5KP1A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y16(cl-y)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
124
Chain Sequence
LPTAQEVQGLMARIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 36
structure length 124
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp1A00
3G8ZA 2YFJB 3OV4A 1Q40A 2BMQB 3MHEA 1NDOB 1JB5A 1QMAA 3LZAA 1DMMA 4FCJA 1GY7A 4J8TA 4XB5A 5EVHA 5TGNA 7STDA 2F98A 1OUNA 3G0KA 4R9KA 3NXJA 4GB5A 2RGQA 2XRXB 3H3HA 4HKVB 4K1VA 4CDLA 1A2KA 3EC9A 4HVNA 3GZBA 3S5CA 2STDA 3JUQA 4XM4A 1NWWA 4U13A 1JKGB 1TUHA 4R9LA 5D83A 3VGNA 1S5AA 1NU3A 5IENA 5KP4A 1OGXA 3JUMA 4HM7B 2QGUA 3NM2A 2A15A 1ZX2A 2INXA 4X2HA 5CXOA 1GY6A 3HK4A 1UUVB 4HM2B 2Z7AA 4L8PA 3GRDA 4XBXA 5DRVA 3JUOA 4WYKB 4L8OA 1DMQA 3ECFA 3F14A 1O7NB 2HMJB 1OF5B 1E3RA 3EN8A 3F7XA 4N3VA 2GBXB 3EBYA 1ULIB 4ORLA 5JPUA 5IEPA 3BB9A 3CU3A 3B4PA 4HM8B 3KE7A 3MKIA 4HM3B 4IIAA 5KP3A 3ROBA 1GY5A 1W02A 2HMMB 5AI1A 3VSYA 3DMCA 2PZVA 3K0ZA 5IG5A 3EHCA 4J9AA 5IEOA 2XR8B 3CNXA 1EA2A 3HX8A 3B4OA 4HM4B 3EQQB 2Z77A 3MG2A 3Q90A 3H51A 4HZ9B 2BMOB 5D82A 2Z76A 3GWRA 3K7CA 5AEUB 1Q42A 1E97A 1C7HA 3OWUA 5CK6A 3F9SA 1JN5B 1SJWA 1U5OA 2BMRB 2GBWB 4Q53A 5JPPA 2XSOB 1K41A 4HM5B 4STDA 3G16A 1OGZA 2RFRA 4XDWA 5IERA 3STDA 1O7MB 3MG1A 5HGRA 1IDPA 1WQLB 2K54A 2I9WA 3OWYA 3EX9A 4HZBB 1JB2A 4LEHA 4MJDA 4XDVA 5CLKA 1O7PB 3FZWA 2YFIB 3SEDA 3SOAA 5BXQA 1Z1SA 3B7CA 1JB4A 3HZPA 3BLZA 3OX9A 5AIIA 3NBRA 2B24B 2HMOB 3CNMA 2YFLB 5D81A 1E3VA 4LMIA 6STDA 3WMDA 4K1UA 3KSPA 1ASKA 1JKGA 1OF5A 3T8NA 3GZXB 1DMNA 2OWPA 3E99A 3A76A 3KKGA 4HM1B 4WYKA 5CF1A 1GS3A 3NV0B 1O7GB 1OPYA 4RZMA 1Q40B 3FGYA 3DXOA 4R1KA 1ULJB 3NV0A 3OXAA 2JQ5A 3FLJA 3NHXA 2BNGA 3F8XA 3LYGA 5AIHA 1GYBA 1ZO2A 2HMNB 3DZLA 1W00A 4I4KA 1EG9B 5IG0A 5IG3A 1VZZA 8CHOA 5FW5A 3M8CA 3GZRA 3JUNA 5AIGA 1OCVA 2GEXA 3F7SA 3FF2A 4L7KA 4OUQA 3DUKA 3F40A 2CHCA 1JN5A 3RGRA 5AEWB 3MSOA 1W6YA 5CF2A 2IMJA 1HKXA 3MYTA 5G2GA 3UNLA 2HMKB 5STDA 3DM8A 1O7WB 2R4IA 3D9RA 3UJMA 2UX0A 3F8HA 3FSDA 2F86B 3FH1A 3OWSA 4HM6B 2W2CA 3NUVA 5AIFA 2QIYA 3KZTA 1BUQA 2F99A 3FF0A 1STDA 4HJLB 2B1XB 5DREA 4XBTA 1OHPA 3EJVA 4XBYA 3T8UA 5IG4A 1TP6A 3EF8A 4PEJA 2GEYA 3IPTA 3RGAA 1UUWB 5KP1A 3CPOA 1O7HB 1QJGA 5IF6A 3EN1B 1ISKA 2XSHB 3GZYB 2CKFB 4OVMA 1CQSA 3SOYA 1W01A 2RCDA 3EBTA 3ER7A 1OHOA 4LGQA 4WP5A 4WWUC 5BVBA 3B8LA 1OH0A 1AR0A 2GXFA 3I0YA 3MG3A 3FKAA 4H3UA 4FCMA 4X2OA 3JUPA 2HMLB 1OHSA 4HM0B 4KVHA
chains in the Genus database with same CATH superfamily
1LQGC 2E2VA 3KFQC 2XGNA 7RNTA 1NDOB 1QMAA 4KFDA 2RSXA 3CCS3 1W2B2 1RCKA 1F8NA 1BRKA 3KCHA 1A90A 1G96A 3NXJA 3CXC2 2XRXB 2KXGA 1I0XA 3H3HA 3EC9A 4HVNA 1RSNA 3GZBA 1X1XA 4LZIA 1IYYA 2FNQA 3VGNA 1YVSA 1NU3A 2D1WA 3AMOA 3X3YA 3MPHA 5CXOA 1GY6A 3HK4A 1RGFA 2M7OA 1BGSA 3AGNA 3BNDA 4HM2B 1SIHA 3LT8A 1LOWA 2H0GA 3ECFA 1O7NB 4ILFA 3URPA 3D79A 2GU1A 5JPUA 3S27A 3EBYA 2WGQA 2QEX3 1BNJA 1FGRA 1RLSA 1RHLA 2LYXA 3X40A 1MWRA 4J5GA 6RNTA 1N9JA 3DGOA 1KWIA 1V74A 2W56B 4HM3B 3CCR3 1FUTA 5AI1A 1W02A 1A67A 4RBNA 3K0ZA 5IG5A 4N6TA 1ZS7A 6GSPA 4J9AA 1K9M4 4HM4B 1X1UA 3B4OA 4GL6A 2BMOB 4HZ9B 4BL3A 3LT9A 5AEUB 1E97A 3S5CA 1Q7Y4 1U5OA 1SJWA 2GBWB 2IUKA 5JPPA 1QVG2 5GSPA 2XF3A 1IQXA 2RFRA 1I2EA 1O7MB 1TFKA 5G1KA 1IDPA 3SLUA 4MJDA 2WO0A 3WA3A 3SEDA 1TTOA 2Y74A 3EE1A 5BXQA 3BLZA 3HIGA 1MNLA 3CCE3 1PFPA 3CNMA 1US1A 3JVCA 5D81A 2WOFA 5AYSC 1R4YA 2ML6A 1AVKA 1RRLA 3NBJA 5I97A 1YJW3 4WYKA 1O7GB 1OPYA 3DXOA 4R1KA 2ML5A 3OXAA 2IY2A 1YI23 3NHXA 3KSED 1BIRA 3DZLA 3IMAB 1I3FA 2J8XB 1DYUA 3AHWA 5IG3A 2QA43 4JRFA 8CHOA 1AY7A 3M8CA 2F5WA 3SX1A 1TRPA 1BUJA 1EKMA 4OK0A 4IPBA 4L7KA 3DUKA 4IT7A 2CHCA 3RDEA 1M1K4 1W6YA 1IVUA 1BSDA 2IMJA 4N6V0 3K9MC 2JDIH 3BIRA 2HMKB 3DM8A 1STFI 2R41A 2UX0A 3F8HA 2W2CA 3NUVA 5AIFA 8RNTA 1QAKA 1BUQA 1DE3A 3QRDA 4EBGA 1PU4A 1RTUA 3V99A 1D6YA 2F99A 1ROAA 4K61A 3FCSB 4R80A 4FMBA 1BRIA 3EJVA 4XBYA 1NO3A 1RDSA 1TP6A 3T8UA 3PCSA 4PEJA 2ZDJA 1UUWB 1RN4A 3LXUX 2W56A 2GSPA 4EC6A 4KFFA 1LOXA 3G713 1CQSA 3VF1A 1W01A 1JJ22 1TJDA 5BVBA 4N6UA 1RN7A 1G02A 3FKAA 4FCMA 3JUPA 3A5EA 1M9GA 1OHSA 4HM0B 2WGOA 1RGCA 1UI7A 1Q40A 3MHEA 7STDA 1LXEA 1GY7A 5TGNA 2O9UX 4CJNA 3I553 2UGIA 2XEPA 3AMOB 2STDA 3JUQA 4WFOA 1NWWA 5D83A 3BNEA 1ZGXA 4O8SA 3EB8A 3IJEB 2CW9A 3ZFZA 3CC23 4HM7B 4NREA 2QGUA 1Q7HA 2INXA 3NM2A 2W03A 