1S5AA

Crystal structure of putative isomerase from bacillus subtilis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
139
structure length
139
Chain Sequence
MNEFEKACETLRKFMAYMLEKDMKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPTVYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDGRIVRYRDYWNPLVVKEAFGGSFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yesE
publication title The Crystal Structure of APC1116 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 42
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1s5aA00
3OXAA 3JUMA 1BUQA 3Q90A 2JQ5A 5IENA 4MJDA 1QJGA 4FCMA 1GS3A 3FH1A 3KKGA 3ER7A 3GZYB 1ASKA 1HKXA 3K0ZA 3I0YA 4GB5A 3MG3A 3FSDA 3B4PA 4U13A 3E99A 3H3HA 4LMIA 2UX0A 3NV0A 1JB2A 1W01A 4IIAA 3FZWA 1ZO2A 3BB9A 3T8NA 3OV4A 2STDA 5AEUB 2GEYA 3EX9A 4Q53A 3MHEA 2XR8B 5JPUA 4LGQA 2HMNB 3G16A 2A15A 5KP4A 2CHCA 1DMQA 1JN5B 3CPOA 3A76A 3B7CA 2HMOB 3ROBA 4HM0B 3VSYA 1A2KA 2QGUA 1VZZA 3NXJA 1W6YA 4HM1B 4HM3B 5HGRA 3JUQA 5KP3A 2XSHB 4XDWA 2BMOB 3F9SA 3KSPA 3SOAA 2XRXB 3DMCA 3MKIA 2F99A 2IMJA 2INXA 4HM2B 4N3VA 1GY7A 5D81A 4I4KA 1C7HA 8CHOA 1ULJB 4R9KA 1O7WB 5IG0A 1TUHA 2XSOB 5AIHA 1JN5A 3DZLA 1JB5A 1O7NB 3GZBA 1GYBA 1JB4A 5IG4A 5STDA 5G2GA 1OGZA 1UUWB 3LYGA 1EA2A 4KVHA 1OPYA 5IG5A 2BMRB 3EF8A 2HMKB 2BNGA 1OF5B 4WYKB 1E3VA 4H3UA 4OVMA 2GXFA 2R4IA 1OHOA 3F8HA 4HVNA 3MYTA 4HM5B 1E3RA 4LEHA 1WQLB 2YFIB 5IF6A 3HZPA 3GZXB 4HZBB 5AIIA 5AIGA 2HMLB 3F7SA 2Z76A 3SEDA 1ZX2A 4STDA 3VGNA 5JPPA 3EQQB 3F8XA 3F14A 3B8LA 3CNXA 3ECFA 1TP6A 5AEWB 1JKGB 4L7KA 5CLKA 1OF5A 2GEXA 2RGQA 3HX8A 4WYKA 4CDLA 3M8CA 2B1XB 3NHXA 3EHCA 3EN8A 3OWYA 3H51A 1GY6A 5BVBA 1IDPA 2Z7AA 1OUNA 5IEOA 4ORLA 3STDA 3FLJA 3HK4A 1S5AA 1O7HB 3NUVA 5CF1A 1UUVB 3RGRA 3DM8A 4OUQA 1O7GB 4XBTA 2CKFB 1NWWA 5TGNA 2OWPA 3DXOA 2YFJB 4HM4B 3FKAA 5D82A 5EVHA 4XBXA 1DMNA 1E97A 1OCVA 3GRDA 1Q42A 3CU3A 3GZRA 5DRVA 5FW5A 1O7MB 3EBYA 1ULIB 1EG9B 3G8ZA 5IERA 3JUPA 3S5CA 5CK6A 1AR0A 2QIYA 4XM4A 3UJMA 3JUOA 2B24B 5BXQA 2GBXB 4L8OA 2F98A 3EC9A 1K41A 1OHSA 4RZMA 1OHPA 3KE7A 5CXOA 4HZ9B 3CNMA 3OWUA 4HKVB 3EJVA 2RFRA 4R9LA 2PZVA 3IPTA 1QMAA 4J9AA 5CF2A 3LZAA 3F40A 7STDA 1SJWA 3F7XA 4R1KA 2GBWB 5AI1A 3GWRA 1NDOB 1OGXA 4K1VA 3MG1A 4WP5A 3G0KA 1CQSA 3NBRA 4PEJA 4L8PA 3RGAA 1GY5A 1STDA 1OH0A 3OWSA 3K7CA 1DMMA 1Q40B 2YFLB 2F86B 3FGYA 4XDVA 3B4OA 2W2CA 1Z1SA 2I9WA 4X2HA 3D9RA 4WWUC 1NU3A 4FCJA 4XB5A 4HM6B 1JKGA 5IG3A 5D83A 3WMDA 2HMJB 3NM2A 4K1UA 3FF2A 3MG2A 3BLZA 5IEPA 1ISKA 1O7PB 3EBTA 1Q40A 4XBYA 4HJLB 3NV0B 6STDA 4J8TA 3OX9A 3SOYA 1U5OA 2K54A 4HM7B 3MSOA 3FF0A 5DREA 5KP1A 2HMMB 2RCDA 4HM8B 3EN1B 3UNLA 2Z77A 3DUKA 3JUNA 2BMQB 1W00A 1W02A 3KZTA 3T8UA 4X2OA 5AIFA
chains in the Genus database with same CATH superfamily
1VQP3 2HOHA 3OXAA 3JUMA 1BRNL 1BUQA 4NREA 3Q90A 1VQ53 2JQ5A 5IENA 4MJDA 4KZ1A 1M1K4 1UGHI 1QJGA 1BIRA 4FCMA 3SLUA 1RTUA 1GS3A 3FH1A 3KKGA 3ER7A 1PYLA 3GZYB 3G4S3 1ASKA 1HKXA 3K0ZA 2CG1A 3I0YA 2QEX3 3MWZA 1U8CB 4GB5A 3MG3A 3D5IA 3FSDA 3B4PA 1GD4A 1YI23 4U13A 1Q814 4G1MB 1K734 1I2FA 4O02B 3E99A 3H3HA 4LMIA 4DKIA 2FGTA 3LT8A 1RGHA 2UX0A 1LRAA 3NV0A 1LNHA 1JB2A 1W01A 3CCJ3 4IIAA 3DY5A 1D6ZA 3FZWA 3V92A 3K63A 1IVUA 1ZO2A 2WO0A 3BB9A 2C10A 3T8NA 3OV4A 4BTWA 2STDA 4BTYA 3V99A 1SIIA 3KFQC 4J5KA 5AEUB 2GEYA 3EX9A 4Q53A 3NBJA 3MHEA 2XR8B 5M1AA 1MWTA 4LGQA 4N6OB 5JPUA 1L5GB 2OQEA 2RNTA 3RNTA 2HMNB 1Q864 1SIHA 2IY2A 1VQO3 3CCS3 3LTBA 1US1A 3G16A 4N6TA 1JBRA 1DVDA 4N6MA 3LTDA 5ELUA 3CCL3 1W6GA 2CH9A 6GSPA 5I97A 3KSED 1IQYA 3J7Yd 1SPUA 1A2VA 1UDII 2A15A 5KP4A 1JJ22 2CK3H 1EQKA 2CHCA 3EE1A 2F56A 1JRQA 1DMQA 1JN5B 3CPOA 2AAEA 3A76A 3B7CA 1AY7A 1G0TA 2CC3A 2CX1A 2HMOB 3ROBA 3I563 4HM0B 1N8QA 1A2KA 3VSYA 1FW7A 1V74A 2QGUA 1BANA 1VZZA 2C4BA 3NXJA 4BL3A 4KFFA 3CD63 1YVBI 2KRTA 4AEQA 1NB5I 1W6YA 4HM1B 1RGLA 4HM3B 5HGRA 1BRJA 1YVSA 1VQ43 1BNGA 3JUQA 5KP3A 3PYJA 3LT9A 3HIGA 2XSHB 1VQN3 4XDWA 3K9MC 1B2ZA 2BMOB 1ROAA 3F9SA 1R4YA 3KSPA 3BNEA 1GMPA 1T2IA 1AV4A 1UCIA 2IYJA 1W4NA 4N6LA 4R80A 3SOAA 2WOFA 3SXXA 1PU4A 2XRXB 3DMCA 1A90A 1IVWA 1K28A 1RSNA 3JVCA 1WMOA 4CCVA 3MKIA 1RGFA 3N8BA 1B27A 2F99A 2CW9A 4GSPA 4HAAA 2IMJA 2INXA 2Y73A 4HM2B 2KF6A 2W9PA 1UI8A 4N3VA 4TX4A 1GY7A 3WR2A 2WGOA 3LMLA 4HBRA 5D81A 1GMQA 1BNRA 4I4KA 3CC43 1C7HA 3IJEB 8CHOA 1FUTA 2BU4A 1RN4A 1TIJA 2P05A 1ULJB 