1O7PB

Naphthalene 1,2-dioxygenase, product complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
total genus 55
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7pB00
3JUQA 4HKVB 2HMNB 5CXOA 4GB5A 3KE7A 1DMMA 4XBTA 1JB2A 2F86B 2RCDA 1HKXA 3CU3A 3E99A 4HJLB 3OWSA 4X2HA 3F8HA 1W6YA 2YFIB 5CF2A 1TP6A 3BLZA 2R4IA 2CKFB 4HM3B 1OF5B 4XBXA 4XM4A 4X2OA 4CDLA 3EF8A 3KSPA 4FCJA 2YFJB 3FZWA 3BB9A 3OWUA 3EJVA 4LMIA 1O7NB 3KZTA 4K1UA 1OPYA 3MKIA 3K0ZA 1OF5A 1OGXA 3MSOA 2K54A 2W2CA 2GEXA 1NDOB 2B24B 1ULJB 3ER7A 3FKAA 3GZYB 4WYKB 5CLKA 3T8UA 1S5AA 1OHOA 2RGQA 4I4KA 5AIIA 5IEOA 3VSYA 1E3RA 3HX8A 3JUPA 2BMOB 3JUNA 1NWWA 3FSDA 4J9AA 3FGYA 2JQ5A 1ZX2A 1DMNA 4HM2B 1Q40A 2BMRB 4Q53A 3FH1A 3DUKA 1O7WB 5AIHA 4HVNA 2XR8B 5AEWB 4HM6B 5BVBA 1JKGA 3NBRA 1EG9B 7STDA 3VGNA 1ZO2A 3EBTA 3ROBA 3DZLA 3DMCA 1C7HA 3UNLA 3EBYA 3NXJA 1STDA 1O7GB 4XDVA 3MG2A 2RFRA 1JB5A 3EHCA 1OGZA 1EA2A 3M8CA 1OUNA 3GWRA 4HZ9B 8CHOA 3MYTA 3B4OA 3F9SA 3MHEA 4H3UA 5CF1A 5TGNA 4FCMA 4U13A 3JUOA 3CNMA 1JN5B 1ISKA 2INXA 1E97A 2XRXB 3NV0A 1Q42A 3G16A 2PZVA 3H51A 1OHSA 3FF0A 3F40A 4R1KA 4XBYA 5HGRA 4WWUC 5STDA 5G2GA 3EN8A 3F7XA 3JUMA 2BNGA 1O7PB 3OXAA 4ORLA 4XB5A 1CQSA 1U5OA 3G8ZA 1BUQA 2GXFA 3K7CA 4J8TA 3F7SA 4HM8B 4PEJA 4L8PA 1GY5A 2I9WA 3OV4A 2HMJB 1GS3A 5IG3A 2UX0A 1ULIB 1ASKA 2CHCA 3HK4A 1QJGA 2HMKB 3LZAA 3MG1A 3H3HA 1SJWA 2YFLB 3B7CA 1E3VA 3FF2A 4IIAA 1O7HB 4WYKA 3NM2A 5FW5A 3CPOA 2A15A 1JB4A 1K41A 5AEUB 1AR0A 3GZXB 3UJMA 3EN1B 1W02A 3WMDA 2HMLB 1QMAA 4K1VA 2IMJA 3MG3A 4WP5A 2Z76A 1GY6A 1OCVA 3I0YA 4LGQA 5BXQA 3D9RA 1A2KA 5IG5A 1Z1SA 1W01A 1O7MB 1GY7A 3NHXA 3Q90A 3FLJA 4XDWA 4L8OA 3CNXA 1TUHA 3STDA 3SOYA 2Z77A 3A76A 2B1XB 2F99A 1WQLB 4OVMA 5IERA 3DM8A 4STDA 1DMQA 2HMOB 3F8XA 5AIGA 4L7KA 1IDPA 1JN5A 3EC9A 5D82A 2QGUA 5AI1A 3OWYA 3IPTA 