1S5AA

Crystal structure of putative isomerase from bacillus subtilis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
139
structure length
139
Chain Sequence
MNEFEKACETLRKFMAYMLEKDMKSWTELWDENAVFEFPYAPEGSPKRIEGKAAIYDYIKDYPKQIHLSSFTAPTVYRSADSNTVIAEFQCDGHVIETGLPYRQSYISVIETRDGRIVRYRDYWNPLVVKEAFGGSFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yesE
publication title The Crystal Structure of APC1116 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
total genus 42
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1s5aA00
3NHXA 1OGXA 3ER7A 1DMQA 1GY7A 4RZMA 3OWUA 5IF6A 1O7GB 2Z7AA 5TGNA 3F40A 1ULIB 5AEWB 3MYTA 1O7PB 1C7HA 3EJVA 1O7WB 2IMJA 5AIFA 7STDA 1NDOB 1GYBA 3DXOA 4OVMA 5IG3A 4Q53A 3LYGA 3DMCA 5D83A 3OWYA 3FSDA 3NV0B 3EF8A 1IDPA 1OCVA 1CQSA 3FKAA 4HM5B 2GEYA 3NV0A 3HK4A 4HM0B 3G8ZA 4IIAA 3DM8A 3MG1A 2GEXA 2BMRB 2Z76A 5CLKA 2Z77A 2F86B 1UUVB 3OX9A 4HZBB 1A2KA 3H51A 4XM4A 3KE7A 3HX8A 1OGZA 4LGQA 3CPOA 1STDA 3NM2A 1GY5A 3F8HA 8CHOA 3CNXA 3B4OA 1Z1SA 5D82A 2BMQB 4MJDA 4I4KA 3FLJA 3NBRA 2W2CA 1JB5A 4K1VA 5IEOA 4LEHA 1JN5B 2QGUA 3RGAA 3MG2A 4L8PA 4WYKA 1JN5A 1JKGB 5KP1A 3UJMA 5AIIA 1JKGA 2QIYA 4ORLA 3VGNA 3EHCA 3GZYB 1W00A 3EQQB 4HM1B 5FW5A 3SEDA 5CF1A 2B24B 5AIGA 1U5OA 3T8UA 2HMMB 5CK6A 2HMOB 4HVNA 1W02A 1W6YA 3WMDA 2HMJB 2STDA 2UX0A 2RGQA 4J8TA 3NUVA 2INXA 1SJWA 2PZVA 3I0YA 3A76A 2YFLB 5DRVA 4HM2B 3RGRA 3ROBA 4R1KA 3EN1B 5IG0A 5KP4A 1O7HB 2BNGA 3Q90A 5D81A 3MG3A 2XR8B 1JB2A 2BMOB 1S5AA 3K7CA 4FCJA 1O7MB 4STDA 1DMMA 4U13A 3FH1A 1GS3A 3MKIA 3EN8A 4XBXA 3GZXB 1OPYA 1VZZA 3JUOA 2GBXB 5IERA 1TUHA 3HZPA 3GWRA 3JUNA 4N3VA 3FGYA 3H3HA 3VSYA 1HKXA 2HMLB 3F7SA 4HKVB 4CDLA 3LZAA 3KSPA 5IG5A 4H3UA 3F8XA 3GZRA 1AR0A 2YFJB 2YFIB 3BB9A 3K0ZA 1E3VA 3DUKA 5CXOA 4PEJA 3IPTA 4WYKB 2HMNB 5STDA 5BXQA 4XDWA 1ZO2A 2B1XB 3S5CA 3F9SA 5G2GA 1OHOA 4FCMA 1OHSA 2RFRA 3E99A 5JPUA 1ULJB 2XSHB 4R9KA 3FF0A 5DREA 4J9AA 1QMAA 3CU3A 1NWWA 1WQLB 4L7KA 4HM4B 4XBYA 5HGRA 3F7XA 1ASKA 3SOAA 3MSOA 5CF2A 1DMNA 3CNMA 3EX9A 2R4IA 3T8NA 1UUWB 3EC9A 6STDA 3OV4A 3MHEA 1OF5B 3FF2A 1Q40B 4HZ9B 1EG9B 1OF5A 1OHPA 1Q40A 5JPPA 2GBWB 1GY6A 4XBTA 4K1UA 3JUPA 3EBYA 2JQ5A 4HM3B 3DZLA 3KKGA 3BLZA 4WWUC 4WP5A 5AIHA 3B4PA 1BUQA 1E3RA 2F99A 1O7NB 1ZX2A 4GB5A 3G0KA 2HMKB 4HM7B 3EBTA 3B7CA 1NU3A 4KVHA 2CKFB 4XB5A 5IENA 2XSOB 3OWSA 1OUNA 3OXAA 3STDA 3ECFA 1JB4A 5AEUB 3KZTA 2K54A 4OUQA 3M8CA 1QJGA 1EA2A 4L8OA 2GXFA 3SOYA 2RCDA 5IG4A 4LMIA 5AI1A 3NXJA 4X2HA 4HM6B 2F98A 1TP6A 3D9RA 1Q42A 2OWPA 4XDVA 4X2OA 1K41A 2I9WA 3GRDA 4HM8B 1W01A 1OH0A 3FZWA 3F14A 2A15A 3UNLA 4R9LA 1ISKA 3JUQA 5EVHA 1E97A 3GZBA 3G16A 2CHCA 5KP3A 3JUMA 5BVBA 5IEPA 2XRXB 3B8LA 4HJLB
chains in the Genus database with same CATH superfamily
3NHXA 1OGXA 1RGFA 3MPHA 4I5QA 3ER7A 3BU4A 1YJN3 1YHQ3 4HOHA 1DMQA 1GY7A 1HZ1A 1MWUA 1UI7A 4RZMA 3OWUA 1AVKA 5IF6A 1O7GB 1W5ZA 1J2BA 2Z7AA 5TGNA 3AGNA 2D1WA 1GMRA 1FUSA 1UCLA 1UCIA 3F40A 1ULIB 2W9QA 5AEWB 5BIRA 2ZDJA 3MYTA 2CG0A 3LMLA 5G1LA 1SARA 3BNBA 3LXUX 1IVUA 4AKZA 1TU5A 1RGLA 1O7PB 4WFOA 5HOHA 1EUIC 1RMSA 5M18A 1C7HA 3CC23 4NPBA 3NQYA 2CX0A 1RKYA 3CCJ3 3EJVA 2CX1A 1SIIA 1PYLA 1RCKA 3DGYA 2C10A 1O7WB 2IMJA 5AIFA 3WA2X 1N5HA 2ML5A 2Y74A 1AY7A 1M1XB 2C11A 5GSPA 3CCM3 7STDA 1BNJA 1TFKA 3V99A 1NDOB 1GYBA 1N8QA 1RLSA 3X41A 4KT3B 1NO3A 1WTHA 3DXOA 2IA7A 4OVMA 2AADA 1W4NA 2FGTA 4Q53A 3NX0A 3FCSB 3FG3A 1RN7A 4CJNA 5IG3A 1JJ22 1DVDA 3LTBA 1GOYA 4RNTA 3QK9A 1YVBI 3LYGA 3PCSA 3DMCA 5ELJA 3PYJA 1RGGA 3KN4A 5D83A 4OK0A 4AEQA 3OWYA 3UL5A 3FSDA 1SPUA 3EF8A 3NV0B 1FYSA 1BNGA 1IDPA 1KQS2 1OCVA 3PZWA 2PNCA 1CQSA 2W04A 3FKAA 4HM5B 2GEYA 3NV0A 2CFWA 3HK4A 3S28A 4N6TA 2M7OA 1C54A 4N6UA 1PFPA 4HM0B 3HOHA 1BANA 1LNHA 1K28A 1RSNA 2BU4A 3G8ZA 4GHOA 1STFI 1FUTA 2RSXA 3JVCA 3X3XA 2MC8A 3G713 4BL3A 1B2MA 2P0XA 4IIAA 1IT8A 1MGWA 3DM8A 3MG1A 1I2EA 3ZG0A 2XFTA 1FGQA 2GEXA 2BMRB 2H0IA 3HIGA 2Z76A 4KZ1A 2CW9A 5CLKA 2WOHA 3A5EA 2Z77A 3CCR3 1T2IA 2F86B 1IQYA 5I97A 1UUVB 3OX9A 1JBTA 3FG4A 4HZBB 4NHFA 2W03A 3CC43 1JV2B 1HYFA 1Q824 1D6YA 3ALAA 4MMYB 1I2FA 3UL6A 3X3YA 1A2KA 3H51A 1BSDA 1F8NA 1BRGA 5BU4A 1BRNL 4XM4A 2CFKA 3X42A 3N8BA 3KE7A 1JZOA 2WGQA 2BT3A 3HX8A 1OGZA 4EBGA 4LGQA 4MMZB 1LVNA 3CPOA 3NBBA 1KSIA 1V74A 4RBNA 1STDA 2SARA 3LH4A 1DYUA 1ROAA 1TRQA 3EE1A 3LT9A 1W7CA 1JZDA 2P05A 3NM2A 3DGOA 