4R9KA 1YIT3 3CC73 1ZS7A 3FCSB 3KCHA 1O7WB 5HOHA 2KF4A 3I553 2PNCA 5IG0A 3A5EA 1TUHA 2XSOB 5AIHA 1YJW3 1JN5A 1BSCA 3DH2A 1HU9A 1DYUA 2F4YA 3DZLA 3LXUX 1JB5A 3BNDA 1O7NB 2CFDA 3GZBA 3ZG5A 3CC23 1GYBA 3CCR3 4LZIA 1JB4A 3ZG0A 5IG4A 5STDA 4I5QA 1MOLA 4KFDA 3CMA3 2Z6BA 2W04A 5G2GA 1KD14 2CWVA 2P38A 3D5GA 2XFSA 1OGZA 1JBSA 1UUWB 3LYGA 1EA2A 4KVHA 3MPHA 4JRFA 2ZA4A 1OPYA 5AYSC 5IG5A 2CFWA 2P0XA 2BMRB 3EF8A 1RNTA 2W9QA 2F5WA 3WDGB 2HMKB 1VQ93 1X1YA 1QVF2 2QA43 1BRSA 1QAKA 4EV2A 4KFEA 1IYYA 1D6YA 2BNGA 5G1LA 3TDGA 1OF5B 3NQYA 4WYKB 2J8XB 1E3VA 3N54B 4H3UA 5ELJA 4OVMA 1GOVA 2CG0A 2GXFA 2R4IA 1OHOA 3F8HA 4HVNA 2YX9A 2AADA 1T2HA 1EKMA 1IQXA 3MYTA 4HM5B 2XH9A 1E3RA 2E2VA 4LEHA 1FGQA 4FCZA 2Q07A 1M9GA 3AMOB 1WQLB 2YFIB 5IF6A 3HZPA 1N8R4 1ZGXA 3NQZA 1Y4KA 2E2UA 3GZXB 4RNTA 4JF8A 1PY3A 4HZBB 5AIIA 5AIGA 1KSIA 1MGWA 2HMLB 3F7SA 3RDEA 2KF5A 3WHOA 1GOUA 1BGSA 1YIJ3 4RBNA 2Z76A 2E2TA 2P0MA 3KN4A 1YJ93 3SEDA 2ZL8A 1ZX2A 1T3BA 4GL6A 4STDA 3VGNA 4NHFA 1UCJA 5JPPA 3EQQB 3CCU3 1UW1A 1K9M4 1F8NA 1FGRA 1BSAA 1WNHA 3F8XA 3F14A 2H0IA 1AVLA 3B8LA 3CNXA 1RCLA 3ECFA 3DGMA 1QALA 4WFOA 3V98A 1TP6A 2GU1A 1RGKA 1JKGB 1GD3A 3IMAB 3QRDA 1AQZA 4L7KA 5AEWB 4O3VA 3G713 1VQ83 1BUJA 5CLKA 1OF5A 1FGMA 2GEXA 2RGQA 3HX8A 4J5GA 4WYKA 4CDLA 3M8CA 2K0MA 2B1XB 1RGGA 3NHXA 2RSXA 2WGQA 3SYUA 3EHCA 3EN8A 3OWYA 1YJN3 3H51A 2CWTA 4QWTA 1G02A 1VQ73 2IUKA 1TFKA 1RGEA 1YNVX 1GY6A 2ML6A 3Q1CA 1BRIA 1W2ZA 3GAXA 1X1WA 4HOHA 3ALAA 5BVBA 4MMXB 1IDPA 1DETA 2M7OA 3Q3FA 3D3LA 2C11A 3URPA 1B3SA 1OUNA 2Z7AA 2D1WA 1KQS2 1STFI 4KT3B 1BNFA 5G1KA 5IEOA 2KF3A 1KC84 3DGYA 3K5TA 4ORLA 3GSPA 1WMNA 3STDA 3WA2X 1OACA 3FLJA 3PS8A 2CFLA 1V57A 4H61A 3HK4A 1DVCA 3X41A 1M904 1SARA 2OTJ3 3LTCA 1G96A 1O7HB 1S5AA 3NUVA 5CF1A 1UUVB 2F5MA 5GSPA 3RGRA 3SX1A 3DM8A 3EB8A 1LQMB 4OUQA 1O7GB 1CYVA 4XBTA 4IPBA 2CKFB 1NWWA 1I3FA 1M1XB 4GHOA 3X3YA 1FGOA 3N9HA 5TGNA 3UB1A 2OWPA 2V1LA 1RJOA 3X40A 1TU5A 1BSBA 1K8A4 2W0QA 1NB3I 1RHLA 2BT3A 2YFJB 3DXOA 3FKAA 1UUGB 1WTHA 4HM4B 5D82A 3CCM3 5EVHA 1RMSA 3T0UA 1LXEA 4EYCA 3AHSA 1W6CA 4XBXA 5FGOA 1DMNA 5LC6A 1E97A 4K90B 1NNVA 3PZWA 3CCQ3 1OCVA 3GRDA 3WODG 1D6UA 3HOHA 1Q42A 1V58A 1VQQA 1JZDA 4N6UA 2H0HA 4N6NB 4IT7A 4NPBA 5BU4A 3CU3A 3GZRA 5DRVA 4EW5A 1J2BA 4FMBA 2L4VA 3U97A 1BVIA 5FW5A 1I2GA 3CPW2 1EEJA 1FYSA 1O7MB 1QAFA 3EBYA 2W03A 1ULIB 1EG9B 2XFTA 1Q7HA 3CME3 7GSPA 1Q824 1UCKA 3G8ZA 1TTOA 1PFPA 1RGAA 1W5ZA 5IERA 3BU4A 3JUPA 1I70A 1R4CA 3S5CA 3OW22 1BU4A 2ZDJA 5AYRB 1QVG2 5CK6A 2OTL3 4ILFA 3DGNA 2LYXA 1JNQA 3S67A 1AR0A 2QIYA 1I2EA 4XM4A 1CEWI 3UJMA 3JUOA 2B24B 4BIRA 5BXQA 2GBXB 4L8OA 1BSDA 2F98A 1BAOA 3EC9A 2JDIH 3DGOA 1K41A 3NM7A 1OHSA 2RBIA 4MMYB 9RNTA 3QK9A 4EV5A 4RZMA 1OHPA 1RLSA 3KE7A 1B21A 5CXOA 4AKYA 1MWUA 1I3IA 2OCTA 2OOVC 4HZ9B 1IK3A 1HZ1A 1LNIA 2K3DA 5BIRA 2XF3A 3CNMA 2O9UX 3OWUA 4HKVB 2CIUA 3EJVA 2RFRA 4FMAA 5IW9A 3PCSA 2L1SA 2P09A 4R9LA 2PZVA 3IPTA 1BNJA 1QMAA 1TJDA 2SARA 4J9AA 5CF2A 3LZAA 3F40A 2CFGA 2H0GA 1MGRA 3PCRA 7STDA 1SJWA 3F7XA 3LTAA 2ML5A 4R1KA 1FZUA 1CYUA 2GBWB 5AI1A 3WOEB 1VQ63 3GWRA 1BNIA 1I8VA 1KWIA 3LOYA 1FUWA 1NDOB 1OGXA 3S28A 4K1VA 3X3XA 3HI7A 1N5HA 3MG1A 4MMZB 3BIRA 3Q2PA 4MEIA 4WP5A 2MF7A 3G0KA 2OOVA 4AKZA 1LOYA 1CQSA 1FGTA 2CX0A 5EEOA 2MC8A 4EBGA 1TRPA 3NBRA 1AVKA 3AGNA 4EXRA 3WOFB 7RNTA 1Q9EA 3SVAA 4PEJA 4L8PA 3WA3A 3NX0A 1S723 3RGAA 1IV9A 1IVXA 1W7CA 3D79A 1GY5A 1B2MA 1STDA 1N9EA 1UCLA 2CWUA 1OH0A 1IQ8A 2UGIA 1FA3A 1B2SA 1NO3A 3G6E3 3ZFZA 2KCDA 3L0RA 3OWSA 3X3ZA 1TFOA 3BNBA 3K7CA 3AMOA 1IT8A 1JV2B 1BRKA 1C54A 8RNTA 2W6JH 3AGOA 4OK0A 2XEPA 2KAAA 1DMMA 1A67A 1Q40B 1IT7A 2YFLB 1RN7A 2W56B 2F86B 1BNEA 3FGYA 5A0OB 4BTXA 1W2B2 4BL2A 1I0XA 2UUGC 5RNTA 4XDVA 2BIRA 3B4OA 3O8YA 1IVVA 2W2CA 1MWSA 1YGWA 1B2UA 4N6V0 4EC6A 1A2PA 1Z1SA 2I9WA 2CFKA 4X2HA 2FNQA 1GOYA 2XGLA 1BOXA 4FR9A 3D9RA 3U1WA 3D4AA 1RN1A 4WWUC 4FMDA 1B2XA 2BO9B 2XGNA 1YHQ3 1DE3A 1NU3A 4FCJA 1JZOA 4XB5A 1FUSA 4HYZA 2Y74A 4CJNA 1BNSA 2FXTA 1GMRA 4RNYA 4HM6B 2KXGA 3UL6A 3CCV3 1JKGA 5IG3A 5D83A 1LOXA 1RCKA 3WMDA 3X42A 2HMJB 1BRHA 3NM2A 4K1UA 1RGCA 1X1XA 3FF2A 1RKYA 4CPKA 4ZM8A 3HIIA 3S27A 3FG3A 3MG2A 1B20A 1IU7A 1I0VA 1RDSA 1CH0A 3FG4A 1VQM3 1SQWA 1RNBA 3BLZA 1NJI4 3FG1A 3CXC2 1Q7Y4 1N9JA 6RNTA 4WHAA 5IEPA 1VQL3 1ISKA 1VQK3 1X1UA 2ZHXB 1O7PB 1TRQA 3EBTA 4FMCA 1BRGA 4RNZA 1Q40A 5JBSA 3AHWA 4XBYA 2OQEC 2W56A 4HJLB 3NV0B 6STDA 3DGLA 1T5YA 5M19A 1LVNA 4J8TA 3OX9A 1GSPA 1BSEA 2SBLA 4K61A 2IUJA 1HYFA 3PGBA 1U5OA 2K54A 4R4KA 3SOYA 1WMPA 1YGEA 1RRHA 5LC7A 3KIIA 4HM7B 3MSOA 1LOWA 1LQGC 2IA7A 2O3OA 3VF1A 2GU3A 3FF0A 1EUIC 1N5PA 5DREA 2GSPA 2WOHA 1MNLA 3BNCA 1MWRA 2HMMB 4O8SA 2RCDA 4BU4A 5KP1A 4HM8B 3EN1B 1UI7A 5M18A 3UNLA 2Z77A 3NBBA 1IV7A 3PXMA 5EQLA 3S29A 2D42A 3DUKA 4LYLB 3JUNA 2BMQB 1W00A 3CCE3 1LOVA 1ROVA 2LQVA 1UGIA 1W02A 1JBTA 4LSOA 4O2HA 3UL5A 2R41A 1RRLA 3KZTA 3LH4A 3T8UA 4X2OA 5AIFA 2BHMA
