5KP1A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y16(cl-y)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
124
Chain Sequence
b'LPTAQEVQGLMARIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 36
structure length 124
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp1A00
3G16A 1NU3A 3RGAA 1JB2A 3DMCA 2QIYA 3M8CA 3VSYA 1U5OA 1O7GB 3H3HA 5IERA 1W01A 3K7CA 1OF5A 4PEJA 5JPUA 1Q40B 3SOAA 3EF8A 1IDPA 1JKGB 2HMNB 5AIGA 4OUQA 1ULJB 2Z77A 3EJVA 2STDA 3FH1A 1JB5A 3GZRA 5KP1A 6STDA 4XBYA 3G8ZA 2IMJA 2W2CA 1STDA 5DRVA 5AEUB 1Q40A 3B8LA 1JKGA 3T8NA 3B4OA 1QMAA 5CLKA 4XBTA 3B7CA 4WYKB 2YFJB 5G2GA 4STDA 4LMIA 2XSHB 2HMOB 5CXOA 2RCDA 1DMNA 1VZZA 1OHSA 3NV0B 3FLJA 5D83A 5BVBA 5KP4A 2CKFB 3GZBA 2INXA 4WYKA 1A2KA 4KVHA 3WMDA 1ZO2A 1ISKA 3VGNA 3CNMA 4HM7B 1QJGA 4OVMA 3D9RA 5IENA 1W00A 4K1VA 4WP5A 3NV0A 5AIFA 5IEPA 1Z1SA 1UUVB 3H51A 1S5AA 3EQQB 4X2OA 3OWYA 2Z76A 1WQLB 1O7WB 3EBTA 2R4IA 5IG5A 1NWWA 3KSPA 1ZX2A 2HMKB 2CHCA 3HX8A 4RZMA 1C7HA 3F9SA 3EC9A 3NUVA 2GBXB 3RGRA 3NM2A 2B24B 3T8UA 1OH0A 2YFIB 2XR8B 3F14A 5D81A 5EVHA 2UX0A 1O7PB 2RFRA 4ORLA 2YFLB 1JB4A 4HM1B 7STDA 3LYGA 5IF6A 3B4PA 3IPTA 4HJLB 4J9AA 3OWSA 1TUHA 5IG0A 5HGRA 3LZAA 5IEOA 3EHCA 1ULIB 2GXFA 3G0KA 1GY6A 5DREA 4HM8B 4XBXA 3STDA 1O7NB 4HM0B 5JPPA 3F8XA 5BXQA 3JUNA 3F8HA 3JUQA 3MKIA 1OGXA 4K1UA 2QGUA 3DM8A 4X2HA 3E99A 1GY7A 3EN8A 3KZTA 1BUQA 3FF2A 1O7MB 4L7KA 1JN5B 3ROBA 2BMOB 2XSOB 1E3RA 4CDLA 4LGQA 3KKGA 1Q42A 4Q53A 4HM4B 1K41A 1OPYA 3I0YA 5D82A 5KP3A 1EG9B 3DUKA 1JN5A 3MG3A 2JQ5A 4XM4A 3OX9A 3FZWA 5AIHA 5CK6A 5AI1A 5FW5A 2RGQA 3F40A 3HZPA 3BLZA 1EA2A 1OHPA 1NDOB 1OHOA 2I9WA 3EN1B 5IG4A 5AIIA 4HM2B 3S5CA 1GYBA 4HM3B 2F86B 3OXAA 5TGNA 2PZVA 4HVNA 4XDWA 4R9LA 3MSOA 3SEDA 1CQSA 4WWUC 1GS3A 4R1KA 4HKVB 2GEXA 5IG3A 3F7SA 5STDA 4H3UA 3DZLA 4U13A 2F98A 3ER7A 3MG1A 4MJDA 3K0ZA 4HZBB 4IIAA 2BMRB 1HKXA 3FGYA 3ECFA 2HMMB 8CHOA 1DMMA 3Q90A 1SJWA 1W02A 4J8TA 1W6YA 3BB9A 2BNGA 1TP6A 3SOYA 4N3VA 1GY5A 1OGZA 1UUWB 4L8PA 2XRXB 3CPOA 4LEHA 3NXJA 3F7XA 3DXOA 1E3VA 3OV4A 4I4KA 5CF2A 3FKAA 1OUNA 3GZYB 2BMQB 2HMJB 2HMLB 2A15A 3NBRA 2B1XB 1AR0A 3FF0A 5CF1A 3HK4A 1ASKA 4GB5A 4R9KA 3MHEA 5AEWB 1E97A 3OWUA 3CNXA 3A76A 1OCVA 3MYTA 3CU3A 2OWPA 3EX9A 3JUPA 3GWRA 3JUOA 3GZXB 3NHXA 3KE7A 3FSDA 4HM5B 4HZ9B 2F99A 3MG2A 2GEYA 4XB5A 2GBWB 1DMQA 4FCMA 1O7HB 4FCJA 4XDVA 3EBYA 3UNLA 1OF5B 2Z7AA 3JUMA 3UJMA 4L8OA 2K54A 3GRDA 4HM6B
chains in the Genus database with same CATH superfamily
3G16A 3U1WA 1NU3A 1LVNA 1BNRA 4DKIA 3RGAA 4LYLB 2H0GA 1IYYA 1LRAA 1MWTA 2RSXA 1QALA 5AYSC 1JB2A 1VQ83 1GMRA 1M9GA 3DMCA 3X42A 2QIYA 4GL6A 2MC8A 2WGOA 1MGWA 3AGNA 3M8CA 4ILFA 1BRKA 1LOYA 3VSYA 1T3BA 1BVIA 1U5OA 1O7GB 1TRQA 3AMOB 2KF5A 3H3HA 5IERA 1FYSA 1A90A 1W01A 1YGWA 2O3OA 1RHLA 3K7CA 3K5TA 1OF5A 3BNBA 4PEJA 5JPUA 1AY7A 3SYUA 3X41A 4EV2A 1Q40B 3SOAA 1FGQA 3EF8A 1IDPA 1JKGB 1JBTA 2OOVA 2HMNB 1IU7A 1RDSA 1VQM3 5AIGA 1B27A 1NB5I 4CCVA 1UUGB 3MPHA 3SX1A 3HIGA 1IV7A 4G1MB 1ULJB 2Z77A 4OUQA 3EJVA 1VQ93 2STDA 3N8BA 1VQ73 3LTAA 2D42A 3FH1A 3DGMA 4IT7A 1PU4A 3I553 4MMZB 1JB5A 1AV4A 4RNTA 1LOWA 3GZRA 1FUSA 3AMOA 3U97A 5KP1A 6STDA 4XBYA 1BRSA 2CC3A 3G8ZA 1FGMA 1BRGA 3PS8A 1RN1A 2BIRA 2H0HA 2IMJA 3BNDA 3CCM3 4H61A 2W2CA 1STDA 3PYJA 5DRVA 1IVUA 1Q40A 3B8LA 1W5ZA 3BNCA 3RNTA 3SXXA 4AKYA 5AEUB 1SARA 4BIRA 1JKGA 3T8NA 1V57A 3B4OA 1G02A 4QWTA 2CFWA 3CC43 1QMAA 3S29A 4R4KA 5CLKA 4XBTA 1KSIA 3B7CA 4WYKB 2YFJB 5G2GA 1RGHA 2P0XA 4I5QA 4STDA 2IUJA 3LT8A 4LMIA 4KFFA 1IV9A 2XSHB 2HMOB 5CXOA 2BT3A 3CPW2 4EC6A 1YNVX 1RN7A 1RJOA 6RNTA 1NNVA 1SIHA 1DMNA 1VZZA 2KCDA 1OHSA 1LQGC 2RCDA 2GSPA 3OW22 3NV0B 3FLJA 1IT8A 2CG1A 5D83A 1BAOA 1IK3A 1UCKA 2CFDA 4N6OB 1LOXA 3K63A 1SPUA 5LC6A 5BVBA 4NHFA 1JZDA 5M18A 4N6UA 2HOHA 5KP4A 2CKFB 3GZBA 2INXA 4WYKA 1A2KA 1AVKA 4KVHA 2IUKA 3WMDA 1ZO2A 3AHWA 1ISKA 1RGEA 2CX0A 3WR2A 8RNTA 1YJ93 3VGNA 3CNMA 1RTUA 2FNQA 4HM7B 1FZUA 1QJGA 1B3SA 4OVMA 3AHSA 3D9RA 5IENA 1RGAA 1W00A 4K1VA 4WP5A 1X1WA 1Y4KA 3NV0A 1BUJA 4MMYB 5AIFA 3S67A 1YI23 5IEPA 1Z1SA 3CCJ3 1K28A 1N5HA 3WDGB 3WA2X 1UUVB 4IPBA 1W6GA 1W6CA 2K3DA 3H51A 1DVDA 2F56A 1RCLA 3X3YA 1OACA 6GSPA 1WMOA 1S5AA 1N9EA 3WA3A 3EQQB 3FG3A 4X2OA 3OWYA 1US1A 2Z76A 1WQLB 1GD3A 3LXUX 1O7WB 1LQMB 2KF3A 3EBTA 4N6MA 5HOHA 2R4IA 5EEOA 5IG5A 