3PYJA 1WMOA 3PZWA 4XBXA 4BL2A 5DRVA 2Z7AA 4L8PA 3GRDA 1YGWA 3CCL3 3JUOA 1FZUA 3EN8A 3S67A 1VQ93 5G1LA 9RNTA 4ORLA 5IEPA 1B3SA 5BU4A 1CYUA 1NJI4 4HM8B 1IVXA 3KE7A 3PXMA 4O02B 5KP3A 1VQ63 3CC73 1BSCA 3G6E3 3OW22 1MOLA 2PZVA 3ALAA 1RKYA 4FMAA 4FR9A 4AKZA 1JV2B 1VQK3 3EHCA 4CCVA 2CWUA 3ZG0A 2XR8B 3CNXA 1EA2A 3HX8A 1G0TA 3N8BA 4GHOA 1QALA 1VQN3 1Q864 5LC6A 3GWRA 2W04A 2ZA4A 3KN4A 1W2ZA 1RNBA 2AADA 4BTXA 2E2TA 1BOXA 1OACA 1MWTA 2RNTA 3D3LA 4HM5B 1OGZA 1MGRA 4N6LA 1RGAA 2KF6A 3STDA 1ROVA 3NM7A 2K54A 3EX9A 5IERA 1JB2A 1O7PB 3FZWA 2YFIB 1TU5A 3HZPA 3OX9A 3PS8A 1CH0A 2V1LA 5AIIA 2ZL8A 3K5TA 1GOUA 2B24B 1CYVA 2HMOB 6STDA 5BIRA 1RN1A 2P0MA 2YX9A 1UCIA 3NQYA 4K1UA 3DGMA 3KSPA 4CPKA 1HYFA 2P0XA 1WMNA 2OOVA 1DMNA 2OWPA 3KKGA 5CF1A 1BSEA 4RNZA 1GS3A 1N8QA 1Q40B 2BIRA 3FG3A 1LRAA 3NV0A 1L5GB 2W0QA 1FA3A 2JQ5A 1N5HA 3FLJA 4O2HA 3F8XA 2KF4A 1GYBA 1BNIA 1W00A 2KF5A 1U8CB 5M1AA 1OCVA 4OUQA 3FF2A 3U97A 1BRNL 3AHSA 1TRQA 3WA2X 1RNTA 3T0UA 1VQQA 2GU3A 1O7WB 1I3IA 3V98A 1GOYA 1W7CA 2H0IA 3D4AA 5EQLA 2QIYA 1UI8A 3LOYA 2H0HA 2Z6BA 3ZG5A 2ZHXB 3HI7A 4HJLB 2RBIA 4XBTA 2D42A 2GEYA 3IPTA 3FG1A 1QJGA 1MGWA 5IF6A 4RNTA 3GZYB 2CKFB 1GMRA 4ZM8A 1YJ93 2P09A 2RCDA 3EBTA 1K8A4 4LGQA 1OHOA 4WP5A 2IUJA 4EYCA 3UB1A 3CMA3 1LQMB 1MWSA 4I5QA 5FGOA 1V57A 4H3UA 1AR0A 3I0YA 1IV7A 4NPBA 1RGHA 3LTAA 3G8ZA 2O3OA 4KVHA 3OV4A 5RNTA 1SIIA 1IT7A 1BRGA 3GSPA 4J8TA 1DMMA 5EVHA 4MMXB 1LOYA 1OUNA 3G0KA 2E2UA 3WOEB 3AGOA 1A2VA 4K1VA 1A2KA 1IQYA 1RGKA 3CD63 5A0OB 1BANA 4HBRA 4XM4A 3NBBA 4U13A 2CWTA 4R9LA 2OQEA 5KP4A 1S5AA 1S723 1RGEA 5IENA 1BNRA 3JUMA 4QWTA 1I0VA 3NX0A 2SARA 4N6NB 4X2HA 1ZX2A 5IW9A 3RNTA 1BVIA 1UUVB 1FGTA 7GSPA 2Q07A 4WYKB 2XGLA 1DMQA 3CCM3 2XH9A 1UW1A 2HMJB 1UDII 3F7XA 5G2GA 2CFGA 1ULIB 1I8VA 3X41A 2F56A 1IVWA 5ELJA 1LNHA 1M1XB 3ROBA 1T3BA 2HMMB 1J2BA 3HOHA 2UUGC 4N6OB 3DMCA 3X3ZA 5JBSA 1VQ53 3MWZA 1RGLA 1MWUA 2L1SA 3CCU3 3EQQB 3MG2A 1GMQA 2L4VA 5D82A 1KC84 2Z76A 3FG4A 2Y73A 2C10A 1JN5B 2BMRB 3NQZA 1KD14 1TFOA 3D5IA 1K28A 3G16A 2FXTA 4XDWA 1BAOA 1Q9EA 4KFEA 3MG1A 1GD3A 4KZ1A 1FYSA 5HGRA 2KAAA 1W6CA 1YNVX 2CH9A 2I9WA 4LEHA 5CLKA 1UCLA 4LYLB 5LC7A 1T5YA 4FMDA 1JB4A 2CG0A 3CCJ3 4TX4A 1Q824 3NBRA 1EQKA 1EUIC 3HIIA 3CC43 2YFLB 3LTBA 3WMDA 4BTWA 1ASKA 1B2UA 1SPUA 1B2MA 1BU4A 1OF5A 3GZXB 1RGGA 3E99A 4HM1B 3A76A 3D5GA 3DH2A 2HMLB 1BRJA 4RZMA 3WOFB 1DVDA 1BNSA 1RCLA 1BNEA 2BU4A 1ULJB 3CPW2 3N9HA 2CFLA 1VQ83 2KF3A 3GAXA 1FGOA 5AIHA 2HMNB 1ZO2A 3SYUA 1EEJA 2OOVC 2SBLA 4O3VA 5IG0A 1AQZA 2MC8A 1W4NA 3DGNA 3LH4A 3LTCA 2OTJ3 1BRSA 1I2FA 3GZRA 1N5PA 5AIGA 1B27A 2GEXA 3F7SA 1X1WA 3RGRA 4BTYA 1SQWA 3MSOA 3UL5A 1IQ8A 1VQ73 1V58A 1I70A 3D9RA 3UJMA 3V92A 3FSDA 1UUGB 4HM6B 1HU9A 1UCJA 5AYRB 4BIRA 5HOHA 1N9EA 1JBTA 2K3DA 1W5ZA 4FCZA 4RNYA 1D6ZA 2K0MA 1FGQA 1STDA 2BHMA 3FF0A 5DREA 2WOHA 4HOHA 5IG4A 3RGAA 1B21A 3CPOA 4KT3B 4MEIA 1VQO3 1N8R4 1FGMA 1SARA 3X3XA 3SOYA 3U1WA 1JBRA 3ER7A 1IK3A 1RMSA 2IA7A 3MG3A 3X42A 1KSIA 4R4KA 3J7Yd 4I4KA 2BT3A 3BNBA 3LMLA 4DKIA 3SVAA 2F5MA 2YFJB 2BMQB 1RRHA 3S29A 1JB5A 3LZAA 4XB5A 4FCJA 2OQEC 1NB3I 2HOHA 1RJOA 2F98A 2F4YA 2W9QA 1Y4KA 4GB5A 2RGQA 4HKVB 4R9KA 4CDLA 1FUWA 2C11A 1WTHA 1NNVA 1JKGB 1TUHA 1QVF2 2KCDA 1OGXA 1K734 1BRHA 1FUSA 4NHFA 1JBSA 2OTL3 2A15A 1DVCA 1BNGA 3DGYA 4L8OA 1PY3A 1Q814 3F14A 2OCTA 4N3VA 1OF5B 1E3RA 3WODG 3WR2A 3I563 1B20A 2GBXB 2P05A 3PCRA 3BB9A 3CU3A 3CCQ3 1X1YA 1C54A 1GMPA 2CIUA 3B4PA 4EV2A 3MKIA 4IIAA 1GY5A 4HAAA 2KRTA 3VSYA 1W6GA 3Q3FA 1IV9A 1UGHI 4AEQA 4WHAA 5IEOA 1AV4A 1IU7A 3G4S3 2AAEA 4JF8A 4EXRA 2Z77A 2C4BA 3Q90A 3H51A 1I2GA 3KIIA 1LVNA 1DETA 2CC3A 1YIJ3 3K7CA 1Q42A 3OWUA 1C7HA 1YVBI 2W6JH 3F9SA 4Q53A 5CK6A 3O8YA 2XSOB 1K41A 4STDA 1AVLA 3WHOA 3N54B 3CCV3 1VQP3 1YIT3 3QK9A 3CME3 1BNFA 3DY5A 4FMCA 1YJN3 5M19A 4MMYB 1WQLB 3OWYA 3Q1CA 4HZBB 4XDVA 2MF7A 4EV5A 1VQ43 1FW7A 5ELUA 2W9PA 3SOAA 1Z1SA 3B7CA 1KQS2 1A2PA 1JNQA 4EW5A 1YGEA 3S28A 2XFTA 4K90B 1E3VA 1GOVA 3LTDA 4LMIA 4LSOA 1WNHA 1LOVA 1JKGA 5M18A 3T8NA 5EEOA 4BU4A 2BO9B 1CEWI 2CFKA 3NV0B 3FGYA 2PNCA 1JRQA 1IT8A 1B2ZA 1QAFA 2BNGA 2LQVA 3LYGA 1VQL3 4MMZB 1EG9B 3L0RA 1HZ1A 1JZOA 1VZZA 3BU4A 5FW5A 1B2SA 3JUNA 2CG1A 5AEWB 3F40A 5CF2A 2CFDA 1JN5A 3BNCA 1GSPA 1WMPA 3DGLA 2CX1A 1HKXA 3MYTA 1M904 3UNLA 5STDA 2R4IA 1IVVA 3Q2PA 2F86B 1UCKA 2IYJA 2P38A 3FH1A 3OWSA 3KZTA 4N6MA 1PYLA 3PGBA 1BSBA 1B2XA 2B1XB 1LNIA 1OHPA 1YHQ3 5KP1A 3EF8A 2FGTA 3SXXA 4AKYA 4HYZA 1O7HB 4GSPA 2XFSA 3UL6A 3EN1B 2CFWA 2XSHB 1UGIA 3K63A 4OVMA 1BSAA 3TDGA 2CK3H 1VQM3 1ISKA 4WWUC 1R4CA 1TIJA 1NB5I 1JZDA 1T2HA 2CX0A 3B8LA 1D6UA 4G1MB 4J5KA 1OH0A 2GXFA 2CWVA 4X2OA 1T2IA 1GD4A 4H61A 3WDGB