chains in the Genus database with same CATH topology
1VQP3 3OXAA 3JUMA 1BUQA 4NREA 3Q90A 1VQ53 2JQ5A 5IENA 4MJDA 4KZ1A 1M1K4 3SLUA 1QJGA 4FCMA 1GS3A 3FH1A 3KKGA 3ER7A 3G4S3 3GZYB 1ASKA 1HKXA 3K0ZA 2CG1A 3I0YA 2QEX3 3MWZA 1U8CB 4GB5A 3MG3A 3FSDA 1YI23 3B4PA 1GD4A 1Q814 4U13A 4G1MB 1K734 4O02B 3E99A 3H3HA 4LMIA 2FGTA 3LT8A 2UX0A 3NV0A 1LNHA 1JB2A 1W01A 3CCJ3 4IIAA 3DY5A 1D6ZA 3FZWA 3V92A 3K63A 1IVUA 1ZO2A 2WO0A 3BB9A 2C10A 3T8NA 3OV4A 4BTWA 2STDA 4BTYA 3V99A 1SIIA 3KFQC 5AEUB 2GEYA 3EX9A 4Q53A 3NBJA 3MHEA 2XR8B 5JPUA 4N6OB 4LGQA 1L5GB 2OQEA 2HMNB 1Q864 1SIHA 1VQO3 3CCS3 3LTBA 1US1A 3G16A 4N6TA 1DVDA 4N6MA 3LTDA 5ELUA 3CCL3 1W6GA 2CH9A 5I97A 3KSED 1IQYA 3J7Yd 1SPUA 1A2VA 2A15A 5KP4A 1JJ22 2CK3H 1EQKA 2CHCA 3EE1A 1JRQA 1DMQA 1JN5B 3CPOA 3A76A 3B7CA 2CC3A 2HMOB 3ROBA 3I563 4HM0B 1N8QA 1A2KA 3VSYA 1V74A 2QGUA 1VZZA 3NXJA 4KFFA 3CD63 1YVBI 2KRTA 4AEQA 1NB5I 1W6YA 4HM1B 4HM3B 5HGRA 1VQ43 3JUQA 5KP3A 3PYJA 3LT9A 3HIGA 2XSHB 1VQN3 4XDWA 3K9MC 2BMOB 1ROAA 3F9SA 3KSPA 3BNEA 1AV4A 4N6LA 1W4NA 4R80A 3SXXA 3SOAA 2WOFA 1PU4A 2XRXB 3DMCA 1A90A 1IVWA 1K28A 3JVCA 1WMOA 4CCVA 3MKIA 3N8BA 2F99A 2CW9A 2IMJA 2INXA 2Y73A 4HM2B 2W9PA 1UI8A 4N3VA 4TX4A 1GY7A 2WGOA 3LMLA 4HBRA 5D81A 4I4KA 3CC43 1C7HA 3IJEB 8CHOA 1TIJA 2P05A 1ULJB 4R9KA 1YIT3 3CC73 3FCSB 1O7WB 3I553 2PNCA 5IG0A 1TUHA 2XSOB 5AIHA 1YJW3 1JN5A 1HU9A 1DYUA 3DZLA 3LXUX 1JB5A 3BNDA 1O7NB 2CFDA 3GZBA 3CC23 1GYBA 3CCR3 4LZIA 1JB4A 5IG4A 5STDA 1MOLA 4KFDA 3CMA3 2Z6BA 2W04A 5G2GA 1KD14 2CWVA 2P38A 2XFSA 1OGZA 1UUWB 3LYGA 1EA2A 4KVHA 3MPHA 4JRFA 1OPYA 5AYSC 5IG5A 2CFWA 2P0XA 2BMRB 3EF8A 2W9QA 3WDGB 2HMKB 1VQ93 1QVF2 2QA43 1QAKA 4EV2A 4KFEA 1D6YA 2BNGA 3TDGA 1OF5B 3NQYA 4WYKB 1E3VA 3N54B 4H3UA 5ELJA 4OVMA 2CG0A 2GXFA 2R4IA 1OHOA 3F8HA 4HVNA 2YX9A 1EKMA 1IQXA 3MYTA 4HM5B 2XH9A 1E3RA 2E2VA 4LEHA 1FGQA 4FCZA 2Q07A 1M9GA 3AMOB 1WQLB 2YFIB 5IF6A 3HZPA 1N8R4 3NQZA 1Y4KA 2E2UA 3GZXB 4JF8A 4HZBB 5AIIA 5AIGA 1KSIA 2HMLB 3F7SA 3RDEA 1YIJ3 4RBNA 2Z76A 2E2TA 2P0MA 3KN4A 1YJ93 3SEDA 2ZL8A 1ZX2A 4GL6A 4STDA 3VGNA 4NHFA 5JPPA 3EQQB 3CCU3 1UW1A 1K9M4 1F8NA 1FGRA 1WNHA 3F8XA 3F14A 1AVLA 3B8LA 3CNXA 3ECFA 3DGMA 1QALA 4WFOA 3V98A 1TP6A 2GU1A 3IMAB 1GD3A 1JKGB 4L7KA 3QRDA 5AEWB 3G713 4O3VA 1VQ83 5CLKA 1OF5A 1FGMA 2GEXA 2RGQA 3HX8A 4WYKA 4CDLA 3M8CA 2K0MA 2B1XB 3NHXA 2RSXA 2WGQA 3EHCA 3EN8A 3OWYA 1YJN3 3H51A 2CWTA 4QWTA 1VQ73 2IUKA 1TFKA 2ML6A 1GY6A 3Q1CA 1W2ZA 3GAXA 5BVBA 3ALAA 4MMXB 1IDPA 2M7OA 3D3LA 2C11A 1KQS2 2Z7AA 1OUNA 2D1WA 1STFI 5IEOA 1KC84 3K5TA 4ORLA 1WMNA 3STDA 3WA2X 1OACA 3FLJA 3PS8A 2CFLA 4H61A 3HK4A 1DVCA 3X41A 1M904 2OTJ3 3LTCA 1G96A 1O7HB 1S5AA 3NUVA 5CF1A 1UUVB 3RGRA 3SX1A 3DM8A 3EB8A 4OUQA 1O7GB 1CYVA 4XBTA 4IPBA 2CKFB 1NWWA 1M1XB 3X3YA 1FGOA 3N9HA 5TGNA 3UB1A 2OWPA 2V1LA 1RJOA 3X40A 1TU5A 1K8A4 2W0QA 1NB3I 2BT3A 2YFJB 3DXOA 3FKAA 4HM4B 1WTHA 5D82A 3CCM3 5EVHA 3T0UA 1LXEA 4EYCA 1W6CA 4XBXA 5FGOA 1DMNA 5LC6A 1E97A 4K90B 3PZWA 3CCQ3 1OCVA 3GRDA 3WODG 1D6UA 1Q42A 4N6UA 4N6NB 4IT7A 3CU3A 3GZRA 5DRVA 1J2BA 4FMBA 2L4VA 3U97A 5FW5A 3CPW2 1O7MB 1QAFA 3EBYA 2W03A 1ULIB 1EG9B 2XFTA 3CME3 1Q824 3G8ZA 1PFPA 1W5ZA 5IERA 3JUPA 3S5CA 1R4CA 3OW22 1QVG2 2OTL3 2ZDJA 5AYRB 5CK6A 3DGNA 2LYXA 1JNQA 3S67A 1AR0A 2QIYA 4XM4A 1CEWI 3UJMA 3JUOA 2B24B 5BXQA 2GBXB 4L8OA 2F98A 3EC9A 2JDIH 3DGOA 1K41A 3NM7A 1OHSA 4MMYB 3QK9A 4EV5A 4RZMA 1OHPA 3KE7A 5CXOA 4AKYA 2OOVC 2OCTA 1IK3A 4HZ9B 2XF3A 3CNMA 2O9UX 3OWUA 4HKVB 2CIUA 3EJVA 2RFRA 4FMAA 5IW9A 3PCSA 2P09A 4R9LA 2PZVA 3IPTA 1QMAA 4J9AA 5CF2A 3LZAA 3F40A 2CFGA 3PCRA 7STDA 1SJWA 3F7XA 3LTAA 2ML5A 4R1KA 1CYUA 2GBWB 5AI1A 3WOEB 1VQ63 3GWRA 1KWIA 3LOYA 1FUWA 1NDOB 1OGXA 3S28A 4K1VA 3X3XA 3HI7A 1N5HA 3MG1A 4MMZB 3Q2PA 4MEIA 4WP5A 2MF7A 3G0KA 2OOVA 4AKZA 5EEOA 1CQSA 1FGTA 