1FGRA 3V98A 3URPA 1NWWA 3KSPA 1J2BA 4O2HA 1ZX2A 1UGIA 4HOHA 2HMKB 1CYUA 1UCJA 2CHCA 3FG4A 4EBGA 4BU4A 3HX8A 1YJN3 5BIRA 1FGOA 2LQVA 2UGIA 3PCRA 2CFGA 5EQLA 4RZMA 2M7OA 1C7HA 3CCL3 4N6TA 1TTOA 2BHMA 3F9SA 1BNSA 3GSPA 4CPKA 2SBLA 4BL3A 4RNYA 2L4VA 1VQL3 3EC9A 2C11A 3NUVA 4BTXA 2CX1A 2CIUA 2GBXB 2Y73A 3RGRA 2W6JH 1VQ53 1UI8A 1BNEA 3SLUA 3N54B 1IQXA 2B24B 3NM2A 3T8UA 1BANA 3CCU3 2UUGC 9RNTA 1K734 2BU4A 5IW9A 1OH0A 2O9UX 4FMDA 2YFIB 2XR8B 2AADA 1EUIC 3F14A 4O3VA 2F5MA 5D81A 5EVHA 3CCS3 2UX0A 1BIRA 1O7PB 2GU1A 1ROVA 1K9M4 1QVF2 1GMQA 3GAXA 2JDIH 2RFRA 1B21A 1BRNL 1T5YA 4ORLA 3KIIA 1DE3A 2YFLB 4KT3B 3UL5A 1FW7A 3V99A 1UW1A 1W7CA 3S27A 1GD4A 1I0XA 1JB4A 2WOHA 4HM1B 7STDA 1B2MA 4EW5A 3LYGA 3DY5A 1S723 3CXC2 5IF6A 3B4PA 4BTYA 3IPTA 3DGLA 4HJLB 2YX9A 4J9AA 1RMSA 2J8XB 1D6ZA 2QEX3 1EEJA 3OWSA 1TUHA 1N9JA 3NQZA 1BRHA 5HGRA 5IG0A 3LZAA 5IEOA 1RNBA 3EHCA 1ULIB 2GXFA 3G0KA 4R80A 3CD63 1GY6A 5DREA 1I3IA 1FUTA 3LT9A 1BGSA 4HM8B 1SQWA 4J5KA 4XBXA 3UL6A 1M1XB 4N6NB 3STDA 1LNIA 3O8YA 1O7NB 4BTWA 1RGLA 4HM0B 1JRQA 3CCQ3 1PFPA 1WMNA 3F8XA 4O02B 5JPPA 1JBSA 5A0OB 5BXQA 3JUNA 3SVAA 1WNHA 1BU4A 3F8HA 1I0VA 3JUQA 3KCHA 2ZDJA 1LNHA 3MKIA 4NREA 3TDGA 3D5IA 3WODG 2Y74A 1OGXA 1JV2B 1Q9EA 1GOYA 2QGUA 4K1UA 7RNTA 1YHQ3 3DM8A 5JBSA 4N6V0 1W4NA 2WOFA 4X2HA 2E2VA 3E99A 4JF8A 3NBBA 2CWTA 1GY7A 2IYJA 3EN8A 3KZTA 3D3LA 3PZWA 4LSOA 4TX4A 3IJEB 1C54A 1Q7HA 1BUQA 1IVVA 3FF2A 4O8SA 3LTBA 4HYZA 3Q2PA 3DGOA 3G4S3 4MEIA 1O7MB 1BSEA 1B2UA 4GSPA 4AKZA 4L7KA 2OTJ3 1Q824 1R4CA 1JN5B 3ROBA 2F4YA 3HOHA 2KAAA 2BMOB 2XSOB 3Q1CA 2CFKA 1E3RA 1Q7Y4 2CWVA 1G0TA 1VQ43 1F8NA 4CDLA 4LGQA 3BNEA 1UDII 3KKGA 1Q42A 4Q53A 4HM4B 3KFQC 5M19A 1K41A 3NQYA 2W56B 4FMBA 1GMPA 2RBIA 4K61A 3ZFZA 1OPYA 1HU9A 1GSPA 1B2SA 5AYRB 1TU5A 1RCKA 3LTDA 1I2EA 3VF1A 3I0YA 3WOFB 5D82A 5KP3A 3X3ZA 1EG9B 5M1AA 1V58A 3EB8A 4K90B 3CC73 2Z6BA 3DUKA 1UGHI 1JN5A 1W2B2 4CJNA 1MWUA 3CC23 3MG3A 1Q814 3BU4A 2JQ5A 3CCE3 4XM4A 3OX9A 2XH9A 1G96A 3FZWA 3CCV3 1Q864 1QVG2 5AIHA 1RGGA 5CK6A 4FR9A 2BO9B 5AI1A 3N9HA 5FW5A 2RGQA 2W03A 3F40A 2CG0A 2W9QA 1FGTA 2C4BA 3BLZA 1NB3I 1EA2A 2W56A 2XEPA 3HZPA 3PCSA 1VQO3 1OHPA 1L5GB 1RGKA 2ML6A 5I97A 3MWZA 3LH4A 3HI7A 2OOVC 1NDOB 1N8R4 2KF6A 1OHOA 1ZS7A 2I9WA 1QAFA 1TIJA 2PNCA 2P05A 2XFSA 1I70A 2XGLA 3EN1B 5IG4A 5AIIA 3S28A 4HM2B 1JZOA 3D79A 3S5CA 3ZG5A 1CEWI 1GYBA 1RRLA 1B20A 3IMAB 4HM3B 1T2HA 1BRJA 2F86B 1STFI 3OXAA 4GHOA 1QAKA 1PYLA 1SIIA 3KSED 5TGNA 1M1K4 3WHOA 1TFOA 2PZVA 3T0UA 1FUWA 4HVNA 4KZ1A 4XDWA 2OQEA 1MWSA 4EXRA 1WTHA 2OTL3 1GOVA 1LOVA 3X3XA 1V74A 3WOEB 3NX0A 4R9LA 1X1YA 3MSOA 3SEDA 1CQSA 4WWUC 1N8QA 3CCR3 1HZ1A 1GS3A 1W2ZA 3LTCA 3UB1A 4HAAA 4RNZA 1N5PA 4MMXB 2CW9A 4R1KA 1PY3A 1RLSA 1X1XA 1BNIA 4HKVB 1X1UA 2GEXA 2SARA 1EKMA 2CK3H 5IG3A 3F7SA 1YVSA 1B2ZA 1IVWA 3PGBA 1DETA 5STDA 2RNTA 4H3UA 4FMCA 2QA43 1D6UA 3Q3FA 1AVLA 2LYXA 2D1WA 3DZLA 4U13A 1BSAA 2W0QA 1UCLA 2F98A 5FGOA 1RGFA 3ER7A 1BSDA 3J7Yd 1ROAA 3MG1A 1BNGA 1D6YA 4MJDA 3K0ZA 4WHAA 5RNTA 2FGTA 2ML5A 1A2PA 3D4AA 4JRFA 2ZL8A 3X40A 4HZBB 3A5EA 2XGNA 4IIAA 2ZHXB 1KWIA 4N6LA 1YIJ3 1TRPA 4WFOA 1KQS2 2BMRB 2KF4A 3G713 1HKXA 3FGYA 5LC7A 1EQKA 2GU3A 3ECFA 3KN4A 2HMMB 8CHOA 1JBRA 2OCTA 1DMMA 3Q90A 1SJWA 1W02A 1CYVA 4J8TA 1JNQA 4FCZA 1W6YA 3BB9A 4HBRA 2BNGA 1TP6A 1TFKA 3FG1A 4FMAA 3SOYA 3PXMA 3LOYA 4N3VA 1VQ63 1I2FA 1GY5A 1YVBI 1OGZA 1UUWB 3CMA3 1UCIA 4RBNA 1YGEA 1NJI4 3HIIA 4L8PA 2XRXB 4NPBA 3CPOA 4LEHA 3FCSB 3NXJA 1TJDA 3F7XA 3ZG0A 1YJW3 3DXOA 2E2UA 3G6E3 2FXTA 1E3VA 3OV4A 4OK0A 4I4KA 3K9MC 2KRTA 3QRDA 5CF2A 1VQK3 3FKAA 1VQN3 1OUNA 3AGOA 2BMQB 3GZYB 3ALAA 1RGCA 2HMJB 2L1SA 2HMLB 1RN4A 4BL2A 2CFLA 2P09A 4AEQA 2MF7A 2A15A 3NBRA 2B1XB 2KXGA 1MGRA 1AR0A 3FF0A 3EE1A 3V92A 5ELJA 1KD14 5CF1A 1ZGXA 3HK4A 1RRHA 4KFEA 1U8CB 1BSBA 1ASKA 3NBJA 3LMLA 4GB5A 5G1KA 1JJ22 4R9KA 4EV5A 1IQYA 1UI7A 1VQQA 3I563 2V1LA 3MHEA 3NM7A 5AEWB 1DVCA 1RSNA 2IY2A 1E97A 2WO0A 3DGYA 3OWUA 1GOUA 3JVCA 3CNXA 2P0MA 1BSCA 3A76A 1OCVA 3MYTA 3CU3A 2F5WA 1AQZA 2OWPA 3RDEA 5GSPA 2CWUA 3EX9A 3JUPA 3GWRA 2XFTA 3D5GA 3GZXB 3JUOA 7GSPA 3NHXA 3KE7A 3FSDA 3L0RA 4HM5B 1K8A4 2OQEC 1VQP3 1HYFA 2R41A 1IT7A 4HZ9B 2F99A 1I3FA 3MG2A 1R4YA 5G1LA 2GEYA 1A2VA 3DGNA 1MNLA 2W9PA 1MWRA 1B2XA 3BIRA 1YIT3 1BNJA 1BRIA 4XB5A 2GBWB 4KFDA 2AAEA 4ZM8A 1MOLA 1NO3A 2P38A 2W04A 4J5GA 1IQ8A 1FA3A 1I2GA 1RNTA 1DMQA 2Q07A 1KC84 2E2TA 4FCMA 2H0IA 1O7HB 2CH9A 1BOXA 1IVXA 1BNFA 4FCJA 1T2IA 1DYUA 1I8VA 4XDVA 2C10A 2IA7A 3EBYA 1RKYA 1CH0A 1LXEA 3CME3 1A67A 5ELUA 5BU4A 3UNLA 2K0MA 2XF3A 1OF5B 2WGQA 2Z7AA 3DH2A 1WMPA 3JUMA 3UJMA 1M904 3QK9A 4EYCA 4LZIA 4L8OA 2K54A 2ZA4A 3GRDA 4HM6B