chains in the Genus database with same CATH topology
2E2VA 3KFQC 2XGNA 1NDOB 1QMAA 4KFDA 2RSXA 3CCS3 1W2B2 1F8NA 1A90A 1G96A 3NXJA 3CXC2 2XRXB 2KXGA 3H3HA 3EC9A 4HVNA 4LZIA 3GZBA 2FNQA 3VGNA 1NU3A 2D1WA 3AMOA 3X3YA 3MPHA 5CXOA 1GY6A 3HK4A 2M7OA 3BNDA 4HM2B 1SIHA 3LT8A 3ECFA 1O7NB 2QEX3 2GU1A 5JPUA 3S27A 3EBYA 2WGQA 1FGRA 2LYXA 3X40A 1N9JA 3DGOA 1KWIA 1V74A 2W56B 4HM3B 3CCR3 1A67A 5AI1A 1W02A 4RBNA 3K0ZA 5IG5A 4N6TA 4J9AA 1K9M4 4HM4B 3B4OA 4GL6A 2BMOB 4HZ9B 5AEUB 3LT9A 1E97A 3S5CA 1Q7Y4 1U5OA 1SJWA 2GBWB 2IUKA 5JPPA 1QVG2 2XF3A 1IQXA 2RFRA 1O7MB 1TFKA 1IDPA 3SLUA 4MJDA 2WO0A 3WA3A 3SEDA 2Y74A 3EE1A 5BXQA 3BLZA 3HIGA 1MNLA 3CCE3 1PFPA 3CNMA 1US1A 3JVCA 5D81A 2WOFA 5AYSC 2ML6A 1AVKA 1RRLA 3NBJA 5I97A 1YJW3 4WYKA 1O7GB 1OPYA 3DXOA 4R1KA 2ML5A 3OXAA 1YI23 3NHXA 3KSED 3IMAB 3DZLA 1DYUA 5IG3A 2QA43 4JRFA 8CHOA 3M8CA 3SX1A 1EKMA 4OK0A 4IPBA 4L7KA 3DUKA 4IT7A 2CHCA 3RDEA 1M1K4 1W6YA 1IVUA 2IMJA 4N6V0 3K9MC 2JDIH 2HMKB 3DM8A 1STFI 2UX0A 3F8HA 2W2CA 3NUVA 5AIFA 1QAKA 1BUQA 3QRDA 4EBGA 1PU4A 3V99A 1D6YA 2F99A 1ROAA 4K61A 3FCSB 4R80A 4FMBA 3EJVA 4XBYA 1NO3A 3T8UA 1TP6A 3PCSA 4PEJA 2ZDJA 1UUWB 3LXUX 2W56A 4EC6A 4KFFA 1LOXA 3G713 1CQSA 3VF1A 1W01A 1JJ22 5BVBA 4N6UA 1RN7A 3FKAA 4FCMA 3JUPA 1M9GA 1OHSA 4HM0B 2WGOA 1UI7A 1Q40A 3MHEA 7STDA 1LXEA 1GY7A 5TGNA 2O9UX 3I553 2XEPA 3AMOB 2STDA 3JUQA 4WFOA 1NWWA 5D83A 3BNEA 4O8SA 3EB8A 3IJEB 2CW9A 3CC23 4HM7B 4NREA 2QGUA 3NM2A 2INXA 3PYJA 2W03A 3PZWA 1WMOA 4XBXA 5DRVA 2Z7AA 4L8PA 3GRDA 3CCL3 3JUOA 3EN8A 3S67A 1VQ93 4ORLA 5IEPA 1CYUA 1NJI4 4HM8B 1IVXA 3KE7A 3PXMA 4O02B 5KP3A 1VQ63 3CC73 3G6E3 3OW22 1MOLA 2PZVA 3ALAA 1RKYA 4FMAA 4FR9A 4AKZA 1JV2B 1VQK3 3EHCA 4CCVA 2CWUA 2XR8B 3CNXA 1EA2A 3HX8A 3N8BA 1QALA 1VQN3 1Q864 5LC6A 3GWRA 2W04A 3KN4A 1W2ZA 4BTXA 2E2TA 1OACA 3D3LA 4HM5B 1OGZA 4N6LA 3STDA 1ROVA 3NM7A 2K54A 3EX9A 5IERA 1JB2A 1O7PB 3FZWA 2YFIB 1TU5A 3HZPA 3OX9A 3PS8A 5AIIA 2V1LA 2ZL8A 3K5TA 2B24B 1CYVA 2HMOB 6STDA 2P0MA 2YX9A 3NQYA 4K1UA 3DGMA 3KSPA 2P0XA 1WMNA 2OOVA 1DMNA 2OWPA 3KKGA 5CF1A 4RNZA 1GS3A 1N8QA 1Q40B 3FG3A 3NV0A 1L5GB 2W0QA 1FA3A 2JQ5A 1N5HA 3FLJA 4O2HA 3F8XA 1GYBA 1W00A 1U8CB 1OCVA 4OUQA 3FF2A 3U97A 3WA2X 3T0UA 2GU3A 1O7WB 3V98A 1W7CA 5EQLA 2QIYA 1UI8A 3LOYA 2Z6BA 3HI7A 4HJLB 4XBTA 2D42A 2GEYA 3IPTA 3FG1A 1QJGA 5IF6A 3GZYB 2CKFB 4ZM8A 1YJ93 2P09A 2RCDA 3EBTA 1K8A4 4LGQA 1OHOA 4WP5A 2IUJA 4EYCA 3UB1A 3CMA3 5FGOA 4H3UA 1AR0A 3I0YA 1IV7A 3LTAA 3G8ZA 2O3OA 4KVHA 3OV4A 1SIIA 1IT7A 4J8TA 5EVHA 1DMMA 4MMXB 1OUNA 3G0KA 2E2UA 3WOEB 1A2VA 4K1VA 1A2KA 1IQYA 3CD63 5A0OB 4HBRA 4XM4A 3NBBA 4U13A 2CWTA 4R9LA 2OQEA 5KP4A 1S5AA 1S723 5IENA 3JUMA 4QWTA 3NX0A 4N6NB 5IW9A 4X2HA 1ZX2A 1UUVB 1FGTA 2Q07A 4WYKB 2XGLA 1DMQA 3CCM3 2XH9A 1UW1A 2HMJB 3F7XA 5G2GA 2CFGA 1ULIB 3X41A 1IVWA 5ELJA 1LNHA 1M1XB 3ROBA 2HMMB 1J2BA 4N6OB 3X3ZA 3DMCA 5JBSA 1VQ53 3MWZA 3CCU3 3EQQB 3MG2A 2L4VA 5D82A 1KC84 2Z76A 3FG4A 2Y73A 2C10A 1JN5B 2BMRB 3NQZA 1KD14 1TFOA 1K28A 3G16A 2FXTA 4XDWA 4KFEA 3MG1A 1GD3A 4KZ1A 5HGRA 1W6CA 2CH9A 2I9WA 4LEHA 5CLKA 5LC7A 1T5YA 4FMDA 1JB4A 2CG0A 3CCJ3 4TX4A 1Q824 3NBRA 1EQKA 3HIIA 3CC43 2YFLB 3LTBA 3WMDA 4BTWA 1ASKA 1SPUA 1OF5A 3GZXB 3E99A 4HM1B 3A76A 2HMLB 4RZMA 3WOFB 1DVDA 1ULJB 3CPW2 3N9HA 2CFLA 1VQ83 3GAXA 1FGOA 5AIHA 2HMNB 1ZO2A 2OOVC 2SBLA 4O3VA 5IG0A 2MC8A 1W4NA 3DGNA 3LH4A 3LTCA 2OTJ3 3GZRA 1N5PA 5AIGA 2GEXA 3F7SA 3RGRA 4BTYA 1SQWA 3MSOA 3UL5A 1IQ8A 1VQ73 3D9RA 3UJMA 3V92A 3FSDA 4HM6B 1HU9A 5AYRB 1N9EA 4FCZA 1W5ZA 4RNYA 1D6ZA 2K0MA 1FGQA 1STDA 2BHMA 3FF0A 5DREA 2WOHA 5IG4A 3RGAA 3CPOA 4MEIA 1VQO3 1N8R4 1FGMA 3X3XA 3SOYA 3U1WA 3ER7A 1IK3A 2IA7A 3MG3A 3X42A 1KSIA 4R4KA 3J7Yd 4I4KA 3BNBA 2BT3A 3LMLA 3SVAA 2YFJB 2BMQB 1RRHA 3S29A 1JB5A 3LZAA 4XB5A 4FCJA 2OQEC 1NB3I 1RJOA 2F98A 4R9KA 2W9QA 1Y4KA 4GB5A 2RGQA 4HKVB 1FUWA 4CDLA 2C11A 1WTHA 1JKGB 1TUHA 1QVF2 2KCDA 1OGXA 1K734 4NHFA 2OTL3 2A15A 1DVCA 4L8OA 1Q814 3F14A 2OCTA 4N3VA 1OF5B 1E3RA 3WODG 