5KP1A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y16(cl-y)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
124
Chain Sequence
LPTAQEVQGLMARIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 36
structure length 124
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp1A00
3OWUA 2K54A 1GY6A 4XB5A 5G2GA 3SOAA 3FZWA 5JPPA 2HMLB 5CF1A 1NU3A 5AEUB 4RZMA 1Q40A 3ROBA 3EJVA 3GZYB 5IG3A 6STDA 1CQSA 1GYBA 4XM4A 1W6YA 3NM2A 5IERA 5AIGA 1AR0A 1VZZA 3BB9A 4L8PA 3SEDA 1K41A 3GZXB 4HM0B 3H3HA 4K1UA 2B1XB 3B4PA 3GZRA 4XBYA 1DMQA 4L7KA 3KSPA 1TUHA 1Q42A 4WP5A 1ASKA 3F8XA 2Z77A 4HM8B 5HGRA 4J8TA 1W00A 5FW5A 1GS3A 2STDA 5AIHA 1O7PB 5IENA 1OPYA 2BMOB 1STDA 3DM8A 3OXAA 1GY7A 3RGAA 3LYGA 2F98A 1O7MB 3EHCA 3DMCA 5KP1A 3F8HA 3MG3A 2GEYA 2XR8B 1GY5A 3FF0A 3FH1A 4WYKA 3MYTA 1W01A 3G16A 4R9LA 1UUVB 3I0YA 3B4OA 1SJWA 4FCJA 2YFIB 1OF5B 2HMKB 2HMMB 2B24B 4X2OA 1Z1SA 2BMRB 1NDOB 1S5AA 3MSOA 3NV0B 1E3VA 5IG5A 2INXA 2JQ5A 1TP6A 4IIAA 1E97A 2YFLB 4HM1B 2F86B 1DMMA 3MG1A 3DXOA 4HM5B 1ZX2A 3IPTA 3CNXA 1JN5B 5AEWB 5CXOA 3CNMA 4XDVA 2UX0A 2RGQA 1U5OA 3NHXA 3JUMA 5AI1A 3NBRA 3EQQB 5TGNA 1IDPA 8CHOA 5IEPA 4HZ9B 3STDA 3S5CA 5AIIA 2Z76A 3EBYA 3A76A 3FF2A 4OUQA 5CLKA 5EVHA 5IG0A 4MJDA 3DUKA 2PZVA 3WMDA 2Z7AA 4HM6B 2GBWB 5CK6A 4R9KA 1JB4A 3EC9A 3CPOA 4HM3B 3KKGA 1W02A 1UUWB 1OGXA 1OGZA 4LMIA 4H3UA 4HZBB 3EN8A 4L8OA 3G8ZA 5BVBA 5STDA 3JUQA 5CF2A 2W2CA 3HZPA 5JPUA 1E3RA 1OUNA 3H51A 3OX9A 3UJMA 1OF5A 2BMQB 3M8CA 1ZO2A 4OVMA 5DRVA 4HM2B 3NV0A 4XDWA 3FSDA 1JB5A 3UNLA 2HMJB 5IF6A 3T8NA 3NUVA 2I9WA 3MKIA 4FCMA 3NXJA 1A2KA 1JKGB 3BLZA 3EF8A 4WWUC 3D9RA 2HMNB 3FGYA 3MHEA 5BXQA 1O7HB 1JN5A 2F99A 3ER7A 3GZBA 4XBTA 5DREA 3JUNA 4XBXA 3F14A 4J9AA 1C7HA 3F9SA 5KP3A 1OHOA 2XRXB 3EX9A 1OCVA 3K0ZA 2R4IA 4HKVB 7STDA 4GB5A 2BNGA 3OV4A 3OWSA 1DMNA 4HM7B 1OHPA 3GWRA 4I4KA 3HX8A 1O7WB 1OHSA 3SOYA 4N3VA 1ULJB 1Q40B 3DZLA 5IEOA 1ULIB 3LZAA 2GEXA 4LEHA 4ORLA 3F40A 3GRDA 1EG9B 2A15A 3HK4A 5D81A 5IG4A 4CDLA 4LGQA 2RFRA 2XSOB 3K7CA 3EBTA 1QMAA 1O7GB 3Q90A 3CU3A 4HM4B 3OWYA 3FKAA 3RGRA 4HJLB 3JUPA 4U13A 1JB2A 3VSYA 4HVNA 3ECFA 4KVHA 3G0KA 3B7CA 2YFJB 3KZTA 1HKXA 3FLJA 1WQLB 1EA2A 5D82A 3T8UA 3F7SA 3E99A 4X2HA 2CKFB 5KP4A 3JUOA 3MG2A 1QJGA 2GBXB 3EN1B 4Q53A 5D83A 2HMOB 1JKGA 2CHCA 4R1KA 3B8LA 2IMJA 3VGNA 3KE7A 4WYKB 2RCDA 4K1VA 2OWPA 1O7NB 1BUQA 1OH0A 2GXFA 1ISKA 3F7XA 2XSHB 4PEJA 5AIFA 2QGUA 4STDA 1NWWA 2QIYA
chains in the Genus database with same CATH superfamily
3OWUA 1I2EA 2K54A 3WA3A 2F5MA 1VQK3 2CFKA 4EXRA 1AVKA 1GY6A 1MWUA 1RNBA 4XB5A 1BOXA 1IVVA 2BHMA 3WDGB 5G2GA 3SOAA 3FZWA 3IJEB 4BU4A 2HMLB 5JPPA 1LQMB 3LH4A 5CF1A 1NU3A 2Z6BA 3WR2A 5AEUB 3LTBA 2MF7A 4RZMA 3G4S3 2GU1A 1BSAA 2XH9A 1Q40A 3ROBA 1F8NA 1PYLA 3EJVA 2HOHA 1W6CA 3GZYB 3ZG0A 6STDA 5IG3A 1FA3A 1MWRA 1CQSA 1GYBA 4KFEA 4XM4A 1W6YA 3NM2A 3SXXA 3BNEA 2P38A 1A90A 2IA7A 4N6UA 1UCJA 4HBRA 4CJNA 2C4BA 1TFKA 3HI7A 3BNBA 5IERA 5AIGA 1N5HA 3AMOB 1AR0A 1VZZA 3BB9A 1YGEA 4L8PA 3SEDA 1Q864 2C10A 3WOEB 1JBSA 1FW7A 3X3XA 3DGNA 3X40A 1BVIA 1K41A 4KFFA 3CCL3 1AQZA 1UCIA 3CC43 3GZXB 1N9JA 1TJDA 1ZGXA 4HM0B 1AVLA 1DETA 3H3HA 4K1UA 1BRHA 1FUWA 2B1XB 3B4PA 2OOVC 3GZRA 3NQZA 4XBYA 1DMQA 1STFI 3D3LA 4L7KA 4H61A 1TU5A 1YI23 1VQ53 3KSPA 1NNVA 1TUHA 3ZG5A 1I3FA 1Q42A 1KQS2 1IVXA 1W5ZA 2CX0A 4WP5A 2P0XA 3V99A 1U8CB 1I2GA 1ASKA 1D6ZA 1IV7A 3F8XA 5M19A 2Z77A 4BTYA 4HM8B 5HGRA 3IMAB 2IY2A 4HAAA 1W00A 4J8TA 5FW5A 1BRSA 1GS3A 1JZDA 2CFLA 2STDA 3I563 5AIHA 1O7PB 1GD4A 2SARA 5IENA 4K90B 1RNTA 1I70A 1OPYA 3DGMA 4O02B 1AV4A 2H0HA 1RGLA 3X41A 1BNFA 1M9GA 2BMOB 3DGLA 3HIIA 2M7OA 2OTJ3 1STDA 3DM8A 3OXAA 1GY7A 4BTXA 2OTL3 2FGTA 4KT3B 3SVAA 1RKYA 4AKZA 3FG4A 5G1KA 3RGAA 2XFSA 3LYGA 1US1A 5BIRA 5JBSA 1X1XA 1W4NA 2CFGA 2F98A 1O7MB 3PCSA 3EHCA 1BNGA 1FGTA 1PFPA 3DMCA 2WGQA 1QALA 2RSXA 3F8HA 1FGRA 4O8SA 5KP1A 3MG3A 1ROAA 1RGFA 1Y4KA 1SQWA 2LYXA 4G1MB 1J2BA 1IT8A 1B2MA 1T3BA 2W56A 2GEYA 2WGOA 2XR8B 1K9M4 3RDEA 2FNQA 2CC3A 1GY5A 3FF0A 3AGNA 3FH1A 1Q7HA 2UGIA 3ZFZA 3JVCA 1RHLA 1BRKA 1GMRA 3NM7A 3ALAA 3A5EA 3CCE3 1T2IA 1UUGB 3BIRA 4WYKA 3MYTA 2CFDA 3O8YA 1W01A 3EE1A 3EB8A 6RNTA 2KF4A 1IQYA 3G16A 3LOYA 4R9LA 1UUVB 2CW9A 2PNCA 1YVSA 3I0YA 3V98A 3B4OA 2YX9A 4AEQA 1LOYA 4CCVA 1N8R4 1A2PA 1NB3I 4EBGA 1SJWA 1T5YA 4FCJA 2YFIB 