2XSOB 3RGRA 5D81A 5IF6A 4N3VA 4LEHA 1NU3A 4OUQA 3T8NA 3KKGA 5KP1A 2HMMB 3G0KA 5DRVA 1W00A 5IENA 2QIYA 3ECFA 3B4PA 4HM4B 4KVHA 5IG4A 5DREA 1GYBA 4HM7B 3SEDA 3B8LA 4HZBB 2Z7AA 3OX9A 4MJDA 2GBWB 5D83A 3NUVA 5JPUA 3EQQB 2BMQB 5IG0A 5JPPA 2F98A 6STDA 4HM0B 1Q40B 3RGAA 3LYGA 1JKGB 3F14A 5IEPA 1VZZA 2OWPA 3GRDA 1UUWB 3EX9A 5EVHA 4R9LA 3HZPA 2GEYA 4HM5B 4R9KA 4HM1B 2GBXB 2XSHB 3S5CA 5CK6A 1UUVB 1OH0A 3GZBA 5AIFA 3DXOA 1OHPA 3SOAA 2STDA 4RZMA 3GZRA 5KP3A 5KP4A 3NV0B
chains in the Genus database with same CATH superfamily
3JUQA 4BU4A 4CPKA 3SVAA 4HKVB 2HMNB 1LOYA 5CXOA 4GB5A 1VQ53 3KE7A 2CWTA 1DMMA 1I70A 4XBTA 1IV9A 4N6NB 1BRKA 1BVIA 1GD3A 1JB2A 2F86B 2KCDA 1HKXA 2RCDA 2UUGC 3EB8A 3CU3A 3E99A 1RGAA 4HJLB 1VQO3 1A67A 3GSPA 3OWSA 4X2HA 2CFWA 1W2ZA 2CWUA 3F8HA 1NJI4 3DH2A 1W6YA 2YFIB 4BTXA 1RGLA 1FGOA 5CF2A 1TP6A 1VQ43 4O02B 3BLZA 1LQMB 2R4IA 3AHWA 2CKFB 4HM3B 2P05A 4N6OB 4AKZA 1FGQA 1OF5B 3AGOA 3NX0A 4XBXA 3G4S3 2F4YA 3D79A 1GOVA 3LT9A 1G96A 4XM4A 4X2OA 1VQM3 4BTYA 3KN4A 2KF5A 2CX1A 1LOXA 2Z6BA 1AVLA 4KFFA 4H61A 2OCTA 4CDLA 3EF8A 3KSPA 4FCJA 4CCVA 1IQXA 2YFJB 3FZWA 1JJ22 1V58A 3BB9A 3OWUA 2XH9A 1JV2B 5ELJA 2BHMA 3EJVA 5ELUA 1I2GA 4LMIA 5M1AA 1O7NB 1B2ZA 2PNCA 3KZTA 1OPYA 4K1UA 1MWSA 4WFOA 2QEX3 1I0VA 3MKIA 3K0ZA 1OF5A 1RN1A 1YIJ3 4HYZA 2K0MA 1OGXA 1BSDA 3MSOA 4CJNA 2FNQA 2K54A 2P09A 3LT8A 2W2CA 3N9HA 4J5GA 4O8SA 1VQK3 2GEXA 1NDOB 2B24B 2LQVA 1MNLA 1ULJB 1Q824 5EQLA 1K8A4 1FUTA 1M904 1UCLA 3I553 1D6YA 1IVVA 2SARA 1S723 3ER7A 1UGIA 3FKAA 3GZYB 3HOHA 4WYKB 5CLKA 3T8UA 3CCQ3 1BRGA 3FG3A 2XGNA 3S27A 1VQL3 3BNBA 9RNTA 1S5AA 3BU4A 3T0UA 1OHOA 3SLUA 1DVDA 1ROAA 1A90A 1I8VA 1BNGA 3A5EA 2OQEA 2RGQA 4I4KA 4EW5A 3WA3A 2QA43 2V1LA 4RBNA 1JBSA 5M18A 1G02A 3BIRA 1Q9EA 5AIIA 5IEOA 3VSYA 4NREA 1NNVA 3AMOB 1UCIA 1E3RA 