chains in the Genus database with same CATH topology
3G16A 3U1WA 1NU3A 1LVNA 3RGAA 2RSXA 1QALA 5AYSC 1JB2A 1VQ83 1M9GA 3DMCA 3X42A 2QIYA 4GL6A 2MC8A 2WGOA 3M8CA 3VSYA 1U5OA 1O7GB 3H3HA 3AMOB 5IERA 1A90A 1W01A 2O3OA 3K7CA 3K5TA 1OF5A 3BNBA 4PEJA 5JPUA 3X41A 4EV2A 1Q40B 3SOAA 1FGQA 3EF8A 1IDPA 1JKGB 2OOVA 2HMNB 1IU7A 1VQM3 5AIGA 1NB5I 4CCVA 3MPHA 3SX1A 3HIGA 1IV7A 4G1MB 1ULJB 2Z77A 4OUQA 3EJVA 1VQ93 2STDA 3N8BA 1VQ73 3LTAA 2D42A 3FH1A 3DGMA 4IT7A 1PU4A 3I553 4MMZB 1JB5A 1AV4A 3GZRA 3AMOA 3U97A 5KP1A 6STDA 4XBYA 2CC3A 3G8ZA 1FGMA 3PS8A 2IMJA 3BNDA 3CCM3 4H61A 2W2CA 1STDA 3PYJA 5DRVA 1IVUA 1Q40A 3B8LA 1W5ZA 3BNCA 4AKYA 3SXXA 5AEUB 1JJ22 1JKGA 3T8NA 3B4OA 4QWTA 2CFWA 3CC43 1QMAA 3S29A 4R4KA 5CLKA 4XBTA 1KSIA 3B7CA 4WYKB 2YFJB 5G2GA 2P0XA 4STDA 2IUJA 3LT8A 4LMIA 4KFFA 1IV9A 2XSHB 2HMOB 5CXOA 2BT3A 3CPW2 4EC6A 1RN7A 1RJOA 1SIHA 1DMNA 1VZZA 2KCDA 1OHSA 2RCDA 3OW22 3NV0B 3FLJA 1IT8A 2CG1A 5D83A 1IK3A 2CFDA 4N6OB 1LOXA 3K63A 1SPUA 5LC6A 5BVBA 4NHFA 4N6UA 5KP4A 2CKFB 3GZBA 2INXA 4WYKA 1A2KA 1AVKA 4KVHA 2IUKA 3WMDA 1ZO2A 1ISKA 1YJ93 3VGNA 3CNMA 2FNQA 4HM7B 1QJGA 4OVMA 3D9RA 5IENA 1W00A 4K1VA 4WP5A 1Y4KA 3NV0A 4MMYB 5AIFA 3S67A 1YI23 5IEPA 1Z1SA 3CCJ3 1K28A 1N5HA 3WDGB 3WA2X 1UUVB 4IPBA 1W6GA 1W6CA 3H51A 1DVDA 3X3YA 1OACA 3WA3A 1WMOA 1S5AA 1N9EA 3EQQB 3FG3A 4X2OA 3OWYA 1US1A 2Z76A 1WQLB 1GD3A 3LXUX 1O7WB 3EBTA 4N6MA 2R4IA 5EEOA 5IG5A 1FGRA 3V98A 1NWWA 3KSPA 1J2BA 4O2HA 1ZX2A 2HMKB 1CYUA 2CHCA 3FG4A 1YJN3 4EBGA 3HX8A 1FGOA 2LQVA 3PCRA 2CFGA 5EQLA 4RZMA 2M7OA 1C7HA 3CCL3 4N6TA 2BHMA 3F9SA 2SBLA 4RNYA 2L4VA 1VQL3 3EC9A 2C11A 3NUVA 4BTXA 2CIUA 2GBXB 2Y73A 3RGRA 2W6JH 1VQ53 1UI8A 3SLUA 3N54B 1IQXA 2B24B 3NM2A 3T8UA 1K734 3CCU3 5IW9A 1OH0A 2O9UX 4FMDA 2YFIB 2XR8B 3F14A 4O3VA 5D81A 5EVHA 3CCS3 2UX0A 1O7PB 2GU1A 1ROVA 1K9M4 1QVF2 3GAXA 2JDIH 2RFRA 1T5YA 4ORLA 3KIIA 2YFLB 3UL5A 3V99A 1UW1A 1W7CA 3S27A 1GD4A 2WOHA 1JB4A 4HM1B 7STDA 3LYGA 3DY5A 1S723 3CXC2 5IF6A 3B4PA 4BTYA 3IPTA 3DGLA 4HJLB 2YX9A 4J9AA 1D6ZA 2QEX3 3OWSA 1TUHA 1N9JA 3NQZA 5HGRA 5IG0A 3LZAA 5IEOA 3EHCA 1ULIB 2GXFA 3G0KA 4R80A 3CD63 1GY6A 5DREA 3LT9A 4HM8B 1SQWA 4XBXA 3UL6A 1M1XB 4N6NB 3STDA 3O8YA 1O7NB 4BTWA 4HM0B 1JRQA 3CCQ3 1PFPA 1WMNA 3F8XA 4O02B 5JPPA 5A0OB 5BXQA 3JUNA 3SVAA 1WNHA 3F8HA 3JUQA 2ZDJA 1LNHA 3MKIA 4NREA 3TDGA 3WODG 2Y74A 1OGXA 1JV2B 4K1UA 2QGUA 1YHQ3 3DM8A 5JBSA 4N6V0 1W4NA 2WOFA 4X2HA 2E2VA 3E99A 4JF8A 3NBBA 2CWTA 1GY7A 3EN8A 3KZTA 3D3LA 3PZWA 4LSOA 4TX4A 3IJEB 1BUQA 1IVVA 3FF2A 4O8SA 3LTBA 4HYZA 3Q2PA 3DGOA 3G4S3 4MEIA 1O7MB 4AKZA 4L7KA 2OTJ3 1Q824 1R4CA 1JN5B 3ROBA 2BMOB 2XSOB 3Q1CA 2CFKA 1E3RA 1Q7Y4 2CWVA 1VQ43 1F8NA 4CDLA 4LGQA 3BNEA 3KKGA 1Q42A 4Q53A 4HM4B 3KFQC 1K41A 3NQYA 2W56B 4FMBA 4K61A 1OPYA 1HU9A 5AYRB 1TU5A 3LTDA 3VF1A 3I0YA 3WOFB 5D82A 5KP3A 3X3ZA 1EG9B 3CC73 3EB8A 4K90B 2Z6BA 3DUKA 1JN5A 1W2B2 3CC23 3MG3A 1Q814 2JQ5A 3CCE3 4XM4A 3OX9A 2XH9A 1G96A 3FZWA 3CCV3 1Q864 1QVG2 5AIHA 5CK6A 4FR9A 2BO9B 5AI1A 3N9HA 5FW5A 2RGQA 2W03A 3F40A 2CG0A 2W9QA 1FGTA 3BLZA 3HZPA 1NB3I 1EA2A 2W56A 2XEPA 3PCSA 1VQO3 1OHPA 1L5GB 2ML6A 5I97A 3MWZA 3LH4A 3HI7A 2OOVC 1NDOB 1N8R4 1OHOA 2I9WA 2XFSA 1QAFA 1TIJA 2PNCA 2P05A 2XGLA 3EN1B 5IG4A 5AIIA 3S28A 4HM2B 3S5CA 1CEWI 1GYBA 1RRLA 3IMAB 4HM3B 2F86B 1STFI 3OXAA 1QAKA 1SIIA 3KSED 5TGNA 1M1K4 1TFOA 2PZVA 3T0UA 1FUWA 4HVNA 4KZ1A 4XDWA 2OQEA 4EXRA 1WTHA 2OTL3 3X3XA 1V74A 3WOEB 3NX0A 4R9LA 3MSOA 3SEDA 1CQSA 4WWUC 1N8QA 3CCR3 1GS3A 1W2ZA 3LTCA 3UB1A 4RNZA 1N5PA 4MMXB 2CW9A 4R1KA 4HKVB 2GEXA 5IG3A 1EKMA 2CK3H 3F7SA 3PGBA 1IVWA 5STDA 4H3UA 2QA43 4FMCA 1D6UA 1AVLA 2LYXA 2D1WA 3DZLA 4U13A 5FGOA 2W0QA 2F98A 3ER7A 3J7Yd 1ROAA 3MG1A 1D6YA 4MJDA 3K0ZA 4WHAA 2FGTA 2ML5A 4JRFA 2ZL8A 3X40A 4HZBB 4IIAA 2XGNA 1KWIA 4N6LA 1YIJ3 4WFOA 1KQS2 2BMRB 3G713 1HKXA 3FGYA 5LC7A 1EQKA 2GU3A 3ECFA 3KN4A 2HMMB 8CHOA 2OCTA 1DMMA 3Q90A 1SJWA 1W02A 1CYVA 4J8TA 1JNQA 4FCZA 1W6YA 3BB9A 4HBRA 2BNGA 1TP6A 1TFKA 