCS3 4FCZA 5FGOA 4HM1B 1JB4A 1X1UA 2GSPA 1QJGA 1LQMB 3KFQC 2IY2A 1FGTA 1B21A 7GSPA 1I3FA 3PYJA 4MMZB 5M18A 1FUTA 3N8BA 3MWZA 2GEXA 3ALAA 2HMOB 2AAEA 4AKYA 4IT7A 1JNQA 3NUVA 4N6MA 2CFLA 4WP5A 4N6V0 3V92A 5JBSA 1C54A 1K28A 4JRFA 4NREA 4MEIA 2P09A 1CQSA
chains in the Genus database with same CATH topology
4BTWA 2R4IA 4L7KA 2XFTA 1W5ZA 1FGOA 4RBNA 3EQQB 4KZ1A 3FG4A 4OUQA 1WMNA 3N9HA 3O8YA 3H51A 3MYTA 4GL6A 3D3LA 3K5TA 1M1K4 5IG3A 4EV5A 3NHXA 4HBRA 1QAFA 2CWVA 2P0MA 2XRXB 3KIIA 1O7MB 2INXA 2KCDA 2M7OA 3RGAA 3VSYA 3UJMA 2WGOA 1O7HB 1JB5A 3G8ZA 3CU3A 1IQYA 2CK3H 2BT3A 1YVBI 3BB9A 1DMQA 3F8HA 4PEJA 3QK9A 4STDA 4J8TA 3BLZA 3GZYB 3FG3A 4FR9A 1A2KA 3GZBA 5CXOA 1WMPA 1OUNA 3MG3A 3ROBA 1LOXA 3FF0A 2WOHA 2IA7A 1YHQ3 2GU3A 5AIGA 2P0XA 2RSXA 4R80A 2GEYA 5G2GA 1RN7A 1QAKA 1YJ93 1LVNA 2E2VA 1ISKA 3WDGB 1U5OA 3PXMA 1RRHA 3SLUA 3LZAA 2WO0A 3JUMA 3UL6A 3SXXA 1EQKA 3NBRA 3CCR3 1LNHA 3LOYA 3PCRA 3S67A 1UUVB 3H3HA 1AVKA 3U1WA 3HK4A 2BNGA 1ASKA 3JUNA 1JV2B 2BO9B 1VQ53 4HZ9B 3FLJA 2BMQB 3SOAA 1W6YA 4HM4B 3CCQ3 4FMDA 1W02A 1YGEA 4MMXB 3X42A 4HM7B 4O02B 3FKAA 2D42A 3NM7A 4MMYB 4ZM8A 3MKIA 3MSOA 1FGRA 4WHAA 2GBXB 4AKZA 3HIIA 3LT8A 3LXUX 3FG1A 4N6TA 1RJOA 2Z6BA 3CNMA 2GBWB 3T8NA 1N9JA 3CC73 4HM8B 1FUWA 4EV2A 1C7HA 3GZRA 2OTL3 3EN1B 1PFPA 4K1VA 4K90B 4KVHA 5EQLA 1ZX2A 4R4KA 1W4NA 4LGQA 3CCM3 5LC6A 1IVWA 1US1A 2STDA 4QWTA 3CME3 3SEDA 3FH1A 2QA43 1NB5I 5AYSC 3DXOA 4XDWA 1DMNA 2C10A 2Z77A 1Q864 3RGRA 3AMOB 2W03A 1JRQA 3BNBA 2CIUA 5LC7A 3OXAA 4LEHA 3LT9A 2Y73A 4HZBB 4K61A 5IEPA 3EC9A 5AYRB 1STDA 3K9MC 1NJI4 2HMNB 3AMOA 5TGNA 3NX0A 1DVDA 5DREA 1Q7Y4 3CD63 2CG1A 5CLKA 1UW1A 1IU7A 2CFKA 1OF5B 3E99A 1E3VA 5KP1A 4O3VA 5JPPA 1IT7A 2KXGA 3DGLA 3MG1A 3EF8A 4HJLB 4K1UA 3WA3A 4FMAA 1OF5A 1VQ43 2OQEC 2CFWA 1WTHA 6STDA 1DYUA 1OCVA 1K9M4 7STDA 3G713 1D6YA 4HM6B 4BTYA 1N5PA 1O7PB 1EKMA 2RFRA 3FGYA 4R9KA 3PZWA 2W9QA 3UL5A 4XBTA 1SIHA 5JPUA 3DGMA 4CDLA 3EBYA 2QIYA 1AVLA 3LTCA 3CCV3 4HM2B 2RCDA 5KP3A 4OK0A 3LTAA 4OVMA 4EBGA 4KFFA 8CHOA 1N5HA 1W2B2 3JUQA 1IT8A 1W6GA 3IPTA 1MOLA 3SOYA 2CC3A 5AIHA 2OWPA 3HX8A 2HMLB 3BNDA 3WOFB 5I97A 4FMCA 4RNYA 3S28A 1KC84 3MPHA 3OX9A 4O2HA 3RDEA 5BVBA 3CC43 1CYUA 3CCJ3 4ORLA 4LMIA 1FGMA 1GY6A 4H61A 4KFDA 1JKGB 1KQS2 3UB1A 1QALA 3NM2A 1E3RA 2W04A 4WFOA 2LQVA 5IENA 1S723 2QGUA 3X41A 1W00A 3K63A 5AI1A 3PCSA 1FGQA 3KZTA 2IUKA 3CXC2 5D83A 4HM0B 5ELUA 2UX0A 3WMDA 3S27A 3EX9A 4AEQA 4N6LA 1JKGA 3V99A 1DVCA 2PZVA 3EE1A 3CCU3 1SPUA 3JUOA 3NBJA 2OCTA 2V1LA 3OV4A 1GS3A 4L8PA 1Y4KA 4EYCA 2FNQA 1TFOA 1TUHA 2PNCA 3DGNA 4Q53A 1OPYA 4X2HA 2XGNA 3F7SA 1ZO2A 2CFGA 2FXTA 3CPW2 1GY5A 2XFSA 1QVG2 1NWWA 3SVAA 1BUQA 1GD3A 2C11A 1VQO3 1OH0A 1KSIA 1TFKA 4I4KA 2XR8B 1WQLB 1RKYA 2KRTA 2WOFA 1VQM3 3OWUA 2F86B 3F8XA 3VF1A 4LSOA 1EG9B 2Z76A 1Q824 4WYKB 1VQL3 2ZDJA 5BXQA 1D6ZA 2OOVC 1K734 3L0RA 2ML6A 4H3UA 2ZL8A 3HIGA 2QEX3 5IG4A 1SJWA 2HMKB 1YI23 3TDGA 3EN8A 3I553 3D9RA 1KWIA 4XBYA 1ROVA 1OGZA 4GB5A 4WYKA 1AR0A 3LTBA 2ML5A 4N6UA 2HMMB 4IIAA 5IERA 2CFDA 1QMAA 1Q814 1TP6A 4BTXA 2CH9A 2CG0A 1VQ73 2W0QA 1OHPA 1M1XB 3EBTA 3CCE3 3X3ZA 3K0ZA 1KD14 2MC8A 1T5YA 1TU5A 1YJN3 1PU4A 2B1XB 1UI7A 4NHFA 3LTDA 5AIIA 4EXRA 1ULJB 1ULIB 3CPOA 1JB2A 