1X1WA 1AVLA 1GY5A 1MOLA 1WMOA 2R41A 3CNXA 3F8HA 3B4OA 5G1KA 8CHOA 3CCV3 1I70A 2XH9A 3Q2PA 1Z1SA 5D82A 2BMQB 3RNTA 3WA3A 1U8CB 4MJDA 2F5WA 4I4KA 1BNEA 3FLJA 2KF5A 1VQ83 2E2TA 3NBRA 2W2CA 1BSBA 2F4YA 2KRTA 1BVIA 1JB5A 4K1VA 1CYUA 5IEOA 3GAXA 3MWZA 4LEHA 1LQGC 2CFLA 2JDIH 3BNEA 1S723 1JN5B 1VQP3 1K734 2CC3A 1B3SA 1UI8A 2QA43 2Q07A 1BUJA 2ZA4A 3CXC2 1UGHI 1TFOA 2QGUA 3MG2A 4L8PA 4WYKA 3RGAA 1JN5A 4FMCA 1JKGB 1RGHA 1W6GA 5KP1A 1B27A 3UJMA 4GL6A 4N6V0 5M1AA 1RGCA 2LYXA 5LC7A 1ZGXA 5AIIA 1JKGA 4EYCA 1K8A4 1RRHA 3L0RA 1QAFA 2KAAA 5ELUA 4BU4A 2QEX3 2QIYA 3SXXA 2H0HA 3D5IA 4ORLA 3VGNA 4K90B 3EHCA 1Y4KA 1I0VA 1A67A 3GZYB 1W00A 2F56A 1RHLA 3EQQB 4HM1B 4NREA 1SIHA 1M9GA 1BOXA 5FW5A 4CPKA 1MNLA 3HIIA 4EC6A 1D6UA 3SEDA 5CF1A 1EQKA 3CMA3 2B24B 5AIGA 1U5OA 4N6LA 3T8UA 1BNSA 1Q7Y4 2HMMB 1VQQA 2P0MA 3CPW2 5AYSC 5CK6A 1X1UA 2HMOB 4HVNA 4LYLB 1DETA 3CCU3 1W02A 1FGMA 1W6YA 2OQEA 3WMDA 2HMJB 1DVCA 2STDA 1IQ8A 2L1SA 2UX0A 3D79A 1BRSA 2FXTA 2O9UX 1PY3A 1YGWA 1VQO3 7RNTA 2RGQA 2LQVA 4J8TA 1BRIA 2CFGA 4O3VA 4R4KA 1B2SA 2CIUA 3NUVA 2INXA 1FZUA 1SJWA 3OW22 2XF3A 2PZVA 3I0YA 2CG1A 3A76A 2YFLB 2W9PA 5DRVA 4JF8A 2OOVA 2KXGA 3DH2A 4HM2B 1R4YA 1BSAA 3RGRA 3ROBA 1IVVA 4R1KA 2ML6A 3EN1B 1CEWI 5IG0A 5KP4A 1B2XA 4CCVA 2XFSA 1UDII 2L4VA 3X3ZA 3AGOA 4J5KA 1O7HB 2BNGA 3Q90A 1DE3A 1KD14 2KCDA 5FGOA 1UGIA 5D81A 3MG3A 2XR8B 3DY5A 1JB2A 2BMOB 3ZFZA 1L5GB 2GSPA 3CCQ3 1NJI4 1S5AA 1QAKA 4RNYA 3AHWA 4TX4A 3VF1A 2FNQA 3K7CA 3CD63 1IK3A 4FCJA 1O7MB 3S67A 4STDA 4BTWA 1DMMA 4U13A 1YIT3 1G96A 1JRQA 3FH1A 1FGRA 2K3DA 3LTAA 1WMPA 1GS3A 3MKIA 1BSEA 1R4CA 3EN8A 1MWRA 4XBXA 1LOYA 4IT7A 2E2VA 1FUWA 9RNTA 3GZXB 1IU7A 4FMBA 1GMPA 4EXRA 1OPYA 1B2ZA 1VZZA 4J5GA 6GSPA 4EV2A 2BIRA 2GBXB 3EB8A 3JUOA 8RNTA 1YJ93 1W2B2 3D3LA 3LTCA 5IERA 2AAEA 4HYZA 1TUHA 1GMQA 3KFQC 3HZPA 1UW1A 3Q1CA 1MWTA 1T5YA 1B20A 1UCKA 3FGYA 1N9EA 3GWRA 3H3HA 3JUNA 4G1MB 4N3VA 3VSYA 1BRJA 1I3FA 3AMOB 1YGEA 4LSOA 1VQL3 1IQXA 1KWIA 1HKXA 2HMLB 4BTXA 3F7SA 3AMOA 4HKVB 5IW9A 1RDSA 4CDLA 1FA3A 1JNQA 3LZAA 3WODG 1IYYA 3KSPA 5IG5A 2RNTA 3N54B 4H3UA 3F8XA 2SBLA 2W56B 3GZRA 1AR0A 3BIRA 1LOXA 2YFJB 4LZIA 3CCL3 2YFIB 3BB9A 1VQ53 2V1LA 2O3OA 2MF7A 2W56A 3K0ZA 3PXMA 1E3VA 1RGEA 3DUKA 1TRPA 1W2ZA 1YVSA 3LOYA 5CXOA 4BTYA 2CWUA 4DKIA 2YX9A 1N5PA 4PEJA 1BNRA 3IPTA 4WYKB 3X40A 1WMNA 2BHMA 3CC73 2HMNB 5STDA 5BXQA 2WGOA 4XDWA 1ZO2A 3SYUA 1RTUA 2B1XB 3S5CA 1NB3I 1GOVA 1IV7A 3F9SA 1US1A 5G2GA 1OHOA 2ZL8A 3DGNA 2F5MA 1JBSA 1TIJA 1NNVA 1OHSA 4FCMA 3D4AA 1LQMB 2RFRA 2GU1A 3N9HA 3E99A 1RN1A 5JPUA 1QVG2 3S27A 3J7Yd 1ULJB 2XSHB 4R9KA 3FF0A 1BGSA 5DREA 3G6E3 4J9AA 1PU4A 1QMAA 1Q9EA 1T2HA 1RN4A 3CU3A 3LT8A 1N8R4 3DGMA 2HOHA 1TJDA 2W6JH 2XGNA 1NWWA 1WQLB 3PCRA 3U1WA 4L7KA 4HM4B 4XBYA 4N6MA 1LRAA 4GSPA 1FGOA 4EW5A 1JBRA 3NM7A 4RNZA 5HGRA 3S29A 3F7XA 4ILFA 3SX1A 1D6ZA 1G0TA 3GSPA 1ASKA 3IJEB 3SOAA 2OTL3 3RDEA 4AKYA 3MSOA 4EV5A 4FR9A 3PS8A 5CF2A 2KF4A 2XGLA 5EQLA 1EKMA 1DMNA 2CFDA 1A2VA 3CNMA 3EX9A 3URPA 3NBJA 2R4IA 1CH0A 2CK3H 2OQEC 3T8NA 3K63A 2Y73A 1UUWB 2CWTA 3EC9A 1IT7A 3OV4A 6STDA 3MHEA 1UUGB 1OF5B 3FF2A 4WHAA 1K9M4 1B2UA 1Q40B 3Q3FA 4HZ9B 2UUGC 2RBIA 1EG9B 1M904 4O02B 1BU4A 1OF5A 1UCJA 1OHPA 1Q40A 4H61A 2GBWB 5JPPA 1GY6A 1ROVA 1QALA 1GD3A 1T3BA 4XBTA 4K1UA 1BRKA 2H0GA 3CME3 3JUPA 1CYVA 1IVXA 2OOVC 3EBYA 3FG1A 2IY2A 2JQ5A 1LOVA 4HM3B 2IUKA 2KF3A 3DZLA 1MWSA 3KKGA 3T0UA 3BLZA 3BNDA 1A90A 4WWUC 3K9MC 2J8XB 1GOUA 4KFDA 1LOWA 3AHSA 4WP5A 5M19A 5EEOA 1TTOA 3O8YA 3TDGA 5AIHA 1I8VA 3ZG5A 1GSPA 3B4PA 2OTJ3 1V58A 4KFEA 1BUQA 4BIRA 1BAOA 2P38A 3KSED 1E3RA 2F99A 1O7NB 4FCZA 4QWTA 3SVAA 4MMXB 1ZX2A 4GB5A 4N6OB 1QVF2 3G0KA 2IUJA 1AV4A 2HMKB 1ZS7A 4HM7B 3EBTA 1YI23 3B7CA 1YJW3 1NU3A 4KVHA 2CKFB 4XB5A 1I0XA 3LTDA 2UGIA 1IVWA 5IENA 3KIIA 1A2PA 3I553 1VQ63 1SQWA 2XSOB 2P09A 1RJOA 3OWSA 1IV9A 1OUNA 4FMDA 4HAAA 1LXEA 3IMAB 3OXAA 4ZM8A 1EEJA 2E2UA 3ECFA 1JB4A 2CWVA 3STDA 4BL2A 1BSCA 2WOFA 5A0OB 5AEUB 4MEIA 3KZTA 4O8SA 1RGAA 2C4BA 2K54A 4FMAA 3DGLA 1X1XA 5LC6A 4OUQA 3U97A 3PGBA 1HU9A 3M8CA 3CCE3 1Q7HA 1RGKA 1QJGA 2WO0A 3WOEB 2XEPA 2Z6BA 3WR2A 1VQM3 1EA2A 1Q814 4L8OA 2GXFA 5JBSA 6RNTA 3SOYA 2RCDA 5IG4A 1BNFA 4LMIA 2W0QA 1RCLA 2CH9A 4R80A 5AI1A 3D5GA 3KCHA 1G02A 1LNIA 3NXJA 1N9JA 4X2HA 1MGRA 1B21A 4HM6B 2F98A 3WHOA 1BNIA 1VQN3 4N6NB 1TP6A 1VQ43 3D9RA 3G4S3 2KF6A 1Q42A 2GU3A 1AQZA 1V57A 4HBRA 1RNTA 3WDGB 2BO9B 1X1YA 2OWPA 3BNCA 4XDVA 4X2OA 1K41A 2I9WA 3GRDA 4HM8B 4IPBA 3I563 2K0MA 3WOFB 1KC84 1VQ73 1W01A 1OH0A 3FZWA 3F14A 2A15A 3HI7A 4JRFA 4R9LA 3UNLA 1Q864 2IYJA 1ISKA 1FW7A 4KFFA 3JUQA 4O2HA 5EVHA 1OACA 1WNHA 1VQ93 4K61A 3SLUA 1YNVX 2D42A 1I2GA 1FGTA 1E97A 1NB5I 1BRHA 3V92A 3GZBA 3K5TA 7GSPA 1YIJ3 3UB1A 3G16A 1RRLA 2CHCA 5RNTA 5AYRB 5KP3A 3V98A 3JUMA 5BVBA 3NQZA 1RNBA 1W6CA 5IEPA 1I3IA 2ZHXB 1VQK3 1BIRA 2XRXB 3B8LA 3QRDA 4HJLB 2OCTA 1GD4A 3CCS3 1M1K4