3I563 2GBXB 2P05A 3PCRA 3BB9A 3CU3A 3CCQ3 2CIUA 3B4PA 4EV2A 3MKIA 4IIAA 1GY5A 2KRTA 3VSYA 1W6GA 1IV9A 4AEQA 4WHAA 5IEOA 1AV4A 1IU7A 3G4S3 4JF8A 4EXRA 2Z77A 1YIJ3 3Q90A 3H51A 3KIIA 1LVNA 2CC3A 3K7CA 1Q42A 3OWUA 2W6JH 1C7HA 1YVBI 3F9SA 4Q53A 5CK6A 3O8YA 2XSOB 1K41A 4STDA 1AVLA 1VQP3 3N54B 3CCV3 1YIT3 3QK9A 3CME3 3DY5A 4FMCA 1YJN3 4MMYB 1WQLB 3OWYA 3Q1CA 4HZBB 4XDVA 2MF7A 4EV5A 1VQ43 5ELUA 2W9PA 3SOAA 1Z1SA 3B7CA 1KQS2 1JNQA 1YGEA 3S28A 2XFTA 4K90B 1E3VA 3LTDA 4LMIA 4LSOA 1WNHA 1JKGA 3T8NA 5EEOA 2BO9B 1CEWI 2CFKA 3NV0B 3FGYA 2PNCA 1JRQA 1IT8A 1QAFA 2BNGA 2LQVA 3LYGA 1VQL3 4MMZB 1EG9B 3L0RA 1VZZA 5FW5A 3JUNA 2CG1A 5AEWB 3F40A 5CF2A 2CFDA 1JN5A 3BNCA 1WMPA 3DGLA 1HKXA 3MYTA 1M904 3UNLA 5STDA 2R4IA 1IVVA 3Q2PA 2F86B 3FH1A 2P38A 3OWSA 3KZTA 4N6MA 3PGBA 2B1XB 1OHPA 1YHQ3 5KP1A 3EF8A 2FGTA 3SXXA 4AKYA 4HYZA 1O7HB 2XFSA 3UL6A 3EN1B 2CFWA 2XSHB 3K63A 4OVMA 3TDGA 1VQM3 1ISKA 2CK3H 4WWUC 1R4CA 1TIJA 1NB5I 3B8LA 1D6UA 4G1MB 1OH0A 2GXFA 2CWVA 4X2OA 1GD4A 4H61A 3WDGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G8Z A;  2YFJ B;  3OV4 A;  1Q40 A;  2BMQ B;  3MHE A;  1NDO B;  1JB5 A;  1QMA A;  3LZA A;  1DMM A;  4FCJ A;  1GY7 A;  4J8T A;  4XB5 A;  5EVH A;  5TGN A;  7STD A;  2F98 A;  1OUN A;  3G0K A;  4R9K A;  3NXJ A;  4GB5 A;  2RGQ A;  2XRX B;  3H3H A;  4HKV B;  4K1V A;  4CDL A;  1A2K A;  3EC9 A;  4HVN A;  3GZB A;  3S5C A;  2STD A;  3JUQ A;  4XM4 A;  1NWW A;  4U13 A;  1JKG B;  1TUH A;  4R9L A;  5D83 A;  3VGN A;  1S5A A;  1NU3 A;  5IEN A;  5KP4 A;  1OGX A;  3JUM A;  4HM7 B;  2QGU A;  3NM2 A;  2A15 A;  1ZX2 A;  2INX A;  4X2H A;  5CXO A;  1GY6 A;  3HK4 A;  1UUV B;  4HM2 B;  2Z7A A;  4L8P A;  3GRD A;  4XBX A;  5DRV A;  3JUO A;  4WYK B;  4L8O A;  1DMQ A;  3ECF A;  3F14 A;  1O7N B;  2HMJ B;  1OF5 B;  1E3R A;  3EN8 A;  3F7X A;  4N3V A;  2GBX B;  3EBY A;  1ULI B;  4ORL A;  5JPU A;  5IEP A;  3BB9 A;  3CU3 A;  3B4P A;  4HM8 B;  3KE7 A;  3MKI A;  4HM3 B;  4IIA A;  5KP3 A;  3ROB A;  1GY5 A;  1W02 A;  2HMM B;  5AI1 A;  3VSY A;  3DMC A;  2PZV A;  3K0Z A;  5IG5 A;  3EHC A;  4J9A A;  5IEO A;  2XR8 B;  3CNX A;  1EA2 A;  3HX8 A;  3B4O A;  4HM4 B;  3EQQ B;  2Z77 A;  3MG2 A;  3Q90 A;  3H51 A;  4HZ9 B;  2BMO B;  5D82 A;  2Z76 A;  3GWR A;  3K7C A;  5AEU B;  1Q42 A;  1E97 A;  1C7H A;  3OWU A;  5CK6 A;  3F9S A;  1JN5 B;  1SJW A;  1U5O A;  2BMR B;  2GBW B;  4Q53 A;  5JPP A;  2XSO B;  1K41 A;  4HM5 B;  4STD A;  3G16 A;  1OGZ A;  2RFR A;  4XDW A;  5IER A;  3STD A;  1O7M B;  3MG1 A;  5HGR A;  1IDP A;  1WQL B;  2K54 A;  2I9W A;  3OWY A;  3EX9 A;  4HZB B;  1JB2 A;  4LEH A;  4MJD A;  4XDV A;  5CLK A;  1O7P B;  3FZW A;  2YFI B;  3SED A;  3SOA A;  5BXQ A;  1Z1S A;  3B7C A;  1JB4 A;  3HZP A;  3BLZ A;  3OX9 A;  5AII A;  3NBR A;  2B24 B;  2HMO B;  3CNM A;  2YFL B;  5D81 A;  1E3V A;  4LMI A;  6STD A;  3WMD A;  4K1U A;  3KSP A;  1ASK A;  1JKG A;  1OF5 A;  3T8N A;  3GZX B;  1DMN A;  2OWP A;  3E99 A;  3A76 A;  3KKG A;  4HM1 B;  4WYK A;  5CF1 A;  1GS3 A;  3NV0 B;  1O7G B;  1OPY A;  4RZM A;  1Q40 B;  3FGY A;  3DXO A;  4R1K A;  1ULJ B;  3NV0 A;  3OXA A;  2JQ5 A;  3FLJ A;  3NHX A;  2BNG A;  3F8X A;  3LYG A;  5AIH A;  1GYB A;  1ZO2 A;  2HMN B;  3DZL A;  1W00 A;  4I4K A;  1EG9 B;  5IG0 A;  5IG3 A;  1VZZ A;  8CHO A;  5FW5 A;  3M8C A;  3GZR A;  3JUN A;  5AIG A;  1OCV A;  2GEX A;  3F7S A;  3FF2 A;  4L7K A;  4OUQ A;  3DUK A;  3F40 A;  2CHC A;  1JN5 A;  3RGR A;  5AEW B;  3MSO A;  1W6Y A;  5CF2 A;  2IMJ A;  1HKX A;  3MYT A;  5G2G A;  3UNL A;  2HMK B;  5STD A;  3DM8 A;  1O7W B;  2R4I A;  3D9R A;  3UJM A;  2UX0 A;  3F8H A;  3FSD A;  2F86 B;  3FH1 A;  3OWS A;  4HM6 B;  2W2C A;  3NUV A;  5AIF A;  2QIY A;  3KZT A;  1BUQ A;  2F99 A;  3FF0 A;  1STD A;  4HJL B;  2B1X B;  5DRE A;  4XBT A;  1OHP A;  3EJV A;  4XBY A;  3T8U A;  5IG4 A;  1TP6 A;  3EF8 A;  4PEJ A;  2GEY A;  3IPT A;  3RGA A;  1UUW B;  5KP1 A;  3CPO A;  1O7H B;  1QJG A;  5IF6 A;  3EN1 B;  1ISK A;  2XSH B;  3GZY B;  2CKF B;  4OVM A;  1CQS A;  3SOY A;  1W01 A;  2RCD A;  3EBT A;  3ER7 A;  1OHO A;  4LGQ A;  4WP5 A;  4WWU C;  5BVB A;  3B8L A;  1OH0 A;  1AR0 A;  2GXF A;  3I0Y A;  3MG3 A;  3FKA A;  4H3U A;  4FCM A;  4X2O A;  3JUP A;  2HML B;  1OHS A;  4HM0 B;  4KVH A; 
#chains in the Genus database with same CATH topology