2MC8A 4EBGA 3NBRA 1AVKA 4EXRA 3WOFB 3SVAA 4PEJA 4L8PA 3WA3A 3NX0A 1S723 3RGAA 1IV9A 1IVXA 1W7CA 1GY5A 1STDA 1N9EA 2CWUA 1OH0A 1IQ8A 1FA3A 1NO3A 3G6E3 2KCDA 3L0RA 3OWSA 3X3ZA 1TFOA 3BNBA 3K7CA 3AMOA 1IT8A 1JV2B 2W6JH 4OK0A 2XEPA 1DMMA 1A67A 1Q40B 1IT7A 2YFLB 1RN7A 2W56B 2F86B 3FGYA 5A0OB 4BTXA 1W2B2 4XDVA 3B4OA 3O8YA 1IVVA 2W2CA 4N6V0 4EC6A 1Z1SA 2I9WA 2CFKA 4X2HA 2FNQA 2XGLA 4FR9A 3D9RA 3U1WA 4WWUC 4FMDA 2BO9B 2XGNA 1YHQ3 1NU3A 4FCJA 4XB5A 4HYZA 2Y74A 2FXTA 4RNYA 4HM6B 2KXGA 3UL6A 3CCV3 1JKGA 5IG3A 5D83A 1LOXA 3WMDA 3X42A 2HMJB 3NM2A 4K1UA 3FF2A 1RKYA 4ZM8A 3HIIA 3S27A 3FG3A 3MG2A 1IU7A 3FG4A 1VQM3 1SQWA 3BLZA 1NJI4 3FG1A 3CXC2 1Q7Y4 1N9JA 4WHAA 5IEPA 1VQL3 1ISKA 1VQK3 4FMCA 1O7PB 4RNZA 3EBTA 5JBSA 1Q40A 4XBYA 2OQEC 2W56A 4HJLB 3NV0B 6STDA 3DGLA 1T5YA 1LVNA 4J8TA 3OX9A 2SBLA 4K61A 2IUJA 3PGBA 3SOYA 1U5OA 2K54A 4R4KA 1WMPA 1YGEA 1RRHA 5LC7A 3KIIA 4HM7B 3MSOA 2O3OA 2IA7A 3VF1A 2GU3A 3FF0A 1N5PA 5DREA 2WOHA 1MNLA 3BNCA 2HMMB 4O8SA 5KP1A 2RCDA 4HM8B 3EN1B 1UI7A 3UNLA 2Z77A 3NBBA 1IV7A 3PXMA 5EQLA 3S29A 2D42A 3DUKA 3JUNA 2BMQB 1W00A 3CCE3 1ROVA 2LQVA 1W02A 4LSOA 4O2HA 3UL5A 1RRLA 3KZTA 3LH4A 3T8UA 4X2OA 5AIFA 2BHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXA A;  3JUM A;  1BUQ A;  3Q90 A;  2JQ5 A;  5IEN A;  4MJD A;  1QJG A;  4FCM A;  1GS3 A;  3FH1 A;  3KKG A;  3ER7 A;  3GZY B;  1ASK A;  1HKX A;  3K0Z A;  3I0Y A;  4GB5 A;  3MG3 A;  3FSD A;  3B4P A;  4U13 A;  3E99 A;  3H3H A;  4LMI A;  2UX0 A;  3NV0 A;  1JB2 A;  1W01 A;  4IIA A;  3FZW A;  1ZO2 A;  3BB9 A;  3T8N A;  3OV4 A;  2STD A;  5AEU B;  2GEY A;  3EX9 A;  4Q53 A;  3MHE A;  2XR8 B;  5JPU A;  4LGQ A;  2HMN B;  3G16 A;  2A15 A;  5KP4 A;  2CHC A;  1DMQ A;  1JN5 B;  3CPO A;  3A76 A;  3B7C A;  2HMO B;  3ROB A;  4HM0 B;  3VSY A;  1A2K A;  2QGU A;  1VZZ A;  3NXJ A;  1W6Y A;  4HM1 B;  4HM3 B;  5HGR A;  3JUQ A;  5KP3 A;  2XSH B;  4XDW A;  2BMO B;  3F9S A;  3KSP A;  3SOA A;  2XRX B;  3DMC A;  3MKI A;  2F99 A;  2IMJ A;  2INX A;  4HM2 B;  4N3V A;  1GY7 A;  5D81 A;  4I4K A;  1C7H A;  8CHO A;  1ULJ B;  4R9K A;  1O7W B;  5IG0 A;  1TUH A;  2XSO B;  5AIH A;  1JN5 A;  3DZL A;  1JB5 A;  1O7N B;  3GZB A;  1GYB A;  1JB4 A;  5IG4 A;  5STD A;  5G2G A;  1OGZ A;  1UUW B;  3LYG A;  1EA2 A;  4KVH A;  1OPY A;  5IG5 A;  2BMR B;  3EF8 A;  2HMK B;  2BNG A;  1OF5 B;  4WYK B;  1E3V A;  4H3U A;  4OVM A;  2GXF A;  2R4I A;  1OHO A;  3F8H A;  4HVN A;  3MYT A;  4HM5 B;  1E3R A;  4LEH A;  1WQL B;  2YFI B;  5IF6 A;  3HZP A;  3GZX B;  4HZB B;  5AII A;  5AIG A;  2HML B;  3F7S A;  2Z76 A;  3SED A;  1ZX2 A;  4STD A;  3VGN A;  5JPP A;  3EQQ B;  3F8X A;  3F14 A;  3B8L A;  3CNX A;  3ECF A;  1TP6 A;  5AEW B;  1JKG B;  4L7K A;  5CLK A;  1OF5 A;  2GEX A;  2RGQ A;  3HX8 A;  4WYK A;  4CDL A;  3M8C A;  2B1X B;  3NHX A;  3EHC A;  3EN8 A;  3OWY A;  3H51 A;  1GY6 A;  5BVB A;  1IDP A;  2Z7A A;  1OUN A;  5IEO A;  4ORL A;  3STD A;  3FLJ A;  3HK4 A;  1S5A A;  1O7H B;  3NUV A;  5CF1 A;  1UUV B;  3RGR A;  3DM8 A;  4OUQ A;  1O7G B;  4XBT A;  2CKF B;  1NWW A;  5TGN A;  2OWP A;  3DXO A;  2YFJ B;  4HM4 B;  3FKA A;  5D82 A;  5EVH A;  4XBX A;  1DMN A;  1E97 A;  1OCV A;  3GRD A;  1Q42 A;  3CU3 A;  3GZR A;  5DRV A;  5FW5 A;  1O7M B;  3EBY A;  1ULI B;  1EG9 B;  3G8Z A;  5IER A;  3JUP A;  3S5C A;  5CK6 A;  1AR0 A;  2QIY A;  4XM4 A;  3UJM A;  3JUO A;  2B24 B;  5BXQ A;  2GBX B;  4L8O A;  2F98 A;  3EC9 A;  1K41 A;  1OHS A;  4RZM A;  1OHP A;  3KE7 A;  5CXO A;  4HZ9 B;  3CNM A;  3OWU A;  4HKV B;  3EJV A;  2RFR A;  4R9L A;  2PZV A;  3IPT A;  1QMA A;  4J9A A;  5CF2 A;  3LZA A;  3F40 A;  7STD A;  1SJW A;  3F7X A;  4R1K A;  2GBW B;  5AI1 A;  3GWR A;  1NDO B;  1OGX A;  4K1V A;  3MG1 A;  4WP5 A;  3G0K A;  1CQS A;  3NBR A;  4PEJ A;  4L8P A;  3RGA A;  1GY5 A;  1STD A;  1OH0 A;  3OWS A;  3K7C A;  1DMM A;  1Q40 B;  2YFL B;  2F86 B;  3FGY A;  4XDV A;  3B4O A;  2W2C A;  1Z1S A;  2I9W A;  4X2H A;  3D9R A;  4WWU C;  1NU3 A;  4FCJ A;  4XB5 A;  4HM6 B;  1JKG A;  5IG3 A;  5D83 A;  3WMD A;  2HMJ B;  3NM2 A;  4K1U A;  3FF2 A;  3MG2 A;  3BLZ A;  5IEP A;  1ISK A;  1O7P B;  3EBT A;  1Q40 A;  4XBY A;  4HJL B;  3NV0 B;  6STD A;  4J8T A;  3OX9 A;  3SOY A;  1U5O A;  2K54 A;  4HM7 B;  3MSO A;  3FF0 A;  5DRE A;  5KP1 A;  2HMM B;  2RCD A;  4HM8 B;  3EN1 B;  3UNL A;  2Z77 A;  3DUK A;  3JUN A;  2BMQ B;  1W00 A;  1W02 A;  3KZT A;  3T8U A;  4X2O A;  5AIF A; 