3QRDA 4N6NB 2OQEA 3STDA 3T8UA 1IVUA 3DY5A 3KSED 3LH4A 3DGOA 1VQ63 4LZIA 1D6UA 5KP4A 1OACA 1CYVA 2F99A 4R9LA 5CF2A 3OW22 5CK6A 1VQP3 3S29A 5STDA 1K8A4 5FW5A 1O7GB 5EVHA 2E2TA 3NBBA 1A67A 3X3YA 3G4S3 1F8NA 3UNLA 1HKXA 5IEOA 4IPBA 3LYGA 4X2OA 2CWTA 3EB8A 3EHCA 1JN5B 1N8R4 1WMOA 1VQK3 3F7XA 5HGRA 1A2VA 1GYBA 4XM4A 1GY7A 3CNXA 4O8SA 3X40A 4WWUC 2K0MA 4U13A 2YFIB 3NQYA 3WA2X 1JN5A 1IV9A 1SIIA 1IK3A 1HU9A 4JF8A 1M9GA 1N9EA 1ROAA 2XGLA 3S5CA 1UI8A 2Q07A 5CF1A 1IVVA 2XH9A 2HMJB 2FGTA 1Q40B 1IV7A 3Q90A 2O9UX 1S5AA 1OHSA 1STFI 1JJ22 1SQWA 1V74A 2W2CA 3ECFA 3MG2A 3N54B 1MNLA 2Y74A 2B24B 2RGQA 3K7CA 2LYXA 2IUJA 1Q40A 1IVXA 2W9PA 3DMCA 3PGBA 1NB3I 3CC23 1W01A 2W6JH 3A76A 1EA2A 2YFJB 3J7Yd 4TX4A 3KN4A 3OWYA 1IQXA 1VQ83 2BHMA 3IJEB 3KE7A 3F9SA 4XDVA 1L5GB 2GXFA 2CWUA 3DZLA 2WGQA 1O7NB 2XSHB 3M8CA 3I563 4XBXA 1G96A 1U8CB 2I9WA 3WOEB 1YIJ3 1J2BA 4CCVA 1A90A 2CW9A 2O3OA 3B4OA 3HZPA 3Q2PA 2BMRB 4EC6A 4FCMA 1Q42A 4R1KA 1VQ93 5AEUB 3GRDA 5IG5A 2OOVA 2W56B 2XSOB 5D81A 2BMOB 4MJDA 4RNZA 2F98A 3GZXB 1VZZA 4N6OB 1NU3A 3I0YA 5AEWB 1YIT3 1AV4A 3PS8A 4L8OA 2JQ5A 1QVF2 3NXJA 1Z1SA 5ELJA 4HKVB 4RZMA 1W6CA 1NDOB 4G1MB 4HM5B 2W56A 3G0KA 1O7WB 3BNCA 3FF2A 2CKFB 3DM8A 3GWRA 4N3VA 2K54A 3U97A 1R4CA 1RRLA 4FMBA 3NQZA 1VQN3 3DUKA 3JUPA 1NO3A 3FZWA 5AIFA 1K41A 3MHEA 4XB5A 1UUWB 5IG0A 2YFLB 3G16A 1W7CA 1GD4A 3OWSA 5IF6A 4HM3B 3KSPA 3V98A 1IQ8A 2XEPA 3EJVA 3NV0B 3CMA3 1TIJA 3X3XA 5DRVA 1FA3A 1DMMA 2D1WA 4J9AA 3T0UA 5A0OB 5EEOA 1CEWI 4HVNA 3B4PA 3ER7A 3F40A 3CCL3 3FSDA 2A15A 2SBLA 2CHCA 2E2UA 2OTJ3 3NV0A 2MF7A 3F14A 2P05A 3HI7A 1M904 5D82A 1WNHA 2XF3A 4KFEA 3KKGA 1IDPA 3VGNA 3Q1CA 3SX1A 3FCSB 3IMAB 1YJW3 1OHOA 3JVCA 3B7CA 5IW9A 2JDIH 3BNEA 1LXEA 4HYZA 2GU1A 4FCJA 1OGXA 2P38A 3GAXA 1E97A 2YX9A 1N8QA 3WODG 2L4VA 2IMJA 3G6E3 1W2ZA 2Z7AA 3LMLA 3B8LA 3CCS3 4FCZA 5FGOA 4HM1B 1JB4A 1QJGA 3KFQC 1FGTA 3PYJA 4MMZB 3N8BA 3MWZA 2GEXA 3ALAA 2HMOB 4AKYA 4IT7A 1JNQA 3NUVA 4N6MA 2CFLA 4WP5A 4N6V0 3V92A 5JBSA 1K28A 4JRFA 4NREA 4MEIA 2P09A 1CQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4I A;  4L7K A;  3EQQ B;  4OUQ A;  3H51 A;  3MYT A;  5IG3 A;  3NHX A;  2XRX B;  1O7M B;  2INX A;  3RGA A;  3VSY A;  3UJM A;  1O7H B;  1JB5 A;  3G8Z A;  3CU3 A;  3BB9 A;  1DMQ A;  3F8H A;  4PEJ A;  4STD A;  4J8T A;  3BLZ A;  3GZY B;  1A2K A;  3GZB A;  5CXO A;  1OUN A;  3MG3 A;  3ROB A;  3FF0 A;  5AIG A;  2GEY A;  5G2G A;  1ISK A;  1U5O A;  3LZA A;  3JUM A;  3NBR A;  1UUV B;  3H3H A;  3HK4 A;  2BNG A;  1ASK A;  3JUN A;  4HZ9 B;  3FLJ A;  2BMQ B;  3SOA A;  1W6Y A;  4HM4 B;  1W02 A;  4HM7 B;  3FKA A;  3MKI A;  3MSO A;  2GBX B;  3CNM A;  2GBW B;  3T8N A;  4HM8 B;  1C7H A;  3GZR A;  3EN1 B;  4K1V A;  4KVH A;  1ZX2 A;  4LGQ A;  2STD A;  3SED A;  3FH1 A;  3DXO A;  4XDW A;  1DMN A;  2Z77 A;  3RGR A;  3OXA A;  4LEH A;  4HZB B;  5IEP A;  3EC9 A;  1STD A;  2HMN B;  5TGN A;  5DRE A;  5CLK A;  1OF5 B;  3E99 A;  1E3V A;  5KP1 A;  5JPP A;  3MG1 A;  3EF8 A;  4HJL B;  4K1U A;  1OF5 A;  6STD A;  1OCV A;  7STD A;  4HM6 B;  1O7P B;  2RFR A;  3FGY A;  4R9K A;  4XBT A;  5JPU A;  4CDL A;  3EBY A;  2QIY A;  4HM2 B;  2RCD A;  5KP3 A;  4OVM A;  8CHO A;  3JUQ A;  3IPT A;  