 1LQG C;  2E2V A;  3KFQ C;  2XGN A;  7RNT A;  1NDO B;  1QMA A;  4KFD A;  2RSX A;  3CCS 3;  1W2B 2;  1RCK A;  1F8N A;  1BRK A;  3KCH A;  1A90 A;  1G96 A;  3NXJ A;  3CXC 2;  2XRX B;  2KXG A;  1I0X A;  3H3H A;  3EC9 A;  4HVN A;  1RSN A;  3GZB A;  1X1X A;  4LZI A;  1IYY A;  2FNQ A;  3VGN A;  1YVS A;  1NU3 A;  2D1W A;  3AMO A;  3X3Y A;  3MPH A;  5CXO A;  1GY6 A;  3HK4 A;  1RGF A;  2M7O A;  1BGS A;  3AGN A;  3BND A;  4HM2 B;  1SIH A;  3LT8 A;  1LOW A;  2H0G A;  3ECF A;  1O7N B;  4ILF A;  3URP A;  3D79 A;  2GU1 A;  5JPU A;  3S27 A;  3EBY A;  2WGQ A;  2QEX 3;  1BNJ A;  1FGR A;  1RLS A;  1RHL A;  2LYX A;  3X40 A;  1MWR A;  4J5G A;  6RNT A;  1N9J A;  3DGO A;  1KWI A;  1V74 A;  2W56 B;  4HM3 B;  3CCR 3;  1FUT A;  5AI1 A;  1W02 A;  1A67 A;  4RBN A;  3K0Z A;  5IG5 A;  4N6T A;  1ZS7 A;  6GSP A;  4J9A A;  1K9M 4;  4HM4 B;  1X1U A;  3B4O A;  4GL6 A;  2BMO B;  4HZ9 B;  4BL3 A;  3LT9 A;  5AEU B;  1E97 A;  3S5C A;  1Q7Y 4;  1U5O A;  1SJW A;  2GBW B;  2IUK A;  5JPP A;  1QVG 2;  5GSP A;  2XF3 A;  1IQX A;  2RFR A;  1I2E A;  1O7M B;  1TFK A;  5G1K A;  1IDP A;  3SLU A;  4MJD A;  2WO0 A;  3WA3 A;  3SED A;  1TTO A;  2Y74 A;  3EE1 A;  5BXQ A;  3BLZ A;  3HIG A;  1MNL A;  3CCE 3;  1PFP A;  3CNM A;  1US1 A;  3JVC A;  5D81 A;  2WOF A;  5AYS C;  1R4Y A;  2ML6 A;  1AVK A;  1RRL A;  3NBJ A;  5I97 A;  1YJW 3;  4WYK A;  1O7G B;  1OPY A;  3DXO A;  4R1K A;  2ML5 A;  3OXA A;  2IY2 A;  1YI2 3;  3NHX A;  3KSE D;  1BIR A;  3DZL A;  3IMA B;  1I3F A;  2J8X B;  1DYU A;  3AHW A;  5IG3 A;  2QA4 3;  4JRF A;  8CHO A;  1AY7 A;  3M8C A;  2F5W A;  3SX1 A;  1TRP A;  1BUJ A;  1EKM A;  4OK0 A;  4IPB A;  4L7K A;  3DUK A;  4IT7 A;  2CHC A;  3RDE A;  1M1K 4;  1W6Y A;  1IVU A;  1BSD A;  2IMJ A;  4N6V 0;  3K9M C;  2JDI H;  3BIR A;  2HMK B;  3DM8 A;  1STF I;  2R41 A;  2UX0 A;  3F8H A;  2W2C A;  3NUV A;  5AIF A;  8RNT A;  1QAK A;  1BUQ A;  1DE3 A;  3QRD A;  4EBG A;  1PU4 A;  1RTU A;  3V99 A;  1D6Y A;  2F99 A;  1ROA A;  4K61 A;  3FCS B;  4R80 A;  4FMB A;  1BRI A;  3EJV A;  4XBY A;  1NO3 A;  1RDS A;  1TP6 A;  3T8U A;  3PCS A;  4PEJ A;  2ZDJ A;  1UUW B;  1RN4 A;  3LXU X;  2W56 A;  2GSP A;  4EC6 A;  4KFF A;  1LOX A;  3G71 3;  1CQS A;  3VF1 A;  1W01 A;  1JJ2 2;  1TJD A;  5BVB A;  4N6U A;  1RN7 A;  1G02 A;  3FKA A;  4FCM A;  3JUP A;  3A5E A;  1M9G A;  1OHS A;  4HM0 B;  2WGO A;  1RGC A;  1UI7 A;  1Q40 A;  3MHE A;  7STD A;  1LXE A;  1GY7 A;  5TGN A;  2O9U X;  4CJN A;  3I55 3;  2UGI A;  2XEP A;  3AMO B;  2STD A;  3JUQ A;  4WFO A;  1NWW A;  5D83 A;  3BNE A;  1ZGX A;  4O8S A;  3EB8 A;  3IJE B;  2CW9 A;  3ZFZ A;  3CC2 3;  4HM7 B;  4NRE A;  2QGU A;  1Q7H A;  2INX A;  3NM2 A;  2W03 A;  3PYJ A;  1WMO A;  3PZW A;  4XBX A;  4BL2 A;  5DRV A;  2Z7A A;  4L8P A;  3GRD A;  1YGW A;  3CCL 3;  3JUO A;  1FZU A;  3EN8 A;  3S67 A;  1VQ9 3;  5G1L A;  9RNT A;  4ORL A;  5IEP A;  1B3S A;  5BU4 A;  1CYU A;  1NJI 4;  4HM8 B;  1IVX A;  3KE7 A;  3PXM A;  4O02 B;  5KP3 A;  1VQ6 3;  3CC7 3;  1BSC A;  3G6E 3;  3OW2 2;  1MOL A;  2PZV A;  3ALA A;  1RKY A;  4FMA A;  4FR9 A;  4AKZ A;  1JV2 B;  1VQK 3;  3EHC A;  4CCV A;  2CWU A;  3ZG0 A;  2XR8 B;  3CNX A;  1EA2 A;  3HX8 A;  1G0T A;  3N8B A;  4GHO A;  1QAL A;  1VQN 3;  1Q86 4;  5LC6 A;  3GWR A;  2W04 A;  2ZA4 A;  3KN4 A;  1W2Z A;  1RNB A;  2AAD A;  4BTX A;  2E2T A;  1BOX A;  1OAC A;  1MWT A;  2RNT A;  3D3L A;  4HM5 B;  1OGZ A;  1MGR A;  4N6L A;  1RGA A;  2KF6 A;  3STD A;  1ROV A;  3NM7 A;  2K54 A;  3EX9 A;  5IER A;  1JB2 A;  1O7P B;  3FZW A;  2YFI B;  1TU5 A;  3HZP A;  3OX9 A;  3PS8 A;  1CH0 A;  2V1L A;  5AII A;  2ZL8 A;  3K5T A;  1GOU A;  2B24 B;  1CYV A;  2HMO B;  6STD A;  5BIR A;  1RN1 A;  2P0M A;  2YX9 A;  1UCI A;  3NQY A;  4K1U A;  3DGM A;  3KSP A;  4CPK A;  1HYF A;  2P0X A;  1WMN A;  2OOV A;  1DMN A;  2OWP A;  3KKG A;  5CF1 A;  1BSE A;  4RNZ A;  1GS3 A;  1N8Q A;  1Q40 B;  2BIR A;  3FG3 A;  1LRA A;  3NV0 A;  1L5G B;  2W0Q A;  1FA3 A;  2JQ5 A;  1N5H A;  3FLJ A;  4O2H A;  3F8X A;  2KF4 A;  1GYB A;  1BNI A;  1W00 A;  2KF5 A;  1U8C B;  5M1A A;  1OCV A;  4OUQ A;  3FF2 A;  3U97 A;  1BRN L;  3AHS A;  1TRQ A;  3WA2 X;  1RNT A;  3T0U A;  1VQQ A;  2GU3 A;  1O7W B;  1I3I A;  3V98 A;  1GOY A;  1W7C A;  2H0I A;  3D4A A;  