1S723

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1s72300
1K9M4 3CCJ3 3G6E3 1YIJ3 3CC73 1VQ93 1M1K4 1KQS2 1QVG2 3CCS3 1VQO3 1Q814 3CCU3 3CPW2 1YI23 1Q864 1NJI4 1VQ53 3CC43 1K734 2QEX3 3CCV3 3CMA3 1S723 3CC23 1VQ73 1VQK3 3CXC2 1VQL3 3CCM3 3I553 1Q7Y4 2OTJ3 1YHQ3 1JJ22 1M904 1YJ93 1W2B2 1N8R4 1KD14 3I563 1Q824 1K8A4 1VQ83 3G713 1VQ63 3CCL3 1QVF2 3OW22 1YIT3 1VQM3 3G4S3 3CCQ3 3CD63 1KC84 3CCE3 3CME3 1VQP3 1YJN3 2QA43 1VQN3 1YJW3 2OTL3 1VQ43 3CCR3
chains in the Genus database with same CATH superfamily
2K3DA 2W04A 1IK3A 2K54A 3DUKA 3BNCA 1FW7A 3H3HA 1YIJ3 3OWUA 1IVWA 1QVG2 1RNBA 3NQZA 2KRTA 3B7CA 2RNTA 3EE1A 1UUVB 4I4KA 3CXC2 1JNQA 4NPBA 3DGMA 1Q7Y4 3GRDA 2P09A 1JJ22 2Z6BA 5D83A 3RNTA 1E3RA 5AEWB 1W7CA 4LYLB 3CCL3 1US1A 1R4YA 3HI7A 1DE3A 1C54A 1N9JA 1AVKA 1BNFA 2B1XB 3N54B 5M1AA 1O7PB 3G4S3 4AKZA 2GEYA 3K7CA 2WO0A 2UGIA 3ZG5A 1BNGA 3NV0B 1IT7A 2A15A 4HBRA 5G1KA 1RGFA 3Q3FA 3AGNA 4HM0B 3CC73 1TRQA 7GSPA 4GSPA 2ML6A 3MHEA 2XGLA 3WOFB 1FUSA 3ALAA 5IF6A 1FGOA 5IG5A 1VQO3 1Y4KA 1SARA 4FMDA 1VZZA 2CG1A 3PXMA 3CCV3 4GL6A 3CMA3 1Q40A 2ZL8A 2JQ5A 3X41A 3F8HA 3DGLA 3D3LA 1E97A 3BIRA 4MMXB 3S27A 3WMDA 4BTXA 2V1LA 3G713 3VGNA 3KIIA 3OW22 1G0TA 1M9GA 2GU1A 2OWPA 3VSYA 3GZYB 1W5ZA 4O02B 3UJMA 1YJN3 1W6GA 2BMQB 1IVVA 4WFOA 2KF5A 1GOUA 1IQ8A 4N6MA 4O3VA 1GSPA 1W2ZA 1UI8A 1EUIC 1RGKA 4FCZA 4K61A 3LTDA 5HGRA 3SX1A 1TRPA 2KAAA 2OQEA 3LT8A 1WMPA 1GY6A 1I8VA 6RNTA 4IPBA 3I553 2RSXA 3WODG 5G1LA 1AVLA 1BSAA 3ER7A 1BRKA 5IEPA 3IPTA 3STDA 1JZDA 1X1YA 1W02A 5CLKA 1RGHA 3OV4A 3B4OA 2KCDA 1B2MA 2GBXB 5IERA 1JN5A 3V98A 1PY3A 1BRHA 2R41A 5LC7A 1GY7A 3CME3 5BU4A 1W6CA 2F86B 3PCSA 1DETA 3CNMA 1A2PA 3HIIA 2CWUA 3NHXA 2H0HA 1ZX2A 3RGAA 3JUOA 2OQEC 5GSPA 1IV9A 4HKVB 3V99A 3U1WA 1PYLA 5AEUB 2MF7A 3KCHA 2IYJA 2CFLA 1STFI 4HZ9B 4CDLA 8CHOA 1VQK3 5EVHA 4K1VA 5FW5A 1MOLA 2CX0A 1I0XA 1ULJB 3IMAB 1B20A 1O7MB 1YJ93 3DM8A 1I0VA 2P0XA 1BANA 2XR8B 3EJVA 4AEQA 3ECFA 3LT9A 3JUNA 1Q42A 1RRHA 5JPUA 1E3VA 3DGOA 1VQM3 2HMOB 3NM7A 5D82A 4N6TA 2AADA 1O7HB 1TIJA 4ILFA 3CCE3 1VQP3 1U8CB 3HOHA 3FF2A 1JB4A 4LEHA 1N5HA 4RNZA 1FUTA 4JRFA 3BNBA 1LOWA 1V74A 4LSOA 1B27A 1BRSA 3BNEA 3EX9A 1NJI4 2ZHXB 1Q864 4HVNA 3HIGA 3F40A 1NB5I 4EC6A 3MG2A 1LXEA 2RGQA 4J9AA 2XFSA 3CCM3 1GMRA 4EV5A 4CCVA 4FCMA 4MEIA 4HM1B 2O3OA 6GSPA 1T2IA 1OHOA 2F98A 3FLJA 1B2UA 1BOXA 3MG1A 1OGZA 1UUGB 3QK9A 4BIRA 3F7XA 5AIHA 3EN1B 2IMJA 4Q53A 4QWTA 1DMNA 4RNTA 1RTUA 2KF6A 3EB8A 1RHLA 3KKGA 1O7GB 1MGWA 3E99A 3SLUA 2CK3H 1LQMB 3TDGA 1JBTA 2KF3A 3FSDA 4OUQA 1BSEA 3CCU3 1S5AA 2P05A 1DMMA 2GU3A 2I9WA 3KFQC 3CC23 1DVDA 3NV0A 3Q2PA 3CNXA 3JUQA 1OF5B 1Z1SA 4HM6B 2CFGA 3L0RA 1NNVA 5IEOA 1UGHI 2XSOB 3S5CA 3O8YA 1NWWA 4HM3B 4BL2A 1K8A4 1BUQA 1VQ83 1RN1A 1LOVA 1IDPA 1NB3I 1RCKA 3D5IA 3RDEA 2BHMA 1FA3A 7RNTA 4RNYA 5I97A 2WOFA 1R4CA 1N5PA 2LYXA 2QA43 1BNEA 1HYFA 2INXA 5LC6A 3S67A 3CCR3 2OTL3 1ISKA 1B2SA 1G02A 2ML5A 3FCSB 2UUGC 2D1WA 3ROBA 4HM5B 3T8UA 5IG4A 4I5QA 4X2HA 4DKIA 2HMNB 1VQ93 1BNRA 1VQ53 3NBRA 1B3SA 4NREA 2W56B 2CFDA 1HKXA 2OCTA 4KVHA 6STDA 2Y74A 5AYSC 1S723 1RGCA 2CFWA 1IU7A 1TJDA 2W0QA 1TFKA 1UCJA 1BU4A 5G2GA 1X1WA 2BNGA 1LRAA 3T8NA 2OTJ3 1OHSA 2AAEA 2YFJB 1NO3A 2W9PA 3DGYA 3MG3A 4X2OA 1Q824 1RJOA 1VQ63 4N6LA 1UGIA 1MNLA 4EYCA 1OGXA 1D6YA 1SQWA 3N8BA 1I2EA 1OACA 4K90B 3UL5A 3X40A 1C7HA 1YVBI 1I2FA 1B2ZA 1PU4A 3EQQB 2WOHA 2L1SA 4R80A 1BRJA 2FNQA 1RCLA 2PNCA 1JB5A 1UI7A 3NQYA 4TX4A 1A90A 3LZAA 1F8NA 5M18A 1D6ZA 1TP6A 2F5WA 1J2BA 3GZXB 3V92A 2QEX3 2MC8A 3GAXA 3K0ZA 4N6NB 1OHPA 1BSCA 2W6JH 1B21A 3SEDA 1YVSA 3WOEB 2C4BA 4FMAA 1RNTA 2PZVA 3CPOA 3NXJA 1N8R4 4WP5A 1GS3A 3DXOA 2Z7AA 1UCLA 4EXRA 1IQXA 3GZBA 1MWRA 1YNVX 3A5EA 3EHCA 4MJDA 1RGAA 1CYVA 1CH0A 