3SOY A;  5AIH A;  2OWP A;  3HX8 A;  2HML B;  3OX9 A;  5BVB A;  4ORL A;  4LMI A;  1GY6 A;  1JKG B;  3NM2 A;  1E3R A;  5IEN A;  2QGU A;  1W00 A;  5AI1 A;  3KZT A;  5D83 A;  4HM0 B;  3WMD A;  2UX0 A;  3EX9 A;  1JKG A;  2PZV A;  3JUO A;  3OV4 A;  1GS3 A;  4L8P A;  1TUH A;  4Q53 A;  1OPY A;  4X2H A;  3F7S A;  1ZO2 A;  1GY5 A;  1NWW A;  1BUQ A;  1OH0 A;  4I4K A;  2XR8 B;  1WQL B;  3OWU A;  2F86 B;  3F8X A;  1EG9 B;  2Z76 A;  4WYK B;  5BXQ A;  4H3U A;  5IG4 A;  1SJW A;  2HMK B;  3EN8 A;  3D9R A;  4XBY A;  1OGZ A;  4GB5 A;  4WYK A;  1AR0 A;  2HMM B;  4IIA A;  5IER A;  1QMA A;  1TP6 A;  1OHP A;  3EBT A;  3K0Z A;  2B1X B;  5AII A;  1ULJ B;  1ULI B;  3CPO A;  1JB2 A;  3STD A;  3T8U A;  5KP4 A;  2F99 A;  4R9L A;  5CF2 A;  5CK6 A;  5STD A;  5FW5 A;  1O7G B;  5EVH A;  3UNL A;  1HKX A;  5IEO A;  3LYG A;  4X2O A;  3EHC A;  1JN5 B;  3F7X A;  5HGR A;  1GYB A;  4XM4 A;  1GY7 A;  3CNX A;  4WWU C;  4U13 A;  2YFI B;  1JN5 A;  3S5C A;  5CF1 A;  2HMJ B;  1Q40 B;  3Q90 A;  1S5A A;  1OHS A;  2W2C A;  3ECF A;  3MG2 A;  2B24 B;  2RGQ A;  3K7C A;  1Q40 A;  3DMC A;  1W01 A;  3A76 A;  1EA2 A;  2YFJ B;  3OWY A;  3KE7 A;  3F9S A;  4XDV A;  2GXF A;  3DZL A;  1O7N B;  2XSH B;  3M8C A;  4XBX A;  2I9W A;  3B4O A;  3HZP A;  2BMR B;  4FCM A;  1Q42 A;  4R1K A;  5AEU B;  3GRD A;  5IG5 A;  2XSO B;  5D81 A;  2BMO B;  4MJD A;  2F98 A;  3GZX B;  1VZZ A;  5AEW B;  1NU3 A;  3I0Y A;  4L8O A;  2JQ5 A;  3NXJ A;  1Z1S A;  4HKV B;  4RZM A;  1NDO B;  4HM5 B;  3G0K A;  1O7W B;  3FF2 A;  2CKF B;  3DM8 A;  3GWR A;  4N3V A;  2K54 A;  3DUK A;  3JUP A;  3FZW A;  5AIF A;  1K41 A;  3MHE A;  4XB5 A;  1UUW B;  5IG0 A;  2YFL B;  3G16 A;  3OWS A;  5IF6 A;  4HM3 B;  3KSP A;  3EJV A;  3NV0 B;  5DRV A;  1DMM A;  4J9A A;  4HVN A;  3B4P A;  3ER7 A;  3F40 A;  3FSD A;  2A15 A;  2CHC A;  3NV0 A;  3F14 A;  5D82 A;  3KKG A;  1IDP A;  3VGN A;  1OHO A;  3B7C A;  4FCJ A;  1OGX A;  1E97 A;  2IMJ A;  2Z7A A;  3B8L A;  4HM1 B;  1JB4 A;  1QJG A;  2GEX A;  2HMO B;  3NUV A;  4WP5 A;  1CQS A; 
#chains in the Genus database with same CATH topology
 4BTW A;  2R4I A;  4L7K A;  2XFT A;  1W5Z A;  1FGO A;  1RGH A;  4RBN A;  3EQQ B;  4KZ1 A;  1GMR A;  3FG4 A;  1B2M A;  4OUQ A;  1WMN A;  3N9H A;  3O8Y A;  1HYF A;  3H51 A;  3MYT A;  4GL6 A;  3D3L A;  3K5T A;  1M1K 4;  5IG3 A;  2RNT A;  4EV5 A;  1BSA A;  3KCH A;  3NHX A;  4HBR A;  1QAF A;  2CWV A;  3BIR A;  1EUI C;  2P0M A;  2XRX B;  3KII A;  1O7M B;  2INX A;  2KCD A;  1G02 A;  1BRH A;  2M7O A;  3AGO A;  4NPB A;  1BNI A;  1I3I A;  1FW7 A;  3RGA A;  3VSY A;  2K3D A;  3UJM A;  2WGO A;  1LQG C;  1O7H B;  2H0G A;  1JB5 A;  2F4Y A;  3CU3 A;  3G8Z A;  1IQY A;  2CK3 H;  2BT3 A;  1YVB I;  3BB9 A;  1DMQ A;  3F8H A;  4PEJ A;  3QK9 A;  4STD A;  1TJD A;  4J8T A;  1RGK A;  1TRP A;  3BLZ A;  1MGW A;  3FG3 A;  3GZY B;  4FR9 A;  1A2K A;  3GZB A;  5CXO A;  1WMP A;  1OUN A;  1BSE A;  3MG3 A;  3ROB A;  1LOX A;  3FF0 A;  2WOH A;  2IA7 A;  1YHQ 3;  1B2Z A;  2GU3 A;  5AIG A;  2P0X A;  2RSX A;  4R80 A;  2GEY A;  1B3S A;  5G2G A;  1RN7 A;  1QAK A;  1YJ9 3;  2F5W A;  1LVN A;  1RNB A;  2E2V A;  1ISK A;  3WDG B;  1U5O A;  3PXM A;  1RRH A;  3SLU A;  