chains in the Genus database with same CATH topology
3NHXA 1OGXA 3MPHA 3ER7A 1YJN3 1YHQ3 1DMQA 1GY7A 4RZMA 1UI7A 3OWUA 1AVKA 5IF6A 1O7GB 1W5ZA 1J2BA 2Z7AA 5TGNA 2D1WA 3F40A 1ULIB 2W9QA 5AEWB 2ZDJA 3MYTA 2CG0A 3LMLA 4AKZA 3BNBA 3LXUX 1IVUA 1TU5A 1O7PB 4WFOA 1C7HA 3CC23 3NQYA 1RKYA 3CCJ3 3EJVA 3WA2X 1SIIA 2C10A 1O7WB 2IMJA 5AIFA 1N5HA 2ML5A 2Y74A 1M1XB 2C11A 3CCM3 7STDA 1TFKA 3V99A 1NDOB 1GYBA 1N8QA 3X41A 1NO3A 1WTHA 3DXOA 2IA7A 4OVMA 5IG3A 1W4NA 2FGTA 4Q53A 3NX0A 3FCSB 3FG3A 1RN7A 1JJ22 1DVDA 3LTBA 3QK9A 1YVBI 3LYGA 3PCSA 3DMCA 5ELJA 3PYJA 3KN4A 5D83A 4OK0A 4AEQA 3OWYA 3UL5A 3FSDA 1SPUA 3EF8A 3NV0B 1IDPA 1KQS2 1OCVA 3PZWA 2PNCA 1CQSA 2W04A 3FKAA 4HM5B 2GEYA 3NV0A 2CFWA 3HK4A 3S28A 4N6TA 2M7OA 4N6UA 1PFPA 4HM0B 1LNHA 1K28A 3G8ZA 1STFI 2RSXA 3JVCA 3X3XA 2MC8A 3G713 2P0XA 4IIAA 1IT8A 3DM8A 3MG1A 2XFTA 1FGQA 2GEXA 2BMRB 3HIGA 2Z76A 4KZ1A 2CW9A 5CLKA 2WOHA 3CCR3 2Z77A 2F86B 1IQYA 5I97A 1UUVB 3OX9A 3FG4A 4HZBB 4NHFA 2W03A 3CC43 1JV2B 1Q824 1D6YA 3ALAA 4MMYB 3UL6A 3X3YA 1A2KA 3H51A 1F8NA 4XM4A 2CFKA 3X42A 3N8BA 3KE7A 2WGQA 2BT3A 3HX8A 1OGZA 4EBGA 4LGQA 4MMZB 1LVNA 3CPOA 3NBBA 1KSIA 1V74A 4RBNA 1STDA 3LH4A 1DYUA 1ROAA 3EE1A 3LT9A 1W7CA 2P05A 3NM2A 3DGOA 1AVLA 1GY5A 1MOLA 1WMOA 3F8HA 8CHOA 3CNXA 3CCV3 3B4OA 2XH9A 3Q2PA 1Z1SA 5D82A 2BMQB 3WA3A 1U8CB 4MJDA 4I4KA 3FLJA 1VQ83 2E2TA 3NBRA 2W2CA 2KRTA 1JB5A 4K1VA 1CYUA 5IEOA 3GAXA 3MWZA 4LEHA 1S723 2CFLA 2JDIH 3BNEA 1K734 1JN5B 1VQP3 2CC3A 1UI8A 2QA43 2Q07A 3CXC2 1TFOA 2QGUA 3MG2A 4L8PA 4WYKA 3RGAA 1JN5A 4FMCA 1JKGB 1W6GA 5KP1A 3UJMA 4GL6A 4N6V0 2LYXA 5LC7A 5AIIA 1JKGA 4EYCA 1K8A4 1RRHA 3L0RA 1QAFA 5ELUA 2QEX3 2QIYA 3SXXA 4ORLA 3VGNA 4K90B 3EHCA 1Y4KA 1A67A 3GZYB 1W00A 3EQQB 4HM1B 4NREA 1SIHA 1M9GA 5FW5A 1MNLA 3HIIA 4EC6A 1D6UA 3SEDA 5CF1A 1EQKA 3CMA3 2B24B 5AIGA 1U5OA 4N6LA 3T8UA 1Q7Y4 2HMMB 2P0MA 3CPW2 5AYSC 5CK6A 2HMOB 4HVNA 3CCU3 1W02A 1FGMA 1W6YA 2OQEA 3WMDA 2HMJB 1DVCA 2STDA 1IQ8A 2UX0A 2FXTA 2O9UX 1VQO3 2RGQA 2LQVA 4J8TA 4O3VA 2CFGA 4R4KA 2CIUA 3NUVA 2INXA 1SJWA 3OW22 2XF3A 2PZVA 3I0YA 2CG1A 3A76A 2YFLB 2W9PA 5DRVA 4JF8A 2OOVA 2KXGA 4HM2B 3RGRA 3ROBA 1IVVA 4R1KA 2ML6A 3EN1B 1CEWI 5IG0A 5KP4A 4CCVA 2XFSA 2L4VA 3X3ZA 1O7HB 2BNGA 3Q90A 1KD14 2KCDA 5FGOA 5D81A 3MG3A 2XR8B 3DY5A 1JB2A 2BMOB 1L5GB 3CCQ3 1NJI4 1S5AA 1QAKA 4RNYA 4TX4A 3VF1A 2FNQA 3K7CA 3CD63 1IK3A 4FCJA 1O7MB 3S67A 4STDA 4BTWA 1DMMA 4U13A 1YIT3 1G96A 1JRQA 3FH1A 1FGRA 3LTAA 1WMPA 1GS3A 3MKIA 1R4CA 3EN8A 4XBXA 1FUWA 4IT7A 2E2VA 3GZXB 1IU7A 4FMBA 4EXRA 1OPYA 1VZZA 4EV2A 3JUOA 2GBXB 3EB8A 1YJ93 1W2B2 3D3LA 3LTCA 5IERA 4HYZA 1TUHA 3KFQC 3HZPA 1UW1A 3Q1CA 1T5YA 3GWRA 3JUNA 3FGYA 1N9EA 3H3HA 4N3VA 3VSYA 4G1MB 3AMOB 1YGEA 4LSOA 1VQL3 1IQXA 1KWIA 1HKXA 2HMLB 4BTXA 3F7SA 3AMOA 4HKVB 5IW9A 4CDLA 1FA3A 1JNQA 3LZAA 3WODG 3KSPA 5IG5A 3N54B 4H3UA 3F8XA 2SBLA 2W56B 3GZRA 1AR0A 1LOXA 2YFJB 4LZIA 3CCL3 2YFIB 3BB9A 1VQ53 2V1LA 2O3OA 2MF7A 2W56A 3K0ZA 3PXMA 1E3VA 3DUKA 1W2ZA 3LOYA 5CXOA 4BTYA 2CWUA 2YX9A 1N5PA 4PEJA 3IPTA 4WYKB 3X40A 1WMNA 2BHMA 3CC73 2HMNB 5STDA 5BXQA 2WGOA 4XDWA 1ZO2A 2B1XB 3S5CA 1NB3I 1IV7A 3F9SA 1US1A 5G2GA 1OHOA 2ZL8A 3DGNA 1TIJA 1OHSA 4FCMA 2RFRA 2GU1A 3N9HA 3E99A 5JPUA 1QVG2 3S27A 3J7Yd 1ULJB 2XSHB 4R9KA 3FF0A 5DREA 3G6E3 4J9AA 1PU4A 1QMAA 3CU3A 3LT8A 1N8R4 3DGMA 2W6JH 2XGNA 1NWWA 1WQLB 3PCRA 3U1WA 4L7KA 4HM4B 4XBYA 4N6MA 1FGOA 3NM7A 4RNZA 5HGRA 3S29A 3F7XA 3SX1A 1D6ZA 3IJEB 1ASKA 3SOAA 2OTL3 3RDEA 4AKYA 3MSOA 4EV5A 4FR9A 3PS8A 5CF2A 2XGLA 5EQLA 1EKMA 1DMNA 2CFDA 1A2VA 3CNMA 3EX9A 3NBJA 2R4IA 2CK3H 2OQEC 3T8NA 3K63A 2Y73A 1UUWB 2CWTA 3EC9A 1IT7A 3OV4A 6STDA 3MHEA 1OF5B 3FF2A 4WHAA 1K9M4 1Q40B 4HZ9B 1EG9B 1M904 4O02B 1OF5A 1OHPA 1Q40A 4H61A 2GBWB 5JPPA 1GY6A 1ROVA 1QALA 1GD3A 4XBTA 4K1UA 3CME3 3JUPA 1CYVA 1IVXA 