1JKGB 1GMPA 1JB2A 2XGNA 1MWUA 2CG0A 3D4AA 3U97A 2RFRA 1BRNL 4N6V0 2XFTA 3DMCA 4U13A 1GD4A 1UCKA 3AMOB 4XBXA 5ELUA 3SOYA 1RGLA 1QMAA 4KFEA 3VF1A 2CKFB 1M1XB 3PCRA 4WWUC 1Q814 3LTCA 3KSED 4L8OA 1I3IA 1K734 1WTHA 2JDIH 3JVCA 4N3VA 3PYJA 5RNTA 1VQ73 1BSDA 1EG9B 2OOVC 4HJLB 3H51A 1ROAA 3D79A 2C10A 3I0YA 4XDWA 5AIGA 3UL6A 5JPPA 3EC9A 1BSBA 1W6YA 2HOHA 4L7KA 5BIRA 1RGEA 2CHCA 1O7WB 1KD14 3BLZA 4KFDA 1KWIA 4XB5A 3S29A 2E2VA 3DY5A 1U5OA 1A2KA 3LTBA 4GB5A 1W4NA 1WQLB 1RN4A 4K1UA 2YFIB 3Q1CA 3WHOA 4JF8A 1NU3A 1UW1A 4WYKA 4HM7B 3BNDA 1I70A 1WMNA 4R9KA 5KP4A 1AY7A 1DYUA 1RLSA 3EN8A 2FXTA 1Q9EA 5EQLA 3S28A 3LMLA 3NM2A 4N6OB 3JUMA 3CC43 1MGRA 4AKYA 5IG0A 4G1MB 1JZOA 2GSPA 1UDII 1PFPA 1TTOA 9RNTA 5CK6A 4H3UA 1YGWA 1W00A 4R9LA 4WHAA 2IA7A 1FGRA 4WYKB 2CIUA 3D9RA 3ZFZA 3X3ZA 2BU4A 1V58A 1KSIA 1T5YA 2W9QA 5AYRB 3FGYA 4FMCA 2Q07A 4XDVA 3Q90A 3MWZA 4XBYA 2BMRB 1LOXA 1OF5A 1DMQA 3FKAA 4BTWA 5CXOA 1BAOA 5STDA 4HOHA 3PS8A 3OXAA 1HU9A 3LTAA 4LZIA 1SPUA 3CCJ3 3WA2X 3G6E3 1RKYA 4IIAA 1FZUA 5AIIA 3PZWA 4STDA 4RBNA 4O8SA 2HMMB 5KP3A 1YI23 1T2HA 4BU4A 5AIFA 3DH2A 3MYTA 5KP1A 2GEXA 5ELJA 4EBGA 1UCIA 2FGTA 2YFLB 2CFKA 3MKIA 4BL3A 3SOAA 2W56A 2C11A 4O2HA 2IUKA 1MWTA 3AGOA 3K63A 2RCDA 3IJEB 2WGOA 4HYZA 1BRIA 1STDA 4FMBA 4KFFA 1IV7A 2ZA4A 3CCQ3 3CD63 1VQN3 1RDSA 2XEPA 4R1KA 3BB9A 1IVXA 1VQ43 4RZMA 1JRQA 3DZLA 3LH4A 3SXXA 1K9M4 2F99A 4HM8B 2ZDJA 4GHOA 4EW5A 1K28A 1CYUA 3FF0A 1ZO2A 1AR0A 2HMKB 3D5GA 3OWYA 2W2CA 3PGBA 1W01A 1RN7A 2LQVA 3KSPA 5FGOA 1X1UA 1ZGXA 3JUPA 3RGRA 1N8QA 5TGNA 2H0GA 1D6UA 1W2B2 1TFOA 3T0UA 2Z76A 1OH0A 4XM4A 3MSOA 5IG3A 3UB1A 3FZWA 1VQQA 4NHFA 2CH9A 3G8ZA 4LGQA 2M7OA 1QALA 5BXQA 2O9UX 5A0OB 4L8PA 1EQKA 4HM4B 4BTYA 1O7NB 2L4VA 2IY2A 5CF2A 1BNJA 2KF4A 1TU5A 1A67A 1V57A 3X42A 3J7Yd 1TUHA 3LOYA 3OX9A 5EEOA 2KXGA 2YX9A 3A76A 1IYYA 2HMJB 3CCS3 1JKGA 1LOYA 1RSNA 3EF8A 3LXUX 5DREA 2BT3A 4ORLA 1G96A 1GOVA 1BUJA 1LNIA 1VQL3 1GYBA 3AHSA 3AMOA 1Q7HA 4FR9A 2GBWB 1MWSA 2E2TA 2B24B 4R4KA 1YHQ3 4J5GA 4J8TA 2BMOB 2BIRA 1JBRA 1EEJA 2F56A 1K41A 2STDA 3FG4A 2OOVA 3B8LA 4HZBB 1IVUA 2RBIA 5IENA 5JBSA 3DGNA 1WMOA 4HM2B 3F14A 2H0IA 3G16A 3WA3A 4EV2A 4H61A 1GOYA 4N6UA 1OUNA 1EA2A 3K9MC 1Q40B 1SIHA 1GD3A 2D42A 3KE7A 2F4YA 2UX0A 2W03A 8RNTA 1CQSA 3N9HA 1GMQA 1SJWA 3NBJA 3B4PA 3NBBA 2WGQA 1FGTA 4J5KA 1HZ1A 3HX8A 1FYSA 1BRGA 1N9EA 1NDOB 1OPYA 1T3BA 4PEJA 1LNHA 1CEWI 1SIIA 3M8CA 1RRLA 7STDA 2R4IA 2SBLA 3AHWA 1LQGC 4XBTA 3WDGB 3X3XA 2XRXB 5CF1A 5IW9A 3I563 2P0MA 1QAFA 4MMYB 3MPHA 1ZS7A 1QVF2 3F9SA 2CW9A 2XF3A 2K0MA 3K5TA 1JV2B 2GXFA 1BNIA 3FH1A 4KT3B 3FG1A 2CWVA 1KC84 1AQZA 3GSPA 4HAAA 3HZPA 1ROVA 3URPA 1YJW3 3UNLA 1A2VA 2CX1A 3SVAA 3NUVA 2F5MA 1BVIA 3FG3A 3OWSA 4CJNA 2E2UA 1WNHA 4IT7A 1M1K4 3EBTA 1KQS2 2XSHB 3KZTA 3ZG0A 5M19A 1EKMA 1GY5A 3G0KA 1IT8A 1I3FA 5AI1A 4ZM8A 2Y73A 1JN5B 1I2GA 1BNSA 3EBYA 1M904 3X3YA 3WR2A 1FUWA 1B2XA 1RMSA 3GZRA 1FGQA 1QAKA 4LMIA 1FGMA 2SARA 1IQYA 3HK4A 1X1XA 1LVNA 4FCJA 3KN4A 1L5GB 2Z77A 2CC3A 1OCVA 3QRDA 4MMZB 5BVBA 1JBSA 5D81A 2HMLB 1ASKA 1RGGA 3NX0A 4OK0A 3BU4A 3CPW2 3F7SA 5DRVA 1BIRA 2J8XB 1QJGA 1BGSA 1DVCA 4KZ1A 1ULIB 3GWRA 4OVMA 1UUWB 1AV4A 4CPKA 2QGUA 5HOHA 2BO9B 1YIT3 1YGEA 2QIYA 3F8XA 3LYGA 3SYUA 2XH9A 2IUJA 2P38A 3CU3A 2CWTA
chains in the Genus database with same CATH topology