5EQL A;  2QIY A;  1UI8 A;  3LOY A;  2H0H A;  2Z6B A;  3ZG5 A;  2ZHX B;  3HI7 A;  4HJL B;  2RBI A;  4XBT A;  2D42 A;  2GEY A;  3IPT A;  3FG1 A;  1QJG A;  1MGW A;  5IF6 A;  4RNT A;  3GZY B;  2CKF B;  1GMR A;  4ZM8 A;  1YJ9 3;  2P09 A;  2RCD A;  3EBT A;  1K8A 4;  4LGQ A;  1OHO A;  4WP5 A;  2IUJ A;  4EYC A;  3UB1 A;  3CMA 3;  1LQM B;  1MWS A;  4I5Q A;  5FGO A;  1V57 A;  4H3U A;  1AR0 A;  3I0Y A;  1IV7 A;  4NPB A;  1RGH A;  3LTA A;  3G8Z A;  2O3O A;  4KVH A;  3OV4 A;  5RNT A;  1SII A;  1IT7 A;  1BRG A;  3GSP A;  4J8T A;  1DMM A;  5EVH A;  4MMX B;  1LOY A;  1OUN A;  3G0K A;  2E2U A;  3WOE B;  3AGO A;  1A2V A;  4K1V A;  1A2K A;  1IQY A;  1RGK A;  3CD6 3;  5A0O B;  1BAN A;  4HBR A;  4XM4 A;  3NBB A;  4U13 A;  2CWT A;  4R9L A;  2OQE A;  5KP4 A;  1S5A A;  1S72 3;  1RGE A;  5IEN A;  1BNR A;  3JUM A;  4QWT A;  1I0V A;  3NX0 A;  2SAR A;  4N6N B;  4X2H A;  1ZX2 A;  5IW9 A;  3RNT A;  1BVI A;  1UUV B;  1FGT A;  7GSP A;  2Q07 A;  4WYK B;  2XGL A;  1DMQ A;  3CCM 3;  2XH9 A;  1UW1 A;  2HMJ B;  1UDI I;  3F7X A;  5G2G A;  2CFG A;  1ULI B;  1I8V A;  3X41 A;  2F56 A;  1IVW A;  5ELJ A;  1LNH A;  1M1X B;  3ROB A;  1T3B A;  2HMM B;  1J2B A;  3HOH A;  2UUG C;  4N6O B;  3DMC A;  3X3Z A;  5JBS A;  1VQ5 3;  3MWZ A;  1RGL A;  1MWU A;  2L1S A;  3CCU 3;  3EQQ B;  3MG2 A;  1GMQ A;  2L4V A;  5D82 A;  1KC8 4;  2Z76 A;  3FG4 A;  2Y73 A;  2C10 A;  1JN5 B;  2BMR B;  3NQZ A;  1KD1 4;  1TFO A;  3D5I A;  1K28 A;  3G16 A;  2FXT A;  4XDW A;  1BAO A;  1Q9E A;  4KFE A;  3MG1 A;  1GD3 A;  4KZ1 A;  1FYS A;  5HGR A;  2KAA A;  1W6C A;  1YNV X;  2CH9 A;  2I9W A;  4LEH A;  5CLK A;  1UCL A;  4LYL B;  5LC7 A;  1T5Y A;  4FMD A;  1JB4 A;  2CG0 A;  3CCJ 3;  4TX4 A;  1Q82 4;  3NBR A;  1EQK A;  1EUI C;  3HII A;  3CC4 3;  2YFL B;  3LTB A;  3WMD A;  4BTW A;  1ASK A;  1B2U A;  1SPU A;  1B2M A;  1BU4 A;  1OF5 A;  3GZX B;  1RGG A;  3E99 A;  4HM1 B;  3A76 A;  3D5G A;  3DH2 A;  2HML B;  1BRJ A;  4RZM A;  3WOF B;  1DVD A;  1BNS A;  1RCL A;  1BNE A;  2BU4 A;  1ULJ B;  3CPW 2;  3N9H A;  2CFL A;  1VQ8 3;  2KF3 A;  3GAX A;  1FGO A;  5AIH A;  2HMN B;  1ZO2 A;  3SYU A;  1EEJ A;  2OOV C;  2SBL A;  4O3V A;  5IG0 A;  1AQZ A;  2MC8 A;  1W4N A;  3DGN A;  3LH4 A;  3LTC A;  2OTJ 3;  1BRS A;  1I2F A;  3GZR A;  1N5P A;  5AIG A;  1B27 A;  2GEX A;  3F7S A;  1X1W A;  3RGR A;  4BTY A;  1SQW A;  3MSO A;  3UL5 A;  1IQ8 A;  1VQ7 3;  1V58 A;  1I70 A;  3D9R A;  3UJM A;  3V92 A;  3FSD A;  1UUG B;  4HM6 B;  1HU9 A;  1UCJ A;  5AYR B;  4BIR A;  5HOH A;  1N9E A;  1JBT A;  2K3D A;  1W5Z A;  4FCZ A;  4RNY A;  1D6Z A;  2K0M A;  1FGQ A;  1STD A;  2BHM A;  3FF0 A;  5DRE A;  2WOH A;  4HOH A;  5IG4 A;  3RGA A;  1B21 A;  3CPO A;  4KT3 B;  4MEI A;  1VQO 3;  1N8R 4;  1FGM A;  1SAR A;  3X3X A;  3SOY A;  3U1W A;  1JBR A;  3ER7 A;  1IK3 A;  1RMS A;  2IA7 A;  3MG3 A;  3X42 A;  1KSI A;  4R4K A;  3J7Y d;  4I4K A;  2BT3 A;  3BNB A;  3LML A;  4DKI A;  3SVA A;  2F5M A;  2YFJ B;  2BMQ B;  1RRH A;  3S29 A;  1JB5 A;  3LZA A;  4XB5 A;  4FCJ A;  2OQE C;  1NB3 I;  2HOH A;  1RJO A;  2F98 A;  2F4Y A;  2W9Q A;  1Y4K A;  4GB5 A;  2RGQ A;  4HKV B;  4R9K A;  4CDL A;  1FUW A;  2C11 A;  1WTH A;  1NNV A;  1JKG B;  1TUH A;  1QVF 2;  2KCD A;  1OGX A;  1K73 4;  1BRH A;  1FUS A;  4NHF A;  1JBS A;  2OTL 3;  2A15 A;  1DVC A;  1BNG A;  3DGY A;  4L8O A;  1PY3 A;  1Q81 4;  3F14 A;  2OCT A;  4N3V A;  1OF5 B;  1E3R A;  3WOD G;  3WR2 A;  3I56 3;  1B20 A;  2GBX B;  2P05 A;  3PCR A;  3BB9 A;  3CU3 A;  3CCQ 3;  1X1Y A;  1C54 A;  1GMP A;  2CIU A;  3B4P A;  4EV2 A;  3MKI A;  4IIA A;  1GY5 A;  4HAA A;  2KRT A;  3VSY A;  1W6G A;  3Q3F A;  1IV9 A;  1UGH I;  4AEQ A;  4WHA A;  5IEO A;  1AV4 A;  1IU7 A;  3G4S 3;  2AAE A;  4JF8 A;  4EXR A;  2Z77 A;  2C4B A;  3Q90 A;  3H51 A;  1I2G A;  3KII A;  1LVN A;  1DET A;  2CC3 A;  1YIJ 3;  3K7C A;  1Q42 A;  3OWU A;  1C7H A;  1YVB I;  2W6J H;  3F9S A;  4Q53 A;  5CK6 A;  3O8Y A;  2XSO B;  1K41 A;  4STD A;  1AVL A;  3WHO A;  3N54 B;  3CCV 3;  1VQP 3;  1YIT 3;  3QK9 A;  3CME 3;  1BNF A;  3DY5 A;  4FMC A;  1YJN 3;  5M19 A;  4MMY B;  1WQL B;  3OWY A;  3Q1C A;  4HZB B;  4XDV A;  2MF7 A;  4EV5 A;  1VQ4 3;  1FW7 A;  5ELU A;  2W9P A;  3SOA A;  1Z1S A;  3B7C A;  1KQS 2;  1A2P A;  1JNQ A;  4EW5 A;  1YGE