3FG1A 4FMAA 3SOYA 3PXMA 3LOYA 4N3VA 1VQ63 1GY5A 1YVBI 1OGZA 1UUWB 3CMA3 4RBNA 1YGEA 1NJI4 3HIIA 4L8PA 2XRXB 3CPOA 4LEHA 3FCSB 3NXJA 3F7XA 1YJW3 3DXOA 2E2UA 3G6E3 2FXTA 1E3VA 3OV4A 4OK0A 4I4KA 3K9MC 2KRTA 3QRDA 5CF2A 1VQK3 3FKAA 1VQN3 1OUNA 3GZYB 2BMQB 3ALAA 2HMJB 2HMLB 2CFLA 2P09A 4AEQA 2MF7A 2A15A 3NBRA 2B1XB 2KXGA 1AR0A 3FF0A 3EE1A 3V92A 5ELJA 1KD14 5CF1A 3HK4A 1RRHA 4KFEA 1U8CB 1ASKA 3NBJA 3LMLA 4GB5A 4R9KA 4EV5A 1IQYA 1UI7A 3I563 2V1LA 3MHEA 3NM7A 5AEWB 1DVCA 1E97A 2WO0A 3OWUA 3JVCA 3CNXA 2P0MA 3A76A 1OCVA 3MYTA 3CU3A 2OWPA 3RDEA 2CWUA 3EX9A 3JUPA 3GWRA 2XFTA 3GZXB 3JUOA 3NHXA 3KE7A 3FSDA 3L0RA 4HM5B 1K8A4 2OQEC 1VQP3 1IT7A 4HZ9B 2F99A 3MG2A 2GEYA 1A2VA 3DGNA 1MNLA 2W9PA 1YIT3 4XB5A 2GBWB 4KFDA 4ZM8A 1MOLA 1NO3A 2P38A 2W04A 1IQ8A 1FA3A 1DMQA 2Q07A 1KC84 2E2TA 4FCMA 1O7HB 2CH9A 1IVXA 4FCJA 1DYUA 4XDVA 2C10A 2IA7A 3EBYA 1RKYA 3CME3 1LXEA 1A67A 5ELUA 3UNLA 2K0MA 2XF3A 1OF5B 2WGQA 2Z7AA 1WMPA 3JUMA 3UJMA 1M904 3QK9A 4EYCA 4LZIA 4L8OA 2K54A 3GRDA 4HM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G16 A;  1NU3 A;  3RGA A;  1JB2 A;  3DMC A;  2QIY A;  3M8C A;  3VSY A;  1U5O A;  1O7G B;  3H3H A;  5IER A;  1W01 A;  3K7C A;  1OF5 A;  4PEJ A;  5JPU A;  1Q40 B;  3SOA A;  3EF8 A;  1IDP A;  1JKG B;  2HMN B;  5AIG A;  4OUQ A;  1ULJ B;  2Z77 A;  3EJV A;  2STD A;  3FH1 A;  1JB5 A;  3GZR A;  5KP1 A;  6STD A;  4XBY A;  3G8Z A;  2IMJ A;  2W2C A;  1STD A;  5DRV A;  5AEU B;  1Q40 A;  3B8L A;  1JKG A;  3T8N A;  3B4O A;  1QMA A;  5CLK A;  4XBT A;  3B7C A;  4WYK B;  2YFJ B;  5G2G A;  4STD A;  4LMI A;  2XSH B;  2HMO B;  5CXO A;  2RCD A;  1DMN A;  1VZZ A;  1OHS A;  3NV0 B;  3FLJ A;  5D83 A;  5BVB A;  5KP4 A;  2CKF B;  3GZB A;  2INX A;  4WYK A;  1A2K A;  4KVH A;  3WMD A;  1ZO2 A;  1ISK A;  3VGN A;  3CNM A;  4HM7 B;  1QJG A;  4OVM A;  3D9R A;  5IEN A;  1W00 A;  4K1V A;  4WP5 A;  3NV0 A;  5AIF A;  5IEP A;  1Z1S A;  1UUV B;  3H51 A;  1S5A A;  3EQQ B;  4X2O A;  3OWY A;  2Z76 A;  1WQL B;  1O7W B;  3EBT A;  2R4I A;  5IG5 A;  1NWW A;  3KSP A;  1ZX2 A;  2HMK B;  2CHC A;  3HX8 A;  4RZM A;  1C7H A;  3F9S A;  3EC9 A;  3NUV A;  2GBX B;  3RGR A;  3NM2 A;  2B24 B;  3T8U A;  1OH0 A;  2YFI B;  2XR8 B;  3F14 A;  5D81 A;  5EVH A;  2UX0 A;  1O7P B;  2RFR A;  4ORL A;  2YFL B;  1JB4 A;  4HM1 B;  7STD A;  3LYG A;  5IF6 A;  3B4P A;  3IPT A;  4HJL B;  4J9A A;  3OWS A;  1TUH A;  5IG0 A;  5HGR A;  3LZA A;  5IEO A;  3EHC A;  1ULI B;  2GXF A;  3G0K A;  1GY6 A;  5DRE A;  4HM8 B;  4XBX A;  3STD A;  1O7N B;  4HM0 B;  5JPP A;  3F8X A;  5BXQ A;  3JUN A;  3F8H A;  3JUQ A;  3MKI A;  1OGX A;  4K1U A;  2QGU A;  3DM8 A;  4X2H A;  3E99 A;  1GY7 A;  3EN8 A;  3KZT A;  1BUQ A;  3FF2 A;  1O7M B;  4L7K A;  1JN5 B;  3ROB A;  2BMO B;  2XSO B;  1E3R A;  4CDL A;  4LGQ A;  3KKG A;  1Q42 A;  4Q53 A;  4HM4 B;  1K41 A;  1OPY A;  3I0Y A;  5D82 A;  5KP3 A;  1EG9 B;  3DUK A;  1JN5 A;  3MG3 A;  2JQ5 A;  4XM4 A;  3OX9 A;  3FZW A;  5AIH A;  5CK6 A;  5AI1 A;  5FW5 A;  2RGQ A;  3F40 A;  3HZP A;  3BLZ A;  1EA2 A;  1OHP A;  1NDO B;  1OHO A;  2I9W A;  3EN1 B;  5IG4 A;  5AII A;  4HM2 B;  3S5C A;  1GYB A;  4HM3 B;  2F86 B;  3OXA A;  5TGN A;  2PZV A;  4HVN A;  4XDW A;  4R9L A;  3MSO A;  3SED A;  1CQS A;  4WWU C;  1GS3 A;  4R1K A;  4HKV B;  2GEX A;  5IG3 A;  3F7S A;  5STD A;  4H3U A;  3DZL A;  4U13 A;  2F98 A;  3ER7 A;  3MG1 A;  4MJD A;  3K0Z A;  4HZB B;  4IIA A;  2BMR B;  1HKX A;  3FGY A;  3ECF A;  2HMM B;  8CHO A;  1DMM A;  3Q90 A;  1SJW A;  1W02 A;  4J8T A;  1W6Y A;  3BB9 A;  2BNG A;  1TP6 A;  3SOY A;  4N3V A;  1GY5 A;  1OGZ A;  1UUW B;  4L8P A;  2XRX B;  3CPO A;  4LEH A;  3NXJ A;  3F7X A;  3DXO A;  1E3V A;  3OV4 A;  4I4K A;  5CF2 A;  3FKA A;  1OUN A;  3GZY B;  2BMQ B;  2HMJ B;  2HML B;  2A15 A;  3NBR A;  2B1X B;  1AR0 A;  3FF0 A;  5CF1 A;  3HK4 A;  1ASK A;  4GB5 A;  4R9K A;  3MHE A;  5AEW B;  1E97 A;  3OWU A;  3CNX A;  3A76 A;  1OCV A;  3MYT A;  3CU3 A;  2OWP A;  3EX9 A;  3JUP A;  3GWR A;  3JUO A;  3GZX B;  3NHX A;  3KE7 A;  3FSD A;  4HM5 B;  4HZ9 B;  2F99 A;  3MG2 A;  2GEY A;  4XB5 A;  2GBW B;  1DMQ A;  4FCM A;  1O7H B;  4FCJ A;  4XDV A;  3EBY A;  3UNL A;  1OF5 B;  2Z7A A;  3JUM A;  3UJM A;  4L8O A;  2K54 A;  3GRD A;  4HM6 B; 
#chains in the Genus database with same CATH topology