2W04A 1IK3A 2K54A 3DUKA 3BNCA 3H3HA 1YIJ3 3OWUA 1IVWA 1QVG2 3NQZA 2KRTA 3B7CA 3EE1A 1UUVB 4I4KA 3CXC2 1JNQA 3DGMA 1Q7Y4 3GRDA 2P09A 1JJ22 2Z6BA 5D83A 1E3RA 5AEWB 1W7CA 3CCL3 1US1A 3HI7A 1N9JA 1AVKA 2B1XB 3N54B 1O7PB 3G4S3 4AKZA 2GEYA 3K7CA 2WO0A 3NV0B 1IT7A 2A15A 4HBRA 4HM0B 3CC73 2ML6A 3MHEA 2XGLA 3WOFB 3ALAA 5IF6A 5IG5A 1FGOA 1VQO3 1Y4KA 4FMDA 1VZZA 2CG1A 3PXMA 3CCV3 4GL6A 3CMA3 1Q40A 2ZL8A 2JQ5A 3X41A 3F8HA 3DGLA 3D3LA 1E97A 4MMXB 3S27A 3WMDA 4BTXA 2V1LA 3G713 3VGNA 3KIIA 3OW22 1M9GA 2GU1A 2OWPA 3VSYA 3GZYB 1W5ZA 4O02B 3UJMA 1YJN3 1W6GA 2BMQB 1IVVA 4WFOA 1IQ8A 4N6MA 4O3VA 1W2ZA 1UI8A 4FCZA 4K61A 3LTDA 5HGRA 3SX1A 2OQEA 3LT8A 1WMPA 1GY6A 4IPBA 3I553 2RSXA 3WODG 1AVLA 3ER7A 5IEPA 3IPTA 3STDA 1W02A 5CLKA 3OV4A 3B4OA 2KCDA 2GBXB 5IERA 1JN5A 3V98A 5LC7A 3CME3 1GY7A 1W6CA 2F86B 3PCSA 3CNMA 3HIIA 2CWUA 3NHXA 1ZX2A 3RGAA 3JUOA 2OQEC 1IV9A 4HKVB 3V99A 3U1WA 5AEUB 2MF7A 2CFLA 1STFI 4HZ9B 4CDLA 8CHOA 1VQK3 5EVHA 4K1VA 5FW5A 1MOLA 1ULJB 3IMAB 1O7MB 1YJ93 3DM8A 2P0XA 2XR8B 3EJVA 4AEQA 3ECFA 3LT9A 3JUNA 1Q42A 1RRHA 5JPUA 1E3VA 3DGOA 1VQM3 2HMOB 3NM7A 5D82A 4N6TA 1O7HB 1TIJA 3CCE3 1VQP3 1U8CB 3FF2A 1JB4A 4LEHA 1N5HA 4RNZA 4JRFA 3BNBA 1V74A 4LSOA 3BNEA 3EX9A 1NJI4 1Q864 4HVNA 3HIGA 3F40A 1NB5I 4EC6A 3MG2A 1LXEA 2RGQA 4J9AA 2XFSA 3CCM3 4EV5A 4CCVA 4FCMA 4MEIA 4HM1B 2O3OA 1OHOA 2F98A 3FLJA 3MG1A 1OGZA 3QK9A 3F7XA 5AIHA 3EN1B 2IMJA 4Q53A 4QWTA 1DMNA 3EB8A 3KKGA 1O7GB 3E99A 3SLUA 2CK3H 3TDGA 3FSDA 4OUQA 3CCU3 1S5AA 2P05A 1DMMA 2GU3A 2I9WA 3KFQC 3CC23 1DVDA 3NV0A 3Q2PA 3CNXA 3JUQA 1OF5B 1Z1SA 4HM6B 2CFGA 3L0RA 5IEOA 2XSOB 3S5CA 3O8YA 1NWWA 4HM3B 1K8A4 1BUQA 1VQ83 3RDEA 1IDPA 1NB3I 2BHMA 1FA3A 4RNYA 5I97A 2WOFA 1R4CA 1N5PA 2LYXA 2QA43 2INXA 2OTL3 3CCR3 5LC6A 3S67A 1ISKA 3FCSB 2ML5A 3ROBA 5IG4A 2D1WA 3T8UA 4HM5B 4X2HA 1VQ93 2HMNB 1VQ53 3NBRA 4NREA 2W56B 2CFDA 1HKXA 2OCTA 4KVHA 6STDA 2Y74A 5AYSC 1S723 2CFWA 1IU7A 2W0QA 1TFKA 5G2GA 2BNGA 2OTJ3 3T8NA 1OHSA 2YFJB 1NO3A 2W9PA 4X2OA 3MG3A 1Q824 1RJOA 1VQ63 4N6LA 1MNLA 4EYCA 1OGXA 1D6YA 1SQWA 3N8BA 1OACA 4K90B 3UL5A 3X40A 1C7HA 1YVBI 1PU4A 3EQQB 2WOHA 4R80A 4TX4A 2FNQA 2PNCA 1A90A 1JB5A 1UI7A 3NQYA 3LZAA 1F8NA 1D6ZA 1TP6A 1J2BA 3GZXB 3V92A 2QEX3 2MC8A 3GAXA 3K0ZA 4N6NB 1OHPA 2W6JH 3SEDA 3WOEB 4FMAA 2PZVA 3CPOA 3NXJA 1N8R4 4WP5A 1GS3A 3DXOA 2Z7AA 4EXRA 1IQXA 3GZBA 3EHCA 4MJDA 1CYVA 1JKGB 3U97A 1JB2A 2XGNA 2CG0A 2RFRA 4N6V0 2XFTA 3DMCA 4U13A 1GD4A 3AMOB 5ELUA 4XBXA 3SOYA 4KFEA 1QMAA 3VF1A 2CKFB 1M1XB 3PCRA 4WWUC 1Q814 3LTCA 3KSED 4L8OA 1K734 1WTHA 2JDIH 3JVCA 4N3VA 3PYJA 1VQ73 1EG9B 2OOVC 4HJLB 3H51A 1ROAA 3I0YA 2C10A 5AIGA 4XDWA 3UL6A 5JPPA 3EC9A 1W6YA 4L7KA 2CHCA 1O7WB 1KD14 3BLZA 4KFDA 1KWIA 4XB5A 3S29A 2E2VA 3DY5A 1U5OA 1A2KA 3LTBA 4GB5A 1W4NA 1WQLB 4K1UA 2YFIB 3Q1CA 4JF8A 1NU3A 1UW1A 4WYKA 4HM7B 3BNDA 1WMNA 4R9KA 5KP4A 1DYUA 3EN8A 2FXTA 5EQLA 3S28A 3LMLA 3NM2A 4N6OB 3JUMA 3CC43 4AKYA 5IG0A 4G1MB 1PFPA 5CK6A 4H3UA 1W00A 4R9LA 4WHAA 2IA7A 1FGRA 4WYKB 2CIUA 3D9RA 3X3ZA 1KSIA 1T5YA 2W9QA 5AYRB 3FGYA 4FMCA 2Q07A 4XDVA 3Q90A 3MWZA 4XBYA 2BMRB 1LOXA 1OF5A 1DMQA 3FKAA 4BTWA 5CXOA 5STDA 3PS8A 3OXAA 1HU9A 3LTAA 4LZIA 1SPUA 3CCJ3 3WA2X 3G6E3 1RKYA 4IIAA 5AIIA 3PZWA 4STDA 4RBNA 4O8SA 2HMMB 5KP3A 1YI23 5AIFA 3MYTA 5KP1A 2GEXA 5ELJA 4EBGA 2FGTA 2YFLB 2CFKA 3MKIA 3SOAA 2W56A 2C11A 4O2HA 2IUKA 3K63A 2RCDA 3IJEB 2WGOA 4HYZA 1STDA 4KFFA 4FMBA 1IV7A 3CCQ3 3CD63 1VQN3 2XEPA 4R1KA 3BB9A 1IVXA 1VQ43 4RZMA 1JRQA 3DZLA 3LH4A 3SXXA 1K9M4 2F99A 4HM8B 2ZDJA 1K28A 1CYUA 3FF0A 1ZO2A 1AR0A 2HMKB 3OWYA 3PGBA 2W2CA 1W01A 1RN7A 2LQVA 3KSPA 5FGOA 3JUPA 3RGRA 1N8QA 5TGNA 1D6UA 1W2B2 1TFOA 3T0UA 2Z76A 1OH0A 4XM4A 3MSOA 5IG3A 3UB1A 3FZWA 4NHFA 2CH9A 3G8ZA 4LGQA 2M7OA 1QALA 5BXQA 2O9UX 5A0OB 4L8PA 1EQKA 4HM4B 4BTYA 1O7NB 2L4VA 5CF2A 1TU5A 1A67A 3X42A 3J7Yd 1TUHA 3LOYA 3OX9A 5EEOA 2KXGA 2YX9A 3A76A 2HMJB 3CCS3 1JKGA 3EF8A 5DREA 3LXUX 2BT3A 4ORLA 1G96A 1VQL3 1GYBA 3AMOA 4FR9A 2GBWB 2E2TA 2B24B 4R4KA 1YHQ3 4J8TA 2BMOB 1K41A 2STDA 3FG4A 2OOVA 3B8LA 4HZBB 1IVUA 5JBSA 5IENA 3DGNA 1WMOA 4HM2B 3F14A 3G16A 3WA3A 4EV2A 4H61A 4N6UA 1OUNA 1EA2A 3K9MC 1Q40B 1SIHA 1GD3A 2D42A 