1YGEA 3HX8A 4N6MA 1CYVA 3X3ZA 2YX9A 3JUPA 3CCV3 1RMSA 2LYXA 3WDGB 1RRLA 1RLSA 2BMOB 1NWWA 3JUNA 1D6UA 3FSDA 7GSPA 4J9AA 3FGYA 1RGHA 3CCL3 2JQ5A 1ZX2A 1DMNA 3HIIA 4HM2B 1RNBA 4GL6A 1Q40A 2BMRB 5HOHA 1SPUA 2ZL8A 2W56A 4Q53A 3FH1A 3DUKA 1O7WB 2IA7A 2C11A 5AIHA 4BL2A 4HVNA 2XR8B 1V57A 1B2XA 1Q814 2RBIA 3V98A 2WOFA 4KFEA 1QAKA 1G0TA 5AEWB 3Q2PA 4HM6B 5BVBA 1IQ8A 1VQ63 1JKGA 2CWVA 3NBRA 1EG9B 1GOUA 7STDA 1IT7A 3VGNA 1WMPA 1YJN3 1ZO2A 3EBTA 3ROBA 4AEQA 1CEWI 1BNSA 3DZLA 3WHOA 3J7Yd 1RSNA 1EUIC 1EKMA 2CH9A 1W5ZA 3DMCA 1C7HA 3UNLA 2F56A 3EBYA 3NXJA 1RGFA 1FGTA 3NQYA 4FMAA 1STDA 4R80A 2GSPA 1O7GB 4XDVA 3WOFB 3MG2A 2RFRA 3UB1A 1JB5A 3EHCA 2CG1A 3VF1A 1OGZA 2BO9B 1EA2A 1RGCA 1BRIA 4N6V0 3M8CA 1BOXA 1OUNA 1TJDA 3GWRA 3KSED 1B2MA 1B27A 1BNJA 4J5KA 2P0XA 4HZ9B 1BIRA 3MYTA 8CHOA 3LTBA 1T5YA 2W6JH 1BU4A 1RTUA 1UI7A 1BSCA 1W7CA 2ML5A 3B4OA 3F9SA 3MHEA 4H3UA 1L5GB 1MWRA 5AYSC 3WA2X 5JBSA 1IK3A 1HZ1A 2CFLA 1TU5A 1JNQA 5CF1A 1OACA 5TGNA 2D42A 2XGLA 4FCMA 3O8YA 1WTHA 3JUOA 3CNMA 1RJOA 4U13A 3V92A 1KD14 1STFI 1JN5B 3PZWA 1ISKA 3JVCA 3TDGA 4FCZA 4KFDA 1VQ83 1B2UA 2KRTA 2INXA 1E97A 2XRXB 3DGYA 3NV0A 1Q42A 3G16A 1CH0A 4FMDA 1FZUA 1W6CA 2PZVA 1EQKA 1GMPA 1KWIA 2CIUA 3ZG0A 2HOHA 1EEJA 3H51A 1OHSA 2OTJ3 5LC7A 1TRPA 1Y4KA 4MMYB 3FF0A 4N6TA 2CFDA 4MEIA 4HOHA 3F40A 3Q1CA 1MGWA 3LTDA 4R1KA 3QK9A 4XBYA 4WHAA 1YJ93 4K61A 5HGRA 3DGMA 2OQEC 2XFTA 4R4KA 4WWUC 2WOHA 5STDA 4O3VA 3AGNA 5G2GA 3S67A 1YHQ3 2D1WA 3CCJ3 2P38A 3EN8A 3F7XA 3V99A 2ZA4A 3JUMA 4ZM8A 1M1K4 2BNGA 1O7PB 3OXAA 4KT3B 4LSOA 4ORLA 1CQSA 4XB5A 1U5OA 1V74A 1K9M4 4RNYA 5I97A 3G8ZA 1BUQA 2GXFA 1TIJA 2O9UX 1N5HA 2CX0A 1WMOA 3RDEA 1X1UA 3K7CA 1MWTA 4OK0A 4J8TA 3F7SA 4HM8B 4PEJA 3LH4A 4L8PA 1GY5A 5G1LA 2I9WA 2J8XB 3Q3FA 1AQZA 3OV4A 2HMJB 2O3OA 1DE3A 1GS3A 3BNDA 5IG3A 3CMA3 