1OF5B 4KFDA 3BNCA 4RBNA 3OW22 1RTUA 3L0RA 3CMA3 1BSEA 2V1LA 4N6LA 3VF1A 1WMNA 2HMMB 2B24B 2GSPA 1UCKA 2HMKB 4X2OA 1VQO3 2RNTA 1Z1SA 1TRQA 2BMRB 3CCU3 1NDOB 1S5AA 3MSOA 3NV0B 1E3VA 5IG5A 3CME3 1NJI4 2P09A 2BIRA 2C11A 1CEWI 2INXA 1TRPA 2W03A 3K9MC 2JQ5A 2CG1A 1RMSA 1VQM3 2XGLA 1IK3A 1RGAA 1KSIA 1TP6A 1HU9A 2R41A 4IIAA 4IPBA 4FMCA 3DH2A 9RNTA 1I2FA 1E97A 5I97A 2YFLB 3AMOA 4HM1B 4EC6A 1A67A 3N54B 2F86B 2IUKA 1DMMA 1AY7A 1IV9A 1EUIC 1B2UA 3WHOA 3MG1A 3DXOA 2W9QA 1ZX2A 4HM5B 1JBTA 1B2XA 2KAAA 3IPTA 4WHAA 1V74A 3GSPA 1A2VA 3CNXA 1PY3A 4MMYB 4O3VA 2ZA4A 1FGOA 1QVG2 1CYUA 1JN5B 1RGKA 3J7Yd 1BAOA 1LXEA 1YNVX 3LTCA 3PS8A 4ILFA 2WOFA 1DVDA 4RNYA 5LC6A 1VQ63 5AEWB 5CXOA 1GOYA 3D79A 2L4VA 3CNMA 1YJW3 3LTAA 5ELJA 1X1YA 4XDVA 2UX0A 2RGQA 1BGSA 3UL6A 1U5OA 1JRQA 1ROVA 1DYUA 1LOVA 3NHXA 4R80A 1YIT3 3JUMA 1MGWA 3LT8A 4LYLB 5AI1A 1BIRA 1IQ8A 3NBRA 1RDSA 5EQLA 3EQQB 3UL5A 4LZIA 1GD3A 1IDPA 3QK9A 1FGMA 5TGNA 8CHOA 5IEPA 3X3YA 2BT3A 5G1LA 3Q1CA 3LMLA 4HZ9B 1PU4A 3STDA 2CIUA 3S5CA 5AIIA 2IYJA 3GAXA 4EYCA 1SIHA 2Q07A 1QAKA 2Z76A 1YIJ3 3EBYA 3A76A 3FF2A 3NQYA 4OUQA 5CLKA 1LNHA 5EVHA 5AYSC 1BNSA 1EQKA 5IG0A 4MJDA 1I3IA 3DUKA 2PZVA 1HZ1A 3CCM3 1VQ93 3WMDA 2Z7AA 4HM6B 2OQEA 3G6E3 1BRIA 4GSPA 5ELUA 2GBWB 2F5WA 4ZM8A 2BO9B 5CK6A 4J5GA 1Q9EA 4GL6A 4JF8A 4R9KA 1JB4A 2O3OA 5A0OB 3EC9A 4J5KA 5M18A 3CPOA 1RN7A 3N8BA 1BNIA 1K28A 3DY5A 4HM3B 1TIJA 1WMPA 3KKGA 1W02A 4N6OB 1LNIA 1BSDA 1UUWB 1V57A 3LT9A 1RGGA 4IT7A 1OGXA 1DVCA 1OGZA 1B21A 1G96A 3DGOA 4NREA 4LMIA 4H3UA 3U1WA 4MEIA 2UUGC 4EV2A 4HZBB 4WFOA 3EN8A 4L8OA 3CCS3 3K5TA 3Q2PA 3G8ZA 6GSPA 2D1WA 1HYFA 4N6NB 5BVBA 5STDA 3BU4A 1Q814 3JUQA 1VQ83 3FG3A 1BNEA 2O9UX 4N6V0 1LOXA 5CF2A 2W2CA 1FUSA 1I0VA 3HZPA 4AKYA 4BIRA 1VQN3 3MWZA 4FMAA 2KF6A 5JPUA 1BNRA 2CFWA 2XGNA 2D42A 1BSBA 2KRTA 1IYYA 1FUTA 3PGBA 1E3RA 1SPUA 1OUNA 2AAEA 3H51A 3OX9A 3UJMA 1M904 1OF5A 1CH0A 2LQVA 2BMQB 2BU4A 3D5IA 1B3SA 1BU4A 1TTOA 3M8CA 1ZO2A 1B2SA 4OVMA 5FGOA 3CCR3 3HOHA 1YJN3 5DRVA 1W6GA 3NV0A 4HM2B 3PXMA 1UI8A 1KC84 1TFOA 4XDWA 4N6TA 3FSDA 1JB5A 1RJOA 1RN4A 3UNLA 1BRGA 5LC7A 2XFTA 2JDIH 4CPKA 1VQ43 1V58A 2HMJB 3KFQC 1LQGC 1SIIA 2W04A 5IF6A 3T8NA 1MWSA 2CG0A 3G713 1FZUA 4FR9A 4DKIA 3NUVA 4FCZA 1FYSA 1I0XA 4RNTA 2I9WA 1FGQA 1GOVA 3MKIA 4FCMA 4KZ1A 1NB5I 2W6JH 3KIIA 3PCRA 1G0TA 3NXJA 3T0UA 3CC23 1QAFA 1D6UA 1A2KA 3NBJA 7RNTA 1JKGB 3BLZA 3EF8A 1VQL3 4WWUC 3D9RA 3N9HA 4QWTA 1N5PA 2E2VA 2HMNB 3FGYA 1MNLA 2K3DA 4GHOA 3S67A 3MHEA 1RSNA 2ML6A 1S723 5BXQA 3PZWA 1O7HB 3TDGA 1JN5A 3CCQ3 2E2TA 2F99A 3ER7A 1IU7A 3GZBA 4XBTA 1M1K4 5DREA 3JUNA 2P05A 4XBXA 3F14A 1OACA 3D4AA 4J9AA 3SYUA 1C7HA 3F9SA 5KP3A 1LRAA 3V92A 2QEX3 1OHOA 1ZS7A 1UDII 2XRXB 4NHFA 3HIGA 3EX9A 1OCVA 3K0ZA 2P0MA 2R4IA 1JZOA 4HKVB 7STDA 1JJ22 4GB5A 3CPW2 5M1AA 3CD63 2BNGA 3OV4A 3OWSA 1DMNA 2K0MA 4HM7B 1OHPA 1YVBI 5GSPA 2OOVA 3WA2X 1C54A 3S27A 1IVUA 2W0QA 3GWRA 4I4KA 1EKMA 3HX8A 2L1SA 3KN4A 1N8QA 1O7WB 1OHSA 3DGYA 1I8VA 4LSOA 2KCDA 3SOYA 4NPBA 1GSPA 4N3VA 1ULJB 4EW5A 1WMOA 1Q40B 3UB1A 1K734 4OK0A 3DZLA 1VQ73 3D5GA 5IEOA 1ULIB 3LZAA 8RNTA 2GEXA 2H0IA 4LEHA 1R4CA 2QA43 1T2HA 1X1WA 1BANA 1BRJA 4ORLA 1MWTA 3F40A 4I5QA 3GRDA 3S29A 1EG9B 1VQQA 2A15A 2AADA 3HK4A 3CXC2 4R4KA 2CX1A 5D81A 5IG4A 1Q7Y4 2H0GA 3CCV3 4CDLA 4FMBA 5RNTA 2WOHA 1B27A 2ZL8A 3AGOA 4LGQA 1LVNA 2KF3A 4N6MA 2RFRA 1W2ZA 2OCTA 4EV5A 4JRFA 3NX0A 3CCJ3 4BTWA 1BRNL 2XSOB 3K7CA 3WODG 3SX1A 3EBTA 2SBLA 3KSED 2CH9A 1QMAA 4MMZB 1GOUA 2Y73A 3Q3FA 4HOHA 1O7GB 1YJ93 3Q90A 1W7CA 2WO0A 1RCLA 1BSCA 1RLSA 3CU3A 4HM4B 5AYRB 1UGHI 1B2ZA 3OWYA 1EEJA 1MGRA 2KF5A 1W2B2 1BNJA 3FKAA 1MOLA 5BU4A 1Q824 3X3ZA 1IT7A 2OQEC 7GSPA 1LOWA 3URPA 1QVF2 3RGRA 2CWVA 1UGIA 3JUPA 4HJLB 1YHQ3 1K8A4 4U13A 1CYVA 1JB2A 5EEOA 3VSYA 4HVNA 2RBIA 3ECFA 4KVHA 4BL3A 1M1XB 1YGWA 1VQP3 3G0KA 3B7CA 1UW1A 2E2UA 4RNZA 2YFJB 3KZTA 3RNTA 1R4YA 1RGEA 2F4YA 1HKXA 1N9EA 2FXTA 3MPHA 3FLJA 1NO3A 1BUJA 1IQXA 1L5GB 1JNQA 2CK3H 1WQLB 1RN1A 1KD14 1EA2A 4FMDA 1RCKA 3WOFB 2CWTA 1GMPA 5D82A 1B20A 3SLUA 3T8UA 4K61A 4BL2A 3LXUX 1RGCA 2XEPA 3F7SA 3PYJA 3E99A 1GMQA 3QRDA 4X2HA 2CKFB 2GU3A 2W9PA 3FG1A 3JUOA 1IVWA 2MC8A 2IUJA 5KP4A 3MG2A 2ZDJA 2J8XB 1QJGA 1KWIA 2GBXB 2W56B 1G02A 3EN1B 3AHSA 3BNDA 4Q53A 3S28A 5D83A 2HMOB 1JKGA 1WTHA 2CHCA 2ML5A 3B8LA 1JV2B 3FCSB 3KCHA 3LTDA 4HYZA 4R1KA 4MMXB 1RRHA 4TX4A 1JBRA 2IMJA 3NBBA 3VGNA 4O2HA 3KE7A 1D6YA 2Y74A 4WYKB 2RCDA 4K1VA 1DE3A 2OWPA 1O7NB 3K63A 1BUQA 3X42A 3U97A 1OH0A 2GXFA 1ISKA 2XF3A 2F56A 3F7XA 2KXGA 2XSHB 4PEJA 5HOHA 3CC73 5AIFA 2QGUA 1WNHA 1X1UA 1RGHA 4STDA 5IW9A 2ZHXB 1RRLA 1NWWA 1UCLA 1UI7A 3AHWA 1SARA 2QIYA 2CWUA 3I553