3KE7A 2W03A 2UX0A 1CQSA 3N9HA 1SJWA 3NBJA 3B4PA 3NBBA 2WGQA 1FGTA 3HX8A 1OPYA 1N9EA 1NDOB 4PEJA 1LNHA 1CEWI 1SIIA 3M8CA 1RRLA 7STDA 2R4IA 2SBLA 5CF1A 3X3XA 4XBTA 3WDGB 5IW9A 2XRXB 3I563 2P0MA 1QAFA 4MMYB 3MPHA 1QVF2 3F9SA 2CW9A 2XF3A 2K0MA 3K5TA 1JV2B 2GXFA 3FH1A 3FG1A 2CWVA 1KC84 3HZPA 1ROVA 1YJW3 3UNLA 1A2VA 3SVAA 3NUVA 3FG3A 3OWSA 2E2UA 1WNHA 4IT7A 1M1K4 3EBTA 1KQS2 2XSHB 3KZTA 1EKMA 1GY5A 3G0KA 1IT8A 5AI1A 4ZM8A 2Y73A 1JN5B 3EBYA 1M904 3X3YA 1FUWA 3GZRA 1FGQA 1QAKA 4LMIA 1FGMA 1IQYA 3HK4A 1LVNA 4FCJA 3KN4A 1L5GB 2Z77A 2CC3A 1OCVA 3QRDA 4MMZB 5BVBA 5D81A 2HMLB 1ASKA 3NX0A 4OK0A 3CPW2 3F7SA 5DRVA 1QJGA 1DVCA 4KZ1A 1ULIB 3GWRA 4OVMA 1UUWB 1AV4A 2QGUA 2BO9B 1YIT3 1YGEA 2QIYA 3F8XA 3LYGA 2XH9A 2IUJA 2P38A 3CU3A 2CWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 4;  3CCJ 3;  3G6E 3;  1YIJ 3;  3CC7 3;  1VQ9 3;  1M1K 4;  1KQS 2;  1QVG 2;  3CCS 3;  1VQO 3;  1Q81 4;  3CCU 3;  3CPW 2;  1YI2 3;  1Q86 4;  1NJI 4;  1VQ5 3;  3CC4 3;  1K73 4;  2QEX 3;  3CCV 3;  3CMA 3;  1S72 3;  3CC2 3;  1VQ7 3;  1VQK 3;  3CXC 2;  1VQL 3;  3CCM 3;  3I55 3;  1Q7Y 4;  2OTJ 3;  1YHQ 3;  1JJ2 2;  1M90 4;  1YJ9 3;  1W2B 2;  1N8R 4;  1KD1 4;  3I56 3;  1Q82 4;  1K8A 4;  1VQ8 3;  3G71 3;  1VQ6 3;  3CCL 3;  1QVF 2;  3OW2 2;  1YIT 3;  1VQM 3;  3G4S 3;  3CCQ 3;  3CD6 3;  1KC8 4;  3CCE 3;  3CME 3;  1VQP 3;  1YJN 3;  2QA4 3;  1VQN 3;  1YJW 3;  2OTL 3;  1VQ4 3;  3CCR 3; 
#chains in the Genus database with same CATH topology
 2K3D A;  2W04 A;  1IK3 A;  2K54 A;  3DUK A;  3BNC A;  1FW7 A;  3H3H A;  1YIJ 3;  3OWU A;  1IVW A;  1QVG 2;  1RNB A;  3NQZ A;  2KRT A;  3B7C A;  2RNT A;  3EE1 A;  1UUV B;  4I4K A;  3CXC 2;  1JNQ A;  4NPB A;  3DGM A;  1Q7Y 4;  3GRD A;  2P09 A;  1JJ2 2;  2Z6B A;  5D83 A;  3RNT A;  1E3R A;  5AEW B;  1W7C A;  4LYL B;  3CCL 3;  1US1 A;  1R4Y A;  3HI7 A;  1DE3 A;  1C54 A;  1N9J A;  1AVK A;  1BNF A;  2B1X B;  3N54 B;  5M1A A;  1O7P B;  3G4S 3;  4AKZ A;  2GEY A;  3K7C A;  2WO0 A;  2UGI A;  3ZG5 A;  1BNG A;  3NV0 B;  1IT7 A;  2A15 A;  4HBR A;  5G1K A;  1RGF A;  3Q3F A;  3AGN A;  4HM0 B;  3CC7 3;  1TRQ A;  7GSP A;  4GSP A;  2ML6 A;  3MHE A;  2XGL A;  3WOF B;  1FUS A;  3ALA A;  5IF6 A;  1FGO A;  5IG5 A;  1VQO 3;  1Y4K A;  1SAR A;  4FMD A;  1VZZ A;  2CG1 A;  3PXM A;  3CCV 3;  4GL6 A;  3CMA 3;  1Q40 A;  2ZL8 A;  2JQ5 A;  3X41 A;  3F8H A;  3DGL A;  3D3L A;  1E97 A;  3BIR A;  4MMX B;  3S27 A;  3WMD A;  4BTX A;  2V1L A;  3G71 3;  3VGN A;  3KII A;  3OW2 2;  1G0T A;  1M9G A;  2GU1 A;  2OWP A;  3VSY A;  3GZY B;  1W5Z A;  4O02 B;  3UJM A;  1YJN 3;  1W6G A;  2BMQ B;  1IVV A;  4WFO A;  2KF5 A;  1GOU A;  1IQ8 A;  4N6M A;  4O3V A;  1GSP A;  1W2Z A;  1UI8 A;  1EUI C;  1RGK A;  4FCZ A;  4K61 A;  3LTD A;  5HGR A;  3SX1 A;  1TRP A;  2KAA A;  2OQE A;  3LT8 A;  1WMP A;  1GY6 A;  1I8V A;  6RNT A;  4IPB A;  3I55 3;  2RSX A;  3WOD G;  5G1L A;  1AVL A;  1BSA A;  3ER7 A;  1BRK A;  5IEP A;  3IPT A;  3STD A;  1JZD A;  1X1Y A;  1W02 A;  5CLK A;  1RGH A;  3OV4 A;  3B4O A;  2KCD A;  1B2M A;  2GBX B;  5IER A;  1JN5 A;  3V98 A;  1PY3 A;  1BRH A;  2R41 A;  5LC7 A;  1GY7 A;  3CME 3;  5BU4 A;  1W6C A;  2F86 B;  3PCS A;  1DET A;  3CNM A;  1A2P A;  3HII A;  2CWU A;  3NHX A;  2H0H A;  1ZX2 A;  3RGA A;  3JUO A;  2OQE C;  5GSP A;  1IV9 A;  4HKV B;  3V99 A;  3U1W A;  1PYL A;  5AEU B;  2MF7 A;  3KCH A;  2IYJ A;  2CFL A;  1STF I;  4HZ9 B;  4CDL A;  8CHO A;  1VQK 3;  5EVH A;  4K1V A;  5FW5 A;  1MOL A;  2CX0 A;  1I0X A;  1ULJ B;  3IMA B;  1B20 A;  1O7M B;  1YJ9 3;  3DM8 A;  1I0V A;  2P0X A;  1BAN A;  2XR8 B;  3EJV A;  4AEQ A;  3ECF A;  3LT9 A;  3JUN A;  1Q42 A;  1RRH A;  5JPU A;  1E3V A;  3DGO A;  1VQM 3;  2HMO B;  3NM7 A;  