#chains in the Genus database with same CATH topology
 1VQP 3;  2HOH A;  3OXA A;  3JUM A;  1BRN L;  1BUQ A;  4NRE A;  3Q90 A;  1VQ5 3;  2JQ5 A;  5IEN A;  4MJD A;  4KZ1 A;  1M1K 4;  1UGH I;  1QJG A;  1BIR A;  4FCM A;  3SLU A;  1RTU A;  1GS3 A;  3FH1 A;  3KKG A;  3ER7 A;  1PYL A;  3GZY B;  3G4S 3;  1ASK A;  1HKX A;  3K0Z A;  2CG1 A;  3I0Y A;  2QEX 3;  3MWZ A;  1U8C B;  4GB5 A;  3MG3 A;  3D5I A;  3FSD A;  3B4P A;  1GD4 A;  1YI2 3;  4U13 A;  1Q81 4;  4G1M B;  1K73 4;  1I2F A;  4O02 B;  3E99 A;  3H3H A;  4LMI A;  4DKI A;  2FGT A;  3LT8 A;  1RGH A;  2UX0 A;  1LRA A;  3NV0 A;  1LNH A;  1JB2 A;  1W01 A;  3CCJ 3;  4IIA A;  3DY5 A;  1D6Z A;  3FZW A;  3V92 A;  3K63 A;  1IVU A;  1ZO2 A;  2WO0 A;  3BB9 A;  2C10 A;  3T8N A;  3OV4 A;  4BTW A;  2STD A;  4BTY A;  3V99 A;  1SII A;  3KFQ C;  4J5K A;  5AEU B;  2GEY A;  3EX9 A;  4Q53 A;  3NBJ A;  3MHE A;  2XR8 B;  5M1A A;  1MWT A;  4LGQ A;  4N6O B;  5JPU A;  1L5G B;  2OQE A;  2RNT A;  3RNT A;  2HMN B;  1Q86 4;  1SIH A;  2IY2 A;  1VQO 3;  3CCS 3;  3LTB A;  1US1 A;  3G16 A;  4N6T A;  1JBR A;  1DVD A;  4N6M A;  3LTD A;  5ELU A;  3CCL 3;  1W6G A;  2CH9 A;  6GSP A;  5I97 A;  3KSE D;  1IQY A;  3J7Y d;  1SPU A;  1A2V A;  1UDI I;  2A15 A;  5KP4 A;  1JJ2 2;  2CK3 H;  1EQK A;  2CHC A;  3EE1 A;  2F56 A;  1JRQ A;  1DMQ A;  1JN5 B;  3CPO A;  2AAE A;  3A76 A;  3B7C A;  1AY7 A;  1G0T A;  2CC3 A;  2CX1 A;  2HMO B;  3ROB A;  3I56 3;  4HM0 B;  1N8Q A;  1A2K A;  3VSY A;  1FW7 A;  1V74 A;  2QGU A;  1BAN A;  1VZZ A;  2C4B A;  3NXJ A;  4BL3 A;  4KFF A;  3CD6 3;  1YVB I;  2KRT A;  4AEQ A;  1NB5 I;  1W6Y A;  4HM1 B;  1RGL A;  4HM3 B;  5HGR A;  1BRJ A;  1YVS A;  1VQ4 3;  1BNG A;  3JUQ A;  5KP3 A;  3PYJ A;  3LT9 A;  3HIG A;  2XSH B;  1VQN 3;  4XDW A;  3K9M C;  1B2Z A;  2BMO B;  1ROA A;  3F9S A;  1R4Y A;  3KSP A;  3BNE A;  1GMP A;  1T2I A;  1AV4 A;  1UCI A;  2IYJ A;  1W4N A;  4N6L A;  4R80 A;  3SOA A;  2WOF A;  3SXX A;  1PU4 A;  2XRX B;  3DMC A;  1A90 A;  1IVW A;  1K28 A;  1RSN A;  3JVC A;  1WMO A;  4CCV A;  3MKI A;  1RGF A;  3N8B A;  1B27 A;  2F99 A;  2CW9 A;  4GSP A;  4HAA A;  2IMJ A;  2INX A;  2Y73 A;  4HM2 B;  2KF6 A;  2W9P A;  1UI8 A;  4N3V A;  4TX4 A;  1GY7 A;  3WR2 A;  2WGO A;  3LML A;  4HBR A;  5D81 A;  1GMQ A;  1BNR A;  4I4K A;  3CC4 3;  1C7H A;  3IJE B;  8CHO A;  1FUT A;  2BU4 A;  1RN4 A;  1TIJ A;  2P05 A;  1ULJ B;  4R9K A;  1YIT 3;  3CC7 3;  1ZS7 A;  3FCS B;  3KCH A;  1O7W B;  5HOH A;  2KF4 A;  3I55 3;  2PNC A;  5IG0 A;  3A5E A;  1TUH A;  2XSO B;  5AIH A;  1YJW 3;  1JN5 A;  1BSC A;  3DH2 A;  1HU9 A;  1DYU A;  2F4Y A;  3DZL A;  3LXU X;  1JB5 A;  3BND A;  1O7N B;  2CFD A;  3GZB A;  3ZG5 A;  3CC2 3;  1GYB A;  3CCR 3;  4LZI A;  1JB4 A;  3ZG0 A;  5IG4 A;  5STD A;  4I5Q A;  1MOL A;  4KFD A;  3CMA 3;  2Z6B A;  2W04 A;  5G2G A;  1KD1 4;  2CWV A;  2P38 A;  3D5G A;  2XFS A;  1OGZ A;  1JBS A;  1UUW B;  3LYG A;  1EA2 A;  4KVH A;  3MPH A;  4JRF A;  2ZA4 A;  1OPY A;  5AYS C;  5IG5 A;  2CFW A;  2P0X A;  2BMR B;  3EF8 A;  1RNT A;  2W9Q A;  2F5W A;  3WDG B;  2HMK B;  1VQ9 3;  1X1Y A;  1QVF 2;  2QA4 3;  1BRS A;  1QAK A;  4EV2 A;  4KFE A;  1IYY A;  1D6Y A;  2BNG A;  5G1L A;  3TDG A;  1OF5 B;  3NQY A;  4WYK B;  2J8X B;  1E3V A;  3N54 B;  4H3U A;  5ELJ A;  4OVM A;  1GOV A;  2CG0 A;  2GXF A;  2R4I A;  1OHO A;  3F8H A;  4HVN A;  2YX9 A;  2AAD A;  1T2H A;  1EKM A;  1IQX A;  3MYT A;  4HM5 B;  2XH9 A;  1E3R A;  2E2V A;  4LEH A;  1FGQ A;  4FCZ A;  2Q07 A;  1M9G A;  3AMO B;  1WQL B;  2YFI B;  5IF6 A;  3HZP A;  1N8R 4;  1ZGX A;  3NQZ A;  1Y4K A;  2E2U A;  3GZX B;  4RNT A;  4JF8 A;  1PY3 A;  4HZB B;  5AII A;  5AIG A;  1KSI A;  1MGW A;  2HML B;  3F7S A;  3RDE A;  2KF5 A;  3WHO A;  1GOU A;  1BGS A;  1YIJ 3;  4RBN A;  2Z76 A;  2E2T A;  2P0M A;  3KN4 A;  1YJ9 3;  3SED A;  2ZL8 A;  1ZX2 A;  1T3B A;  4GL6 A;  4STD A;  3VGN A;  4NHF A;  1UCJ A;  5JPP A;  3EQQ B;  3CCU 3;  1UW1 A;  1K9M 4;  1F8N A;  1FGR A;  1BSA A;  1WNH A;  3F8X A;  3F14 A;  2H0I A;  1AVL A;  3B8L A;  3CNX A;  1RCL A;  3ECF A;  3DGM A;  1QAL A;  4WFO A;  3V98 A;  1TP6 A;  2GU1 A;  1RGK A;  1JKG B;  1GD3 A;  3IMA B;  3QRD A;  1AQZ A;  4L7K A;  5AEW B;  4O3V A;  3G71 3;  1VQ8 