 3G16 A;  3U1W A;  1NU3 A;  1LVN A;  1BNR A;  4DKI A;  3RGA A;  4LYL B;  2H0G A;  1IYY A;  1LRA A;  1MWT A;  2RSX A;  1QAL A;  5AYS C;  1JB2 A;  1VQ8 3;  1GMR A;  1M9G A;  3DMC A;  3X42 A;  2QIY A;  4GL6 A;  2MC8 A;  2WGO A;  1MGW A;  3AGN A;  3M8C A;  4ILF A;  1BRK A;  1LOY A;  3VSY A;  1T3B A;  1BVI A;  1U5O A;  1O7G B;  1TRQ A;  3AMO B;  2KF5 A;  3H3H A;  5IER A;  1FYS A;  1A90 A;  1W01 A;  1YGW A;  2O3O A;  1RHL A;  3K7C A;  3K5T A;  1OF5 A;  3BNB A;  4PEJ A;  5JPU A;  1AY7 A;  3SYU A;  3X41 A;  4EV2 A;  1Q40 B;  3SOA A;  1FGQ A;  3EF8 A;  1IDP A;  1JKG B;  1JBT A;  2OOV A;  2HMN B;  1IU7 A;  1RDS A;  1VQM 3;  5AIG A;  1B27 A;  1NB5 I;  4CCV A;  1UUG B;  3MPH A;  3SX1 A;  3HIG A;  1IV7 A;  4G1M B;  1ULJ B;  2Z77 A;  4OUQ A;  3EJV A;  1VQ9 3;  2STD A;  3N8B A;  1VQ7 3;  3LTA A;  2D42 A;  3FH1 A;  3DGM A;  4IT7 A;  1PU4 A;  3I55 3;  4MMZ B;  1JB5 A;  1AV4 A;  4RNT A;  1LOW A;  3GZR A;  1FUS A;  3AMO A;  3U97 A;  5KP1 A;  6STD A;  4XBY A;  1BRS A;  2CC3 A;  3G8Z A;  1FGM A;  1BRG A;  3PS8 A;  1RN1 A;  2BIR A;  2H0H A;  2IMJ A;  3BND A;  3CCM 3;  4H61 A;  2W2C A;  1STD A;  3PYJ A;  5DRV A;  1IVU A;  1Q40 A;  3B8L A;  1W5Z A;  3BNC A;  3RNT A;  3SXX A;  4AKY A;  5AEU B;  1SAR A;  4BIR A;  1JKG A;  3T8N A;  1V57 A;  3B4O A;  1G02 A;  4QWT A;  2CFW A;  3CC4 3;  1QMA A;  3S29 A;  4R4K A;  5CLK A;  4XBT A;  1KSI A;  3B7C A;  4WYK B;  2YFJ B;  5G2G A;  1RGH A;  2P0X A;  4I5Q A;  4STD A;  2IUJ A;  3LT8 A;  4LMI A;  4KFF A;  1IV9 A;  2XSH B;  2HMO B;  5CXO A;  2BT3 A;  3CPW 2;  4EC6 A;  1YNV X;  1RN7 A;  1RJO A;  6RNT A;  1NNV A;  1SIH A;  1DMN A;  1VZZ A;  2KCD A;  1OHS A;  1LQG C;  2RCD A;  2GSP A;  3OW2 2;  3NV0 B;  3FLJ A;  1IT8 A;  2CG1 A;  5D83 A;  1BAO A;  1IK3 A;  1UCK A;  2CFD A;  4N6O B;  1LOX A;  3K63 A;  1SPU A;  5LC6 A;  5BVB A;  4NHF A;  1JZD A;  5M18 A;  4N6U A;  2HOH A;  5KP4 A;  2CKF B;  3GZB A;  2INX A;  4WYK A;  1A2K A;  1AVK A;  4KVH A;  2IUK A;  3WMD A;  1ZO2 A;  3AHW A;  1ISK A;  1RGE A;  2CX0 A;  3WR2 A;  8RNT A;  1YJ9 3;  3VGN A;  3CNM A;  1RTU A;  2FNQ A;  4HM7 B;  1FZU A;  1QJG A;  1B3S A;  4OVM A;  3AHS A;  3D9R A;  5IEN A;  1RGA A;  1W00 A;  4K1V A;  4WP5 A;  1X1W A;  1Y4K A;  3NV0 A;  1BUJ A;  4MMY B;  5AIF A;  3S67 A;  1YI2 3;  5IEP A;  1Z1S A;  3CCJ 3;  1K28 A;  1N5H A;  3WDG B;  3WA2 X;  1UUV B;  4IPB A;  1W6G A;  1W6C A;  2K3D A;  3H51 A;  1DVD A;  2F56 A;  1RCL A;  3X3Y A;  1OAC A;  6GSP A;  1WMO A;  1S5A A;  1N9E A;  3WA3 A;  3EQQ B;  3FG3 A;  4X2O A;  3OWY A;  1US1 A;  2Z76 A;  1WQL B;  1GD3 A;  3LXU X;  1O7W B;  1LQM B;  2KF3 A;  3EBT A;  4N6M A;  5HOH A;  2R4I A;  5EEO A;  5IG5 A;  1FGR A;  3V98 A;  3URP A;  1NWW A;  3KSP A;  1J2B A;  4O2H A;  1ZX2 A;  1UGI A;  4HOH A;  2HMK B;  1CYU A;  1UCJ A;  2CHC A;  3FG4 A;  4EBG A;  4BU4 A;  3HX8 A;  1YJN 3;  5BIR A;  1FGO A;  2LQV A;  2UGI A;  3PCR A;  2CFG A;  5EQL A;  4RZM A;  2M7O A;  1C7H A;  3CCL 3;  4N6T A;  1TTO A;  2BHM A;  3F9S A;  1BNS A;  3GSP A;  4CPK A;  2SBL A;  4BL3 A;  4RNY A;  2L4V A;  1VQL 3;  3EC9 A;  2C11 A;  3NUV A;  4BTX A;  2CX1 A;  2CIU A;  2GBX B;  2Y73 A;  3RGR A;  2W6J H;  1VQ5 3;  1UI8 A;  1BNE A;  3SLU A;  3N54 B;  1IQX A;  2B24 B;  3NM2 A;  3T8U A;  1BAN A;  3CCU 3;  2UUG C;  9RNT A;  1K73 4;  2BU4 A;  5IW9 A;  1OH0 A;  2O9U X;  4FMD A;  2YFI B;  2XR8 B;  2AAD A;  1EUI C;  3F14 A;  4O3V A;  2F5M A;  5D81 A;  5EVH A;  3CCS 3;  2UX0 A;  1BIR A;  1O7P B;  2GU1 A;  1ROV A;  1K9M 4;  1QVF 2;  1GMQ A;  3GAX A;  2JDI H;  2RFR A;  1B21 A;  1BRN L;  1T5Y A;  4ORL A;  3KII A;  1DE3 A;  2YFL B;  4KT3 B;  3UL5 A;  1FW7 A;  3V99 A;  1UW1 A;  1W7C A;  3S27 A;  1GD4 A;  1I0X A;  1JB4 A;  2WOH A;  4HM1 B;  7STD A;  1B2M A;  4EW5 A;  3LYG A;  3DY5 A;  1S72 3;  3CXC 2;  5IF6 A;  3B4P A;  4BTY A;  3IPT A;  3DGL A;  4HJL B;  2YX9 A;  4J9A A;  1RMS A;  2J8X B;  1D6Z A;  2QEX 3;  1EEJ A;  3OWS A;  1TUH A;  1N9J A;  3NQZ A;  1BRH A;  5HGR A;  5IG0 A;  3LZA A;  5IEO A;  1RNB A;  3EHC A;  1ULI B;  2GXF A;  3G0K A;  4R80 A;  3CD6 3;  1GY6 A;  5DRE A;  1I3I A;  1FUT A;  3LT9 A;  1BGS A;  4HM8 B;  1SQW A;  4J5K A;  4XBX A;  3UL6 A;  1M1X B;  4N6N B;  3STD A;  1LNI A;  3O8Y A;  1O7N B;  