2OOVC 3EBYA 3FG1A 2JQ5A 4HM3B 2IUKA 3DZLA 3KKGA 3T0UA 3BLZA 3BNDA 1A90A 4WWUC 3K9MC 4KFDA 4WP5A 5EEOA 3O8YA 3TDGA 5AIHA 3B4PA 2OTJ3 4KFEA 1BUQA 2P38A 3KSED 1E3RA 2F99A 1O7NB 4FCZA 4QWTA 3SVAA 4MMXB 1ZX2A 4GB5A 4N6OB 1QVF2 3G0KA 2IUJA 1AV4A 2HMKB 4HM7B 3EBTA 1YI23 3B7CA 1YJW3 1NU3A 4KVHA 2CKFB 4XB5A 3LTDA 5IENA 1IVWA 3KIIA 3I553 1VQ63 1SQWA 2XSOB 2P09A 1RJOA 3OWSA 1IV9A 1OUNA 4FMDA 1LXEA 3IMAB 3OXAA 4ZM8A 2E2UA 3STDA 3ECFA 1JB4A 2CWVA 5A0OB 5AEUB 2WOFA 4MEIA 3KZTA 4O8SA 2K54A 4FMAA 3DGLA 5LC6A 4OUQA 3U97A 3PGBA 1HU9A 3M8CA 3CCE3 2WO0A 1QJGA 3WOEB 2XEPA 2Z6BA 1VQM3 1EA2A 1Q814 4L8OA 2GXFA 5JBSA 3SOYA 2RCDA 5IG4A 4LMIA 2W0QA 2CH9A 4R80A 5AI1A 3NXJA 1N9JA 4X2HA 4HM6B 2F98A 1VQN3 4N6NB 1TP6A 1VQ43 3D9RA 3G4S3 1Q42A 2GU3A 4HBRA 3WDGB 2BO9B 2OWPA 3BNCA 4XDVA 4X2OA 1K41A 2I9WA 3GRDA 4HM8B 4IPBA 3I563 2K0MA 3WOFB 1KC84 1VQ73 1W01A 1OH0A 3FZWA 3F14A 2A15A 3HI7A 4JRFA 4R9LA 3UNLA 1Q864 1ISKA 4KFFA 3JUQA 4O2HA 5EVHA 1OACA 1WNHA 1VQ93 4K61A 3SLUA 2D42A 1FGTA 1E97A 1NB5I 3V92A 3GZBA 3K5TA 1YIJ3 3UB1A 3G16A 1RRLA 2CHCA 5AYRB 5KP3A 3V98A 3JUMA 5BVBA 3NQZA 1W6CA 5IEPA 1VQK3 2XRXB 3B8LA 3QRDA 4HJLB 2OCTA 1GD4A 3CCS3 1M1K4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHX A;  1OGX A;  3ER7 A;  1DMQ A;  1GY7 A;  4RZM A;  3OWU A;  5IF6 A;  1O7G B;  2Z7A A;  5TGN A;  3F40 A;  1ULI B;  5AEW B;  3MYT A;  1O7P B;  1C7H A;  3EJV A;  1O7W B;  2IMJ A;  5AIF A;  7STD A;  1NDO B;  1GYB A;  3DXO A;  4OVM A;  5IG3 A;  4Q53 A;  3LYG A;  3DMC A;  5D83 A;  3OWY A;  3FSD A;  3NV0 B;  3EF8 A;  1IDP A;  1OCV A;  1CQS A;  3FKA A;  4HM5 B;  2GEY A;  3NV0 A;  3HK4 A;  4HM0 B;  3G8Z A;  4IIA A;  3DM8 A;  3MG1 A;  2GEX A;  2BMR B;  2Z76 A;  5CLK A;  2Z77 A;  2F86 B;  1UUV B;  3OX9 A;  4HZB B;  1A2K A;  3H51 A;  4XM4 A;  3KE7 A;  3HX8 A;  1OGZ A;  4LGQ A;  3CPO A;  1STD A;  3NM2 A;  1GY5 A;  3F8H A;  8CHO A;  3CNX A;  3B4O A;  1Z1S A;  5D82 A;  2BMQ B;  4MJD A;  4I4K A;  3FLJ A;  3NBR A;  2W2C A;  1JB5 A;  4K1V A;  5IEO A;  4LEH A;  1JN5 B;  2QGU A;  3RGA A;  3MG2 A;  4L8P A;  4WYK A;  1JN5 A;  1JKG B;  5KP1 A;  3UJM A;  5AII A;  1JKG A;  2QIY A;  4ORL A;  3VGN A;  3EHC A;  3GZY B;  1W00 A;  3EQQ B;  4HM1 B;  5FW5 A;  3SED A;  5CF1 A;  2B24 B;  5AIG A;  1U5O A;  3T8U A;  2HMM B;  5CK6 A;  2HMO B;  4HVN A;  1W02 A;  1W6Y A;  3WMD A;  2HMJ B;  2STD A;  2UX0 A;  2RGQ A;  4J8T A;  3NUV A;  2INX A;  1SJW A;  2PZV A;  3I0Y A;  3A76 A;  2YFL B;  5DRV A;  4HM2 B;  3RGR A;  3ROB A;  4R1K A;  3EN1 B;  5IG0 A;  5KP4 A;  1O7H B;  2BNG A;  3Q90 A;  5D81 A;  3MG3 A;  2XR8 B;  1JB2 A;  2BMO B;  1S5A A;  3K7C A;  4FCJ A;  1O7M B;  4STD A;  1DMM A;  4U13 A;  3FH1 A;  1GS3 A;  3MKI A;  3EN8 A;  4XBX A;  3GZX B;  1OPY A;  1VZZ A;  3JUO A;  2GBX B;  5IER A;  1TUH A;  3HZP A;  3GWR A;  3JUN A;  4N3V A;  3FGY A;  3H3H A;  3VSY A;  1HKX A;  2HML B;  3F7S A;  4HKV B;  4CDL A;  3LZA A;  3KSP A;  5IG5 A;  4H3U A;  3F8X A;  3GZR A;  1AR0 A;  2YFJ B;  2YFI B;  3BB9 A;  3K0Z A;  1E3V A;  3DUK A;  5CXO A;  4PEJ A;  3IPT A;  4WYK B;  2HMN B;  5STD A;  5BXQ A;  4XDW A;  1ZO2 A;  2B1X B;  3S5C A;  3F9S A;  5G2G A;  1OHO A;  4FCM A;  1OHS A;  2RFR A;  3E99 A;  5JPU A;  1ULJ B;  2XSH B;  4R9K A;  3FF0 A;  5DRE A;  4J9A A;  1QMA A;  3CU3 A;  1NWW A;  1WQL B;  4L7K A;  4HM4 B;  4XBY A;  5HGR A;  3F7X A;  1ASK A;  3SOA A;  3MSO A;  5CF2 A;  1DMN A;  3CNM A;  3EX9 A;  2R4I A;  3T8N A;  1UUW B;  3EC9 A;  6STD A;  3OV4 A;  3MHE A;  1OF5 B;  3FF2 A;  1Q40 B;  4HZ9 B;  1EG9 B;  1OF5 A;  1OHP A;  1Q40 A;  5JPP A;  2GBW B;  1GY6 A;  4XBT A;  4K1U A;  3JUP A;  3EBY A;  2JQ5 A;  4HM3 B;  3DZL A;  3KKG A;  3BLZ A;  4WWU C;  4WP5 A;  5AIH A;  3B4P A;  1BUQ A;  1E3R A;  2F99 A;  1O7N B;  1ZX2 A;  4GB5 A;  3G0K A;  2HMK B;  4HM7 B;  3EBT A;  3B7C A;  1NU3 A;  4KVH A;  2CKF B;  4XB5 A;  5IEN A;  2XSO B;  3OWS A;  1OUN A;  3OXA A;  3STD A;  3ECF A;  1JB4 A;  5AEU B;  3KZT A;  2K54 A;  4OUQ A;  3M8C A;  1QJG A;  1EA2 A;  4L8O A;  2GXF A;  3SOY A;  2RCD A;  5IG4 A;  4LMI A;  5AI1 A;  3NXJ A;  4X2H A;  4HM6 B;  2F98 A;  1TP6 A;  3D9R A;  1Q42 A;  2OWP A;  4XDV A;  4X2O A;  1K41 A;  2I9W A;  3GRD A;  4HM8 B;  1W01 A;  1OH0 A;  3FZW A;  3F14 A;  2A15 A;  3UNL A;  4R9L A;  1ISK A;  3JUQ A;  5EVH A;  1E97 A;  3GZB A;  3G16 A;  2CHC A;  5KP3 A;  3JUM A;  5BVB A;  5IEP A;  2XRX B;  3B8L A;  4HJL B; 