3;  1BUJ A;  5CLK A;  1OF5 A;  1FGM A;  2GEX A;  2RGQ A;  3HX8 A;  4J5G A;  4WYK A;  4CDL A;  3M8C A;  2K0M A;  2B1X B;  1RGG A;  3NHX A;  2RSX A;  2WGQ A;  3SYU A;  3EHC A;  3EN8 A;  3OWY A;  1YJN 3;  3H51 A;  2CWT A;  4QWT A;  1G02 A;  1VQ7 3;  2IUK A;  1TFK A;  1RGE A;  1YNV X;  1GY6 A;  2ML6 A;  3Q1C A;  1BRI A;  1W2Z A;  3GAX A;  1X1W A;  4HOH A;  3ALA A;  5BVB A;  4MMX B;  1IDP A;  1DET A;  2M7O A;  3Q3F A;  3D3L A;  2C11 A;  3URP A;  1B3S A;  1OUN A;  2Z7A A;  2D1W A;  1KQS 2;  1STF I;  4KT3 B;  1BNF A;  5G1K A;  5IEO A;  2KF3 A;  1KC8 4;  3DGY A;  3K5T A;  4ORL A;  3GSP A;  1WMN A;  3STD A;  3WA2 X;  1OAC A;  3FLJ A;  3PS8 A;  2CFL A;  1V57 A;  4H61 A;  3HK4 A;  1DVC A;  3X41 A;  1M90 4;  1SAR A;  2OTJ 3;  3LTC A;  1G96 A;  1O7H B;  1S5A A;  3NUV A;  5CF1 A;  1UUV B;  2F5M A;  5GSP A;  3RGR A;  3SX1 A;  3DM8 A;  3EB8 A;  1LQM B;  4OUQ A;  1O7G B;  1CYV A;  4XBT A;  4IPB A;  2CKF B;  1NWW A;  1I3F A;  1M1X B;  4GHO A;  3X3Y A;  1FGO A;  3N9H A;  5TGN A;  3UB1 A;  2OWP A;  2V1L A;  1RJO A;  3X40 A;  1TU5 A;  1BSB A;  1K8A 4;  2W0Q A;  1NB3 I;  1RHL A;  2BT3 A;  2YFJ B;  3DXO A;  3FKA A;  1UUG B;  1WTH A;  4HM4 B;  5D82 A;  3CCM 3;  5EVH A;  1RMS A;  3T0U A;  1LXE A;  4EYC A;  3AHS A;  1W6C A;  4XBX A;  5FGO A;  1DMN A;  5LC6 A;  1E97 A;  4K90 B;  1NNV A;  3PZW A;  3CCQ 3;  1OCV A;  3GRD A;  3WOD G;  1D6U A;  3HOH A;  1Q42 A;  1V58 A;  1VQQ A;  1JZD A;  4N6U A;  2H0H A;  4N6N B;  4IT7 A;  4NPB A;  5BU4 A;  3CU3 A;  3GZR A;  5DRV A;  4EW5 A;  1J2B A;  4FMB A;  2L4V A;  3U97 A;  1BVI A;  5FW5 A;  1I2G A;  3CPW 2;  1EEJ A;  1FYS A;  1O7M B;  1QAF A;  3EBY A;  2W03 A;  1ULI B;  1EG9 B;  2XFT A;  1Q7H A;  3CME 3;  7GSP A;  1Q82 4;  1UCK A;  3G8Z A;  1TTO A;  1PFP A;  1RGA A;  1W5Z A;  5IER A;  3BU4 A;  3JUP A;  1I70 A;  1R4C A;  3S5C A;  3OW2 2;  1BU4 A;  2ZDJ A;  5AYR B;  1QVG 2;  5CK6 A;  2OTL 3;  4ILF A;  3DGN A;  2LYX A;  1JNQ A;  3S67 A;  1AR0 A;  2QIY A;  1I2E A;  4XM4 A;  1CEW I;  3UJM A;  3JUO A;  2B24 B;  4BIR A;  5BXQ A;  2GBX B;  4L8O A;  1BSD A;  2F98 A;  1BAO A;  3EC9 A;  2JDI H;  3DGO A;  1K41 A;  3NM7 A;  1OHS A;  2RBI A;  4MMY B;  9RNT A;  3QK9 A;  4EV5 A;  4RZM A;  1OHP A;  1RLS A;  3KE7 A;  1B21 A;  5CXO A;  4AKY A;  1MWU A;  1I3I A;  2OCT A;  2OOV C;  4HZ9 B;  1IK3 A;  1HZ1 A;  1LNI A;  2K3D A;  5BIR A;  2XF3 A;  3CNM A;  2O9U X;  3OWU A;  4HKV B;  2CIU A;  3EJV A;  2RFR A;  4FMA A;  5IW9 A;  3PCS A;  2L1S A;  2P09 A;  4R9L A;  2PZV A;  3IPT A;  1BNJ A;  1QMA A;  1TJD A;  2SAR A;  4J9A A;  5CF2 A;  3LZA A;  3F40 A;  2CFG A;  2H0G A;  1MGR A;  3PCR A;  7STD A;  1SJW A;  3F7X A;  3LTA A;  2ML5 A;  4R1K A;  1FZU A;  1CYU A;  2GBW B;  5AI1 A;  3WOE B;  1VQ6 3;  3GWR A;  1BNI A;  1I8V A;  1KWI A;  3LOY A;  1FUW A;  1NDO B;  1OGX A;  3S28 A;  4K1V A;  3X3X A;  3HI7 A;  1N5H A;  3MG1 A;  4MMZ B;  3BIR A;  3Q2P A;  4MEI A;  4WP5 A;  2MF7 A;  3G0K A;  2OOV A;  4AKZ A;  1LOY A;  1CQS A;  1FGT A;  2CX0 A;  5EEO A;  2MC8 A;  4EBG A;  1TRP A;  3NBR A;  1AVK A;  3AGN A;  4EXR A;  3WOF B;  7RNT A;  1Q9E A;  3SVA A;  4PEJ A;  4L8P A;  3WA3 A;  3NX0 A;  1S72 3;  3RGA A;  1IV9 A;  1IVX A;  1W7C A;  3D79 A;  1GY5 A;  1B2M A;  1STD A;  1N9E A;  1UCL A;  2CWU A;  1OH0 A;  1IQ8 A;  2UGI A;  1FA3 A;  1B2S A;  1NO3 A;  3G6E 3;  3ZFZ A;  2KCD A;  3L0R A;  3OWS A;  3X3Z A;  1TFO A;  3BNB A;  3K7C A;  3AMO A;  1IT8 A;  1JV2 B;  1BRK A;  1C54 A;  8RNT A;  2W6J H;  3AGO A;  4OK0 A;  2XEP A;  2KAA A;  1DMM A;  1A67 A;  1Q40 B;  1IT7 A;  2YFL B;  1RN7 A;  2W56 B;  2F86 B;  1BNE A;  3FGY A;  5A0O B;  4BTX A;  1W2B 2;  4BL2 A;  1I0X A;  2UUG C;  5RNT A;  4XDV A;  2BIR A;  3B4O A;  3O8Y A;  1IVV A;  2W2C A;  1MWS A;  1YGW A;  1B2U A;  4N6V 0;  4EC6 A;  1A2P A;  1Z1S A;  2I9W A;  2CFK A;  4X2H A;  2FNQ A;  1GOY A;  2XGL A;  1BOX A;  4FR9 A;  3D9R A;  3U1W A;  3D4A A;  1RN1 A;  4WWU C;  4FMD A;  1B2X A;  2BO9 B;  2XGN A;  1YHQ 3;  1DE3 A;  1NU3 A;  4FCJ A;  1JZO A;  4XB5 A;  1FUS A;  4HYZ A;  2Y74 A;  4CJN A;  1BNS A;  2FXT A;  1GMR A;  4RNY A;  4HM6 B;  2KXG A;  3UL6 A;  3CCV 3;  1JKG A;  5IG3 A;  5D83 A;  1LOX A;  1RCK A;  3WMD A;  3X42 A;  2HMJ B;  1BRH A;  3NM2 A;  4K1U A;  1RGC A;  1X1X A;  3FF2 A;  1RKY A;  4CPK A;  4ZM8 