4BTW A;  1RGL A;  4HM0 B;  1JRQ A;  3CCQ 3;  1PFP A;  1WMN A;  3F8X A;  4O02 B;  5JPP A;  1JBS A;  5A0O B;  5BXQ A;  3JUN A;  3SVA A;  1WNH A;  1BU4 A;  3F8H A;  1I0V A;  3JUQ A;  3KCH A;  2ZDJ A;  1LNH A;  3MKI A;  4NRE A;  3TDG A;  3D5I A;  3WOD G;  2Y74 A;  1OGX A;  1JV2 B;  1Q9E A;  1GOY A;  2QGU A;  4K1U A;  7RNT A;  1YHQ 3;  3DM8 A;  5JBS A;  4N6V 0;  1W4N A;  2WOF A;  4X2H A;  2E2V A;  3E99 A;  4JF8 A;  3NBB A;  2CWT A;  1GY7 A;  2IYJ A;  3EN8 A;  3KZT A;  3D3L A;  3PZW A;  4LSO A;  4TX4 A;  3IJE B;  1C54 A;  1Q7H A;  1BUQ A;  1IVV A;  3FF2 A;  4O8S A;  3LTB A;  4HYZ A;  3Q2P A;  3DGO A;  3G4S 3;  4MEI A;  1O7M B;  1BSE A;  1B2U A;  4GSP A;  4AKZ A;  4L7K A;  2OTJ 3;  1Q82 4;  1R4C A;  1JN5 B;  3ROB A;  2F4Y A;  3HOH A;  2KAA A;  2BMO B;  2XSO B;  3Q1C A;  2CFK A;  1E3R A;  1Q7Y 4;  2CWV A;  1G0T A;  1VQ4 3;  1F8N A;  4CDL A;  4LGQ A;  3BNE A;  1UDI I;  3KKG A;  1Q42 A;  4Q53 A;  4HM4 B;  3KFQ C;  5M19 A;  1K41 A;  3NQY A;  2W56 B;  4FMB A;  1GMP A;  2RBI A;  4K61 A;  3ZFZ A;  1OPY A;  1HU9 A;  1GSP A;  1B2S A;  5AYR B;  1TU5 A;  1RCK A;  3LTD A;  1I2E A;  3VF1 A;  3I0Y A;  3WOF B;  5D82 A;  5KP3 A;  3X3Z A;  1EG9 B;  5M1A A;  1V58 A;  3EB8 A;  4K90 B;  3CC7 3;  2Z6B A;  3DUK A;  1UGH I;  1JN5 A;  1W2B 2;  4CJN A;  1MWU A;  3CC2 3;  3MG3 A;  1Q81 4;  3BU4 A;  2JQ5 A;  3CCE 3;  4XM4 A;  3OX9 A;  2XH9 A;  1G96 A;  3FZW A;  3CCV 3;  1Q86 4;  1QVG 2;  5AIH A;  1RGG A;  5CK6 A;  4FR9 A;  2BO9 B;  5AI1 A;  3N9H A;  5FW5 A;  2RGQ A;  2W03 A;  3F40 A;  2CG0 A;  2W9Q A;  1FGT A;  2C4B A;  3BLZ A;  1NB3 I;  1EA2 A;  2W56 A;  2XEP A;  3HZP A;  3PCS A;  1VQO 3;  1OHP A;  1L5G B;  1RGK A;  2ML6 A;  5I97 A;  3MWZ A;  3LH4 A;  3HI7 A;  2OOV C;  1NDO B;  1N8R 4;  2KF6 A;  1OHO A;  1ZS7 A;  2I9W A;  1QAF A;  1TIJ A;  2PNC A;  2P05 A;  2XFS A;  1I70 A;  2XGL A;  3EN1 B;  5IG4 A;  5AII A;  3S28 A;  4HM2 B;  1JZO A;  3D79 A;  3S5C A;  3ZG5 A;  1CEW I;  1GYB A;  1RRL A;  1B20 A;  3IMA B;  4HM3 B;  1T2H A;  1BRJ A;  2F86 B;  1STF I;  3OXA A;  4GHO A;  1QAK A;  1PYL A;  1SII A;  3KSE D;  5TGN A;  1M1K 4;  3WHO A;  1TFO A;  2PZV A;  3T0U A;  1FUW A;  4HVN A;  4KZ1 A;  4XDW A;  2OQE A;  1MWS A;  4EXR A;  1WTH A;  2OTL 3;  1GOV A;  1LOV A;  3X3X A;  1V74 A;  3WOE B;  3NX0 A;  4R9L A;  1X1Y A;  3MSO A;  3SED A;  1CQS A;  4WWU C;  1N8Q A;  3CCR 3;  1HZ1 A;  1GS3 A;  1W2Z A;  3LTC A;  3UB1 A;  4HAA A;  4RNZ A;  1N5P A;  4MMX B;  2CW9 A;  4R1K A;  1PY3 A;  1RLS A;  1X1X A;  1BNI A;  4HKV B;  1X1U A;  2GEX A;  2SAR A;  1EKM A;  2CK3 H;  5IG3 A;  3F7S A;  1YVS A;  1B2Z A;  1IVW A;  3PGB A;  1DET A;  5STD A;  2RNT A;  4H3U A;  4FMC A;  2QA4 3;  1D6U A;  3Q3F A;  1AVL A;  2LYX A;  2D1W A;  3DZL A;  4U13 A;  1BSA A;  2W0Q A;  1UCL A;  2F98 A;  5FGO A;  1RGF A;  3ER7 A;  1BSD A;  3J7Y d;  1ROA A;  3MG1 A;  1BNG A;  1D6Y A;  4MJD A;  3K0Z A;  4WHA A;  5RNT A;  2FGT A;  2ML5 A;  1A2P A;  3D4A A;  4JRF A;  2ZL8 A;  3X40 A;  4HZB B;  3A5E A;  2XGN A;  4IIA A;  2ZHX B;  1KWI A;  4N6L A;  1YIJ 3;  1TRP A;  4WFO A;  1KQS 2;  2BMR B;  2KF4 A;  3G71 3;  1HKX A;  3FGY A;  5LC7 A;  1EQK A;  2GU3 A;  3ECF A;  3KN4 A;  2HMM B;  8CHO A;  1JBR A;  2OCT A;  1DMM A;  3Q90 A;  1SJW A;  1W02 A;  1CYV A;  4J8T A;  1JNQ A;  4FCZ A;  1W6Y A;  3BB9 A;  4HBR A;  2BNG A;  1TP6 A;  1TFK A;  3FG1 A;  4FMA A;  3SOY A;  3PXM A;  3LOY A;  4N3V A;  1VQ6 3;  1I2F A;  1GY5 A;  1YVB I;  1OGZ A;  1UUW B;  3CMA 3;  1UCI A;  4RBN A;  1YGE A;  1NJI 4;  3HII A;  4L8P A;  2XRX B;  4NPB A;  3CPO A;  4LEH A;  3FCS B;  3NXJ A;  1TJD A;  3F7X A;  3ZG0 A;  1YJW 3;  3DXO A;  2E2U A;  3G6E 3;  2FXT A;  1E3V A;  3OV4 A;  4OK0 A;  4I4K A;  3K9M C;  2KRT A;  3QRD A;  5CF2 A;  1VQK 3;  3FKA A;  1VQN 3;  1OUN A;  3AGO A;  2BMQ B;  3GZY B;  3ALA A;  1RGC A;  2HMJ B;  2L1S A;  2HML B;  1RN4 A;  4BL2 A;  2CFL A;  2P09 A;  4AEQ A;  2MF7 A;  2A15 A;  3NBR A;  2B1X B;  2KXG A;  1MGR A;  1AR0 A;  3FF0 A;  3EE1 A;  3V92 A;  5ELJ A;  1KD1 4;  5CF1 A;  1ZGX A;  3HK4 A;  1RRH A;  4KFE A;  1U8C B;  1BSB A;  1ASK A;  3NBJ A;  3LML A;  4GB5 A;  5G1K A;  1JJ2 2;  4R9K A;  4EV5 A;  1IQY A;  1UI7 A;  1VQQ A;  3I56 3;  2V1L A;  3MHE A;  3NM7 A;  5AEW B;  1DVC A;  1RSN A;  2IY2 