chains in the Genus database with same CATH topology
3OWUA 2K54A 3WA3A 1VQK3 2CFKA 4EXRA 1AVKA 1GY6A 4XB5A 1IVVA 2BHMA 3WDGB 5G2GA 3SOAA 3FZWA 3IJEB 5JPPA 2HMLB 3LH4A 5CF1A 1NU3A 2Z6BA 5AEUB 3G4S3 3LTBA 2MF7A 4RZMA 2GU1A 2XH9A 1Q40A 3ROBA 1F8NA 3EJVA 3GZYB 5IG3A 1W6CA 6STDA 1FA3A 1CQSA 1GYBA 4KFEA 4XM4A 1W6YA 3NM2A 3SXXA 3BNEA 2P38A 1A90A 2IA7A 4N6UA 4HBRA 1TFKA 3HI7A 3BNBA 5IERA 5AIGA 1N5HA 3AMOB 1AR0A 1VZZA 3BB9A 1YGEA 4L8PA 3SEDA 1Q864 2C10A 3WOEB 3X3XA 3DGNA 3X40A 1K41A 4KFFA 3CCL3 3CC43 3GZXB 1N9JA 4HM0B 1AVLA 3H3HA 4K1UA 1FUWA 2B1XB 3B4PA 2OOVC 3GZRA 3NQZA 4XBYA 1DMQA 1STFI 3D3LA 4L7KA 4H61A 1TU5A 1YI23 1VQ53 3KSPA 1TUHA 1Q42A 1KQS2 1IVXA 1W5ZA 4WP5A 2P0XA 3V99A 1U8CB 1ASKA 1D6ZA 1IV7A 3F8XA 2Z77A 4BTYA 4HM8B 5HGRA 3IMAB 4J8TA 1W00A 5FW5A 1GS3A 2STDA 2CFLA 3I563 5AIHA 1O7PB 1GD4A 5IENA 4K90B 3DGMA 1OPYA 4O02B 1AV4A 3X41A 3DGLA 1M9GA 2BMOB 3HIIA 2M7OA 2OTJ3 1STDA 3DM8A 3OXAA 1GY7A 4BTXA 2OTL3 2FGTA 3SVAA 1RKYA 4AKZA 3FG4A 3RGAA 2XFSA 3LYGA 1US1A 5JBSA 3PCSA 1W4NA 2CFGA 2F98A 1O7MB 3EHCA 3DMCA 1FGTA 1PFPA 2WGQA 1QALA 2RSXA 3F8HA 1FGRA 4O8SA 5KP1A 3MG3A 1ROAA 1Y4KA 1SQWA 2LYXA 4G1MB 1J2BA 1IT8A 2W56A 2GEYA 2WGOA 2XR8B 1K9M4 3RDEA 2FNQA 2CC3A 1GY5A 3FF0A 3FH1A 3JVCA 3NM7A 3ALAA 3CCE3 4WYKA 3MYTA 2CFDA 3O8YA 1W01A 3EE1A 3EB8A 1IQYA 3G16A 3LOYA 4R9LA 1UUVB 2CW9A 2PNCA 3I0YA 3V98A 3B4OA 2YX9A 4AEQA 4CCVA 1N8R4 1NB3I 4EBGA 1SJWA 1T5YA 4FCJA 2YFIB 1OF5B 4KFDA 3BNCA 4RBNA 3OW22 3CMA3 3L0RA 4N6LA 2V1LA 3VF1A 1WMNA 2HMMB 2B24B 2HMKB 4X2OA 1VQO3 1Z1SA 3CCU3 2BMRB 1NDOB 1S5AA 3MSOA 3NV0B 1E3VA 5IG5A 3CME3 1NJI4 2P09A 2C11A 1CEWI 2INXA 2W03A 3K9MC 2JQ5A 2CG1A 1VQM3 2XGLA 1IK3A 1KSIA 1TP6A 1HU9A 4IIAA 4IPBA 4FMCA 1E97A 5I97A 2YFLB 3AMOA 4HM1B 1A67A 3N54B 2F86B 2IUKA 1DMMA 1IV9A 3MG1A 3DXOA 2W9QA 1ZX2A 4HM5B 3IPTA 4WHAA 1V74A 1A2VA 3CNXA 4O3VA 4MMYB 1FGOA 1QVG2 1CYUA 1JN5B 3J7Yd 1LXEA 3LTCA 1DVDA 3PS8A 2WOFA 4RNYA 5LC6A 1VQ63 5AEWB 5CXOA 2L4VA 3CNMA 1YJW3 3LTAA 5ELJA 4XDVA 2UX0A 2RGQA 3UL6A 1U5OA 1JRQA 1ROVA 1DYUA 3NHXA 4R80A 1YIT3 3JUMA 3LT8A 5AI1A 3NBRA 1IQ8A 5EQLA 3EQQB 3UL5A 4LZIA 1GD3A 1IDPA 3QK9A 1FGMA 5TGNA 8CHOA 5IEPA 3X3YA 2BT3A 3Q1CA 3LMLA 4HZ9B 1PU4A 3STDA 2CIUA 3S5CA 5AIIA 3GAXA 4EYCA 1SIHA 2Q07A 1QAKA 2Z76A 1YIJ3 3EBYA 3A76A 3FF2A 3NQYA 4OUQA 5CLKA 1LNHA 5EVHA 5AYSC 1EQKA 5IG0A 4MJDA 3DUKA 2PZVA 3CCM3 1VQ93 3WMDA 2Z7AA 4HM6B 2OQEA 3G6E3 5ELUA 2GBWB 4ZM8A 2BO9B 5CK6A 4GL6A 4JF8A 4R9KA 1JB4A 2O3OA 5A0OB 3EC9A 3CPOA 1RN7A 3N8BA 1K28A 3DY5A 4HM3B 1TIJA 1WMPA 3KKGA 1W02A 4N6OB 4IT7A 1UUWB 3LT9A 1OGXA 1DVCA 1OGZA 3DGOA 1G96A 4NREA 4LMIA 4H3UA 3U1WA 4MEIA 4EV2A 4HZBB 4WFOA 3EN8A 4L8OA 3CCS3 3K5TA 3Q2PA 3G8ZA 2D1WA 4N6NB 5BVBA 5STDA 1Q814 3JUQA 1VQ83 3FG3A 2O9UX 4N6V0 1LOXA 5CF2A 2W2CA 4AKYA 3HZPA 1VQN3 3MWZA 4FMAA 5JPUA 2CFWA 2XGNA 2D42A 2KRTA 3PGBA 1E3RA 1SPUA 1OUNA 3H51A 3OX9A 3UJMA 1M904 1OF5A 2LQVA 2BMQB 3M8CA 5FGOA 1ZO2A 3CCR3 4OVMA 5DRVA 1W6GA 3NV0A 4HM2B 3PXMA 1UI8A 1KC84 1TFOA 4XDWA 4N6TA 3FSDA 1JB5A 1RJOA 3UNLA 5LC7A 2XFTA 2JDIH 1VQ43 2HMJB 3KFQC 1SIIA 2W04A 5IF6A 3T8NA 2CG0A 3G713 4FR9A 3NUVA 4FCZA 2I9WA 1FGQA 3MKIA 4FCMA 4KZ1A 1NB5I 2W6JH 3KIIA 3PCRA 3NXJA 3T0UA 3CC23 1QAFA 1D6UA 1A2KA 3NBJA 1JKGB 3BLZA 3EF8A 1VQL3 4WWUC 3D9RA 3N9HA 4QWTA 1N5PA 2E2VA 2HMNB 3FGYA 1MNLA 3S67A 5IW9A 3MHEA 2ML6A 1S723 5BXQA 3PZWA 1O7HB 3TDGA 1JN5A 3CCQ3 2E2TA 2F99A 3ER7A 1IU7A 3GZBA 4XBTA 1M1K4 5DREA 3JUNA 2P05A 4XBXA 3F14A 1OACA 4J9AA 1C7HA 3F9SA 5KP3A 3V92A 2QEX3 1OHOA 2XRXB 4NHFA 3HIGA 3EX9A 1OCVA 3K0ZA 2P0MA 2R4IA 4HKVB 7STDA 1JJ22 4GB5A 3CPW2 3CD63 2BNGA 3OV4A 3OWSA 1DMNA 2K0MA 4HM7B 1OHPA 1YVBI 2OOVA 3WA2X 3S27A 1IVUA 2W0QA 3GWRA 4I4KA 1EKMA 3HX8A 3KN4A 1N8QA 1O7WB 1OHSA 4LSOA 2KCDA 3SOYA 4N3VA 1ULJB 1WMOA 1Q40B 3UB1A 1K734 4OK0A 3DZLA 1VQ73 5IEOA 1ULIB 3LZAA 2GEXA 4LEHA 1R4CA 2QA43 4ORLA 3F40A 3GRDA 3S29A 1EG9B 2A15A 3CXC2 3HK4A 4R4KA 5D81A 5IG4A 1Q7Y4 3CCV3 4CDLA 4FMBA 2WOHA 