A;  3HII A;  3S27 A;  3FG3 A;  3MG2 A;  1B20 A;  1IU7 A;  1I0V A;  1RDS A;  1CH0 A;  3FG4 A;  1VQM 3;  1SQW A;  1RNB A;  3BLZ A;  1NJI 4;  3FG1 A;  3CXC 2;  1Q7Y 4;  1N9J A;  6RNT A;  4WHA A;  5IEP A;  1VQL 3;  1ISK A;  1VQK 3;  1X1U A;  2ZHX B;  1O7P B;  1TRQ A;  3EBT A;  4FMC A;  1BRG A;  4RNZ A;  1Q40 A;  5JBS A;  3AHW A;  4XBY A;  2OQE C;  2W56 A;  4HJL B;  3NV0 B;  6STD A;  3DGL A;  1T5Y A;  5M19 A;  1LVN A;  4J8T A;  3OX9 A;  1GSP A;  1BSE A;  2SBL A;  4K61 A;  2IUJ A;  1HYF A;  3PGB A;  1U5O A;  2K54 A;  4R4K A;  3SOY A;  1WMP A;  1YGE A;  1RRH A;  5LC7 A;  3KII A;  4HM7 B;  3MSO A;  1LOW A;  1LQG C;  2IA7 A;  2O3O A;  3VF1 A;  2GU3 A;  3FF0 A;  1EUI C;  1N5P A;  5DRE A;  2GSP A;  2WOH A;  1MNL A;  3BNC A;  1MWR A;  2HMM B;  4O8S A;  2RCD A;  4BU4 A;  5KP1 A;  4HM8 B;  3EN1 B;  1UI7 A;  5M18 A;  3UNL A;  2Z77 A;  3NBB A;  1IV7 A;  3PXM A;  5EQL A;  3S29 A;  2D42 A;  3DUK A;  4LYL B;  3JUN A;  2BMQ B;  1W00 A;  3CCE 3;  1LOV A;  1ROV A;  2LQV A;  1UGI A;  1W02 A;  1JBT A;  4LSO A;  4O2H A;  3UL5 A;  2R41 A;  1RRL A;  3KZT A;  3LH4 A;  3T8U A;  4X2O A;  5AIF A;  2BHM A; 
#chains in the Genus database with same CATH homology
 1VQP 3;  3OXA A;  3JUM A;  1BUQ A;  4NRE A;  3Q90 A;  1VQ5 3;  2JQ5 A;  5IEN A;  4MJD A;  4KZ1 A;  1M1K 4;  3SLU A;  1QJG A;  4FCM A;  1GS3 A;  3FH1 A;  3KKG A;  3ER7 A;  3G4S 3;  3GZY B;  1ASK A;  1HKX A;  3K0Z A;  2CG1 A;  3I0Y A;  2QEX 3;  3MWZ A;  1U8C B;  4GB5 A;  3MG3 A;  3FSD A;  1YI2 3;  3B4P A;  1GD4 A;  1Q81 4;  4U13 A;  4G1M B;  1K73 4;  4O02 B;  3E99 A;  3H3H A;  4LMI A;  2FGT A;  3LT8 A;  2UX0 A;  3NV0 A;  1LNH A;  1JB2 A;  1W01 A;  3CCJ 3;  4IIA A;  3DY5 A;  1D6Z A;  3FZW A;  3V92 A;  3K63 A;  1IVU A;  1ZO2 A;  2WO0 A;  3BB9 A;  2C10 A;  3T8N A;  3OV4 A;  4BTW A;  2STD A;  4BTY A;  3V99 A;  1SII A;  3KFQ C;  5AEU B;  2GEY A;  3EX9 A;  4Q53 A;  3NBJ A;  3MHE A;  2XR8 B;  5JPU A;  4N6O B;  4LGQ A;  1L5G B;  2OQE A;  2HMN B;  1Q86 4;  1SIH A;  1VQO 3;  3CCS 3;  3LTB A;  1US1 A;  3G16 A;  4N6T A;  1DVD A;  4N6M A;  3LTD A;  5ELU A;  3CCL 3;  1W6G A;  2CH9 A;  5I97 A;  3KSE D;  1IQY A;  3J7Y d;  1SPU A;  1A2V A;  2A15 A;  5KP4 A;  1JJ2 2;  2CK3 H;  1EQK A;  2CHC A;  3EE1 A;  1JRQ A;  1DMQ A;  1JN5 B;  3CPO A;  3A76 A;  3B7C A;  2CC3 A;  2HMO B;  3ROB A;  3I56 3;  4HM0 B;  1N8Q A;  1A2K A;  3VSY A;  1V74 A;  2QGU A;  1VZZ A;  3NXJ A;  4KFF A;  3CD6 3;  1YVB I;  2KRT A;  4AEQ A;  1NB5 I;  1W6Y A;  4HM1 B;  4HM3 B;  5HGR A;  1VQ4 3;  3JUQ A;  5KP3 A;  3PYJ A;  3LT9 A;  3HIG A;  2XSH B;  1VQN 3;  4XDW A;  3K9M C;  2BMO B;  1ROA A;  3F9S A;  3KSP A;  3BNE A;  1AV4 A;  4N6L A;  1W4N A;  4R80 A;  3SXX A;  3SOA A;  2WOF A;  1PU4 A;  2XRX B;  3DMC A;  1A90 A;  1IVW A;  1K28 A;  3JVC A;  1WMO A;  4CCV A;  3MKI A;  3N8B A;  2F99 A;  2CW9 A;  2IMJ A;  2INX A;  2Y73 A;  4HM2 B;  2W9P A;  1UI8 A;  4N3V A;  4TX4 A;  1GY7 A;  2WGO A;  3LML A;  4HBR A;  5D81 A;  4I4K A;  3CC4 3;  1C7H A;  3IJE B;  8CHO A;  1TIJ A;  2P05 A;  1ULJ B;  4R9K A;  1YIT 3;  3CC7 3;  3FCS B;  1O7W B;  3I55 3;  2PNC A;  5IG0 A;  1TUH A;  2XSO B;  5AIH A;  1YJW 3;  1JN5 A;  1HU9 A;  1DYU A;  3DZL A;  3LXU X;  1JB5 A;  3BND A;  1O7N B;  2CFD A;  3GZB A;  3CC2 3;  1GYB A;  3CCR 3;  4LZI A;  1JB4 A;  5IG4 A;  5STD A;  1MOL A;  4KFD A;  3CMA 3;  2Z6B A;  2W04 A;  5G2G A;  1KD1 4;  2CWV A;  2P38 A;  2XFS A;  1OGZ A;  1UUW B;  3LYG A;  1EA2 A;  4KVH A;  3MPH A;  4JRF A;  1OPY A;  5AYS C;  5IG5 A;  2CFW A;  2P0X A;  2BMR B;  3EF8 A;  2W9Q A;  3WDG B;  2HMK B;  1VQ9 3;  1QVF 2;  2QA4 3;  1QAK A;  4EV2 A;  4KFE A;  1D6Y A;  2BNG A;  3TDG A;  1OF5 B;  3NQY A;  4WYK B;  1E3V A;  3N54 B;  4H3U A;  5ELJ A;  4OVM A;  2CG0 A;  2GXF A;  2R4I A;  1OHO A;  3F8H A;  4HVN A;  2YX9 A;  1EKM A;  1IQX A;  3MYT A;  4HM5 B;  2XH9 A;  1E3R A;  2E2V A;  4LEH A;  1FGQ A;  4FCZ A;  2Q07 A;  1M9G A;  3AMO B;  1WQL B;  2YFI B;  5IF6 A;  3HZP A;  1N8R 4;  3NQZ A;  1Y4K A;  2E2U A;  3GZX B;  4JF8 A;  4HZB B;  5AII A;  5AIG A;  1KSI A;  2HML B;  3F7S A;  3RDE A;  1YIJ 3;  4RBN A;  2Z76 A;  2E2T A;  2P0M A;  3KN4 A;  1YJ9 3;  3SED A;  2ZL8 A;  1ZX2 A;  4GL6 A;  4STD A;  3VGN A;  4NHF A;  5JPP A;  3EQQ B;  3CCU 3;  1UW1 A;  1K9M 4;  1F8N A;  1FGR A;  1WNH