A;  1E97 A;  2WO0 A;  3DGY A;  3OWU A;  1GOU A;  3JVC A;  3CNX A;  2P0M A;  1BSC A;  3A76 A;  1OCV A;  3MYT A;  3CU3 A;  2F5W A;  1AQZ A;  2OWP A;  3RDE A;  5GSP A;  2CWU A;  3EX9 A;  3JUP A;  3GWR A;  2XFT A;  3D5G A;  3GZX B;  3JUO A;  7GSP A;  3NHX A;  3KE7 A;  3FSD A;  3L0R A;  4HM5 B;  1K8A 4;  2OQE C;  1VQP 3;  1HYF A;  2R41 A;  1IT7 A;  4HZ9 B;  2F99 A;  1I3F A;  3MG2 A;  1R4Y A;  5G1L A;  2GEY A;  1A2V A;  3DGN A;  1MNL A;  2W9P A;  1MWR A;  1B2X A;  3BIR A;  1YIT 3;  1BNJ A;  1BRI A;  4XB5 A;  2GBW B;  4KFD A;  2AAE A;  4ZM8 A;  1MOL A;  1NO3 A;  2P38 A;  2W04 A;  4J5G A;  1IQ8 A;  1FA3 A;  1I2G A;  1RNT A;  1DMQ A;  2Q07 A;  1KC8 4;  2E2T A;  4FCM A;  2H0I A;  1O7H B;  2CH9 A;  1BOX A;  1IVX A;  1BNF A;  4FCJ A;  1T2I A;  1DYU A;  1I8V A;  4XDV A;  2C10 A;  2IA7 A;  3EBY A;  1RKY A;  1CH0 A;  1LXE A;  3CME 3;  1A67 A;  5ELU A;  5BU4 A;  3UNL A;  2K0M A;  2XF3 A;  1OF5 B;  2WGQ A;  2Z7A A;  3DH2 A;  1WMP A;  3JUM A;  3UJM A;  1M90 4;  3QK9 A;  4EYC A;  4LZI A;  4L8O A;  2K54 A;  2ZA4 A;  3GRD A;  4HM6 B; 
#chains in the Genus database with same CATH homology
 3G16 A;  3U1W A;  1NU3 A;  1LVN A;  3RGA A;  2RSX A;  1QAL A;  5AYS C;  1JB2 A;  1VQ8 3;  1M9G A;  3DMC A;  3X42 A;  2QIY A;  4GL6 A;  2MC8 A;  2WGO A;  3M8C A;  3VSY A;  1U5O A;  1O7G B;  3H3H A;  3AMO B;  5IER A;  1A90 A;  1W01 A;  2O3O A;  3K7C A;  3K5T A;  1OF5 A;  3BNB A;  4PEJ A;  5JPU A;  3X41 A;  4EV2 A;  1Q40 B;  3SOA A;  1FGQ A;  3EF8 A;  1IDP A;  1JKG B;  2OOV A;  2HMN B;  1IU7 A;  1VQM 3;  5AIG A;  1NB5 I;  4CCV A;  3MPH A;  3SX1 A;  3HIG A;  1IV7 A;  4G1M B;  1ULJ B;  2Z77 A;  4OUQ A;  3EJV A;  1VQ9 3;  2STD A;  3N8B A;  1VQ7 3;  3LTA A;  2D42 A;  3FH1 A;  3DGM A;  4IT7 A;  1PU4 A;  3I55 3;  4MMZ B;  1JB5 A;  1AV4 A;  3GZR A;  3AMO A;  3U97 A;  5KP1 A;  6STD A;  4XBY A;  2CC3 A;  3G8Z A;  1FGM A;  3PS8 A;  2IMJ A;  3BND A;  3CCM 3;  4H61 A;  2W2C A;  1STD A;  3PYJ A;  5DRV A;  1IVU A;  1Q40 A;  3B8L A;  1W5Z A;  3BNC A;  4AKY A;  3SXX A;  5AEU B;  1JJ2 2;  1JKG A;  3T8N A;  3B4O A;  4QWT A;  2CFW A;  3CC4 3;  1QMA A;  3S29 A;  4R4K A;  5CLK A;  4XBT A;  1KSI A;  3B7C A;  4WYK B;  2YFJ B;  5G2G A;  2P0X A;  4STD A;  2IUJ A;  3LT8 A;  4LMI A;  4KFF A;  1IV9 A;  2XSH B;  2HMO B;  5CXO A;  2BT3 A;  3CPW 2;  4EC6 A;  1RN7 A;  1RJO A;  1SIH A;  1DMN A;  1VZZ A;  2KCD A;  1OHS A;  2RCD A;  3OW2 2;  3NV0 B;  3FLJ A;  1IT8 A;  2CG1 A;  5D83 A;  1IK3 A;  2CFD A;  4N6O B;  1LOX A;  3K63 A;  1SPU A;  5LC6 A;  5BVB A;  4NHF A;  4N6U A;  5KP4 A;  2CKF B;  3GZB A;  2INX A;  4WYK A;  1A2K A;  1AVK A;  4KVH A;  2IUK A;  3WMD A;  1ZO2 A;  1ISK A;  1YJ9 3;  3VGN A;  3CNM A;  2FNQ A;  4HM7 B;  1QJG A;  4OVM A;  3D9R A;  5IEN A;  1W00 A;  4K1V A;  4WP5 A;  1Y4K A;  3NV0 A;  4MMY B;  5AIF A;  3S67 A;  1YI2 3;  5IEP A;  1Z1S A;  3CCJ 3;  1K28 A;  1N5H A;  3WDG B;  3WA2 X;  1UUV B;  4IPB A;  1W6G A;  1W6C A;  3H51 A;  1DVD A;  3X3Y A;  1OAC A;  3WA3 A;  1WMO A;  1S5A A;  1N9E A;  3EQQ B;  3FG3 A;  4X2O A;  3OWY A;  1US1 A;  2Z76 A;  1WQL B;  1GD3 A;  3LXU X;  1O7W B;  3EBT A;  4N6M A;  2R4I A;  5EEO A;  5IG5 A;  1FGR A;  3V98 A;  1NWW A;  3KSP A;  1J2B A;  4O2H A;  1ZX2 A;  2HMK B;  1CYU A;  2CHC A;  3FG4 A;  1YJN 3;  4EBG A;  3HX8 A;  1FGO A;  2LQV A;  3PCR A;  2CFG A;  5EQL A;  4RZM A;  2M7O A;  1C7H A;  3CCL 3;  4N6T A;  2BHM A;  3F9S A;  2SBL A;  4RNY A;  2L4V A;  1VQL 3;  3EC9 A;  2C11 A;  3NUV A;  4BTX A;  2CIU A;  2GBX B;  2Y73 A;  3RGR A;  2W6J H;  1VQ5 3;  1UI8 A;  3SLU A;  3N54 B;  1IQX A;  2B24 B;  3NM2 A;  3T8U A;  1K73 4;  3CCU 3;  5IW9 A;  1OH0 A;  2O9U X;  4FMD A;  2YFI B;  2XR8 B;  3F14 A;  4O3V A;  5D81 A;  5EVH A;  3CCS 3;  2UX0 A;  1O7P B;  2GU1 A;  1ROV A;  1K9M 4;  1QVF 2;  3GAX A;  2JDI H;  2RFR A;  1T5Y A;  4ORL A;  3KII A;  2YFL B;  3UL5 A;  3V99 A;  1UW1 A;  1W7C A;  3S27 A;  1GD4 A;  2WOH A;  1JB4 A;  4HM1 B;  7STD A;  3LYG A;  3DY5 A;  1S72 3;  3CXC 2;  5IF6 A;  3B4P A;  4BTY A;  3IPT A;  3DGL A;  4HJL B;  2YX9 A;  4J9A A;  1D6Z A;  2QEX 3;  3OWS A;  1TUH A;  1N9J A;  3NQZ A;  5HGR A;  5IG0 A;  3LZA A;  5IEO A;  3EHC A;  1ULI B;  2GXF A;  3G0K A;  4R80 A;  3CD6 3;  1GY6 A;  5DRE A;  3LT9 A;  4HM8 B;  