2ZL8A 4LGQA 4N6MA 1LVNA 2RFRA 1W2ZA 2OCTA 4EV5A 4JRFA 3NX0A 3CCJ3 4BTWA 2XSOB 3K7CA 3WODG 3SX1A 3EBTA 2SBLA 3KSED 2CH9A 1QMAA 4MMZB 2Y73A 1YJ93 1O7GB 3Q90A 1W7CA 2WO0A 3CU3A 4HM4B 5AYRB 3OWYA 1W2B2 3FKAA 1MOLA 1Q824 3X3ZA 1IT7A 2OQEC 1QVF2 3RGRA 2CWVA 4HJLB 3JUPA 1K8A4 1YHQ3 4U13A 1CYVA 1JB2A 5EEOA 3VSYA 4HVNA 3ECFA 4KVHA 1M1XB 1VQP3 3G0KA 3B7CA 1UW1A 2E2UA 4RNZA 2YFJB 3KZTA 1YJN3 1HKXA 1N9EA 2FXTA 3MPHA 3FLJA 1NO3A 1IQXA 1L5GB 1JNQA 2CK3H 1WQLB 1KD14 1EA2A 4FMDA 3WOFB 2CWTA 5D82A 3SLUA 3T8UA 4K61A 3LXUX 2XEPA 3F7SA 3PYJA 3E99A 3QRDA 4X2HA 2CKFB 2GU3A 2W9PA 3FG1A 3JUOA 1IVWA 2MC8A 2IUJA 5KP4A 3MG2A 2ZDJA 1QJGA 1KWIA 2GBXB 2W56B 3EN1B 3BNDA 4Q53A 3S28A 5D83A 2HMOB 1JKGA 2ML5A 1WTHA 2CHCA 3B8LA 1JV2B 3FCSB 3LTDA 4HYZA 4R1KA 4EC6A 4MMXB 1RRHA 4TX4A 2IMJA 3NBBA 3VGNA 4O2HA 3KE7A 1D6YA 2Y74A 4WYKB 2RCDA 4K1VA 2OWPA 1O7NB 3K63A 1BUQA 3X42A 3U97A 1OH0A 2GXFA 1ISKA 2XF3A 3F7XA 2KXGA 2XSHB 4PEJA 3CC73 5AIFA 2QGUA 1WNHA 4STDA 1RRLA 1NWWA 1UI7A 2QIYA 2CWUA 3I553
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWU A;  2K54 A;  1GY6 A;  4XB5 A;  5G2G A;  3SOA A;  3FZW A;  5JPP A;  2HML B;  5CF1 A;  1NU3 A;  5AEU B;  4RZM A;  1Q40 A;  3ROB A;  3EJV A;  3GZY B;  5IG3 A;  6STD A;  1CQS A;  1GYB A;  4XM4 A;  1W6Y A;  3NM2 A;  5IER A;  5AIG A;  1AR0 A;  1VZZ A;  3BB9 A;  4L8P A;  3SED A;  1K41 A;  3GZX B;  4HM0 B;  3H3H A;  4K1U A;  2B1X B;  3B4P A;  3GZR A;  4XBY A;  1DMQ A;  4L7K A;  3KSP A;  1TUH A;  1Q42 A;  4WP5 A;  1ASK A;  3F8X A;  2Z77 A;  4HM8 B;  5HGR A;  4J8T A;  1W00 A;  5FW5 A;  1GS3 A;  2STD A;  5AIH A;  1O7P B;  5IEN A;  1OPY A;  2BMO B;  1STD A;  3DM8 A;  3OXA A;  1GY7 A;  3RGA A;  3LYG A;  2F98 A;  1O7M B;  3EHC A;  3DMC A;  5KP1 A;  3F8H A;  3MG3 A;  2GEY A;  2XR8 B;  1GY5 A;  3FF0 A;  3FH1 A;  4WYK A;  3MYT A;  1W01 A;  3G16 A;  4R9L A;  1UUV B;  3I0Y A;  3B4O A;  1SJW A;  4FCJ A;  2YFI B;  1OF5 B;  2HMK B;  2HMM B;  2B24 B;  4X2O A;  1Z1S A;  2BMR B;  1NDO B;  1S5A A;  3MSO A;  3NV0 B;  1E3V A;  5IG5 A;  2INX A;  2JQ5 A;  1TP6 A;  4IIA A;  1E97 A;  2YFL B;  4HM1 B;  2F86 B;  1DMM A;  3MG1 A;  3DXO A;  4HM5 B;  1ZX2 A;  3IPT A;  3CNX A;  1JN5 B;  5AEW B;  5CXO A;  3CNM A;  4XDV A;  2UX0 A;  2RGQ A;  1U5O A;  3NHX A;  3JUM A;  5AI1 A;  3NBR A;  3EQQ B;  5TGN A;  1IDP A;  8CHO A;  5IEP A;  4HZ9 B;  3STD A;  3S5C A;  5AII A;  2Z76 A;  3EBY A;  3A76 A;  3FF2 A;  4OUQ A;  5CLK A;  5EVH A;  5IG0 A;  4MJD A;  3DUK A;  2PZV A;  3WMD A;  2Z7A A;  4HM6 B;  2GBW B;  5CK6 A;  4R9K A;  1JB4 A;  3EC9 A;  3CPO A;  4HM3 B;  3KKG A;  1W02 A;  1UUW B;  1OGX A;  1OGZ A;  4LMI A;  4H3U A;  4HZB B;  3EN8 A;  4L8O A;  3G8Z A;  5BVB A;  5STD A;  3JUQ A;  5CF2 A;  2W2C A;  3HZP A;  5JPU A;  1E3R A;  1OUN A;  3H51 A;  3OX9 A;  3UJM A;  1OF5 A;  2BMQ B;  3M8C A;  1ZO2 A;  4OVM A;  5DRV A;  4HM2 B;  3NV0 A;  4XDW A;  3FSD A;  1JB5 A;  3UNL A;  2HMJ B;  5IF6 A;  3T8N A;  3NUV A;  2I9W A;  3MKI A;  4FCM A;  3NXJ A;  1A2K A;  1JKG B;  3BLZ A;  3EF8 A;  4WWU C;  3D9R A;  2HMN B;  3FGY A;  3MHE A;  5BXQ A;  1O7H B;  1JN5 A;  2F99 A;  3ER7 A;  3GZB A;  4XBT A;  5DRE A;  3JUN A;  4XBX A;  3F14 A;  4J9A A;  1C7H A;  3F9S A;  5KP3 A;  1OHO A;  2XRX B;  3EX9 A;  1OCV A;  3K0Z A;  2R4I A;  4HKV B;  7STD A;  4GB5 A;  2BNG A;  3OV4 A;  3OWS A;  1DMN A;  4HM7 B;  1OHP A;  3GWR A;  4I4K A;  3HX8 A;  1O7W B;  1OHS A;  3SOY A;  4N3V A;  1ULJ B;  1Q40 B;  3DZL A;  5IEO A;  1ULI B;  3LZA A;  2GEX A;  4LEH A;  4ORL A;  3F40 A;  3GRD A;  1EG9 B;  2A15 A;  3HK4 A;  5D81 A;  5IG4 A;  4CDL A;  4LGQ A;  2RFR A;  2XSO B;  3K7C A;  3EBT A;  1QMA A;  1O7G B;  3Q90 A;  3CU3 A;  4HM4 B;  3OWY A;  3FKA A;  3RGR A;  4HJL B;  3JUP A;  4U13 A;  1JB2 A;  3VSY A;  4HVN A;  3ECF A;  4KVH A;  3G0K A;  3B7C A;  2YFJ B;  3KZT A;  1HKX A;  3FLJ A;  1WQL B;  1EA2 A;  5D82 A;  3T8U A;  3F7S A;  3E99 A;  4X2H A;  2CKF B;  5KP4 A;  3JUO A;  3MG2 A;  1QJG A;  2GBX B;  3EN1 B;  4Q53 A;  5D83 A;  2HMO B;  1JKG A;  2CHC A;  4R1K A;  3B8L A;  2IMJ A;  3VGN A;  3KE7 A;  4WYK B;  2RCD A;  4K1V A;  2OWP A;  1O7N B;  1BUQ A;  1OH0 A;  2GXF A;  1ISK A;  3F7X A;  2XSH B;  4PEJ A;  5AIF A;  2QGU A;  4STD A;  1NWW A;  2QIY A; 
#chains in the Genus database with same CATH topology