A;  3S28 A;  2XFT A;  4K90 B;  1E3V A;  1GOV A;  3LTD A;  4LMI A;  4LSO A;  1WNH A;  1LOV A;  1JKG A;  5M18 A;  3T8N A;  5EEO A;  4BU4 A;  2BO9 B;  1CEW I;  2CFK A;  3NV0 B;  3FGY A;  2PNC A;  1JRQ A;  1IT8 A;  1B2Z A;  1QAF A;  2BNG A;  2LQV A;  3LYG A;  1VQL 3;  4MMZ B;  1EG9 B;  3L0R A;  1HZ1 A;  1JZO A;  1VZZ A;  3BU4 A;  5FW5 A;  1B2S A;  3JUN A;  2CG1 A;  5AEW B;  3F40 A;  5CF2 A;  2CFD A;  1JN5 A;  3BNC A;  1GSP A;  1WMP A;  3DGL A;  2CX1 A;  1HKX A;  3MYT A;  1M90 4;  3UNL A;  5STD A;  2R4I A;  1IVV A;  3Q2P A;  2F86 B;  1UCK A;  2IYJ A;  2P38 A;  3FH1 A;  3OWS A;  3KZT A;  4N6M A;  1PYL A;  3PGB A;  1BSB A;  1B2X A;  2B1X B;  1LNI A;  1OHP A;  1YHQ 3;  5KP1 A;  3EF8 A;  2FGT A;  3SXX A;  4AKY A;  4HYZ A;  1O7H B;  4GSP A;  2XFS A;  3UL6 A;  3EN1 B;  2CFW A;  2XSH B;  1UGI A;  3K63 A;  4OVM A;  1BSA A;  3TDG A;  2CK3 H;  1VQM 3;  1ISK A;  4WWU C;  1R4C A;  1TIJ A;  1NB5 I;  1JZD A;  1T2H A;  2CX0 A;  3B8L A;  1D6U A;  4G1M B;  4J5K A;  1OH0 A;  2GXF A;  2CWV A;  4X2O A;  1T2I A;  1GD4 A;  4H61 A;  3WDG B; 
#chains in the Genus database with same CATH homology
 2E2V A;  3KFQ C;  2XGN A;  1NDO B;  1QMA A;  4KFD A;  2RSX A;  3CCS 3;  1W2B 2;  1F8N A;  1A90 A;  1G96 A;  3NXJ A;  3CXC 2;  2XRX B;  2KXG A;  3H3H A;  3EC9 A;  4HVN A;  4LZI A;  3GZB A;  2FNQ A;  3VGN A;  1NU3 A;  2D1W A;  3AMO A;  3X3Y A;  3MPH A;  5CXO A;  1GY6 A;  3HK4 A;  2M7O A;  3BND A;  4HM2 B;  1SIH A;  3LT8 A;  3ECF A;  1O7N B;  2QEX 3;  2GU1 A;  5JPU A;  3S27 A;  3EBY A;  2WGQ A;  1FGR A;  2LYX A;  3X40 A;  1N9J A;  3DGO A;  1KWI A;  1V74 A;  2W56 B;  4HM3 B;  3CCR 3;  1A67 A;  5AI1 A;  1W02 A;  4RBN A;  3K0Z A;  5IG5 A;  4N6T A;  4J9A A;  1K9M 4;  4HM4 B;  3B4O A;  4GL6 A;  2BMO B;  4HZ9 B;  5AEU B;  3LT9 A;  1E97 A;  3S5C A;  1Q7Y 4;  1U5O A;  1SJW A;  2GBW B;  2IUK A;  5JPP A;  1QVG 2;  2XF3 A;  1IQX A;  2RFR A;  1O7M B;  1TFK A;  1IDP A;  3SLU A;  4MJD A;  2WO0 A;  3WA3 A;  3SED A;  2Y74 A;  3EE1 A;  5BXQ A;  3BLZ A;  3HIG A;  1MNL A;  3CCE 3;  1PFP A;  3CNM A;  1US1 A;  3JVC A;  5D81 A;  2WOF A;  5AYS C;  2ML6 A;  1AVK A;  1RRL A;  3NBJ A;  5I97 A;  1YJW 3;  4WYK A;  1O7G B;  1OPY A;  3DXO A;  4R1K A;  2ML5 A;  3OXA A;  1YI2 3;  3NHX A;  3KSE D;  3IMA B;  3DZL A;  1DYU A;  5IG3 A;  2QA4 3;  4JRF A;  8CHO A;  3M8C A;  3SX1 A;  1EKM A;  4OK0 A;  4IPB A;  4L7K A;  3DUK A;  4IT7 A;  2CHC A;  3RDE A;  1M1K 4;  1W6Y A;  1IVU A;  2IMJ A;  4N6V 0;  3K9M C;  2JDI H;  2HMK B;  3DM8 A;  1STF I;  2UX0 A;  3F8H A;  2W2C A;  3NUV A;  5AIF A;  1QAK A;  1BUQ A;  3QRD A;  4EBG A;  1PU4 A;  3V99 A;  1D6Y A;  2F99 A;  1ROA A;  4K61 A;  3FCS B;  4R80 A;  4FMB A;  3EJV A;  4XBY A;  1NO3 A;  3T8U A;  1TP6 A;  3PCS A;  4PEJ A;  2ZDJ A;  1UUW B;  3LXU X;  2W56 A;  4EC6 A;  4KFF A;  1LOX A;  3G71 3;  1CQS A;  3VF1 A;  1W01 A;  1JJ2 2;  5BVB A;  4N6U A;  1RN7 A;  3FKA A;  4FCM A;  3JUP A;  1M9G A;  1OHS A;  4HM0 B;  2WGO A;  1UI7 A;  1Q40 A;  3MHE A;  7STD A;  1LXE A;  1GY7 A;  5TGN A;  2O9U X;  3I55 3;  2XEP A;  3AMO B;  2STD A;  3JUQ A;  4WFO A;  1NWW A;  5D83 A;  3BNE A;  4O8S A;  3EB8 A;  3IJE B;  2CW9 A;  3CC2 3;  4HM7 B;  4NRE A;  2QGU A;  3NM2 A;  2INX A;  3PYJ A;  2W03 A;  3PZW A;  1WMO A;  4XBX A;  5DRV A;  2Z7A A;  4L8P A;  3GRD A;  3CCL 3;  3JUO A;  3EN8 A;  3S67 A;  1VQ9 3;  4ORL A;  5IEP A;  1CYU A;  1NJI 4;  4HM8 B;  1IVX A;  3KE7 A;  3PXM A;  4O02 B;  5KP3 A;  1VQ6 3;  3CC7 3;  3G6E 3;  3OW2 2;  1MOL A;  2PZV A;  3ALA A;  1RKY A;  4FMA A;  4FR9 A;  4AKZ A;  1JV2 B;  1VQK 3;  3EHC A;  4CCV A;  2CWU A;  2XR8 B;  3CNX A;  1EA2 A;  3HX8 A;  3N8B A;  1QAL A;  1VQN 3;  1Q86 4;  5LC6 A;  3GWR A;  2W04 A;  3KN4 A;  1W2Z A;  4BTX A;  2E2T A;  1OAC A;  3D3L A;  4HM5 B;  1OGZ A;  4N6L A;  3STD A;  1ROV A;  3NM7 A;  2K54 A;  3EX9 A;  5IER A;  1JB2 A;  1O7P B;  3FZW A;  2YFI B;  1TU5 A;  3HZP A;  3OX9 A;  3PS8 A;  5AII A;  2V1L A;  2ZL8 A;  3K5T A;  2B24 B;  1CYV A;  2HMO B;  6STD A;  2P0M A;  2YX9 A;  3NQY A;  4K1U A;  3DGM A;  3KSP A;  2P0X A;  1WMN A;  2OOV A;  1DMN A;  2OWP A;  3KKG A;  5CF1 A;  4RNZ A;  1GS3 A;  1N8Q A;  1Q40 B;  3FG3 A;  3NV0 A;  1L5G B;  2W0Q A;  1FA3 A;  2JQ5 A;  1N5H A;  3FLJ A;  4O2H A;  3F8X A;  