2UX0A 3CD63 2W9PA 3LMLA 3ZFZA 1ZS7A 2KXGA 1ULIB 1RNTA 1ASKA 3HIGA 2CHCA 5BIRA 3HK4A 1QJGA 2HMKB 3D4AA 3LZAA 3MG1A 1MOLA 1U8CB 5LC6A 1IVWA 2E2TA 3H3HA 1SJWA 3LOYA 2YFLB 1RCLA 3B7CA 3HI7A 1E3VA 3KIIA 3FF2A 3CCS3 2F5MA 1O7HB 4IIAA 1NO3A 4WYKA 3CC23 1R4YA 1NB5I 2H0HA 3NM2A 5BU4A 4K90B 5FW5A 1BNEA 2Q07A 3UL5A 1W6GA 3CPOA 3PS8A 2A15A 5G1KA 3DGNA 3L0RA 1JB4A 2GU3A 2L4VA 1W2B2 2IYJA 1SQWA 1LOWA 4FR9A 1YGWA 1F8NA 1K41A 5AEUB 1JBTA 1I2FA 4EC6A 1LOVA 2BU4A 1AR0A 3MPHA 1YI23 3GZXB 1BSAA 3GAXA 4TX4A 3AMOA 3UJMA 3EN1B 1W02A 3LTAA 3WMDA 3N8BA 3PGBA 2WO0A 1UUGB 2HMLB 3S29A 8RNTA 1QMAA 2JDIH 4IPBA 3BNCA 1WMNA 5M19A 2KF3A 4I5QA 3UL6A 4K1VA 2IMJA 3MG3A 4WP5A 1N5PA 2H0IA 2Z76A 1GY6A 3D5GA 1KQS2 1BSBA 3SX1A 1OCVA 1UCKA 3WR2A 3I0YA 1LQGC 4LGQA 4NHFA 5BXQA 2L1SA 3D9RA 3KCHA 3MWZA 1BANA 1RKYA 1A2KA 1US1A 1T2HA 5IG5A 1BNIA 1Z1SA 1W01A 1IU7A 4EXRA 4RNTA 1O7MB 1LVNA 3PCSA 3K5TA 1GY7A 4N6LA 3SXXA 4FMBA 3WOEB 3NHXA 3Q90A 3BNEA 3FLJA 2R41A 1SARA 4XDWA 2WGQA 5IW9A 4N6UA 3G6E3 1A2PA 4L8OA 1YNVX 2BIRA 3AHSA 1RGKA 1GD4A 3RNTA 3X40A 2IUKA 1TTOA 1TUHA 3CNXA 1RGEA 3IJEB 2FXTA 1IQYA 3KFQC 1I2EA 3STDA 2OTL3 3N54B 4O2HA 3SOYA 3I563 2F5WA 3FCSB 4AKYA 2H0GA 2MF7A 4GSPA 1QVG2 1IT8A 4EYCA 2OOVA 3X42A 1YVSA 4NPBA 3IMAB 1Q7HA 3U97A 2MC8A 1JRQA 1BAOA 1KSIA 1N9EA 2W03A 2Z77A 3K63A 3A76A 4LYLB 4BIRA 1N8QA 1PYLA 2B1XB 3FG1A 4EBGA 1RGGA 2F99A 1WQLB 2W04A 4OVMA 3CXC2 1JBRA 1RCKA 2KAAA 3OW22 3X41A 5IERA 3DM8A 4STDA 1BRNL 1X1YA 1GMRA 2XEPA 1DMQA 2HMOB 1PY3A 1X1XA 3F8XA 5AIGA 1J2BA 4L7KA 2RNTA 4G1MB 1RDSA 1IDPA 1B20A 2P0MA 1JN5A 1HYFA 4GHOA 2CG0A 3CME3 1BRSA 2M7OA 4LZIA 3X3YA 1PFPA 1FUWA 3EC9A 5D82A 3S28A 3URPA 2AADA 2W0QA 1VQQA 3CCR3 2QGUA 5AI1A 1GMQA 3OWYA 1IV7A 2RSXA 2XSOB 3IPTA 1RHLA 4RNZA 5D81A 3RGRA 1MGRA 1W4NA 4N3VA 5IF6A 4LEHA 1NU3A 