#chains in the Genus database with same CATH topology
 3NHX A;  1OGX A;  1RGF A;  3MPH A;  4I5Q A;  3ER7 A;  3BU4 A;  1YJN 3;  1YHQ 3;  4HOH A;  1DMQ A;  1GY7 A;  1HZ1 A;  1MWU A;  1UI7 A;  4RZM A;  3OWU A;  1AVK A;  5IF6 A;  1O7G B;  1W5Z A;  1J2B A;  2Z7A A;  5TGN A;  3AGN A;  2D1W A;  1GMR A;  1FUS A;  1UCL A;  1UCI A;  3F40 A;  1ULI B;  2W9Q A;  5AEW B;  5BIR A;  2ZDJ A;  3MYT A;  2CG0 A;  3LML A;  5G1L A;  1SAR A;  3BNB A;  3LXU X;  1IVU A;  4AKZ A;  1TU5 A;  1RGL A;  1O7P B;  4WFO A;  5HOH A;  1EUI C;  1RMS A;  5M18 A;  1C7H A;  3CC2 3;  4NPB A;  3NQY A;  2CX0 A;  1RKY A;  3CCJ 3;  3EJV A;  2CX1 A;  1SII A;  1PYL A;  1RCK A;  3DGY A;  2C10 A;  1O7W B;  2IMJ A;  5AIF A;  3WA2 X;  1N5H A;  2ML5 A;  2Y74 A;  1AY7 A;  1M1X B;  2C11 A;  5GSP A;  3CCM 3;  7STD A;  1BNJ A;  1TFK A;  3V99 A;  1NDO B;  1GYB A;  1N8Q A;  1RLS A;  3X41 A;  4KT3 B;  1NO3 A;  1WTH A;  3DXO A;  2IA7 A;  4OVM A;  2AAD A;  1W4N A;  2FGT A;  4Q53 A;  3NX0 A;  3FCS B;  3FG3 A;  1RN7 A;  4CJN A;  5IG3 A;  1JJ2 2;  1DVD A;  3LTB A;  1GOY A;  4RNT A;  3QK9 A;  1YVB I;  3LYG A;  3PCS A;  3DMC A;  5ELJ A;  3PYJ A;  1RGG A;  3KN4 A;  5D83 A;  4OK0 A;  4AEQ A;  3OWY A;  3UL5 A;  3FSD A;  1SPU A;  3EF8 A;  3NV0 B;  1FYS A;  1BNG A;  1IDP A;  1KQS 2;  1OCV A;  3PZW A;  2PNC A;  1CQS A;  2W04 A;  3FKA A;  4HM5 B;  2GEY A;  3NV0 A;  2CFW A;  3HK4 A;  3S28 A;  4N6T A;  2M7O A;  1C54 A;  4N6U A;  1PFP A;  4HM0 B;  3HOH A;  1BAN A;  1LNH A;  1K28 A;  1RSN A;  2BU4 A;  3G8Z A;  4GHO A;  1STF I;  1FUT A;  2RSX A;  3JVC A;  3X3X A;  2MC8 A;  3G71 3;  4BL3 A;  1B2M A;  2P0X A;  4IIA A;  1IT8 A;  1MGW A;  3DM8 A;  3MG1 A;  1I2E A;  3ZG0 A;  2XFT A;  1FGQ A;  2GEX A;  2BMR B;  2H0I A;  3HIG A;  2Z76 A;  4KZ1 A;  2CW9 A;  5CLK A;  2WOH A;  3A5E A;  2Z77 A;  3CCR 3;  1T2I A;  2F86 B;  1IQY A;  5I97 A;  1UUV B;  3OX9 A;  1JBT A;  3FG4 A;  4HZB B;  4NHF A;  2W03 A;  3CC4 3;  1JV2 B;  1HYF A;  1Q82 4;  1D6Y A;  3ALA A;  4MMY B;  1I2F A;  3UL6 A;  3X3Y A;  1A2K A;  3H51 A;  1BSD A;  1F8N A;  1BRG A;  5BU4 A;  1BRN L;  4XM4 A;  2CFK A;  3X42 A;  3N8B A;  3KE7 A;  1JZO A;  2WGQ A;  2BT3 A;  3HX8 A;  1OGZ A;  4EBG A;  4LGQ A;  4MMZ B;  1LVN A;  3CPO A;  3NBB A;  1KSI A;  1V74 A;  4RBN A;  1STD A;  2SAR A;  3LH4 A;  1DYU A;  1ROA A;  1TRQ A;  3EE1 A;  3LT9 A;  1W7C A;  1JZD A;  2P05 A;  3NM2 A;  3DGO A;  1X1W A;  1AVL A;  1GY5 A;  1MOL A;  1WMO A;  2R41 A;  3CNX A;  3F8H A;  3B4O A;  5G1K A;  8CHO A;  3CCV 3;  1I70 A;  2XH9 A;  3Q2P A;  1Z1S A;  5D82 A;  2BMQ B;  3RNT A;  3WA3 A;  1U8C B;  4MJD A;  2F5W A;  4I4K A;  1BNE A;  3FLJ A;  2KF5 A;  1VQ8 3;  2E2T A;  3NBR A;  2W2C A;  1BSB A;  2F4Y A;  2KRT A;  1BVI A;  1JB5 A;  4K1V A;  1CYU A;  5IEO A;  3GAX A;  3MWZ A;  4LEH A;  1LQG C;  2CFL A;  2JDI H;  3BNE A;  1S72 3;  1JN5 B;  1VQP 3;  1K73 4;  2CC3 A;  1B3S A;  1UI8 A;  2QA4 3;  2Q07 A;  1BUJ A;  2ZA4 A;  3CXC 2;  1UGH I;  1TFO A;  2QGU A;  3MG2 A;  4L8P A;  4WYK A;  3RGA A;  1JN5 A;  4FMC A;  1JKG B;  1RGH A;  1W6G A;  5KP1 A;  1B27 A;  3UJM A;  4GL6 A;  4N6V 0;  5M1A A;  1RGC A;  2LYX A;  5LC7 A;  1ZGX A;  5AII A;  1JKG A;  4EYC A;  1K8A 4;  1RRH A;  3L0R A;  1QAF A;  2KAA A;  5ELU A;  4BU4 A;  2QEX 3;  2QIY A;  3SXX A;  2H0H A;  3D5I A;  4ORL A;  3VGN A;  4K90 B;  3EHC A;  1Y4K A;  1I0V A;  1A67 A;  3GZY B;  1W00 A;  2F56 A;  1RHL A;  3EQQ B;  4HM1 B;  4NRE A;  1SIH A;  1M9G A;  1BOX A;  5FW5 A;  4CPK A;  1MNL A;  3HII A;  4EC6 A;  1D6U A;  3SED A;  5CF1 A;  1EQK A;  3CMA 3;  2B24 B;  5AIG A;  1U5O A;  4N6L A;  3T8U A;  1BNS A;  1Q7Y 4;  2HMM B;  1VQQ A;  2P0M A;  3CPW 2;  5AYS C;  5CK6 A;  1X1U A;  2HMO B;  4HVN A;  4LYL B;  1DET A;  3CCU 3;  1W02 A;  1FGM A;  1W6Y A;  2OQE A;  3WMD A;  2HMJ B;  1DVC A;  2STD A;  1IQ8 A;  2L1S A;  2UX0 A;  3D79 A;  1BRS A;  2FXT A;  2O9U X;  1PY3 A;  1YGW A;  1VQO 3;  7RNT A;  2RGQ A;  2LQV A;  4J8T A;  1BRI A;  2CFG A;  4O3V A;  4R4K A;  1B2S A;  2CIU A;  3NUV A;  2INX A;  1FZU A;  1SJW A;  3OW2 2;  2XF3 A;  2PZV A;  3I0Y A;  2CG1 A;  3A76 A;  2YFL B;  2W9P A;  5DRV A;  4JF8 A;  2OOV A;  2KXG A;  3DH2 A;  4HM2 B;  1R4Y A;  1BSA A;  3RGR A;  