1GYB A;  1W00 A;  1U8C B;  1OCV A;  4OUQ A;  3FF2 A;  3U97 A;  3WA2 X;  3T0U A;  2GU3 A;  1O7W B;  3V98 A;  1W7C A;  5EQL A;  2QIY A;  1UI8 A;  3LOY A;  2Z6B A;  3HI7 A;  4HJL B;  4XBT A;  2D42 A;  2GEY A;  3IPT A;  3FG1 A;  1QJG A;  5IF6 A;  3GZY B;  2CKF B;  4ZM8 A;  1YJ9 3;  2P09 A;  2RCD A;  3EBT A;  1K8A 4;  4LGQ A;  1OHO A;  4WP5 A;  2IUJ A;  4EYC A;  3UB1 A;  3CMA 3;  5FGO A;  4H3U A;  1AR0 A;  3I0Y A;  1IV7 A;  3LTA A;  3G8Z A;  2O3O A;  4KVH A;  3OV4 A;  1SII A;  1IT7 A;  4J8T A;  5EVH A;  1DMM A;  4MMX B;  1OUN A;  3G0K A;  2E2U A;  3WOE B;  1A2V A;  4K1V A;  1A2K A;  1IQY A;  3CD6 3;  5A0O B;  4HBR A;  4XM4 A;  3NBB A;  4U13 A;  2CWT A;  4R9L A;  2OQE A;  5KP4 A;  1S5A A;  1S72 3;  5IEN A;  3JUM A;  4QWT A;  3NX0 A;  4N6N B;  5IW9 A;  4X2H A;  1ZX2 A;  1UUV B;  1FGT A;  2Q07 A;  4WYK B;  2XGL A;  1DMQ A;  3CCM 3;  2XH9 A;  1UW1 A;  2HMJ B;  3F7X A;  5G2G A;  2CFG A;  1ULI B;  3X41 A;  1IVW A;  5ELJ A;  1LNH A;  1M1X B;  3ROB A;  2HMM B;  1J2B A;  4N6O B;  3X3Z A;  3DMC A;  5JBS A;  1VQ5 3;  3MWZ A;  3CCU 3;  3EQQ B;  3MG2 A;  2L4V A;  5D82 A;  1KC8 4;  2Z76 A;  3FG4 A;  2Y73 A;  2C10 A;  1JN5 B;  2BMR B;  3NQZ A;  1KD1 4;  1TFO A;  1K28 A;  3G16 A;  2FXT A;  4XDW A;  4KFE A;  3MG1 A;  1GD3 A;  4KZ1 A;  5HGR A;  1W6C A;  2CH9 A;  2I9W A;  4LEH A;  5CLK A;  5LC7 A;  1T5Y A;  4FMD A;  1JB4 A;  2CG0 A;  3CCJ 3;  4TX4 A;  1Q82 4;  3NBR A;  1EQK A;  3HII A;  3CC4 3;  2YFL B;  3LTB A;  3WMD A;  4BTW A;  1ASK A;  1SPU A;  1OF5 A;  3GZX B;  3E99 A;  4HM1 B;  3A76 A;  2HML B;  4RZM A;  3WOF B;  1DVD A;  1ULJ B;  3CPW 2;  3N9H A;  2CFL A;  1VQ8 3;  3GAX A;  1FGO A;  5AIH A;  2HMN B;  1ZO2 A;  2OOV C;  2SBL A;  4O3V A;  5IG0 A;  2MC8 A;  1W4N A;  3DGN A;  3LH4 A;  3LTC A;  2OTJ 3;  3GZR A;  1N5P A;  5AIG A;  2GEX A;  3F7S A;  3RGR A;  4BTY A;  1SQW A;  3MSO A;  3UL5 A;  1IQ8 A;  1VQ7 3;  3D9R A;  3UJM A;  3V92 A;  3FSD A;  4HM6 B;  1HU9 A;  5AYR B;  1N9E A;  4FCZ A;  1W5Z A;  4RNY A;  1D6Z A;  2K0M A;  1FGQ A;  1STD A;  2BHM A;  3FF0 A;  5DRE A;  2WOH A;  5IG4 A;  3RGA A;  3CPO A;  4MEI A;  1VQO 3;  1N8R 4;  1FGM A;  3X3X A;  3SOY A;  3U1W A;  3ER7 A;  1IK3 A;  2IA7 A;  3MG3 A;  3X42 A;  1KSI A;  4R4K A;  3J7Y d;  4I4K A;  3BNB A;  2BT3 A;  3LML A;  3SVA A;  2YFJ B;  2BMQ B;  1RRH A;  3S29 A;  1JB5 A;  3LZA A;  4XB5 A;  4FCJ A;  2OQE C;  1NB3 I;  1RJO A;  2F98 A;  4R9K A;  2W9Q A;  1Y4K A;  4GB5 A;  2RGQ A;  4HKV B;  1FUW A;  4CDL A;  2C11 A;  1WTH A;  1JKG B;  1TUH A;  1QVF 2;  2KCD A;  1OGX A;  1K73 4;  4NHF A;  2OTL 3;  2A15 A;  1DVC A;  4L8O A;  1Q81 4;  3F14 A;  2OCT A;  4N3V A;  1OF5 B;  1E3R A;  3WOD G;  3I56 3;  2GBX B;  2P05 A;  3PCR A;  3BB9 A;  3CU3 A;  3CCQ 3;  2CIU A;  3B4P A;  4EV2 A;  3MKI A;  4IIA A;  1GY5 A;  2KRT A;  3VSY A;  1W6G A;  1IV9 A;  4AEQ A;  4WHA A;  5IEO A;  1AV4 A;  1IU7 A;  3G4S 3;  4JF8 A;  4EXR A;  2Z77 A;  1YIJ 3;  3Q90 A;  3H51 A;  3KII A;  1LVN A;  2CC3 A;  3K7C A;  1Q42 A;  3OWU A;  2W6J H;  1C7H A;  1YVB I;  3F9S A;  4Q53 A;  5CK6 A;  3O8Y A;  2XSO B;  1K41 A;  4STD A;  1AVL A;  1VQP 3;  3N54 B;  3CCV 3;  1YIT 3;  3QK9 A;  3CME 3;  3DY5 A;  4FMC A;  1YJN 3;  4MMY B;  1WQL B;  3OWY A;  3Q1C A;  4HZB B;  4XDV A;  2MF7 A;  4EV5 A;  1VQ4 3;  5ELU A;  2W9P A;  3SOA A;  1Z1S A;  3B7C A;  1KQS 2;  1JNQ A;  1YGE A;  3S28 A;  2XFT A;  4K90 B;  1E3V A;  3LTD A;  4LMI A;  4LSO A;  1WNH A;  1JKG A;  3T8N A;  5EEO A;  2BO9 B;  1CEW I;  2CFK A;  3NV0 B;  3FGY A;  2PNC A;  1JRQ A;  1IT8 A;  1QAF A;  2BNG A;  2LQV A;  3LYG A;  1VQL 3;  4MMZ B;  1EG9 B;  3L0R A;  1VZZ A;  5FW5 A;  3JUN A;  2CG1 A;  5AEW B;  3F40 A;  5CF2 A;  2CFD A;  1JN5 A;  3BNC A;  1WMP A;  3DGL A;  1HKX A;  3MYT A;  1M90 4;  3UNL A;  5STD A;  2R4I A;  1IVV A;  3Q2P A;  2F86 B;  3FH1 A;  2P38 A;  3OWS A;  3KZT A;  4N6M A;  3PGB A;  2B1X B;  1OHP A;  1YHQ 3;  5KP1 A;  3EF8 A;  2FGT A;  3SXX A;  4AKY A;  4HYZ A;  1O7H B;  2XFS A;  3UL6 A;  3EN1 B;  2CFW A;  2XSH B;  3K63 A;  4OVM A;  3TDG A;  1VQM 3;  1ISK A;  2CK3 H;  4WWU C;  1R4C A;  1TIJ A;  1NB5 I;  3B8L A;  1D6U A;  4G1M B;  1OH0 A;  2GXF A;  2CWV A;  4X2O A;  1GD4 A;  4H61 A;  3WDG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...