3K9MC 1SIIA 4MMXB 4OUQA 3T8NA 1Q864 4FMCA 3KKGA 6GSPA 1N8R4 1D6ZA 5KP1A 1ZGXA 2HMMB 1TFKA 3ALAA 3G0KA 5DRVA 1W00A 3DY5A 3WODG 1LRAA 1BNFA 5IENA 2QIYA 1DETA 3ECFA 1QAFA 3B4PA 5FGOA 4HM4B 1FGRA 2C10A 4KVHA 2KF4A 1AVKA 4HAAA 5EEOA 3CCM3 2IY2A 4KZ1A 5IG4A 1C54A 1AY7A 6RNTA 5DREA 1GYBA 1LNHA 4HM7B 1SIHA 3SEDA 1BUJA 3B8LA 1GOYA 1M1XB 2ML6A 4HZBB 1UW1A 3U1WA 1LXEA 2BT3A 2Z7AA 3OX9A 4MJDA 5A0OB 3NQZA 1QVF2 1DYUA 2GBWB 5D83A 1VQ93 3NUVA 3EE1A 3CPW2 2CK3H 5JPUA 3ZG5A 1B2SA 2AAEA 3EQQB 1YIT3 3CC73 1RN7A 1IVUA 3CCU3 2BMQB 1Q7Y4 1M9GA 1VQN3 1MWUA 3PYJA 1AV4A 3DGLA 5IG0A 1FUSA 5GSPA 4QWTA 5JPPA 2E2VA 2F98A 2ZHXB 3G713 1BRHA 1X1WA 6STDA 1BNRA 4HM0B 1N9JA 3NBBA 3NM7A 1Q40B 1UI8A 1K734 1FW7A 2W56B 7RNTA 1VQ73 1JZOA 2XFSA 3CC43 1I3FA 1NB3I 2Y74A 3X3XA 3RGAA 1BSEA 3FG4A 3LYGA 2W9QA 4IT7A 4HBRA 1CYUA 1UGHI 3D3LA 1UCJA 2OOVC 4BTWA 1I3IA 1JKGB 1RN4A 3QRDA 4JRFA 3F14A 2KF6A 5IEPA 1VZZA 2OWPA 1I0XA 1FA3A 1IYYA 3GRDA 2SBLA 3NBJA 1UUWB 1PU4A 1UDII 3EX9A 1T3BA 1RRHA 5EVHA 4BL3A 1YJW3 1FGMA 2XF3A 4JF8A 4R9LA 3HZPA 2GEYA 5RNTA 1DVCA 2C4BA 3LXUX 1JZDA 4HM5B 2GU1A 3SYUA 2K3DA 1LNIA 4R9KA 2CC3A 4HM1B 1K28A 2IUJA 2GBXB 3CCE3 1ROVA 2XSHB 1QALA 1TRQA 2CFGA 3S5CA 3LTCA 1FYSA 2E2UA 4MMZB 5CK6A 1TFOA 1VQP3 2FGTA 3PCRA 1UUVB 1OH0A 3D5IA 3GZBA 1BRJA 1YVBI 5AIFA 1KC84 1WNHA 5AYRB 1GSPA 4DKIA 3DXOA 1BGSA 3DGOA 2ZDJA 1OHPA 4ILFA 4EV2A 2CFKA 1R4CA 1IVXA 1HU9A 2WGOA 3SOAA 3PXMA 2CW9A 1A2VA 1T2IA 2UGIA 2STDA 2Y73A 4RZMA 3GZRA 5KP3A 4EV5A 1B3SA 1B21A 5KP4A 3NV0B
chains in the Genus database with same CATH topology