1SQW A;  4XBX A;  3UL6 A;  1M1X B;  4N6N B;  3STD A;  3O8Y A;  1O7N B;  4BTW A;  4HM0 B;  1JRQ A;  3CCQ 3;  1PFP A;  1WMN A;  3F8X A;  4O02 B;  5JPP A;  5A0O B;  5BXQ A;  3JUN A;  3SVA A;  1WNH A;  3F8H A;  3JUQ A;  2ZDJ A;  1LNH A;  3MKI A;  4NRE A;  3TDG A;  3WOD G;  2Y74 A;  1OGX A;  1JV2 B;  4K1U A;  2QGU A;  1YHQ 3;  3DM8 A;  5JBS A;  4N6V 0;  1W4N A;  2WOF A;  4X2H A;  2E2V A;  3E99 A;  4JF8 A;  3NBB A;  2CWT A;  1GY7 A;  3EN8 A;  3KZT A;  3D3L A;  3PZW A;  4LSO A;  4TX4 A;  3IJE B;  1BUQ A;  1IVV A;  3FF2 A;  4O8S A;  3LTB A;  4HYZ A;  3Q2P A;  3DGO A;  3G4S 3;  4MEI A;  1O7M B;  4AKZ A;  4L7K A;  2OTJ 3;  1Q82 4;  1R4C A;  1JN5 B;  3ROB A;  2BMO B;  2XSO B;  3Q1C A;  2CFK A;  1E3R A;  1Q7Y 4;  2CWV A;  1VQ4 3;  1F8N A;  4CDL A;  4LGQ A;  3BNE A;  3KKG A;  1Q42 A;  4Q53 A;  4HM4 B;  3KFQ C;  1K41 A;  3NQY A;  2W56 B;  4FMB A;  4K61 A;  1OPY A;  1HU9 A;  5AYR B;  1TU5 A;  3LTD A;  3VF1 A;  3I0Y A;  3WOF B;  5D82 A;  5KP3 A;  3X3Z A;  1EG9 B;  3CC7 3;  3EB8 A;  4K90 B;  2Z6B A;  3DUK A;  1JN5 A;  1W2B 2;  3CC2 3;  3MG3 A;  1Q81 4;  2JQ5 A;  3CCE 3;  4XM4 A;  3OX9 A;  2XH9 A;  1G96 A;  3FZW A;  3CCV 3;  1Q86 4;  1QVG 2;  5AIH A;  5CK6 A;  4FR9 A;  2BO9 B;  5AI1 A;  3N9H A;  5FW5 A;  2RGQ A;  2W03 A;  3F40 A;  2CG0 A;  2W9Q A;  1FGT A;  3BLZ A;  3HZP A;  1NB3 I;  1EA2 A;  2W56 A;  2XEP A;  3PCS A;  1VQO 3;  1OHP A;  1L5G B;  2ML6 A;  5I97 A;  3MWZ A;  3LH4 A;  3HI7 A;  2OOV C;  1NDO B;  1N8R 4;  1OHO A;  2I9W A;  2XFS A;  1QAF A;  1TIJ A;  2PNC A;  2P05 A;  2XGL A;  3EN1 B;  5IG4 A;  5AII A;  3S28 A;  4HM2 B;  3S5C A;  1CEW I;  1GYB A;  1RRL A;  3IMA B;  4HM3 B;  2F86 B;  1STF I;  3OXA A;  1QAK A;  1SII A;  3KSE D;  5TGN A;  1M1K 4;  1TFO A;  2PZV A;  3T0U A;  1FUW A;  4HVN A;  4KZ1 A;  4XDW A;  2OQE A;  4EXR A;  1WTH A;  2OTL 3;  3X3X A;  1V74 A;  3WOE B;  3NX0 A;  4R9L A;  3MSO A;  3SED A;  1CQS A;  4WWU C;  1N8Q A;  3CCR 3;  1GS3 A;  1W2Z A;  3LTC A;  3UB1 A;  4RNZ A;  1N5P A;  4MMX B;  2CW9 A;  4R1K A;  4HKV B;  2GEX A;  5IG3 A;  1EKM A;  2CK3 H;  3F7S A;  3PGB A;  1IVW A;  5STD A;  4H3U A;  2QA4 3;  4FMC A;  1D6U A;  1AVL A;  2LYX A;  2D1W A;  3DZL A;  4U13 A;  5FGO A;  2W0Q A;  2F98 A;  3ER7 A;  3J7Y d;  1ROA A;  3MG1 A;  1D6Y A;  4MJD A;  3K0Z A;  4WHA A;  2FGT A;  2ML5 A;  4JRF A;  2ZL8 A;  3X40 A;  4HZB B;  4IIA A;  2XGN A;  1KWI A;  4N6L A;  1YIJ 3;  4WFO A;  1KQS 2;  2BMR B;  3G71 3;  1HKX A;  3FGY A;  5LC7 A;  1EQK A;  2GU3 A;  3ECF A;  3KN4 A;  2HMM B;  8CHO A;  2OCT A;  1DMM A;  3Q90 A;  1SJW A;  1W02 A;  1CYV A;  4J8T A;  1JNQ A;  4FCZ A;  1W6Y A;  3BB9 A;  4HBR A;  2BNG A;  1TP6 A;  1TFK A;  3FG1 A;  4FMA A;  3SOY A;  3PXM A;  3LOY A;  4N3V A;  1VQ6 3;  1GY5 A;  1YVB I;  1OGZ A;  1UUW B;  3CMA 3;  4RBN A;  1YGE A;  1NJI 4;  3HII A;  4L8P A;  2XRX B;  3CPO A;  4LEH A;  3FCS B;  3NXJ A;  3F7X A;  1YJW 3;  3DXO A;  2E2U A;  3G6E 3;  2FXT A;  1E3V A;  3OV4 A;  4OK0 A;  4I4K A;  3K9M C;  2KRT A;  3QRD A;  5CF2 A;  1VQK 3;  3FKA A;  1VQN 3;  1OUN A;  3GZY B;  2BMQ B;  3ALA A;  2HMJ B;  2HML B;  2CFL A;  2P09 A;  4AEQ A;  2MF7 A;  2A15 A;  3NBR A;  2B1X B;  2KXG A;  1AR0 A;  3FF0 A;  3EE1 A;  3V92 A;  5ELJ A;  1KD1 4;  5CF1 A;  3HK4 A;  1RRH A;  4KFE A;  1U8C B;  1ASK A;  3NBJ A;  3LML A;  4GB5 A;  4R9K A;  4EV5 A;  1IQY A;  1UI7 A;  3I56 3;  2V1L A;  3MHE A;  3NM7 A;  5AEW B;  1DVC A;  1E97 A;  2WO0 A;  3OWU A;  3JVC A;  3CNX A;  2P0M A;  3A76 A;  1OCV A;  3MYT A;  3CU3 A;  2OWP A;  3RDE A;  2CWU A;  3EX9 A;  3JUP A;  3GWR A;  2XFT A;  3GZX B;  3JUO A;  3NHX A;  3KE7 A;  3FSD A;  3L0R A;  4HM5 B;  1K8A 4;  2OQE C;  1VQP 3;  1IT7 A;  4HZ9 B;  2F99 A;  3MG2 A;  2GEY A;  1A2V A;  3DGN A;  1MNL A;  2W9P A;  1YIT 3;  4XB5 A;  2GBW B;  4KFD A;  4ZM8 A;  1MOL A;  1NO3 A;  2P38 A;  2W04 A;  1IQ8 A;  1FA3 A;  1DMQ A;  2Q07 A;  1KC8 4;  2E2T A;  4FCM A;  1O7H B;  2CH9 A;  1IVX A;  4FCJ A;  1DYU A;  4XDV A;  2C10 A;  2IA7 A;  3EBY A;  1RKY A;  3CME 3;  1LXE A;  1A67 A;  5ELU A;  3UNL A;  2K0M A;  2XF3 A;  1OF5 B;  2WGQ A;  2Z7A A;  1WMP A;  3JUM A;  3UJM A;  1M90 4;  3QK9 A;  4EYC A;  4LZI A;  4L8O A;  2K54 A;  3GRD A;  4HM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...