 3OWU A;  1I2E A;  2K54 A;  3WA3 A;  2F5M A;  1VQK 3;  2CFK A;  4EXR A;  1AVK A;  1GY6 A;  1MWU A;  1RNB A;  4XB5 A;  1BOX A;  1IVV A;  2BHM A;  3WDG B;  5G2G A;  3SOA A;  3FZW A;  3IJE B;  4BU4 A;  2HML B;  5JPP A;  1LQM B;  3LH4 A;  5CF1 A;  1NU3 A;  2Z6B A;  3WR2 A;  5AEU B;  3LTB A;  2MF7 A;  4RZM A;  3G4S 3;  2GU1 A;  1BSA A;  2XH9 A;  1Q40 A;  3ROB A;  1F8N A;  1PYL A;  3EJV A;  2HOH A;  1W6C A;  3GZY B;  3ZG0 A;  6STD A;  5IG3 A;  1FA3 A;  1MWR A;  1CQS A;  1GYB A;  4KFE A;  4XM4 A;  1W6Y A;  3NM2 A;  3SXX A;  3BNE A;  2P38 A;  1A90 A;  2IA7 A;  4N6U A;  1UCJ A;  4HBR A;  4CJN A;  2C4B A;  1TFK A;  3HI7 A;  3BNB A;  5IER A;  5AIG A;  1N5H A;  3AMO B;  1AR0 A;  1VZZ A;  3BB9 A;  1YGE A;  4L8P A;  3SED A;  1Q86 4;  2C10 A;  3WOE B;  1JBS A;  1FW7 A;  3X3X A;  3DGN A;  3X40 A;  1BVI A;  1K41 A;  4KFF A;  3CCL 3;  1AQZ A;  1UCI A;  3CC4 3;  3GZX B;  1N9J A;  1TJD A;  1ZGX A;  4HM0 B;  1AVL A;  1DET A;  3H3H A;  4K1U A;  1BRH A;  1FUW A;  2B1X B;  3B4P A;  2OOV C;  3GZR A;  3NQZ A;  4XBY A;  1DMQ A;  1STF I;  3D3L A;  4L7K A;  4H61 A;  1TU5 A;  1YI2 3;  1VQ5 3;  3KSP A;  1NNV A;  1TUH A;  3ZG5 A;  1I3F A;  1Q42 A;  1KQS 2;  1IVX A;  1W5Z A;  2CX0 A;  4WP5 A;  2P0X A;  3V99 A;  1U8C B;  1I2G A;  1ASK A;  1D6Z A;  1IV7 A;  3F8X A;  5M19 A;  2Z77 A;  4BTY A;  4HM8 B;  5HGR A;  3IMA B;  2IY2 A;  4HAA A;  1W00 A;  4J8T A;  5FW5 A;  1BRS A;  1GS3 A;  1JZD A;  2CFL A;  2STD A;  3I56 3;  5AIH A;  1O7P B;  1GD4 A;  2SAR A;  5IEN A;  4K90 B;  1RNT A;  1I70 A;  1OPY A;  3DGM A;  4O02 B;  1AV4 A;  2H0H A;  1RGL A;  3X41 A;  1BNF A;  1M9G A;  2BMO B;  3DGL A;  3HII A;  2M7O A;  2OTJ 3;  1STD A;  3DM8 A;  3OXA A;  1GY7 A;  4BTX A;  2OTL 3;  2FGT A;  4KT3 B;  3SVA A;  1RKY A;  4AKZ A;  3FG4 A;  5G1K A;  3RGA A;  2XFS A;  3LYG A;  1US1 A;  5BIR A;  5JBS A;  1X1X A;  1W4N A;  2CFG A;  2F98 A;  1O7M B;  3PCS A;  3EHC A;  1BNG A;  1FGT A;  1PFP A;  3DMC A;  2WGQ A;  1QAL A;  2RSX A;  3F8H A;  1FGR A;  4O8S A;  5KP1 A;  3MG3 A;  1ROA A;  1RGF A;  1Y4K A;  1SQW A;  2LYX A;  4G1M B;  1J2B A;  1IT8 A;  1B2M A;  1T3B A;  2W56 A;  2GEY A;  2WGO A;  2XR8 B;  1K9M 4;  3RDE A;  2FNQ A;  2CC3 A;  1GY5 A;  3FF0 A;  3AGN A;  3FH1 A;  1Q7H A;  2UGI A;  3ZFZ A;  3JVC A;  1RHL A;  1BRK A;  1GMR A;  3NM7 A;  3ALA A;  3A5E A;  3CCE 3;  1T2I A;  1UUG B;  3BIR A;  4WYK A;  3MYT A;  2CFD A;  3O8Y A;  1W01 A;  3EE1 A;  3EB8 A;  6RNT A;  2KF4 A;  1IQY A;  3G16 A;  3LOY A;  4R9L A;  1UUV B;  2CW9 A;  2PNC A;  1YVS A;  3I0Y A;  3V98 A;  3B4O A;  2YX9 A;  4AEQ A;  1LOY A;  4CCV A;  1N8R 4;  1A2P A;  1NB3 I;  4EBG A;  1SJW A;  1T5Y A;  4FCJ A;  2YFI B;  1OF5 B;  4KFD A;  3BNC A;  4RBN A;  3OW2 2;  1RTU A;  3L0R A;  3CMA 3;  1BSE A;  2V1L A;  4N6L A;  3VF1 A;  1WMN A;  2HMM B;  2B24 B;  2GSP A;  1UCK A;  2HMK B;  4X2O A;  1VQO 3;  2RNT A;  1Z1S A;  1TRQ A;  2BMR B;  3CCU 3;  1NDO B;  1S5A A;  3MSO A;  3NV0 B;  1E3V A;  5IG5 A;  3CME 3;  1NJI 4;  2P09 A;  2BIR A;  2C11 A;  1CEW I;  2INX A;  1TRP A;  2W03 A;  3K9M C;  2JQ5 A;  2CG1 A;  1RMS A;  1VQM 3;  2XGL A;  1IK3 A;  1RGA A;  1KSI A;  1TP6 A;  1HU9 A;  2R41 A;  4IIA A;  4IPB A;  4FMC A;  3DH2 A;  9RNT A;  1I2F A;  1E97 A;  5I97 A;  2YFL B;  3AMO A;  4HM1 B;  4EC6 A;  1A67 A;  3N54 B;  2F86 B;  2IUK A;  1DMM A;  1AY7 A;  1IV9 A;  1EUI C;  1B2U A;  3WHO A;  3MG1 A;  3DXO A;  2W9Q A;  1ZX2 A;  4HM5 B;  1JBT A;  1B2X A;  2KAA A;  3IPT A;  4WHA A;  1V74 A;  3GSP A;  1A2V A;  3CNX A;  1PY3 A;  4MMY B;  4O3V A;  2ZA4 A;  1FGO A;  1QVG 2;  1CYU A;  1JN5 B;  1RGK A;  3J7Y d;  1BAO A;  1LXE A;  1YNV X;  3LTC A;  3PS8 A;  4ILF A;  2WOF A;  1DVD A;  4RNY A;  5LC6 A;  1VQ6 3;  5AEW B;  5CXO A;  1GOY A;  3D79 A;  2L4V A;  3CNM A;  1YJW 3;  3LTA A;  5ELJ A;  1X1Y A;  4XDV A;  2UX0 A;  2RGQ A;  1BGS A;  3UL6 A;  1U5O A;  1JRQ A;  1ROV A;  1DYU A;  1LOV A;  3NHX A;  4R80 A;  1YIT 3;  3JUM A;  1MGW A;  3LT8 A;  4LYL B;  5AI1 A;  1BIR A;  1IQ8 A;  3NBR A;  1RDS A;  5EQL A;  3EQQ B;  3UL5 A;  4LZI A;  1GD3 A;  1IDP A;  3QK9 A;  1FGM A;  5TGN A;  8CHO A;  5IEP A;  3X3Y A;  2BT3 A;  5G1L A;  3Q1C A;  3LML A;  4HZ9 B;  1PU4 A;  3STD A;  2CIU A;  3S5C A;  5AII A;  2IYJ A;  