5D82 A;  4N6T A;  2AAD A;  1O7H B;  1TIJ A;  4ILF A;  3CCE 3;  1VQP 3;  1U8C B;  3HOH A;  3FF2 A;  1JB4 A;  4LEH A;  1N5H A;  4RNZ A;  1FUT A;  4JRF A;  3BNB A;  1LOW A;  1V74 A;  4LSO A;  1B27 A;  1BRS A;  3BNE A;  3EX9 A;  1NJI 4;  2ZHX B;  1Q86 4;  4HVN A;  3HIG A;  3F40 A;  1NB5 I;  4EC6 A;  3MG2 A;  1LXE A;  2RGQ A;  4J9A A;  2XFS A;  3CCM 3;  1GMR A;  4EV5 A;  4CCV A;  4FCM A;  4MEI A;  4HM1 B;  2O3O A;  6GSP A;  1T2I A;  1OHO A;  2F98 A;  3FLJ A;  1B2U A;  1BOX A;  3MG1 A;  1OGZ A;  1UUG B;  3QK9 A;  4BIR A;  3F7X A;  5AIH A;  3EN1 B;  2IMJ A;  4Q53 A;  4QWT A;  1DMN A;  4RNT A;  1RTU A;  2KF6 A;  3EB8 A;  1RHL A;  3KKG A;  1O7G B;  1MGW A;  3E99 A;  3SLU A;  2CK3 H;  1LQM B;  3TDG A;  1JBT A;  2KF3 A;  3FSD A;  4OUQ A;  1BSE A;  3CCU 3;  1S5A A;  2P05 A;  1DMM A;  2GU3 A;  2I9W A;  3KFQ C;  3CC2 3;  1DVD A;  3NV0 A;  3Q2P A;  3CNX A;  3JUQ A;  1OF5 B;  1Z1S A;  4HM6 B;  2CFG A;  3L0R A;  1NNV A;  5IEO A;  1UGH I;  2XSO B;  3S5C A;  3O8Y A;  1NWW A;  4HM3 B;  4BL2 A;  1K8A 4;  1BUQ A;  1VQ8 3;  1RN1 A;  1LOV A;  1IDP A;  1NB3 I;  1RCK A;  3D5I A;  3RDE A;  2BHM A;  1FA3 A;  7RNT A;  4RNY A;  5I97 A;  2WOF A;  1R4C A;  1N5P A;  2LYX A;  2QA4 3;  1BNE A;  1HYF A;  2INX A;  5LC6 A;  3S67 A;  3CCR 3;  2OTL 3;  1ISK A;  1B2S A;  1G02 A;  2ML5 A;  3FCS B;  2UUG C;  2D1W A;  3ROB A;  4HM5 B;  3T8U A;  5IG4 A;  4I5Q A;  4X2H A;  4DKI A;  2HMN B;  1VQ9 3;  1BNR A;  1VQ5 3;  3NBR A;  1B3S A;  4NRE A;  2W56 B;  2CFD A;  1HKX A;  2OCT A;  4KVH A;  6STD A;  2Y74 A;  5AYS C;  1S72 3;  1RGC A;  2CFW A;  1IU7 A;  1TJD A;  2W0Q A;  1TFK A;  1UCJ A;  1BU4 A;  5G2G A;  1X1W A;  2BNG A;  1LRA A;  3T8N A;  2OTJ 3;  1OHS A;  2AAE A;  2YFJ B;  1NO3 A;  2W9P A;  3DGY A;  3MG3 A;  4X2O A;  1Q82 4;  1RJO A;  1VQ6 3;  4N6L A;  1UGI A;  1MNL A;  4EYC A;  1OGX A;  1D6Y A;  1SQW A;  3N8B A;  1I2E A;  1OAC A;  4K90 B;  3UL5 A;  3X40 A;  1C7H A;  1YVB I;  1I2F A;  1B2Z A;  1PU4 A;  3EQQ B;  2WOH A;  2L1S A;  4R80 A;  1BRJ A;  2FNQ A;  1RCL A;  2PNC A;  1JB5 A;  1UI7 A;  3NQY A;  4TX4 A;  1A90 A;  3LZA A;  1F8N A;  5M18 A;  1D6Z A;  1TP6 A;  2F5W A;  1J2B A;  3GZX B;  3V92 A;  2QEX 3;  2MC8 A;  3GAX A;  3K0Z A;  4N6N B;  1OHP A;  1BSC A;  2W6J H;  1B21 A;  3SED A;  1YVS A;  3WOE B;  2C4B A;  4FMA A;  1RNT A;  2PZV A;  3CPO A;  3NXJ A;  1N8R 4;  4WP5 A;  1GS3 A;  3DXO A;  2Z7A A;  1UCL A;  4EXR A;  1IQX A;  3GZB A;  1MWR A;  1YNV X;  3A5E A;  3EHC A;  4MJD A;  1RGA A;  1CYV A;  1CH0 A;  1JKG B;  1GMP A;  1JB2 A;  2XGN A;  1MWU A;  2CG0 A;  3D4A A;  3U97 A;  2RFR A;  1BRN L;  4N6V 0;  2XFT A;  3DMC A;  4U13 A;  1GD4 A;  1UCK A;  3AMO B;  4XBX A;  5ELU A;  3SOY A;  1RGL A;  1QMA A;  4KFE A;  3VF1 A;  2CKF B;  1M1X B;  3PCR A;  4WWU C;  1Q81 4;  3LTC A;  3KSE D;  4L8O A;  1I3I A;  1K73 4;  1WTH A;  2JDI H;  3JVC A;  4N3V A;  3PYJ A;  5RNT A;  1VQ7 3;  1BSD A;  1EG9 B;  2OOV C;  4HJL B;  3H51 A;  1ROA A;  3D79 A;  2C10 A;  3I0Y A;  4XDW A;  5AIG A;  3UL6 A;  5JPP A;  3EC9 A;  1BSB A;  1W6Y A;  2HOH A;  4L7K A;  5BIR A;  1RGE A;  2CHC A;  1O7W B;  1KD1 4;  3BLZ A;  4KFD A;  1KWI A;  4XB5 A;  3S29 A;  2E2V A;  3DY5 A;  1U5O A;  1A2K A;  3LTB A;  4GB5 A;  1W4N A;  1WQL B;  1RN4 A;  4K1U A;  2YFI B;  3Q1C A;  3WHO A;  4JF8 A;  1NU3 A;  1UW1 A;  4WYK A;  4HM7 B;  3BND A;  1I70 A;  1WMN A;  4R9K A;  5KP4 A;  1AY7 A;  1DYU A;  1RLS A;  3EN8 A;  2FXT A;  1Q9E A;  5EQL A;  3S28 A;  3LML A;  3NM2 A;  4N6O B;  3JUM A;  3CC4 3;  1MGR A;  4AKY A;  5IG0 A;  4G1M B;  1JZO A;  2GSP A;  1UDI I;  1PFP A;  1TTO A;  9RNT A;  5CK6 A;  4H3U A;  1YGW A;  1W00 A;  4R9L A;  4WHA A;  2IA7 A;  1FGR A;  4WYK B;  2CIU A;  3D9R A;  3ZFZ A;  3X3Z A;  2BU4 A;  1V58 A;  1KSI A;  1T5Y A;  2W9Q A;  5AYR B;  3FGY A;  4FMC A;  2Q07 A;  4XDV A;  3Q90 A;  3MWZ A;  4XBY A;  2BMR B;  1LOX A;  1OF5 A;  1DMQ A;  3FKA A;  4BTW A;  5CXO A;  1BAO A;  5STD A;  4HOH A;  3PS8 A;  3OXA A;  1HU9 A;  3LTA A;  4LZI A;  1SPU A;  3CCJ 3;  3WA2 X;  3G6E 3;  1RKY A;  4IIA A;  1FZU A;  5AII A;  3PZW A;  4STD A;  4RBN A;  4O8S A;  2HMM B;  5KP3 A;  1YI2 3;  1T2H A;  4BU4 A;  5AIF A;  3DH2 A;  3MYT A;  5KP1 A;  2GEX A;  5ELJ A;  4EBG A;  1UCI A;  2FGT A;  2YFL B;  2CFK A;  3MKI A;  4BL3 A;  3SOA A;  2W56 A;  2C11 A;  4O2H A;  2IUK A;  1MWT A;  3AGO A;  3K63 A;  2RCD A;  3IJE B;  2WGO A;  4HYZ A;  1BRI A;  1STD A;  4FMB A;  4KFF A;  1IV7 A;  2ZA4 A;  3CCQ 3;  3CD6 3;  1VQN 3;  1RDS A;  2XEP A;  4R1K A;  3BB9 A;  1IVX A;  1VQ4 3;  4RZM A;  1JRQ A;  3DZL A;  3LH4 A;  3SXX A;  1K9M 4;  2F99 A;  4HM8 B;  2ZDJ A;  4GHO A;  4EW5 A;  1K28 A;  1CYU A;  3FF0 A;  1ZO2 A;  1AR0 A;  2HMK B;  3D5G A;  3OWY A;  2W2C A;  3PGB A;  1W01 A;  1RN7 A;  2LQV A;  3KSP A;  5FGO A;  1X1U A;  1ZGX A;  3JUP A;  3RGR A;  1N8Q A;  5TGN A;  2H0G A;  1D6U A;  1W2B 2;  1TFO A;  3T0U A;  2Z76 A;  1OH0 A;  4XM4 A;  3MSO A;  5IG3 A;  3UB1 A;  3FZW A;  1VQQ A;  4NHF A;  2CH9 A;  3G8Z A;  4LGQ A;  2M7O A;  1QAL A;  5BXQ A;  2O9U X;  5A0O B;  4L8P A;  1EQK A;  4HM4 B;  4BTY A;  1O7N B;  2L4V A;  2IY2 A;  5CF2 A;  1BNJ A;  2KF4 A;  1TU5 A;  1A67 A;  1V57 A;  3X42 A;  3J7Y d;  1TUH A;  3LOY A;  3OX9 A;  5EEO A;  2KXG A;  2YX9 A;  3A76 A;  1IYY A;  2HMJ B;  3CCS 3;  1JKG A;  1LOY A;  1RSN A;  3EF8 A;  3LXU X;  5DRE A;  2BT3 A;  4ORL A;  1G96 A;  1GOV A;  1BUJ A;  1LNI A;  1VQL 3;  1GYB A;  3AHS A;  3AMO A;  1Q7H A;  4FR9 A;  2GBW B;  1MWS A;  2E2T A;  2B24 B;  4R4K A;  1YHQ 3;  4J5G A;  4J8T A;  2BMO B;  2BIR A;  1JBR A;  1EEJ A;  2F56 A;  1K41 A;  2STD A;  3FG4 A;  2OOV A;  3B8L A;  4HZB B;  1IVU A;  2RBI A;  5IEN A;  5JBS A;  3DGN A;  1WMO A;  4HM2 B;  3F14 A;  2H0I A;  3G16 A;  3WA3 A;  4EV2 A;  4H61 A;  1GOY A;  4N6U A;  1OUN A;  1EA2 A;  3K9M C;  1Q40 B;  1SIH A;  1GD3 A;  2D42 A;  3KE7 A;  2F4Y A;  2UX0 A;  2W03 A;  8RNT A;  1CQS A;  3N9H A;  1GMQ A;  1SJW A;  3NBJ A;  3B4P A;  3NBB A;  2WGQ A;  1FGT A;  4J5K A;  1HZ1 A;  3HX8 A;  1FYS A;  1BRG A;  1N9E A;  1NDO B;  1OPY A;  1T3B A;  4PEJ A;  1LNH A;  1CEW I;  1SII A;  3M8C A;  1RRL A;  7STD A;  2R4I A;  2SBL A;  3AHW A;  1LQG C;  4XBT A;  3WDG B;  3X3X A;  2XRX B;  5CF1 A;  5IW9 A;  3I56 3;  2P0M A;  1QAF A;  4MMY B;  3MPH A;  1ZS7 A;  1QVF 2;  3F9S A;  2CW9 A;  2XF3 A;  2K0M A;  3K5T A;  1JV2 B;  2GXF A;  1BNI A;  3FH1 A;  4KT3 B;  3FG1 A;  2CWV A;  1KC8 4;  1AQZ A;  3GSP A;  4HAA A;  3HZP A;  1ROV A;  3URP A;  1YJW 3;  3UNL A;  1A2V A;  2CX1 A;  3SVA A;  3NUV A;  2F5M A;  1BVI A;  3FG3 A;  3OWS A;  4CJN A;  2E2U A;  1WNH A;  4IT7 A;  1M1K 4;  3EBT A;  1KQS 2;  2XSH B;  3KZT A;  3ZG0 A;  5M19 A;  1EKM A;  1GY5 A;  3G0K A;  1IT8 A;  1I3F A;  5AI1 A;  4ZM8 A;  2Y73 A;  1JN5 B;  1I2G A;  1BNS A;  3EBY A;  1M90 4;  3X3Y A;  3WR2 A;  1FUW A;  1B2X A;  1RMS A;  3GZR A;  1FGQ A;  1QAK A;  4LMI A;  1FGM A;  2SAR A;  1IQY A;  3HK4 A;  1X1X A;  1LVN A;  4FCJ A;  3KN4 A;  1L5G B;  2Z77 A;  2CC3 A;  1OCV A;  3QRD A;  4MMZ B;  5BVB A;  1JBS A;  5D81 A;  2HML B;  1ASK A;  1RGG A;  3NX0 A;  4OK0 A;  3BU4 A;  3CPW 2;  3F7S A;  5DRV A;  1BIR A;  2J8X B;  1QJG A;  1BGS A;  1DVC A;  4KZ1 A;  1ULI B;  3GWR A;  4OVM A;  1UUW B;  1AV4 A;  4CPK A;  2QGU A;  5HOH A;  2BO9 B;  1YIT 3;  1YGE A;  2QIY A;  3F8X A;  3LYG A;  3SYU A;  2XH9 A;  2IUJ A;  2P38 A;  3CU3 A;  2CWT A; 
#chains in the Genus database with same CATH homology