3ROB A;  1IVV A;  4R1K A;  2ML6 A;  3EN1 B;  1CEW I;  5IG0 A;  5KP4 A;  1B2X A;  4CCV A;  2XFS A;  1UDI I;  2L4V A;  3X3Z A;  3AGO A;  4J5K A;  1O7H B;  2BNG A;  3Q90 A;  1DE3 A;  1KD1 4;  2KCD A;  5FGO A;  1UGI A;  5D81 A;  3MG3 A;  2XR8 B;  3DY5 A;  1JB2 A;  2BMO B;  3ZFZ A;  1L5G B;  2GSP A;  3CCQ 3;  1NJI 4;  1S5A A;  1QAK A;  4RNY A;  3AHW A;  4TX4 A;  3VF1 A;  2FNQ A;  3K7C A;  3CD6 3;  1IK3 A;  4FCJ A;  1O7M B;  3S67 A;  4STD A;  4BTW A;  1DMM A;  4U13 A;  1YIT 3;  1G96 A;  1JRQ A;  3FH1 A;  1FGR A;  2K3D A;  3LTA A;  1WMP A;  1GS3 A;  3MKI A;  1BSE A;  1R4C A;  3EN8 A;  1MWR A;  4XBX A;  1LOY A;  4IT7 A;  2E2V A;  1FUW A;  9RNT A;  3GZX B;  1IU7 A;  4FMB A;  1GMP A;  4EXR A;  1OPY A;  1B2Z A;  1VZZ A;  4J5G A;  6GSP A;  4EV2 A;  2BIR A;  2GBX B;  3EB8 A;  3JUO A;  8RNT A;  1YJ9 3;  1W2B 2;  3D3L A;  3LTC A;  5IER A;  2AAE A;  4HYZ A;  1TUH A;  1GMQ A;  3KFQ C;  3HZP A;  1UW1 A;  3Q1C A;  1MWT A;  1T5Y A;  1B20 A;  1UCK A;  3FGY A;  1N9E A;  3GWR A;  3H3H A;  3JUN A;  4G1M B;  4N3V A;  3VSY A;  1BRJ A;  1I3F A;  3AMO B;  1YGE A;  4LSO A;  1VQL 3;  1IQX A;  1KWI A;  1HKX A;  2HML B;  4BTX A;  3F7S A;  3AMO A;  4HKV B;  5IW9 A;  1RDS A;  4CDL A;  1FA3 A;  1JNQ A;  3LZA A;  3WOD G;  1IYY A;  3KSP A;  5IG5 A;  2RNT A;  3N54 B;  4H3U A;  3F8X A;  2SBL A;  2W56 B;  3GZR A;  1AR0 A;  3BIR A;  1LOX A;  2YFJ B;  4LZI A;  3CCL 3;  2YFI B;  3BB9 A;  1VQ5 3;  2V1L A;  2O3O A;  2MF7 A;  2W56 A;  3K0Z A;  3PXM A;  1E3V A;  1RGE A;  3DUK A;  1TRP A;  1W2Z A;  1YVS A;  3LOY A;  5CXO A;  4BTY A;  2CWU A;  4DKI A;  2YX9 A;  1N5P A;  4PEJ A;  1BNR A;  3IPT A;  4WYK B;  3X40 A;  1WMN A;  2BHM A;  3CC7 3;  2HMN B;  5STD A;  5BXQ A;  2WGO A;  4XDW A;  1ZO2 A;  3SYU A;  1RTU A;  2B1X B;  3S5C A;  1NB3 I;  1GOV A;  1IV7 A;  3F9S A;  1US1 A;  5G2G A;  1OHO A;  2ZL8 A;  3DGN A;  2F5M A;  1JBS A;  1TIJ A;  1NNV A;  1OHS A;  4FCM A;  3D4A A;  1LQM B;  2RFR A;  2GU1 A;  3N9H A;  3E99 A;  1RN1 A;  5JPU A;  1QVG 2;  3S27 A;  3J7Y d;  1ULJ B;  2XSH B;  4R9K A;  3FF0 A;  1BGS A;  5DRE A;  3G6E 3;  4J9A A;  1PU4 A;  1QMA A;  1Q9E A;  1T2H A;  1RN4 A;  3CU3 A;  3LT8 A;  1N8R 4;  3DGM A;  2HOH A;  1TJD A;  2W6J H;  2XGN A;  1NWW A;  1WQL B;  3PCR A;  3U1W A;  4L7K A;  4HM4 B;  4XBY A;  4N6M A;  1LRA A;  4GSP A;  1FGO A;  4EW5 A;  1JBR A;  3NM7 A;  4RNZ A;  5HGR A;  3S29 A;  3F7X A;  4ILF A;  3SX1 A;  1D6Z A;  1G0T A;  3GSP A;  1ASK A;  3IJE B;  3SOA A;  2OTL 3;  3RDE A;  4AKY A;  3MSO A;  4EV5 A;  4FR9 A;  3PS8 A;  5CF2 A;  2KF4 A;  2XGL A;  5EQL A;  1EKM A;  1DMN A;  2CFD A;  1A2V A;  3CNM A;  3EX9 A;  3URP A;  3NBJ A;  2R4I A;  1CH0 A;  2CK3 H;  2OQE C;  3T8N A;  3K63 A;  2Y73 A;  1UUW B;  2CWT A;  3EC9 A;  1IT7 A;  3OV4 A;  6STD A;  3MHE A;  1UUG B;  1OF5 B;  3FF2 A;  4WHA A;  1K9M 4;  1B2U A;  1Q40 B;  3Q3F A;  4HZ9 B;  2UUG C;  2RBI A;  1EG9 B;  1M90 4;  4O02 B;  1BU4 A;  1OF5 A;  1UCJ A;  1OHP A;  1Q40 A;  4H61 A;  2GBW B;  5JPP A;  1GY6 A;  1ROV A;  1QAL A;  1GD3 A;  1T3B A;  4XBT A;  4K1U A;  1BRK A;  2H0G A;  3CME 3;  3JUP A;  1CYV A;  1IVX A;  2OOV C;  3EBY A;  3FG1 A;  2IY2 A;  2JQ5 A;  1LOV A;  4HM3 B;  2IUK A;  2KF3 A;  3DZL A;  1MWS A;  3KKG A;  3T0U A;  3BLZ A;  3BND A;  1A90 A;  4WWU C;  3K9M C;  2J8X B;  1GOU A;  4KFD A;  1LOW A;  3AHS A;  4WP5 A;  5M19 A;  5EEO A;  1TTO A;  3O8Y A;  3TDG A;  5AIH A;  1I8V A;  3ZG5 A;  1GSP A;  3B4P A;  2OTJ 3;  1V58 A;  4KFE A;  1BUQ A;  4BIR A;  1BAO A;  2P38 A;  3KSE D;  1E3R A;  2F99 A;  1O7N B;  4FCZ A;  4QWT A;  3SVA A;  4MMX B;  1ZX2 A;  4GB5 A;  4N6O B;  1QVF 2;  3G0K A;  2IUJ A;  1AV4 A;  2HMK B;  1ZS7 A;  4HM7 B;  3EBT A;  1YI2 3;  3B7C A;  1YJW 3;  1NU3 A;  4KVH A;  2CKF B;  4XB5 A;  1I0X A;  3LTD A;  2UGI A;  1IVW A;  5IEN A;  3KII A;  1A2P A;  3I55 3;  1VQ6 3;  1SQW A;  2XSO B;  2P09 A;  1RJO A;  3OWS A;  1IV9 A;  1OUN A;  4FMD A;  4HAA A;  1LXE A;  3IMA B;  3OXA A;  4ZM8 A;  1EEJ A;  2E2U A;  3ECF A;  1JB4 A;  2CWV A;  3STD A;  4BL2 A;  1BSC A;  2WOF A;  5A0O B;  5AEU B;  4MEI A;  3KZT A;  4O8S A;  1RGA A;  2C4B A;  2K54 A;  4FMA A;  3DGL A;  1X1X A;  5LC6 A;  4OUQ A;  3U97 A;  3PGB A;  1HU9 A;  3M8C A;  3CCE 3;  1Q7H A;  1RGK A;  1QJG A;  2WO0 A;  3WOE B;  2XEP A;  2Z6B A;  