3LZA A;  2WO0 A;  3JUM A;  3UL6 A;  3DGY A;  3SXX A;  1EQK A;  3NBR A;  3AHW A;  1RGL A;  3CCR 3;  1LNH A;  3LOY A;  3PCR A;  3S67 A;  1UUV B;  3H3H A;  1AVK A;  3U1W A;  3HK4 A;  2BNG A;  1ASK A;  3JUN A;  1JV2 B;  2C4B A;  2BO9 B;  5M19 A;  1VQ5 3;  4HZ9 B;  3FLJ A;  2BMQ B;  2CX0 A;  4HOH A;  3SOA A;  1W6Y A;  4HM4 B;  3CCQ 3;  1FZU A;  2R41 A;  4FMD A;  1W02 A;  3SYU A;  2IYJ A;  1X1X A;  1YGE A;  4MMX B;  3X42 A;  4HM7 B;  4O02 B;  3FKA A;  2D42 A;  3NM7 A;  4MMY B;  4ZM8 A;  3MKI A;  3MSO A;  1B27 A;  1FGR A;  1HZ1 A;  2KF3 A;  4WHA A;  2GBX B;  2KF4 A;  4AKZ A;  3HII A;  1RNT A;  3LT8 A;  3LXU X;  1BNJ A;  3FG1 A;  4N6T A;  1PY3 A;  1RJO A;  2Z6B A;  3CNM A;  2GBW B;  3T8N A;  1N9J A;  3ZG5 A;  3CC7 3;  4HM8 B;  1B2U A;  1FUW A;  4EV2 A;  1C7H A;  3GZR A;  3D79 A;  2OTL 3;  3EN1 B;  1PFP A;  4K1V A;  4K90 B;  4KVH A;  5EQL A;  3URP A;  1X1Y A;  1ZX2 A;  4R4K A;  1W4N A;  4LGQ A;  3CCM 3;  5LC6 A;  4HAA A;  1IVW A;  1US1 A;  2STD A;  4QWT A;  3CME 3;  3SED A;  3FH1 A;  2QA4 3;  1NB5 I;  1AY7 A;  5AYS C;  1TRQ A;  3DXO A;  1BRN L;  2HOH A;  4XDW A;  1DMN A;  2C10 A;  2Z77 A;  1Q86 4;  3RGR A;  3AMO B;  2W03 A;  1JRQ A;  1V57 A;  3BNB A;  2CIU A;  5LC7 A;  1BRK A;  3OXA A;  4LEH A;  3LT9 A;  1I0X A;  2Y73 A;  1BNG A;  4HZB B;  4K61 A;  3RNT A;  5IEP A;  3EC9 A;  5AYR B;  1STD A;  3K9M C;  1NJI 4;  2ZA4 A;  1RGE A;  2HMN B;  3AMO A;  5TGN A;  3NX0 A;  1DVD A;  4GHO A;  5DRE A;  1Q7Y 4;  3CD6 3;  2CG1 A;  1LNI A;  5CLK A;  1UW1 A;  1IU7 A;  2CFK A;  1OF5 B;  3E99 A;  1RN4 A;  2BU4 A;  1E3V A;  5KP1 A;  4O3V A;  1RSN A;  5JPP A;  1IT7 A;  2KXG A;  3DGL A;  3MG1 A;  3EF8 A;  4HJL B;  4K1U A;  1RMS A;  1Q7H A;  1BAN A;  3WA3 A;  4FMA A;  1OF5 A;  1VQ4 3;  5G1L A;  2OQE C;  2CFW A;  1WTH A;  1SAR A;  2UGI A;  1DYU A;  1I8V A;  1OCV A;  6STD A;  1K9M 4;  1MWS A;  2BIR A;  7STD A;  1D6Y A;  3G71 3;  4HM6 B;  4BTY A;  1N5P A;  1O7P B;  1EKM A;  2RFR A;  3FGY A;  4R9K A;  3AGN A;  3PZW A;  3A5E A;  1MWU A;  2W9Q A;  2SAR A;  3UL5 A;  4XBT A;  4BIR A;  1SIH A;  5JPU A;  3DGM A;  4CDL A;  1IYY A;  3EBY A;  2QIY A;  1AVL A;  3LTC A;  3ZFZ A;  4HM2 B;  2RCD A;  5KP3 A;  3CCV 3;  4OK0 A;  5G1K A;  1DET A;  3LTA A;  1TTO A;  4OVM A;  4EBG A;  4KFF A;  8CHO A;  1N5H A;  1W2B 2;  3JUQ A;  1IT8 A;  1W6G A;  2H0I A;  3IPT A;  1MOL A;  3SOY A;  2CC3 A;  5AIH A;  2OWP A;  3HX8 A;  2HML B;  3BND A;  3WOF B;  5I97 A;  4FMC A;  4RNY A;  3S28 A;  1GMP A;  7RNT A;  1KC8 4;  3MPH A;  3OX9 A;  4O2H A;  1UCK A;  3RDE A;  5BVB A;  3CC4 3;  1CYU A;  3CCJ 3;  4ORL A;  1JBS A;  4LMI A;  1FGM A;  1GY6 A;  4H61 A;  4KFD A;  1JKG B;  1AQZ A;  1GOV A;  5M1A A;  1KQS 2;  5GSP A;  4KT3 B;  3UB1 A;  1QAL A;  3NM2 A;  1E3R A;  2W04 A;  4WFO A;  2LQV A;  5IEN A;  1S72 3;  2QGU A;  3X41 A;  1W00 A;  1UCI A;  3K63 A;  5AI1 A;  3PCS A;  1FGQ A;  3KZT A;  1BU4 A;  2IUK A;  3CXC 2;  5D83 A;  4HM0 B;  5ELU A;  1A2P A;  2UX0 A;  3WMD A;  5BIR A;  3S27 A;  3EX9 A;  4AEQ A;  4N6L A;  1JKG A;  3V99 A;  1DVC A;  2PZV A;  3EE1 A;  3CCU 3;  1SPU A;  3JUO A;  3NBJ A;  2OCT A;  2V1L A;  3OV4 A;  1GS3 A;  4L8P A;  1GOU A;  1B2X A;  