3JUQA 3SVAA 4HKVB 2HMNB 5CXOA 4GB5A 1VQ53 3KE7A 2CWTA 1DMMA 4XBTA 1IV9A 4N6NB 1GD3A 1JB2A 2F86B 2KCDA 1HKXA 2RCDA 3EB8A 3CU3A 3E99A 1VQO3 4HJLB 1A67A 3OWSA 4X2HA 2CFWA 1W2ZA 2CWUA 3F8HA 1NJI4 1W6YA 2YFIB 4BTXA 1FGOA 5CF2A 1TP6A 1VQ43 4O02B 3BLZA 2R4IA 4N6OB 2CKFB 4HM3B 2P05A 4AKZA 1FGQA 1OF5B 3NX0A 4XBXA 3G4S3 3LT9A 1G96A 4XM4A 4X2OA 1VQM3 4BTYA 3KN4A 1LOXA 2Z6BA 1AVLA 4KFFA 4H61A 2OCTA 4CDLA 3EF8A 3KSPA 4FCJA 4CCVA 1IQXA 2YFJB 3FZWA 1JJ22 3BB9A 3OWUA 2XH9A 1JV2B 5ELJA 2BHMA 3EJVA 5ELUA 4LMIA 1O7NB 3KZTA 2PNCA 4K1UA 1OPYA 4WFOA 2QEX3 1K8A4 3MKIA 3K0ZA 1OF5A 1YIJ3 4HYZA 2K0MA 1OGXA 3MSOA 2FNQA 2K54A 2P09A 3LT8A 2W2CA 3N9HA 4O8SA 1VQK3 2GEXA 1NDOB 2B24B 2LQVA 1MNLA 1ULJB 1Q824 5EQLA 1M904 3I553 1D6YA 1IVVA 1S723 3ER7A 3FKAA 3GZYB 4WYKB 5CLKA 3T8UA 3CCQ3 3FG3A 2XGNA 3S27A 1VQL3 3BNBA 1S5AA 3T0UA 1OHOA 3SLUA 1DVDA 1ROAA 1A90A 2OQEA 2RGQA 4I4KA 3WA3A 2QA43 2V1LA 4RBNA 5AIIA 5IEOA 3VSYA 4NREA 3AMOB 1E3RA 1YGEA 3HX8A 4N6MA 1CYVA 3X3ZA 2YX9A 3JUPA 3CCV3 2LYXA 3WDGB 1RRLA 2BMOB 3JUNA 1NWWA 1D6UA 3FSDA 4J9AA 3FGYA 3CCL3 2JQ5A 1ZX2A 1DMNA 3HIIA 4HM2B 4GL6A 1Q40A 2BMRB 1SPUA 2ZL8A 2W56A 4Q53A 3FH1A 3DUKA 1O7WB 2IA7A 2C11A 5AIHA 4HVNA 2XR8B 1Q814 3V98A 2WOFA 4KFEA 1QAKA 5AEWB 3Q2PA 4HM6B 5BVBA 1IQ8A 1VQ63 1JKGA 2CWVA 3NBRA 1EG9B 7STDA 1IT7A 3VGNA 1WMPA 1YJN3 1ZO2A 3EBTA 3ROBA 4AEQA 1CEWI 3DZLA 3J7Yd 1EKMA 2CH9A 1W5ZA 3DMCA 1C7HA 3UNLA 3EBYA 3NXJA 1FGTA 3NQYA 4FMAA 1STDA 4R80A 3WOFB 1O7GB 4XDVA 3MG2A 2RFRA 3UB1A 1JB5A 3EHCA 2CG1A 3VF1A 1OGZA 2BO9B 1EA2A 4N6V0 3M8CA 1OUNA 3KSED 3GWRA 2P0XA 4HZ9B 8CHOA 3MYTA 3LTBA 1T5YA 2W6JH 1UI7A 2ML5A 1W7CA 3B4OA 3F9SA 3CCE3 3MHEA 4H3UA 1L5GB 3WA2X 5JBSA 5AYSC 1IK3A 3G6E3 1TU5A 2CFLA 1JNQA 5CF1A 1OACA 5TGNA 2D42A 2XGLA 4FCMA 3O8YA 1WTHA 3JUOA 3CNMA 1RJOA 4U13A 3V92A 1KD14 1STFI 1JN5B 3PZWA 1ISKA 3JVCA 3TDGA 4FCZA 4KFDA 1VQ83 2KRTA 2INXA 1E97A 2XRXB 3NV0A 1Q42A 3G16A 4FMDA 2PZVA 1W6CA 1EQKA 1KWIA 2CIUA 3H51A 1OHSA 2OTJ3 5LC7A 1Y4KA 4MMYB 3FF0A 4N6TA 2CFDA 4MEIA 3F40A 3Q1CA 3LTDA 4R1KA 4XBYA 