3WR2 A;  1VQM 3;  1EA2 A;  1Q81 4;  4L8O A;  2GXF A;  5JBS A;  6RNT A;  3SOY A;  2RCD A;  5IG4 A;  1BNF A;  4LMI A;  2W0Q A;  1RCL A;  2CH9 A;  4R80 A;  5AI1 A;  3D5G A;  3KCH A;  1G02 A;  1LNI A;  3NXJ A;  1N9J A;  4X2H A;  1MGR A;  1B21 A;  4HM6 B;  2F98 A;  3WHO A;  1BNI A;  1VQN 3;  4N6N B;  1TP6 A;  1VQ4 3;  3D9R A;  3G4S 3;  2KF6 A;  1Q42 A;  2GU3 A;  1AQZ A;  1V57 A;  4HBR A;  1RNT A;  3WDG B;  2BO9 B;  1X1Y A;  2OWP A;  3BNC A;  4XDV A;  4X2O A;  1K41 A;  2I9W A;  3GRD A;  4HM8 B;  4IPB A;  3I56 3;  2K0M A;  3WOF B;  1KC8 4;  1VQ7 3;  1W01 A;  1OH0 A;  3FZW A;  3F14 A;  2A15 A;  3HI7 A;  4JRF A;  4R9L A;  3UNL A;  1Q86 4;  2IYJ A;  1ISK A;  1FW7 A;  4KFF A;  3JUQ A;  4O2H A;  5EVH A;  1OAC A;  1WNH A;  1VQ9 3;  4K61 A;  3SLU A;  1YNV X;  2D42 A;  1I2G A;  1FGT A;  1E97 A;  1NB5 I;  1BRH A;  3V92 A;  3GZB A;  3K5T A;  7GSP A;  1YIJ 3;  3UB1 A;  3G16 A;  1RRL A;  2CHC A;  5RNT A;  5AYR B;  5KP3 A;  3V98 A;  3JUM A;  5BVB A;  3NQZ A;  1RNB A;  1W6C A;  5IEP A;  1I3I A;  2ZHX B;  1VQK 3;  1BIR A;  2XRX B;  3B8L A;  3QRD A;  4HJL B;  2OCT A;  1GD4 A;  3CCS 3;  1M1K 4; 
#chains in the Genus database with same CATH homology
 3NHX A;  1OGX A;  3MPH A;  3ER7 A;  1YJN 3;  1YHQ 3;  1DMQ A;  1GY7 A;  4RZM A;  1UI7 A;  3OWU A;  1AVK A;  5IF6 A;  1O7G B;  1W5Z A;  1J2B A;  2Z7A A;  5TGN A;  2D1W A;  3F40 A;  1ULI B;  2W9Q A;  5AEW B;  2ZDJ A;  3MYT A;  2CG0 A;  3LML A;  4AKZ A;  3BNB A;  3LXU X;  1IVU A;  1TU5 A;  1O7P B;  4WFO A;  1C7H A;  3CC2 3;  3NQY A;  1RKY A;  3CCJ 3;  3EJV A;  3WA2 X;  1SII A;  2C10 A;  1O7W B;  2IMJ A;  5AIF A;  1N5H A;  2ML5 A;  2Y74 A;  1M1X B;  2C11 A;  3CCM 3;  7STD A;  1TFK A;  3V99 A;  1NDO B;  1GYB A;  1N8Q A;  3X41 A;  1NO3 A;  1WTH A;  3DXO A;  2IA7 A;  4OVM A;  5IG3 A;  1W4N A;  2FGT A;  4Q53 A;  3NX0 A;  3FCS B;  3FG3 A;  1RN7 A;  1JJ2 2;  1DVD A;  3LTB A;  3QK9 A;  1YVB I;  3LYG A;  3PCS A;  3DMC A;  5ELJ A;  3PYJ A;  3KN4 A;  5D83 A;  4OK0 A;  4AEQ A;  3OWY A;  3UL5 A;  3FSD A;  1SPU A;  3EF8 A;  3NV0 B;  1IDP A;  1KQS 2;  1OCV A;  3PZW A;  2PNC A;  1CQS A;  2W04 A;  3FKA A;  4HM5 B;  2GEY A;  3NV0 A;  2CFW A;  3HK4 A;  3S28 A;  4N6T A;  2M7O A;  4N6U A;  1PFP A;  4HM0 B;  1LNH A;  1K28 A;  3G8Z A;  1STF I;  2RSX A;  3JVC A;  3X3X A;  2MC8 A;  3G71 3;  2P0X A;  4IIA A;  1IT8 A;  3DM8 A;  3MG1 A;  2XFT A;  1FGQ A;  2GEX A;  2BMR B;  3HIG A;  2Z76 A;  4KZ1 A;  2CW9 A;  5CLK A;  2WOH A;  3CCR 3;  2Z77 A;  2F86 B;  1IQY A;  5I97 A;  1UUV B;  3OX9 A;  3FG4 A;  4HZB B;  4NHF A;  2W03 A;  3CC4 3;  1JV2 B;  1Q82 4;  1D6Y A;  3ALA A;  4MMY B;  3UL6 A;  3X3Y A;  1A2K A;  3H51 A;  1F8N A;  4XM4 A;  2CFK A;  3X42 A;  3N8B A;  3KE7 A;  2WGQ A;  2BT3 A;  3HX8 A;  1OGZ A;  4EBG A;  4LGQ A;  4MMZ B;  1LVN A;  3CPO A;  3NBB A;  1KSI A;  1V74 A;  4RBN A;  1STD A;  3LH4 A;  1DYU A;  1ROA A;  3EE1 A;  3LT9 A;  1W7C A;  2P05 A;  3NM2 A;  3DGO A;  1AVL A;  1GY5 A;  1MOL A;  1WMO A;  3F8H A;  8CHO A;  3CNX A;  3CCV 3;  3B4O A;  2XH9 A;  3Q2P A;  1Z1S A;  5D82 A;  2BMQ B;  3WA3 A;  1U8C B;  4MJD A;  4I4K A;  3FLJ A;  1VQ8 3;  2E2T A;  3NBR A;  2W2C A;  2KRT A;  1JB5 A;  4K1V A;  1CYU A;  5IEO A;  3GAX A;  3MWZ A;  4LEH A;  1S72 3;  2CFL A;  2JDI H;  3BNE A;  1K73 4;  1JN5 B;  1VQP 3;  2CC3 A;  1UI8 A;  2QA4 3;  2Q07 A;  3CXC 2;  1TFO A;  2QGU A;  3MG2 A;  4L8P A;  4WYK A;  3RGA A;  1JN5 A;  4FMC A;  1JKG B;  1W6G A;  5KP1 A;  3UJM A;  4GL6 A;  4N6V 0;  2LYX A;  5LC7 A;  5AII A;  1JKG A;  4EYC A;  1K8A 4;  1RRH A;  3L0R A;  1QAF A;  5ELU A;  2QEX 3;  2QIY A;  3SXX A;  4ORL A;  3VGN A;  4K90 B;  3EHC A;  1Y4K A;  1A67 A;  3GZY B;  1W00 A;  3EQQ B;  4HM1 B;  4NRE A;  1SIH A;  1M9G A;  5FW5 A;  1MNL A;  3HII A;  4EC6 A;  1D6U A;  3SED A;  5CF1 A;  1EQK A;  3CMA 3;  2B24 B;  5AIG A;  1U5O A;  4N6L A;  3T8U A;  1Q7Y 4;  2HMM B;  2P0M A;  3CPW 2;  5AYS C;  5CK6 A;  2HMO B;  4HVN A;  3CCU 3;  1W02 A;  1FGM A;  1W6Y A;  2OQE A;  3WMD A;  2HMJ B;  1DVC A;  2STD A;  1IQ8 A;  2UX0 A;  2FXT A;  2O9U X;  1VQO 3;  2RGQ A;  2LQV A;  4J8T A;  4O3V A;  2CFG A;  4R4K A;  2CIU A;  3NUV A;  2INX A;  1SJW A;  3OW2 2;  2XF3 A;  2PZV A;  3I0Y A;  2CG1 A;  3A76 A;  2YFL B;  2W9P A;  5DRV A;  4JF8 A;  2OOV A;  2KXG A;  4HM2 