 2W04 A;  1IK3 A;  2K54 A;  3DUK A;  3BNC A;  3H3H A;  1YIJ 3;  3OWU A;  1IVW A;  1QVG 2;  3NQZ A;  2KRT A;  3B7C A;  3EE1 A;  1UUV B;  4I4K A;  3CXC 2;  1JNQ A;  3DGM A;  1Q7Y 4;  3GRD A;  2P09 A;  1JJ2 2;  2Z6B A;  5D83 A;  1E3R A;  5AEW B;  1W7C A;  3CCL 3;  1US1 A;  3HI7 A;  1N9J A;  1AVK A;  2B1X B;  3N54 B;  1O7P B;  3G4S 3;  4AKZ A;  2GEY A;  3K7C A;  2WO0 A;  3NV0 B;  1IT7 A;  2A15 A;  4HBR A;  4HM0 B;  3CC7 3;  2ML6 A;  3MHE A;  2XGL A;  3WOF B;  3ALA A;  5IF6 A;  5IG5 A;  1FGO A;  1VQO 3;  1Y4K A;  4FMD A;  1VZZ A;  2CG1 A;  3PXM A;  3CCV 3;  4GL6 A;  3CMA 3;  1Q40 A;  2ZL8 A;  2JQ5 A;  3X41 A;  3F8H A;  3DGL A;  3D3L A;  1E97 A;  4MMX B;  3S27 A;  3WMD A;  4BTX A;  2V1L A;  3G71 3;  3VGN A;  3KII A;  3OW2 2;  1M9G A;  2GU1 A;  2OWP A;  3VSY A;  3GZY B;  1W5Z A;  4O02 B;  3UJM A;  1YJN 3;  1W6G A;  2BMQ B;  1IVV A;  4WFO A;  1IQ8 A;  4N6M A;  4O3V A;  1W2Z A;  1UI8 A;  4FCZ A;  4K61 A;  3LTD A;  5HGR A;  3SX1 A;  2OQE A;  3LT8 A;  1WMP A;  1GY6 A;  4IPB A;  3I55 3;  2RSX A;  3WOD G;  1AVL A;  3ER7 A;  5IEP A;  3IPT A;  3STD A;  1W02 A;  5CLK A;  3OV4 A;  3B4O A;  2KCD A;  2GBX B;  5IER A;  1JN5 A;  3V98 A;  5LC7 A;  3CME 3;  1GY7 A;  1W6C A;  2F86 B;  3PCS A;  3CNM A;  3HII A;  2CWU A;  3NHX A;  1ZX2 A;  3RGA A;  3JUO A;  2OQE C;  1IV9 A;  4HKV B;  3V99 A;  3U1W A;  5AEU B;  2MF7 A;  2CFL A;  1STF I;  4HZ9 B;  4CDL A;  8CHO A;  1VQK 3;  5EVH A;  4K1V A;  5FW5 A;  1MOL A;  1ULJ B;  3IMA B;  1O7M B;  1YJ9 3;  3DM8 A;  2P0X A;  2XR8 B;  3EJV A;  4AEQ A;  3ECF A;  3LT9 A;  3JUN A;  1Q42 A;  1RRH A;  5JPU A;  1E3V A;  3DGO A;  1VQM 3;  2HMO B;  3NM7 A;  5D82 A;  4N6T A;  1O7H B;  1TIJ A;  3CCE 3;  1VQP 3;  1U8C B;  3FF2 A;  1JB4 A;  4LEH A;  1N5H A;  4RNZ A;  4JRF A;  3BNB A;  1V74 A;  4LSO A;  3BNE A;  3EX9 A;  1NJI 4;  1Q86 4;  4HVN A;  3HIG A;  3F40 A;  1NB5 I;  4EC6 A;  3MG2 A;  1LXE A;  2RGQ A;  4J9A A;  2XFS A;  3CCM 3;  4EV5 A;  4CCV A;  4FCM A;  4MEI A;  4HM1 B;  2O3O A;  1OHO A;  2F98 A;  3FLJ A;  3MG1 A;  1OGZ A;  3QK9 A;  3F7X A;  5AIH A;  3EN1 B;  2IMJ A;  4Q53 A;  4QWT A;  1DMN A;  3EB8 A;  3KKG A;  1O7G B;  3E99 A;  3SLU A;  2CK3 H;  3TDG A;  3FSD A;  4OUQ A;  3CCU 3;  1S5A A;  2P05 A;  1DMM A;  2GU3 A;  2I9W A;  3KFQ C;  3CC2 3;  1DVD A;  3NV0 A;  3Q2P A;  3CNX A;  3JUQ A;  1OF5 B;  1Z1S A;  4HM6 B;  2CFG A;  3L0R A;  5IEO A;  2XSO B;  3S5C A;  3O8Y A;  1NWW A;  4HM3 B;  1K8A 4;  1BUQ A;  1VQ8 3;  3RDE A;  1IDP A;  1NB3 I;  2BHM A;  1FA3 A;  4RNY A;  5I97 A;  2WOF A;  1R4C A;  1N5P A;  2LYX A;  2QA4 3;  2INX A;  2OTL 3;  3CCR 3;  5LC6 A;  3S67 A;  1ISK A;  3FCS B;  2ML5 A;  3ROB A;  5IG4 A;  2D1W A;  3T8U A;  4HM5 B;  4X2H A;  1VQ9 3;  2HMN B;  1VQ5 3;  3NBR A;  4NRE A;  2W56 B;  2CFD A;  1HKX A;  2OCT A;  4KVH A;  6STD A;  2Y74 A;  5AYS C;  1S72 3;  2CFW A;  1IU7 A;  2W0Q A;  1TFK A;  5G2G A;  2BNG A;  2OTJ 3;  3T8N A;  1OHS A;  2YFJ B;  1NO3 A;  2W9P A;  4X2O A;  3MG3 A;  1Q82 4;  1RJO A;  1VQ6 3;  4N6L A;  1MNL A;  4EYC A;  1OGX A;  1D6Y A;  1SQW A;  3N8B A;  1OAC A;  4K90 B;  3UL5 A;  3X40 A;  1C7H A;  1YVB I;  1PU4 A;  3EQQ B;  2WOH A;  4R80 A;  4TX4 A;  2FNQ A;  2PNC A;  1A90 A;  1JB5 A;  1UI7 A;  3NQY A;  3LZA A;  1F8N A;  1D6Z A;  1TP6 A;  1J2B A;  3GZX B;  3V92 A;  2QEX 3;  2MC8 A;  3GAX A;  3K0Z A;  4N6N B;  1OHP A;  2W6J H;  3SED A;  3WOE B;  4FMA A;  2PZV A;  3CPO A;  3NXJ A;  1N8R 4;  4WP5 A;  1GS3 A;  3DXO A;  2Z7A A;  4EXR A;  1IQX A;  3GZB A;  3EHC A;  4MJD A;  1CYV A;  1JKG B;  3U97 A;  1JB2 A;  2XGN A;  2CG0 A;  2RFR A;  4N6V 0;  2XFT A;  3DMC A;  4U13 A;  1GD4 A;  3AMO B;  5ELU A;  4XBX A;  3SOY A;  