1Y4K A;  1GSP A;  4EYC A;  2F56 A;  2FNQ A;  1TFO A;  1TUH A;  2PNC A;  3DGN A;  4CPK A;  4Q53 A;  5HOH A;  1OPY A;  4X2H A;  2XGN A;  1MWR A;  3F7S A;  1ZO2 A;  2CFG A;  2FXT A;  3CPW 2;  1GY5 A;  2XFS A;  1QVG 2;  1MGR A;  1YVS A;  1NWW A;  3SVA A;  1BUQ A;  3D5I A;  1GD3 A;  2C11 A;  1VQO 3;  1OH0 A;  1KSI A;  1TFK A;  4I4K A;  2XR8 B;  1RLS A;  1BSB A;  1FYS A;  1V58 A;  1WQL B;  1RKY A;  1RDS A;  2KRT A;  2WOF A;  3DH2 A;  1VQM 3;  3OWU A;  2F86 B;  1UGI A;  3F8X A;  1T3B A;  1BNS A;  4LSO A;  3VF1 A;  1VQQ A;  8RNT A;  1EG9 B;  4J5K A;  2Z76 A;  2RBI A;  1Q82 4;  4WYK B;  1VQL 3;  2ZDJ A;  5BXQ A;  1D6Z A;  2OOV C;  1K73 4;  3L0R A;  2ML6 A;  4H3U A;  2ZL8 A;  3HIG A;  2QEX 3;  5IG4 A;  2AAD A;  1RGF A;  4CJN A;  1SJW A;  2HMK B;  1YI2 3;  3TDG A;  3EN8 A;  3I55 3;  2ZHX B;  3D9R A;  1KWI A;  2H0H A;  4XBY A;  1ZGX A;  1ROV A;  3Q3F A;  1OGZ A;  4GB5 A;  4BL3 A;  4WYK A;  1AR0 A;  3LTB A;  2ML5 A;  4N6U A;  2HMM B;  1CH0 A;  4IIA A;  5IER A;  1EEJ A;  2CFD A;  4GSP A;  4I5Q A;  1PYL A;  1QMA A;  3WHO A;  5RNT A;  1Q81 4;  1TP6 A;  4BTX A;  1I0V A;  2CH9 A;  2CG0 A;  1VQ7 3;  1JBT A;  2W0Q A;  1OHP A;  1RCL A;  1BUJ A;  1M1X B;  3EBT A;  3CCE 3;  3X3Z A;  3K0Z A;  1KD1 4;  2MC8 A;  1T5Y A;  1TU5 A;  1YJN 3;  1PU4 A;  2B1X B;  1UI7 A;  4NHF A;  3LTD A;  5AII A;  1UCL A;  4EXR A;  1ULJ B;  1ULI B;  1LOY A;  3CPO A;  1JB2 A;  1LOV A;  3QRD A;  4N6N B;  2OQE A;  3STD A;  3T8U A;  1IVU A;  3DY5 A;  3KSE D;  3LH4 A;  3DGO A;  1VQ6 3;  1B20 A;  1D6U A;  4LZI A;  5KP4 A;  1OAC A;  1CYV A;  2F99 A;  4R9L A;  5CF2 A;  1Q9E A;  3OW2 2;  5CK6 A;  1VQP 3;  3S29 A;  5STD A;  1K8A 4;  5FW5 A;  1O7G B;  5EVH A;  2E2T A;  4RNT A;  3NBB A;  1A67 A;  3X3Y A;  3G4S 3;  1F8N A;  3UNL A;  1HKX A;  4J5G A;  5IEO A;  4IPB A;  1RGC A;  1RHL A;  1GMQ A;  2L1S A;  3LYG A;  2CWT A;  4X2O A;  3EB8 A;  3EHC A;  1JN5 B;  1N8R 4;  1WMO A;  1DE3 A;  1VQK 3;  3F7X A;  1ZS7 A;  5HGR A;  1A2V A;  1GYB A;  4XM4 A;  1GY7 A;  1BSD A;  1X1W A;  3CNX A;  4O8S A;  3X40 A;  4WWU C;  2K0M A;  4U13 A;  2YFI B;  1GOY A;  3NQY A;  3WA2 X;  1JN5 A;  1IV9 A;  1SII A;  1IK3 A;  1HU9 A;  4JF8 A;  1M9G A;  1N9E A;  2J8X B;  1ROA A;  1I70 A;  2XGL A;  6GSP A;  3S5C A;  1UI8 A;  2Q07 A;  5CF1 A;  1I2G A;  1IVV A;  2KF6 A;  2XH9 A;  2HMJ B;  3ZG0 A;  1BNE A;  2FGT A;  1Q40 B;  1IV7 A;  3Q90 A;  2O9U X;  1S5A A;  1OHS A;  1BNR A;  1STF I;  4LYL B;  1JJ2 2;  1SQW A;  1V74 A;  2W2C A;  3ECF A;  3MG2 A;  2CX1 A;  3N54 B;  1MNL A;  2Y74 A;  2B24 B;  2RGQ A;  3K7C A;  2LYX A;  2IUJ A;  1Q40 A;  3AHS A;  1IVX A;  2W9P A;  3DMC A;  4EW5 A;  3PGB A;  2KF5 A;  1NB3 I;  3CC2 3;  1W01 A;  2W6J H;  4ILF A;  3A76 A;  1EA2 A;  2YFJ B;  3J7Y d;  4TX4 A;  1YNV X;  2KAA A;  3KN4 A;  3OWY A;  1IQX A;  5BU4 A;  1VQ8 3;  2BHM A;  3IJE B;  1BOX A;  1RTU A;  2UUG C;  3F9S A;  3KE7 A;  4XDV A;  1L5G B;  2GXF A;  2CWU A;  3DZL A;  2WGQ A;  1JBR A;  1O7N B;  2XSH B;  3M8C A;  3I56 3;  4XBX A;  1G96 A;  1U8C B;  2I9W A;  3WOE B;  9RNT A;  1YIJ 3;  1J2B A;  3BU4 A;  4CCV A;  1NNV A;  1A90 A;  2CW9 A;  1BNF A;  2O3O A;  3B4O A;  3HZP A;  3Q2P A;  2BMR B;  