B;  3RGR A;  3ROB A;  1IVV A;  4R1K A;  2ML6 A;  3EN1 B;  1CEW I;  5IG0 A;  5KP4 A;  4CCV A;  2XFS A;  2L4V A;  3X3Z A;  1O7H B;  2BNG A;  3Q90 A;  1KD1 4;  2KCD A;  5FGO A;  5D81 A;  3MG3 A;  2XR8 B;  3DY5 A;  1JB2 A;  2BMO B;  1L5G B;  3CCQ 3;  1NJI 4;  1S5A A;  1QAK A;  4RNY A;  4TX4 A;  3VF1 A;  2FNQ A;  3K7C A;  3CD6 3;  1IK3 A;  4FCJ A;  1O7M B;  3S67 A;  4STD A;  4BTW A;  1DMM A;  4U13 A;  1YIT 3;  1G96 A;  1JRQ A;  3FH1 A;  1FGR A;  3LTA A;  1WMP A;  1GS3 A;  3MKI A;  1R4C A;  3EN8 A;  4XBX A;  1FUW A;  4IT7 A;  2E2V A;  3GZX B;  1IU7 A;  4FMB A;  4EXR A;  1OPY A;  1VZZ A;  4EV2 A;  3JUO A;  2GBX B;  3EB8 A;  1YJ9 3;  1W2B 2;  3D3L A;  3LTC A;  5IER A;  4HYZ A;  1TUH A;  3KFQ C;  3HZP A;  1UW1 A;  3Q1C A;  1T5Y A;  3GWR A;  3JUN A;  3FGY A;  1N9E A;  3H3H A;  4N3V A;  3VSY A;  4G1M B;  3AMO B;  1YGE A;  4LSO A;  1VQL 3;  1IQX A;  1KWI A;  1HKX A;  2HML B;  4BTX A;  3F7S A;  3AMO A;  4HKV B;  5IW9 A;  4CDL A;  1FA3 A;  1JNQ A;  3LZA A;  3WOD G;  3KSP A;  5IG5 A;  3N54 B;  4H3U A;  3F8X A;  2SBL A;  2W56 B;  3GZR A;  1AR0 A;  1LOX A;  2YFJ B;  4LZI A;  3CCL 3;  2YFI B;  3BB9 A;  1VQ5 3;  2V1L A;  2O3O A;  2MF7 A;  2W56 A;  3K0Z A;  3PXM A;  1E3V A;  3DUK A;  1W2Z A;  3LOY A;  5CXO A;  4BTY A;  2CWU A;  2YX9 A;  1N5P A;  4PEJ A;  3IPT A;  4WYK B;  3X40 A;  1WMN A;  2BHM A;  3CC7 3;  2HMN B;  5STD A;  5BXQ A;  2WGO A;  4XDW A;  1ZO2 A;  2B1X B;  3S5C A;  1NB3 I;  1IV7 A;  3F9S A;  1US1 A;  5G2G A;  1OHO A;  2ZL8 A;  3DGN A;  1TIJ A;  1OHS A;  4FCM A;  2RFR A;  2GU1 A;  3N9H A;  3E99 A;  5JPU A;  1QVG 2;  3S27 A;  3J7Y d;  1ULJ B;  2XSH B;  4R9K A;  3FF0 A;  5DRE A;  3G6E 3;  4J9A A;  1PU4 A;  1QMA A;  3CU3 A;  3LT8 A;  1N8R 4;  3DGM A;  2W6J H;  2XGN A;  1NWW A;  1WQL B;  3PCR A;  3U1W A;  4L7K A;  4HM4 B;  4XBY A;  4N6M A;  1FGO A;  3NM7 A;  4RNZ A;  5HGR A;  3S29 A;  3F7X A;  3SX1 A;  1D6Z A;  3IJE B;  1ASK A;  3SOA A;  2OTL 3;  3RDE A;  4AKY A;  3MSO A;  4EV5 A;  4FR9 A;  3PS8 A;  5CF2 A;  2XGL A;  5EQL A;  1EKM A;  1DMN A;  2CFD A;  1A2V A;  3CNM A;  3EX9 A;  3NBJ A;  2R4I A;  2CK3 H;  2OQE C;  3T8N A;  3K63 A;  2Y73 A;  1UUW B;  2CWT A;  3EC9 A;  1IT7 A;  3OV4 A;  6STD A;  3MHE A;  1OF5 B;  3FF2 A;  4WHA A;  1K9M 4;  1Q40 B;  4HZ9 B;  1EG9 B;  1M90 4;  4O02 B;  1OF5 A;  1OHP A;  1Q40 A;  4H61 A;  2GBW B;  5JPP A;  1GY6 A;  1ROV A;  1QAL A;  1GD3 A;  4XBT A;  4K1U A;  3CME 3;  3JUP A;  1CYV A;  1IVX A;  2OOV C;  3EBY A;  3FG1 A;  2JQ5 A;  4HM3 B;  2IUK A;  3DZL A;  3KKG A;  3T0U A;  3BLZ A;  3BND A;  1A90 A;  4WWU C;  3K9M C;  4KFD A;  4WP5 A;  5EEO A;  3O8Y A;  3TDG A;  5AIH A;  3B4P A;  2OTJ 3;  4KFE A;  1BUQ A;  2P38 A;  3KSE D;  1E3R A;  2F99 A;  1O7N B;  4FCZ A;  4QWT A;  3SVA A;  4MMX B;  1ZX2 A;  4GB5 A;  4N6O B;  1QVF 2;  3G0K A;  2IUJ A;  1AV4 A;  2HMK B;  4HM7 B;  3EBT A;  1YI2 3;  3B7C A;  1YJW 3;  1NU3 A;  4KVH A;  2CKF B;  4XB5 A;  3LTD A;  5IEN A;  1IVW A;  3KII A;  3I55 3;  1VQ6 3;  1SQW A;  2XSO B;  2P09 A;  1RJO A;  3OWS A;  1IV9 A;  1OUN A;  4FMD A;  1LXE A;  3IMA B;  3OXA A;  4ZM8 A;  2E2U A;  3STD A;  3ECF A;  1JB4 A;  2CWV A;  5A0O B;  5AEU B;  2WOF A;  4MEI A;  3KZT A;  4O8S A;  2K54 A;  4FMA A;  3DGL A;  5LC6 A;  4OUQ A;  3U97 A;  3PGB A;  1HU9 A;  3M8C A;  3CCE 3;  2WO0 A;  1QJG A;  3WOE B;  2XEP A;  2Z6B A;  1VQM 3;  1EA2 A;  1Q81 4;  4L8O A;  2GXF A;  5JBS A;  3SOY A;  2RCD A;  5IG4 A;  4LMI A;  2W0Q A;  2CH9 A;  4R80 A;  5AI1 A;  3NXJ A;  1N9J A;  4X2H A;  4HM6 B;  2F98 A;  1VQN 3;  4N6N B;  1TP6 A;  1VQ4 3;  3D9R A;  3G4S 3;  1Q42 A;  2GU3 A;  4HBR A;  3WDG B;  2BO9 B;  2OWP A;  3BNC A;  4XDV A;  4X2O A;  1K41 A;  2I9W A;  3GRD A;  4HM8 B;  4IPB A;  3I56 3;  2K0M A;  3WOF B;  1KC8 4;  1VQ7 3;  1W01 A;  1OH0 A;  3FZW A;  3F14 A;  2A15 A;  3HI7 A;  4JRF A;  4R9L A;  3UNL A;  1Q86 4;  1ISK A;  4KFF A;  3JUQ A;  4O2H A;  5EVH A;  1OAC A;  1WNH A;  1VQ9 3;  4K61 A;  3SLU A;  2D42 A;  1FGT A;  1E97 A;  1NB5 I;  3V92 A;  3GZB A;  3K5T A;  1YIJ 3;  3UB1 A;  3G16 A;  1RRL A;  2CHC A;  5AYR B;  5KP3 A;  3V98 A;  3JUM A;  5BVB A;  3NQZ A;  1W6C A;  5IEP A;  1VQK 3;  2XRX B;  3B8L A;  3QRD A;  4HJL B;  2OCT A;  1GD4 A;  3CCS 3;  1M1K 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...