4KFE A;  1QMA A;  3VF1 A;  2CKF B;  1M1X B;  3PCR A;  4WWU C;  1Q81 4;  3LTC A;  3KSE D;  4L8O A;  1K73 4;  1WTH A;  2JDI H;  3JVC A;  4N3V A;  3PYJ A;  1VQ7 3;  1EG9 B;  2OOV C;  4HJL B;  3H51 A;  1ROA A;  3I0Y A;  2C10 A;  5AIG A;  4XDW A;  3UL6 A;  5JPP A;  3EC9 A;  1W6Y A;  4L7K A;  2CHC A;  1O7W B;  1KD1 4;  3BLZ A;  4KFD A;  1KWI A;  4XB5 A;  3S29 A;  2E2V A;  3DY5 A;  1U5O A;  1A2K A;  3LTB A;  4GB5 A;  1W4N A;  1WQL B;  4K1U A;  2YFI B;  3Q1C A;  4JF8 A;  1NU3 A;  1UW1 A;  4WYK A;  4HM7 B;  3BND A;  1WMN A;  4R9K A;  5KP4 A;  1DYU A;  3EN8 A;  2FXT A;  5EQL A;  3S28 A;  3LML A;  3NM2 A;  4N6O B;  3JUM A;  3CC4 3;  4AKY A;  5IG0 A;  4G1M B;  1PFP A;  5CK6 A;  4H3U A;  1W00 A;  4R9L A;  4WHA A;  2IA7 A;  1FGR A;  4WYK B;  2CIU A;  3D9R A;  3X3Z A;  1KSI A;  1T5Y A;  2W9Q A;  5AYR B;  3FGY A;  4FMC A;  2Q07 A;  4XDV A;  3Q90 A;  3MWZ A;  4XBY A;  2BMR B;  1LOX A;  1OF5 A;  1DMQ A;  3FKA A;  4BTW A;  5CXO A;  5STD A;  3PS8 A;  3OXA A;  1HU9 A;  3LTA A;  4LZI A;  1SPU A;  3CCJ 3;  3WA2 X;  3G6E 3;  1RKY A;  4IIA A;  5AII A;  3PZW A;  4STD A;  4RBN A;  4O8S A;  2HMM B;  5KP3 A;  1YI2 3;  5AIF A;  3MYT A;  5KP1 A;  2GEX A;  5ELJ A;  4EBG A;  2FGT A;  2YFL B;  2CFK A;  3MKI A;  3SOA A;  2W56 A;  2C11 A;  4O2H A;  2IUK A;  3K63 A;  2RCD A;  3IJE B;  2WGO A;  4HYZ A;  1STD A;  4KFF A;  4FMB A;  1IV7 A;  3CCQ 3;  3CD6 3;  1VQN 3;  2XEP A;  4R1K A;  3BB9 A;  1IVX A;  1VQ4 3;  4RZM A;  1JRQ A;  3DZL A;  3LH4 A;  3SXX A;  1K9M 4;  2F99 A;  4HM8 B;  2ZDJ A;  1K28 A;  1CYU A;  3FF0 A;  1ZO2 A;  1AR0 A;  2HMK B;  3OWY A;  3PGB A;  2W2C A;  1W01 A;  1RN7 A;  2LQV A;  3KSP A;  5FGO A;  3JUP A;  3RGR A;  1N8Q A;  5TGN A;  1D6U A;  1W2B 2;  1TFO A;  3T0U A;  2Z76 A;  1OH0 A;  4XM4 A;  3MSO A;  5IG3 A;  3UB1 A;  3FZW A;  4NHF A;  2CH9 A;  3G8Z A;  4LGQ A;  2M7O A;  1QAL A;  5BXQ A;  2O9U X;  5A0O B;  4L8P A;  1EQK A;  4HM4 B;  4BTY A;  1O7N B;  2L4V A;  5CF2 A;  1TU5 A;  1A67 A;  3X42 A;  3J7Y d;  1TUH A;  3LOY A;  3OX9 A;  5EEO A;  2KXG A;  2YX9 A;  3A76 A;  2HMJ B;  3CCS 3;  1JKG A;  3EF8 A;  5DRE A;  3LXU X;  2BT3 A;  4ORL A;  1G96 A;  1VQL 3;  1GYB A;  3AMO A;  4FR9 A;  2GBW B;  2E2T A;  2B24 B;  4R4K A;  1YHQ 3;  4J8T A;  2BMO B;  1K41 A;  2STD A;  3FG4 A;  2OOV A;  3B8L A;  4HZB B;  1IVU A;  5JBS A;  5IEN A;  3DGN A;  1WMO A;  4HM2 B;  3F14 A;  3G16 A;  3WA3 A;  4EV2 A;  4H61 A;  4N6U A;  1OUN A;  1EA2 A;  3K9M C;  1Q40 B;  1SIH A;  1GD3 A;  2D42 A;  3KE7 A;  2W03 A;  2UX0 A;  1CQS A;  3N9H A;  1SJW A;  3NBJ A;  3B4P A;  3NBB A;  2WGQ A;  1FGT A;  3HX8 A;  1OPY A;  1N9E A;  1NDO B;  4PEJ A;  1LNH A;  1CEW I;  1SII A;  3M8C A;  1RRL A;  7STD A;  2R4I A;  2SBL A;  5CF1 A;  3X3X A;  4XBT A;  3WDG B;  5IW9 A;  2XRX B;  3I56 3;  2P0M A;  1QAF A;  4MMY B;  3MPH A;  1QVF 2;  3F9S A;  2CW9 A;  2XF3 A;  2K0M A;  3K5T A;  1JV2 B;  2GXF A;  3FH1 A;  3FG1 A;  2CWV A;  1KC8 4;  3HZP A;  1ROV A;  1YJW 3;  3UNL A;  1A2V A;  3SVA A;  3NUV A;  3FG3 A;  3OWS A;  2E2U A;  1WNH A;  4IT7 A;  1M1K 4;  3EBT A;  1KQS 2;  2XSH B;  3KZT A;  1EKM A;  1GY5 A;  3G0K A;  1IT8 A;  5AI1 A;  4ZM8 A;  2Y73 A;  1JN5 B;  3EBY A;  1M90 4;  3X3Y A;  1FUW A;  3GZR A;  1FGQ A;  1QAK A;  4LMI A;  1FGM A;  1IQY A;  3HK4 A;  1LVN A;  4FCJ A;  3KN4 A;  1L5G B;  2Z77 A;  2CC3 A;  1OCV A;  3QRD A;  4MMZ B;  5BVB A;  5D81 A;  2HML B;  1ASK A;  3NX0 A;  4OK0 A;  3CPW 2;  3F7S A;  5DRV A;  1QJG A;  1DVC A;  4KZ1 A;  1ULI B;  3GWR A;  4OVM A;  1UUW B;  1AV4 A;  2QGU A;  2BO9 B;  1YIT 3;  1YGE A;  2QIY A;  3F8X A;  3LYG A;  2XH9 A;  2IUJ A;  2P38 A;  3CU3 A;  2CWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...