3D5G A;  1RGG A;  4FCM A;  1Q42 A;  4R1K A;  4EC6 A;  1T2H A;  1VQ9 3;  5AEU B;  1T2I A;  3GRD A;  5IG5 A;  2OOV A;  2W56 B;  2XSO B;  5D81 A;  2BMO B;  4MJD A;  4RNZ A;  2F98 A;  3GZX B;  4BL2 A;  6RNT A;  1VZZ A;  1RN1 A;  1UUG B;  4N6O B;  1NU3 A;  1RGA A;  3I0Y A;  5AEW B;  1AV4 A;  3PS8 A;  4L8O A;  2JQ5 A;  1YIT 3;  1QVF 2;  3NXJ A;  1Z1S A;  5ELJ A;  1YGW A;  4HKV B;  4RZM A;  1RCK A;  1BAO A;  1W6C A;  1NDO B;  4G1M B;  4HM5 B;  2W56 A;  3G0K A;  1O7W B;  3BNC A;  3FF2 A;  2CKF B;  3D4A A;  3DM8 A;  3GWR A;  4N3V A;  2K54 A;  3U97 A;  1R4C A;  1RRL A;  4FMB A;  1BRS A;  3NQZ A;  1VQN 3;  3DUK A;  3JUP A;  1NO3 A;  4DKI A;  1I2F A;  3FZW A;  5AIF A;  1K41 A;  3MHE A;  4XB5 A;  1UUW B;  5IG0 A;  1B2S A;  2YFL B;  3G16 A;  1R4Y A;  1W7C A;  1GD4 A;  3OWS A;  1BRG A;  5IF6 A;  1LOW A;  1BGS A;  4HM3 B;  1JZO A;  3KSP A;  3V98 A;  1LRA A;  1IQ8 A;  2XEP A;  3EJV A;  3NV0 B;  1BVI A;  3CMA 3;  1TIJ A;  3X3X A;  1BRJ A;  5DRV A;  1I2E A;  1FA3 A;  1BRI A;  1DMM A;  2D1W A;  4J9A A;  3T0U A;  5A0O B;  5EEO A;  1CEW I;  4HVN A;  3B4P A;  3ER7 A;  1UDI I;  3F40 A;  3CCL 3;  3FSD A;  1MWT A;  2A15 A;  2SBL A;  2CHC A;  2E2U A;  1UGH I;  2OTJ 3;  3NV0 A;  2MF7 A;  3F14 A;  2F5M A;  2P05 A;  3HI7 A;  1M90 4;  5D82 A;  4BU4 A;  1G0T A;  1WNH A;  2XF3 A;  4KFE A;  3KKG A;  1IDP A;  3VGN A;  3Q1C A;  3SX1 A;  3FCS B;  3IMA B;  1YJW 3;  1OHO A;  1BSC A;  3JVC A;  1UCJ A;  3WR2 A;  3B7C A;  5IW9 A;  2JDI H;  3BNE A;  1LXE A;  4HYZ A;  1BIR A;  2GU1 A;  1JZD A;  4FCJ A;  1FUS A;  1OGX A;  2P38 A;  3GAX A;  1E97 A;  3HOH A;  2YX9 A;  1N8Q A;  3WOD G;  2L4V A;  3GSP A;  2IMJ A;  3G6E 3;  1W2Z A;  2Z7A A;  3LML A;  3B8L A;  3CCS 3;  4FCZ A;  5FGO A;  4HM1 B;  1JB4 A;  1X1U A;  2GSP A;  1QJG A;  1LQM B;  3KFQ C;  2IY2 A;  1FGT A;  1B21 A;  7GSP A;  1I3F A;  3PYJ A;  4MMZ B;  5M18 A;  1FUT A;  3N8B A;  3MWZ A;  2GEX A;  3ALA A;  2HMO B;  2AAE A;  4AKY A;  4IT7 A;  1JNQ A;  3NUV A;  4N6M A;  2CFL A;  4WP5 A;  4N6V 0;  3V92 A;  5JBS A;  1C54 A;  1K28 A;  4JRF A;  4NRE A;  4MEI A;  2P09 A;  1CQS A; 
#chains in the Genus database with same CATH homology
 4BTW A;  2R4I A;  4L7K A;  2XFT A;  1W5Z A;  1FGO A;  4RBN A;  3EQQ B;  4KZ1 A;  3FG4 A;  4OUQ A;  1WMN A;  3N9H A;  3O8Y A;  3H51 A;  3MYT A;  4GL6 A;  3D3L A;  3K5T A;  1M1K 4;  5IG3 A;  4EV5 A;  3NHX A;  4HBR A;  1QAF A;  2CWV A;  2P0M A;  2XRX B;  3KII A;  1O7M B;  2INX A;  2KCD A;  2M7O A;  3RGA A;  3VSY A;  3UJM A;  2WGO A;  1O7H B;  1JB5 A;  3G8Z A;  3CU3 A;  1IQY A;  2CK3 H;  2BT3 A;  1YVB I;  3BB9 A;  1DMQ A;  3F8H A;  4PEJ A;  3QK9 A;  4STD A;  4J8T A;  3BLZ A;  3GZY B;  3FG3 A;  4FR9 A;  1A2K A;  3GZB A;  5CXO A;  1WMP A;  1OUN A;  3MG3 A;  3ROB A;  1LOX A;  3FF0 A;  2WOH A;  2IA7 A;  1YHQ 3;  2GU3 A;  5AIG A;  2P0X A;  2RSX A;  4R80 A;  2GEY A;  5G2G A;  1RN7 A;  1QAK A;  1YJ9 3;  1LVN A;  2E2V A;  1ISK A;  3WDG B;  1U5O A;  3PXM A;  1RRH A;  3SLU A;  3LZA A;  2WO0 A;  3JUM A;  3UL6 A;  3SXX A;  1EQK A;  3NBR A;  3CCR 3;  1LNH A;  3LOY A;  3PCR A;  3S67 A;  1UUV B;  3H3H A;  1AVK A;  3U1W A;  3HK4 A;  2BNG A;  1ASK A;  3JUN A;  1JV2 