3GAX A;  4EYC A;  1SIH A;  2Q07 A;  1QAK A;  2Z76 A;  1YIJ 3;  3EBY A;  3A76 A;  3FF2 A;  3NQY A;  4OUQ A;  5CLK A;  1LNH A;  5EVH A;  5AYS C;  1BNS A;  1EQK A;  5IG0 A;  4MJD A;  1I3I A;  3DUK A;  2PZV A;  1HZ1 A;  3CCM 3;  1VQ9 3;  3WMD A;  2Z7A A;  4HM6 B;  2OQE A;  3G6E 3;  1BRI A;  4GSP A;  5ELU A;  2GBW B;  2F5W A;  4ZM8 A;  2BO9 B;  5CK6 A;  4J5G A;  1Q9E A;  4GL6 A;  4JF8 A;  4R9K A;  1JB4 A;  2O3O A;  5A0O B;  3EC9 A;  4J5K A;  5M18 A;  3CPO A;  1RN7 A;  3N8B A;  1BNI A;  1K28 A;  3DY5 A;  4HM3 B;  1TIJ A;  1WMP A;  3KKG A;  1W02 A;  4N6O B;  1LNI A;  1BSD A;  1UUW B;  1V57 A;  3LT9 A;  1RGG A;  4IT7 A;  1OGX A;  1DVC A;  1OGZ A;  1B21 A;  1G96 A;  3DGO A;  4NRE A;  4LMI A;  4H3U A;  3U1W A;  4MEI A;  2UUG C;  4EV2 A;  4HZB B;  4WFO A;  3EN8 A;  4L8O A;  3CCS 3;  3K5T A;  3Q2P A;  3G8Z A;  6GSP A;  2D1W A;  1HYF A;  4N6N B;  5BVB A;  5STD A;  3BU4 A;  1Q81 4;  3JUQ A;  1VQ8 3;  3FG3 A;  1BNE A;  2O9U X;  4N6V 0;  1LOX A;  5CF2 A;  2W2C A;  1FUS A;  1I0V A;  3HZP A;  4AKY A;  4BIR A;  1VQN 3;  3MWZ A;  4FMA A;  2KF6 A;  5JPU A;  1BNR A;  2CFW A;  2XGN A;  2D42 A;  1BSB A;  2KRT A;  1IYY A;  1FUT A;  3PGB A;  1E3R A;  1SPU A;  1OUN A;  2AAE A;  3H51 A;  3OX9 A;  3UJM A;  1M90 4;  1OF5 A;  1CH0 A;  2LQV A;  2BMQ B;  2BU4 A;  3D5I A;  1B3S A;  1BU4 A;  1TTO A;  3M8C A;  1ZO2 A;  1B2S A;  4OVM A;  5FGO A;  3CCR 3;  3HOH A;  1YJN 3;  5DRV A;  1W6G A;  3NV0 A;  4HM2 B;  3PXM A;  1UI8 A;  1KC8 4;  1TFO A;  4XDW A;  4N6T A;  3FSD A;  1JB5 A;  1RJO A;  1RN4 A;  3UNL A;  1BRG A;  5LC7 A;  2XFT A;  2JDI H;  4CPK A;  1VQ4 3;  1V58 A;  2HMJ B;  3KFQ C;  1LQG C;  1SII A;  2W04 A;  5IF6 A;  3T8N A;  1MWS A;  2CG0 A;  3G71 3;  1FZU A;  4FR9 A;  4DKI A;  3NUV A;  4FCZ A;  1FYS A;  1I0X A;  4RNT A;  2I9W A;  1FGQ A;  1GOV A;  3MKI A;  4FCM A;  4KZ1 A;  1NB5 I;  2W6J H;  3KII A;  3PCR A;  1G0T A;  3NXJ A;  3T0U A;  3CC2 3;  1QAF A;  1D6U A;  1A2K A;  3NBJ A;  7RNT A;  1JKG B;  3BLZ A;  3EF8 A;  1VQL 3;  4WWU C;  3D9R A;  3N9H A;  4QWT A;  1N5P A;  2E2V A;  2HMN B;  3FGY A;  1MNL A;  2K3D A;  4GHO A;  3S67 A;  3MHE A;  1RSN A;  2ML6 A;  1S72 3;  5BXQ A;  3PZW A;  1O7H B;  3TDG A;  1JN5 A;  3CCQ 3;  2E2T A;  2F99 A;  3ER7 A;  1IU7 A;  3GZB A;  4XBT A;  1M1K 4;  5DRE A;  3JUN A;  2P05 A;  4XBX A;  3F14 A;  1OAC A;  3D4A A;  4J9A A;  3SYU A;  1C7H A;  3F9S A;  5KP3 A;  1LRA A;  3V92 A;  2QEX 3;  1OHO A;  1ZS7 A;  1UDI I;  2XRX B;  4NHF A;  3HIG A;  3EX9 A;  1OCV A;  3K0Z A;  2P0M A;  2R4I A;  1JZO A;  4HKV B;  7STD A;  1JJ2 2;  4GB5 A;  3CPW 2;  5M1A A;  3CD6 3;  2BNG A;  3OV4 A;  3OWS A;  1DMN A;  2K0M A;  4HM7 B;  1OHP A;  1YVB I;  5GSP A;  2OOV A;  3WA2 X;  1C54 A;  3S27 A;  1IVU A;  2W0Q A;  3GWR A;  4I4K A;  1EKM A;  3HX8 A;  2L1S A;  3KN4 A;  1N8Q A;  1O7W B;  1OHS A;  3DGY A;  1I8V A;  4LSO A;  2KCD A;  3SOY A;  4NPB A;  1GSP A;  4N3V A;  1ULJ B;  4EW5 A;  1WMO A;  1Q40 B;  3UB1 A;  1K73 4;  4OK0 A;  3DZL A;  1VQ7 3;  3D5G A;  5IEO A;  1ULI B;  3LZA A;  8RNT A;  2GEX A;  2H0I A;  4LEH A;  1R4C A;  2QA4 3;  1T2H A;  1X1W A;  1BAN A;  1BRJ A;  4ORL A;  1MWT A;  3F40 A;  4I5Q A;  3GRD A;  3S29 A;  1EG9 B;  1VQQ A;  2A15 A;  2AAD A;  3HK4 A;  3CXC 2;  4R4K A;  2CX1 A;  5D81 A;  5IG4 A;  1Q7Y 4;  2H0G A;  3CCV 3;  4CDL A;  4FMB A;  5RNT A;  2WOH A;  1B27 A;  2ZL8 A;  3AGO A;  4LGQ A;  1LVN A;  2KF3 A;  4N6M A;  2RFR A;  1W2Z A;  2OCT A;  4EV5 A;  4JRF A;  3NX0 A;  3CCJ 3;  4BTW A;  1BRN L;  2XSO B;  3K7C A;  3WOD G;  3SX1 A;  3EBT A;  2SBL A;  3KSE D;  2CH9 A;  1QMA A;  4MMZ B;  1GOU A;  2Y73 A;  3Q3F A;  4HOH A;  1O7G B;  1YJ9 3;  3Q90 A;  1W7C A;  2WO0 A;  1RCL A;  1BSC A;  1RLS A;  3CU3 A;  4HM4 B;  5AYR B;  1UGH I;  1B2Z A;  3OWY A;  1EEJ A;  1MGR A;  2KF5 A;  1W2B 2;  1BNJ A;  3FKA A;  1MOL A;  5BU4 A;  1Q82 4;  3X3Z A;  1IT7 A;  2OQE C;  7GSP A;  1LOW A;  3URP A;  1QVF 2;  3RGR A;  2CWV A;  1UGI A;  3JUP A;  4HJL B;  1YHQ 3;  1K8A 4;  4U13 A;  1CYV A;  1JB2 A;  5EEO A;  3VSY A;  4HVN A;  2RBI A;  3ECF A;  4KVH A;  4BL3 A;  1M1X B;  1YGW A;  1VQP 3;  3G0K A;  3B7C A;  1UW1 A;  2E2U A;  4RNZ A;  2YFJ B;  3KZT A;  3RNT A;  1R4Y A;  1RGE A;  2F4Y A;  1HKX A;  1N9E A;  2FXT A;  3MPH A;  3FLJ A;  1NO3 A;  1BUJ A;  1IQX A;  1L5G B;  1JNQ A;  2CK3 H;  1WQL B;  1RN1 A;  1KD1 4;  1EA2 A;  4FMD A;  1RCK A;  3WOF B;  2CWT A;  1GMP A;  5D82 A;  1B20 A;  3SLU A;  3T8U A;  4K61 A;  4BL2 A;  3LXU X;  1RGC A;  2XEP A;  3F7S A;  3PYJ A;  3E99 A;  1GMQ A;  3QRD A;  4X2H A;  2CKF B;  2GU3 A;  2W9P A;  3FG1 A;  3JUO A;  1IVW A;  2MC8 A;  2IUJ A;  5KP4 A;  3MG2 A;  2ZDJ A;  2J8X B;  1QJG A;  1KWI A;  2GBX B;  2W56 B;  1G02 A;  3EN1 B;  3AHS A;  3BND A;  4Q53 A;  3S28 A;  5D83 A;  2HMO B;  1JKG A;  1WTH A;  2CHC A;  2ML5 A;  3B8L A;  1JV2 B;  3FCS B;  3KCH A;  3LTD A;  4HYZ A;  4R1K A;  4MMX B;  1RRH A;  4TX4 A;  1JBR A;  2IMJ A;  3NBB A;  3VGN A;  4O2H A;  3KE7 A;  1D6Y A;  2Y74 A;  4WYK B;  2RCD A;  4K1V A;  1DE3 A;  2OWP A;  1O7N B;  3K63 A;  1BUQ A;  3X42 A;  3U97 A;  1OH0 A;  2GXF A;  1ISK A;  2XF3 A;  2F56 A;  3F7X A;  2KXG A;  2XSH B;  4PEJ A;  5HOH A;  3CC7 3;  5AIF A;  2QGU A;  1WNH A;  1X1U A;  1RGH A;  4STD A;  5IW9 A;  2ZHX B;  1RRL A;  1NWW A;  1UCL A;  1UI7 A;  3AHW A;  1SAR A;  2QIY A;  2CWU A;  3I55 3; 
#chains in the Genus database with same CATH homology
 3OWU A;  2K54 A;  3WA3 A;  1VQK 3;  2CFK A;  4EXR A;  1AVK A;  1GY6 A;  4XB5 A;  1IVV A;  2BHM A;  3WDG B;  5G2G A;  3SOA A;  3FZW A;  3IJE B;  5JPP A;  2HML B;  3LH4 A;  5CF1 A;  1NU3 A;  2Z6B A;  5AEU B;  3G4S 3;  3LTB A;  2MF7 A;  4RZM A;  2GU1 A;  2XH9 A;  1Q40 A;  3ROB A;  1F8N A;  3EJV A;  3GZY B;  5IG3 A;  1W6C A;  6STD A;  1FA3 A;  1CQS A;  1GYB A;  4KFE A;  4XM4 A;  1W6Y A;  3NM2 A;  3SXX A;  3BNE A;  2P38 A;  1A90 A;  2IA7 A;  4N6U A;  4HBR A;  1TFK A;  3HI7 A;  3BNB A;  5IER A;  5AIG A;  1N5H A;  3AMO B;  1AR0 A;  1VZZ A;  3BB9 A;  1YGE A;  4L8P A;  3SED A;  1Q86 4;  2C10 A;  3WOE B;  3X3X A;  3DGN A;  3X40 A;  1K41 A;  4KFF A;  3CCL 3;  3CC4 3;  3GZX B;  1N9J A;  4HM0 B;  1AVL A;  3H3H A;  4K1U A;  1FUW A;  2B1X B;  3B4P A;  2OOV C;  3GZR A;  3NQZ A;  4XBY A;  1DMQ A;  1STF I;  3D3L A;  4L7K A;  4H61 A;  1TU5 A;  1YI2 3;  1VQ5 3;  3KSP A;  1TUH A;  1Q42 A;  1KQS 2;  1IVX A;  1W5Z A;  4WP5 A;  2P0X A;  3V99 A;  1U8C B;  1ASK A;  1D6Z A;  1IV7 A;  3F8X A;  2Z77 A;  4BTY A;  4HM8 B;  5HGR A;  3IMA B;  4J8T A;  1W00 A;  5FW5 A;  1GS3 A;  2STD A;  2CFL A;  3I56 3;  5AIH A;  1O7P B;  1GD4 A;  5IEN A;  4K90 B;  3DGM A;  1OPY A;  4O02 B;  1AV4 A;  3X41 A;  3DGL A;  1M9G A;  2BMO B;  3HII A;  2M7O A;  2OTJ 3;  1STD A;  3DM8 A;  3OXA A;  1GY7 A;  4BTX A;  2OTL 3;  2FGT A;  3SVA A;  1RKY A;  4AKZ A;  3FG4 A;  3RGA A;  2XFS A;  3LYG A;  1US1 A;  5JBS A;  3PCS A;  1W4N A;  2CFG A;  2F98 A;  1O7M B;  3EHC A;  3DMC A;  1FGT A;  1PFP A;  2WGQ A;  1QAL A;  2RSX A;  3F8H A;  1FGR A;  4O8S A;  5KP1 A;  3MG3 A;  1ROA A;  1Y4K A;  1SQW A;  2LYX A;  4G1M B;  1J2B A;  1IT8 A;  2W56 A;  2GEY A;  2WGO A;  2XR8 B;  1K9M 4;  3RDE A;  2FNQ A;  2CC3 A;  1GY5 A;  3FF0 A;  3FH1 A;  3JVC A;  3NM7 A;  3ALA A;  3CCE 3;  4WYK A;  3MYT A;  2CFD A;  3O8Y A;  1W01 A;  3EE1 A;  3EB8 A;  1IQY A;  3G16 A;  3LOY A;  4R9L A;  1UUV B;  2CW9 A;  2PNC A;  3I0Y A;  3V98 A;  3B4O A;  2YX9 A;  4AEQ A;  4CCV A;  1N8R 4;  1NB3 I;  4EBG A;  1SJW A;  1T5Y A;  4FCJ A;  2YFI B;  1OF5 B;  4KFD A;  3BNC A;  4RBN A;  3OW2 2;  3CMA 3;  3L0R A;  4N6L A;  2V1L A;  3VF1 A;  1WMN A;  2HMM B;  2B24 B;  2HMK B;  4X2O A;  1VQO 3;  1Z1S A;  3CCU 3;  2BMR B;  1NDO B;  1S5A A;  3MSO A;  3NV0 B;  1E3V A;  5IG5 A;  3CME 3;  1NJI 4;  2P09 A;  2C11 A;  1CEW I;  2INX A;  2W03 A;  3K9M C;  2JQ5 A;  2CG1 A;  1VQM 3;  2XGL A;  1IK3 A;  1KSI A;  1TP6 A;  1HU9 A;  4IIA A;  4IPB A;  4FMC A;  1E97 A;  5I97 A;  2YFL B;  3AMO A;  4HM1 B;  1A67 A;  3N54 B;  2F86 B;  2IUK A;  1DMM A;  1IV9 A;  3MG1 A;  3DXO A;  2W9Q A;  1ZX2 A;  4HM5 B;  3IPT A;  4WHA A;  1V74 A;  1A2V A;  3CNX A;  4O3V A;  4MMY B;  1FGO A;  1QVG 2;  1CYU A;  1JN5 B;  3J7Y d;  1LXE A;  3LTC A;  1DVD A;  3PS8 A;  2WOF A;  4RNY A;  5LC6 A;  1VQ6 3;  5AEW B;  5CXO A;  2L4V A;  3CNM A;  1YJW 3;  3LTA A;  5ELJ A;  4XDV A;  2UX0 A;  2RGQ A;  3UL6 A;  1U5O A;  1JRQ A;  1ROV A;  1DYU A;  3NHX A;  4R80 A;  1YIT 3;  3JUM A;  3LT8 A;  5AI1 A;  3NBR A;  1IQ8 A;  5EQL A;  3EQQ B;  3UL5 A;  4LZI A;  1GD3 A;  1IDP A;  3QK9 A;  1FGM A;  