A;  3F8X A;  3F14 A;  1AVL A;  3B8L A;  3CNX A;  3ECF A;  3DGM A;  1QAL A;  4WFO A;  3V98 A;  1TP6 A;  2GU1 A;  3IMA B;  1GD3 A;  1JKG B;  4L7K A;  3QRD A;  5AEW B;  3G71 3;  4O3V A;  1VQ8 3;  5CLK A;  1OF5 A;  1FGM A;  2GEX A;  2RGQ A;  3HX8 A;  4WYK A;  4CDL A;  3M8C A;  2K0M A;  2B1X B;  3NHX A;  2RSX A;  2WGQ A;  3EHC A;  3EN8 A;  3OWY A;  1YJN 3;  3H51 A;  2CWT A;  4QWT A;  1VQ7 3;  2IUK A;  1TFK A;  2ML6 A;  1GY6 A;  3Q1C A;  1W2Z A;  3GAX A;  5BVB A;  3ALA A;  4MMX B;  1IDP A;  2M7O A;  3D3L A;  2C11 A;  1KQS 2;  2Z7A A;  1OUN A;  2D1W A;  1STF I;  5IEO A;  1KC8 4;  3K5T A;  4ORL A;  1WMN A;  3STD A;  3WA2 X;  1OAC A;  3FLJ A;  3PS8 A;  2CFL A;  4H61 A;  3HK4 A;  1DVC A;  3X41 A;  1M90 4;  2OTJ 3;  3LTC A;  1G96 A;  1O7H B;  1S5A A;  3NUV A;  5CF1 A;  1UUV B;  3RGR A;  3SX1 A;  3DM8 A;  3EB8 A;  4OUQ A;  1O7G B;  1CYV A;  4XBT A;  4IPB A;  2CKF B;  1NWW A;  1M1X B;  3X3Y A;  1FGO A;  3N9H A;  5TGN A;  3UB1 A;  2OWP A;  2V1L A;  1RJO A;  3X40 A;  1TU5 A;  1K8A 4;  2W0Q A;  1NB3 I;  2BT3 A;  2YFJ B;  3DXO A;  3FKA A;  4HM4 B;  1WTH A;  5D82 A;  3CCM 3;  5EVH A;  3T0U A;  1LXE A;  4EYC A;  1W6C A;  4XBX A;  5FGO A;  1DMN A;  5LC6 A;  1E97 A;  4K90 B;  3PZW A;  3CCQ 3;  1OCV A;  3GRD A;  3WOD G;  1D6U A;  1Q42 A;  4N6U A;  4N6N B;  4IT7 A;  3CU3 A;  3GZR A;  5DRV A;  1J2B A;  4FMB A;  2L4V A;  3U97 A;  5FW5 A;  3CPW 2;  1O7M B;  1QAF A;  3EBY A;  2W03 A;  1ULI B;  1EG9 B;  2XFT A;  3CME 3;  1Q82 4;  3G8Z A;  1PFP A;  1W5Z A;  5IER A;  3JUP A;  3S5C A;  1R4C A;  3OW2 2;  1QVG 2;  2OTL 3;  2ZDJ A;  5AYR B;  5CK6 A;  3DGN A;  2LYX A;  1JNQ A;  3S67 A;  1AR0 A;  2QIY A;  4XM4 A;  1CEW I;  3UJM A;  3JUO A;  2B24 B;  5BXQ A;  2GBX B;  4L8O A;  2F98 A;  3EC9 A;  2JDI H;  3DGO A;  1K41 A;  3NM7 A;  1OHS A;  4MMY B;  3QK9 A;  4EV5 A;  4RZM A;  1OHP A;  3KE7 A;  5CXO A;  4AKY A;  2OOV C;  2OCT A;  1IK3 A;  4HZ9 B;  2XF3 A;  3CNM A;  2O9U X;  3OWU A;  4HKV B;  2CIU A;  3EJV A;  2RFR A;  4FMA A;  5IW9 A;  3PCS A;  2P09 A;  4R9L A;  2PZV A;  3IPT A;  1QMA A;  4J9A A;  5CF2 A;  3LZA A;  3F40 A;  2CFG A;  3PCR A;  7STD A;  1SJW A;  3F7X A;  3LTA A;  2ML5 A;  4R1K A;  1CYU A;  2GBW B;  5AI1 A;  3WOE B;  1VQ6 3;  3GWR A;  1KWI A;  3LOY A;  1FUW A;  1NDO B;  1OGX A;  3S28 A;  4K1V A;  3X3X A;  3HI7 A;  1N5H A;  3MG1 A;  4MMZ B;  3Q2P A;  4MEI A;  4WP5 A;  2MF7 A;  3G0K A;  2OOV A;  4AKZ A;  5EEO A;  1CQS A;  1FGT A;  2MC8 A;  4EBG A;  3NBR A;  1AVK A;  4EXR A;  3WOF B;  3SVA A;  4PEJ A;  4L8P A;  3WA3 A;  3NX0 A;  1S72 3;  3RGA A;  1IV9 A;  1IVX A;  1W7C A;  1GY5 A;  1STD A;  1N9E A;  2CWU A;  1OH0 A;  1IQ8 A;  1FA3 A;  1NO3 A;  3G6E 3;  2KCD A;  3L0R A;  3OWS A;  3X3Z A;  1TFO A;  3BNB A;  3K7C A;  3AMO A;  1IT8 A;  1JV2 B;  2W6J H;  4OK0 A;  2XEP A;  1DMM A;  1A67 A;  1Q40 B;  1IT7 A;  2YFL B;  1RN7 A;  2W56 B;  2F86 B;  3FGY A;  5A0O B;  4BTX A;  1W2B 2;  4XDV A;  3B4O A;  3O8Y A;  1IVV A;  2W2C A;  4N6V 0;  4EC6 A;  1Z1S A;  2I9W A;  2CFK A;  4X2H A;  2FNQ A;  2XGL A;  4FR9 A;  3D9R A;  3U1W A;  4WWU C;  4FMD A;  2BO9 B;  2XGN A;  1YHQ 3;  1NU3 A;  4FCJ A;  4XB5 A;  4HYZ A;  2Y74 A;  2FXT A;  4RNY A;  4HM6 B;  2KXG A;  3UL6 A;  3CCV 3;  1JKG A;  5IG3 A;  5D83 A;  1LOX A;  3WMD A;  3X42 A;  2HMJ B;  3NM2 A;  4K1U A;  3FF2 A;  1RKY A;  4ZM8 A;  3HII A;  3S27 A;  3FG3 A;  3MG2 A;  1IU7 A;  3FG4 A;  1VQM 3;  1SQW A;  3BLZ A;  1NJI 4;  3FG1 A;  3CXC 2;  1Q7Y 4;  1N9J A;  4WHA A;  5IEP A;  1VQL 3;  1ISK A;  1VQK 3;  4FMC A;  1O7P B;  4RNZ A;  3EBT A;  5JBS A;  1Q40 A;  4XBY A;  2OQE C;  2W56 A;  4HJL B;  3NV0 B;  6STD A;  3DGL A;  1T5Y A;  1LVN A;  4J8T A;  3OX9 A;  2SBL A;  4K61 A;  2IUJ A;  3PGB A;  3SOY A;  1U5O A;  2K54 A;  4R4K A;  1WMP A;  1YGE A;  1RRH A;  5LC7 A;  3KII A;  4HM7 B;  3MSO A;  2O3O A;  2IA7 A;  3VF1 A;  2GU3 A;  3FF0 A;  1N5P A;  5DRE A;  2WOH A;  1MNL A;  3BNC A;  2HMM B;  4O8S A;  5KP1 A;  2RCD A;  4HM8 B;  3EN1 B;  1UI7 A;  3UNL A;  2Z77 A;  3NBB A;  1IV7 A;  3PXM A;  5EQL A;  3S29 A;  2D42 A;  3DUK A;  3JUN A;  2BMQ B;  1W00 A;  3CCE 3;  1ROV A;  2LQV A;  1W02 A;  4LSO A;  4O2H A;  3UL5 A;  1RRL A;  3KZT A;  3LH4 A;  3T8U A;  4X2O A;  5AIF A;  2BHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...