B;  2BO9 B;  1VQ5 3;  4HZ9 B;  3FLJ A;  2BMQ B;  3SOA A;  1W6Y A;  4HM4 B;  3CCQ 3;  4FMD A;  1W02 A;  1YGE A;  4MMX B;  3X42 A;  4HM7 B;  4O02 B;  3FKA A;  2D42 A;  3NM7 A;  4MMY B;  4ZM8 A;  3MKI A;  3MSO A;  1FGR A;  4WHA A;  2GBX B;  4AKZ A;  3HII A;  3LT8 A;  3LXU X;  3FG1 A;  4N6T A;  1RJO A;  2Z6B A;  3CNM A;  2GBW B;  3T8N A;  1N9J A;  3CC7 3;  4HM8 B;  1FUW A;  4EV2 A;  1C7H A;  3GZR A;  2OTL 3;  3EN1 B;  1PFP A;  4K1V A;  4K90 B;  4KVH A;  5EQL A;  1ZX2 A;  4R4K A;  1W4N A;  4LGQ A;  3CCM 3;  5LC6 A;  1IVW A;  1US1 A;  2STD A;  4QWT A;  3CME 3;  3SED A;  3FH1 A;  2QA4 3;  1NB5 I;  5AYS C;  3DXO A;  4XDW A;  1DMN A;  2C10 A;  2Z77 A;  1Q86 4;  3RGR A;  3AMO B;  2W03 A;  1JRQ A;  3BNB A;  2CIU A;  5LC7 A;  3OXA A;  4LEH A;  3LT9 A;  2Y73 A;  4HZB B;  4K61 A;  5IEP A;  3EC9 A;  5AYR B;  1STD A;  3K9M C;  1NJI 4;  2HMN B;  3AMO A;  5TGN A;  3NX0 A;  1DVD A;  5DRE A;  1Q7Y 4;  3CD6 3;  2CG1 A;  5CLK A;  1UW1 A;  1IU7 A;  2CFK A;  1OF5 B;  3E99 A;  1E3V A;  5KP1 A;  4O3V A;  5JPP A;  1IT7 A;  2KXG A;  3DGL A;  3MG1 A;  3EF8 A;  4HJL B;  4K1U A;  3WA3 A;  4FMA A;  1OF5 A;  1VQ4 3;  2OQE C;  2CFW A;  1WTH A;  6STD A;  1DYU A;  1OCV A;  1K9M 4;  7STD A;  3G71 3;  1D6Y A;  4HM6 B;  4BTY A;  1N5P A;  1O7P B;  1EKM A;  2RFR A;  3FGY A;  4R9K A;  3PZW A;  2W9Q A;  3UL5 A;  4XBT A;  1SIH A;  5JPU A;  3DGM A;  4CDL A;  3EBY A;  2QIY A;  1AVL A;  3LTC A;  3CCV 3;  4HM2 B;  2RCD A;  5KP3 A;  4OK0 A;  3LTA A;  4OVM A;  4EBG A;  4KFF A;  8CHO A;  1N5H A;  1W2B 2;  3JUQ A;  1IT8 A;  1W6G A;  3IPT A;  1MOL A;  3SOY A;  2CC3 A;  5AIH A;  2OWP A;  3HX8 A;  2HML B;  3BND A;  3WOF B;  5I97 A;  4FMC A;  4RNY A;  3S28 A;  1KC8 4;  3MPH A;  3OX9 A;  4O2H A;  3RDE A;  5BVB A;  3CC4 3;  1CYU A;  3CCJ 3;  4ORL A;  4LMI A;  1FGM A;  1GY6 A;  4H61 A;  4KFD A;  1JKG B;  1KQS 2;  3UB1 A;  1QAL A;  3NM2 A;  1E3R A;  2W04 A;  4WFO A;  2LQV A;  5IEN A;  1S72 3;  2QGU A;  3X41 A;  1W00 A;  3K63 A;  5AI1 A;  3PCS A;  1FGQ A;  3KZT A;  2IUK A;  3CXC 2;  5D83 A;  4HM0 B;  5ELU A;  2UX0 A;  3WMD A;  3S27 A;  3EX9 A;  4AEQ A;  4N6L A;  1JKG A;  3V99 A;  1DVC A;  2PZV A;  3EE1 A;  3CCU 3;  1SPU A;  3JUO A;  3NBJ A;  2OCT A;  2V1L A;  3OV4 A;  1GS3 A;  4L8P A;  1Y4K A;  4EYC A;  2FNQ A;  1TFO A;  1TUH A;  2PNC A;  3DGN A;  4Q53 A;  1OPY A;  4X2H A;  2XGN A;  3F7S A;  1ZO2 A;  2CFG A;  2FXT A;  3CPW 2;  1GY5 A;  2XFS A;  1QVG 2;  1NWW A;  3SVA A;  1BUQ A;  1GD3 A;  2C11 A;  1VQO 3;  1OH0 A;  1KSI A;  1TFK A;  4I4K A;  2XR8 B;  1WQL B;  1RKY A;  2KRT A;  2WOF A;  1VQM 3;  3OWU A;  2F86 B;  3F8X A;  3VF1 A;  4LSO A;  1EG9 B;  2Z76 A;  1Q82 4;  4WYK B;  1VQL 3;  2ZDJ A;  5BXQ A;  1D6Z A;  2OOV C;  1K73 4;  3L0R A;  2ML6 A;  4H3U A;  2ZL8 A;  3HIG A;  2QEX 3;  5IG4 A;  1SJW A;  2HMK B;  1YI2 3;  3TDG A;  3EN8 A;  3I55 3;  3D9R A;  1KWI A;  4XBY A;  1ROV A;  1OGZ A;  4GB5 A;  4WYK A;  1AR0 A;  3LTB A;  2ML5 A;  4N6U A;  2HMM B;  4IIA A;  5IER A;  2CFD A;  1QMA A;  1Q81 4;  1TP6 A;  4BTX A;  2CH9 A;  2CG0 A;  1VQ7 3;  2W0Q A;  1OHP A;  1M1X B;  3EBT A;  3CCE 3;  3X3Z A;  3K0Z A;  1KD1 4;  2MC8 A;  1T5Y A;  1TU5 A;  1YJN 