5TGN A;  8CHO A;  5IEP A;  3X3Y A;  2BT3 A;  3Q1C A;  3LML A;  4HZ9 B;  1PU4 A;  3STD A;  2CIU A;  3S5C A;  5AII A;  3GAX A;  4EYC A;  1SIH A;  2Q07 A;  1QAK A;  2Z76 A;  1YIJ 3;  3EBY A;  3A76 A;  3FF2 A;  3NQY A;  4OUQ A;  5CLK A;  1LNH A;  5EVH A;  5AYS C;  1EQK A;  5IG0 A;  4MJD A;  3DUK A;  2PZV A;  3CCM 3;  1VQ9 3;  3WMD A;  2Z7A A;  4HM6 B;  2OQE A;  3G6E 3;  5ELU A;  2GBW B;  4ZM8 A;  2BO9 B;  5CK6 A;  4GL6 A;  4JF8 A;  4R9K A;  1JB4 A;  2O3O A;  5A0O B;  3EC9 A;  3CPO A;  1RN7 A;  3N8B A;  1K28 A;  3DY5 A;  4HM3 B;  1TIJ A;  1WMP A;  3KKG A;  1W02 A;  4N6O B;  4IT7 A;  1UUW B;  3LT9 A;  1OGX A;  1DVC A;  1OGZ A;  3DGO A;  1G96 A;  4NRE A;  4LMI A;  4H3U A;  3U1W A;  4MEI A;  4EV2 A;  4HZB B;  4WFO A;  3EN8 A;  4L8O A;  3CCS 3;  3K5T A;  3Q2P A;  3G8Z A;  2D1W A;  4N6N B;  5BVB A;  5STD A;  1Q81 4;  3JUQ A;  1VQ8 3;  3FG3 A;  2O9U X;  4N6V 0;  1LOX A;  5CF2 A;  2W2C A;  4AKY A;  3HZP A;  1VQN 3;  3MWZ A;  4FMA A;  5JPU A;  2CFW A;  2XGN A;  2D42 A;  2KRT A;  3PGB A;  1E3R A;  1SPU A;  1OUN A;  3H51 A;  3OX9 A;  3UJM A;  1M90 4;  1OF5 A;  2LQV A;  2BMQ B;  3M8C A;  5FGO A;  1ZO2 A;  3CCR 3;  4OVM A;  5DRV A;  1W6G A;  3NV0 A;  4HM2 B;  3PXM A;  1UI8 A;  1KC8 4;  1TFO A;  4XDW A;  4N6T A;  3FSD A;  1JB5 A;  1RJO A;  3UNL A;  5LC7 A;  2XFT A;  2JDI H;  1VQ4 3;  2HMJ B;  3KFQ C;  1SII A;  2W04 A;  5IF6 A;  3T8N A;  2CG0 A;  3G71 3;  4FR9 A;  3NUV A;  4FCZ A;  2I9W A;  1FGQ A;  3MKI A;  4FCM A;  4KZ1 A;  1NB5 I;  2W6J H;  3KII A;  3PCR A;  3NXJ A;  3T0U A;  3CC2 3;  1QAF A;  1D6U A;  1A2K A;  3NBJ A;  1JKG B;  3BLZ A;  3EF8 A;  1VQL 3;  4WWU C;  3D9R A;  3N9H A;  4QWT A;  1N5P A;  2E2V A;  2HMN B;  3FGY A;  1MNL A;  3S67 A;  5IW9 A;  3MHE A;  2ML6 A;  1S72 3;  5BXQ A;  3PZW A;  1O7H B;  3TDG A;  1JN5 A;  3CCQ 3;  2E2T A;  2F99 A;  3ER7 A;  1IU7 A;  3GZB A;  4XBT A;  1M1K 4;  5DRE A;  3JUN A;  2P05 A;  4XBX A;  3F14 A;  1OAC A;  4J9A A;  1C7H A;  3F9S A;  5KP3 A;  3V92 A;  2QEX 3;  1OHO A;  2XRX B;  4NHF A;  3HIG A;  3EX9 A;  1OCV A;  3K0Z A;  2P0M A;  2R4I A;  4HKV B;  7STD A;  1JJ2 2;  4GB5 A;  3CPW 2;  3CD6 3;  2BNG A;  3OV4 A;  3OWS A;  1DMN A;  2K0M A;  4HM7 B;  1OHP A;  1YVB I;  2OOV A;  3WA2 X;  3S27 A;  1IVU A;  2W0Q A;  3GWR A;  4I4K A;  1EKM A;  3HX8 A;  3KN4 A;  1N8Q A;  1O7W B;  1OHS A;  4LSO A;  2KCD A;  3SOY A;  4N3V A;  1ULJ B;  1WMO A;  1Q40 B;  3UB1 A;  1K73 4;  4OK0 A;  3DZL A;  1VQ7 3;  5IEO A;  1ULI B;  3LZA A;  2GEX A;  4LEH A;  1R4C A;  2QA4 3;  4ORL A;  3F40 A;  3GRD A;  3S29 A;  1EG9 B;  2A15 A;  3CXC 2;  3HK4 A;  4R4K A;  5D81 A;  5IG4 A;  1Q7Y 4;  3CCV 3;  4CDL A;  4FMB A;  2WOH A;  2ZL8 A;  4LGQ A;  4N6M A;  1LVN A;  2RFR A;  1W2Z A;  2OCT A;  4EV5 A;  4JRF A;  3NX0 A;  3CCJ 3;  4BTW A;  2XSO B;  3K7C A;  3WOD G;  3SX1 A;  3EBT A;  2SBL A;  3KSE D;  2CH9 A;  1QMA A;  4MMZ B;  2Y73 A;  1YJ9 3;  1O7G B;  3Q90 A;  1W7C A;  2WO0 A;  3CU3 A;  4HM4 B;  5AYR B;  3OWY A;  1W2B 2;  3FKA A;  1MOL A;  1Q82 4;  3X3Z A;  1IT7 A;  2OQE C;  1QVF 2;  3RGR A;  2CWV A;  4HJL B;  3JUP A;  1K8A 4;  1YHQ 3;  4U13 A;  1CYV A;  1JB2 A;  5EEO A;  3VSY A;  4HVN A;  3ECF A;  4KVH A;  1M1X B;  1VQP 3;  3G0K A;  3B7C A;  1UW1 A;  2E2U A;  4RNZ A;  2YFJ B;  3KZT A;  1YJN 3;  1HKX A;  1N9E A;  2FXT A;  3MPH A;  3FLJ A;  1NO3 A;  1IQX A;  1L5G B;  1JNQ A;  2CK3 H;  1WQL B;  1KD1 4;  1EA2 A;  4FMD A;  3WOF B;  2CWT A;  5D82 A;  3SLU A;  3T8U A;  4K61 A;  3LXU X;  2XEP A;  3F7S A;  3PYJ A;  3E99 A;  3QRD A;  4X2H A;  2CKF B;  2GU3 A;  2W9P A;  3FG1 A;  3JUO A;  1IVW A;  2MC8 A;  2IUJ A;  5KP4 A;  3MG2 A;  2ZDJ A;  1QJG A;  1KWI A;  2GBX B;  2W56 B;  3EN1 B;  3BND A;  4Q53 A;  3S28 A;  5D83 A;  2HMO B;  1JKG A;  2ML5 A;  1WTH A;  2CHC A;  3B8L A;  1JV2 B;  3FCS B;  3LTD A;  4HYZ A;  4R1K A;  4EC6 A;  4MMX B;  1RRH A;  4TX4 A;  2IMJ A;  3NBB A;  3VGN A;  4O2H A;  3KE7 A;  1D6Y A;  2Y74 A;  4WYK B;  2RCD A;  4K1V A;  2OWP A;  1O7N B;  3K63 A;  1BUQ A;  3X42 A;  3U97 A;  1OH0 A;  2GXF A;  1ISK A;  2XF3 A;  3F7X A;  2KXG A;  2XSH B;  4PEJ A;  3CC7 3;  5AIF A;  2QGU A;  1WNH A;  4STD A;  1RRL A;  1NWW A;  1UI7 A;  2QIY A;  2CWU A;  3I55 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...