3;  1PU4 A;  2B1X B;  1UI7 A;  4NHF A;  3LTD A;  5AII A;  4EXR A;  1ULJ B;  1ULI B;  3CPO A;  1JB2 A;  3QRD A;  4N6N B;  2OQE A;  3STD A;  3T8U A;  1IVU A;  3DY5 A;  3KSE D;  3LH4 A;  3DGO A;  1VQ6 3;  4LZI A;  1D6U A;  5KP4 A;  1OAC A;  1CYV A;  2F99 A;  4R9L A;  5CF2 A;  3OW2 2;  5CK6 A;  1VQP 3;  3S29 A;  5STD A;  1K8A 4;  5FW5 A;  1O7G B;  5EVH A;  2E2T A;  3NBB A;  1A67 A;  3X3Y A;  3G4S 3;  1F8N A;  3UNL A;  1HKX A;  5IEO A;  4IPB A;  3LYG A;  4X2O A;  2CWT A;  3EB8 A;  3EHC A;  1JN5 B;  1N8R 4;  1WMO A;  1VQK 3;  3F7X A;  5HGR A;  1A2V A;  1GYB A;  4XM4 A;  1GY7 A;  3CNX A;  4O8S A;  3X40 A;  4WWU C;  2K0M A;  4U13 A;  2YFI B;  3NQY A;  3WA2 X;  1JN5 A;  1IV9 A;  1SII A;  1IK3 A;  1HU9 A;  4JF8 A;  1M9G A;  1N9E A;  1ROA A;  2XGL A;  3S5C A;  1UI8 A;  2Q07 A;  5CF1 A;  1IVV A;  2XH9 A;  2HMJ B;  2FGT A;  1Q40 B;  1IV7 A;  3Q90 A;  2O9U X;  1S5A A;  1OHS A;  1STF I;  1JJ2 2;  1SQW A;  1V74 A;  2W2C A;  3ECF A;  3MG2 A;  3N54 B;  1MNL A;  2Y74 A;  2B24 B;  2RGQ A;  3K7C A;  2LYX A;  2IUJ A;  1Q40 A;  1IVX A;  2W9P A;  3DMC A;  3PGB A;  1NB3 I;  3CC2 3;  1W01 A;  2W6J H;  3A76 A;  1EA2 A;  2YFJ B;  3J7Y d;  4TX4 A;  3KN4 A;  3OWY A;  1IQX A;  1VQ8 3;  2BHM A;  3IJE B;  3KE7 A;  3F9S A;  4XDV A;  1L5G B;  2GXF A;  2CWU A;  3DZL A;  2WGQ A;  1O7N B;  2XSH B;  3M8C A;  3I56 3;  4XBX A;  1G96 A;  1U8C B;  2I9W A;  3WOE B;  1YIJ 3;  1J2B A;  4CCV A;  1A90 A;  2CW9 A;  2O3O A;  3B4O A;  3HZP A;  3Q2P A;  2BMR B;  4EC6 A;  4FCM A;  1Q42 A;  4R1K A;  1VQ9 3;  5AEU B;  3GRD A;  5IG5 A;  2OOV A;  2W56 B;  2XSO B;  5D81 A;  2BMO B;  4MJD A;  4RNZ A;  2F98 A;  3GZX B;  1VZZ A;  4N6O B;  1NU3 A;  3I0Y A;  5AEW B;  1YIT 3;  1AV4 A;  3PS8 A;  4L8O A;  2JQ5 A;  1QVF 2;  3NXJ A;  1Z1S A;  5ELJ A;  4HKV B;  4RZM A;  1W6C A;  1NDO B;  4G1M B;  4HM5 B;  2W56 A;  3G0K A;  1O7W B;  3BNC A;  3FF2 A;  2CKF B;  3DM8 A;  3GWR A;  4N3V A;  2K54 A;  3U97 A;  1R4C A;  1RRL A;  4FMB A;  3NQZ A;  1VQN 3;  3DUK A;  3JUP A;  1NO3 A;  3FZW A;  5AIF A;  1K41 A;  3MHE A;  4XB5 A;  1UUW B;  5IG0 A;  2YFL B;  3G16 A;  1W7C A;  1GD4 A;  3OWS A;  5IF6 A;  4HM3 B;  3KSP A;  3V98 A;  1IQ8 A;  2XEP A;  3EJV A;  3NV0 B;  3CMA 3;  1TIJ A;  3X3X A;  5DRV A;  1FA3 A;  1DMM A;  2D1W A;  4J9A A;  3T0U A;  5A0O B;  5EEO A;  1CEW I;  4HVN A;  3B4P A;  3ER7 A;  3F40 A;  3CCL 3;  3FSD A;  2A15 A;  2SBL A;  2CHC A;  2E2U A;  2OTJ 3;  3NV0 A;  2MF7 A;  3F14 A;  2P05 A;  3HI7 A;  1M90 4;  5D82 A;  1WNH A;  2XF3 A;  4KFE A;  3KKG A;  1IDP A;  3VGN A;  3Q1C A;  3SX1 A;  3FCS B;  3IMA B;  1YJW 3;  1OHO A;  3JVC A;  3B7C A;  5IW9 A;  2JDI H;  3BNE A;  1LXE A;  4HYZ A;  2GU1 A;  4FCJ A;  1OGX A;  2P38 A;  3GAX A;  1E97 A;  2YX9 A;  1N8Q A;  3WOD G;  2L4V A;  2IMJ A;  3G6E 3;  1W2Z A;  2Z7A A;  3LML A;  3B8L A;  3CCS 3;  4FCZ A;  5FGO A;  4HM1 B;  1JB4 A;  1QJG A;  3KFQ C;  1FGT A;  3PYJ A;  4MMZ B;  3N8B A;  3MWZ A;  2GEX A;  3ALA A;  2HMO B;  4AKY A;  4IT7 A;  1JNQ A;  3NUV A;  4N6M A;  2CFL A;  4WP5 A;  4N6V 0;  3V92 A;  5JBS A;  1K28 A;  4JRF A;  4NRE A;  4MEI A;  2P09 A;  1CQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...