3QK9A 4WHAA 1YJ93 4K61A 5HGRA 3DGMA 2OQEC 2XFTA 4R4KA 4WWUC 2WOHA 5STDA 4O3VA 5G2GA 3S67A 1YHQ3 2D1WA 3CCJ3 2P38A 3EN8A 3F7XA 3V99A 3JUMA 4ZM8A 1M1K4 2BNGA 1O7PB 3OXAA 4LSOA 4ORLA 4XB5A 1CQSA 1U5OA 1V74A 1K9M4 4RNYA 5I97A 3G8ZA 1BUQA 2GXFA 1TIJA 2O9UX 1N5HA 1WMOA 3RDEA 3K7CA 4OK0A 4J8TA 3F7SA 4HM8B 4PEJA 3LH4A 4L8PA 1GY5A 2I9WA 3OV4A 2HMJB 2O3OA 1GS3A 3BNDA 5IG3A 3CMA3 2UX0A 3CD63 2W9PA 3LMLA 2KXGA 1ULIB 1ASKA 3HIGA 2CHCA 3HK4A 1QJGA 2HMKB 3LZAA 3MG1A 1MOLA 1U8CB 5LC6A 1IVWA 2E2TA 3H3HA 1SJWA 3LOYA 2YFLB 3HI7A 3B7CA 1E3VA 3KIIA 3FF2A 3CCS3 4IIAA 1O7HB 1NO3A 4WYKA 3CC23 1NB5I 3NM2A 4K90B 5FW5A 2Q07A 3UL5A 1W6GA 3CPOA 3PS8A 2A15A 3DGNA 3L0RA 1JB4A 2GU3A 2L4VA 1W2B2 1SQWA 4FR9A 1F8NA 1K41A 5AEUB 4EC6A 1AR0A 3MPHA 1YI23 3GZXB 3GAXA 4TX4A 3AMOA 3UJMA 3EN1B 1W02A 3LTAA 3WMDA 3N8BA 3PGBA 2WO0A 2HMLB 3S29A 1QMAA 2JDIH 4IPBA 3BNCA 1WMNA 3UL6A 4K1VA 2IMJA 3MG3A 4WP5A 1N5PA 2Z76A 1GY6A 1KQS2 3SX1A 1OCVA 3I0YA 4LGQA 4NHFA 5BXQA 1RKYA 3D9RA 3MWZA 1A2KA 1US1A 5IG5A 1Z1SA 1W01A 1IU7A 4EXRA 1O7MB 1LVNA 3PCSA 3K5TA 1GY7A 4N6LA 3SXXA 4FMBA 3WOEB 3NHXA 3Q90A 3BNEA 3FLJA 4XDWA 2WGQA 5IW9A 4N6UA 4L8OA 1GD4A 3X40A 2IUKA 3CNXA 1TUHA 3IJEB 2FXTA 1IQYA 3KFQC 3STDA 2OTL3 3N54B 4O2HA 3SOYA 3I563 3FCSB 4AKYA 2MF7A 1QVG2 1IT8A 4EYCA 2OOVA 3X42A 3IMAB 3U97A 2MC8A 1JRQA 1KSIA 1N9EA 2W03A 2Z77A 3K63A 3A76A 1N8QA 2B1XB 3FG1A 4EBGA 2F99A 1WQLB 2W04A 4OVMA 3CXC2 3OW22 3X41A 5IERA 3DM8A 4STDA 2XEPA 1DMQA 2HMOB 3F8XA 5AIGA 1J2BA 4L7KA 4G1MB 1IDPA 2P0MA 1JN5A 2CG0A 3CME3 2M7OA 4LZIA 3X3YA 1PFPA 1FUWA 3EC9A 5D82A 3S28A 2W0QA 3CCR3 2QGUA 5AI1A 3OWYA 1IV7A 2RSXA 2XSOB 3IPTA 3RGRA 4RNZA 5D81A 1W4NA 4N3VA 5IF6A 4LEHA 1NU3A 3K9MC 1SIIA 4MMXB 4OUQA 3T8NA 1Q864 4FMCA 3KKGA 1N8R4 1D6ZA 5KP1A 3ALAA 2HMMB 1TFKA 3G0KA 5DRVA 1W00A 3DY5A 3WODG 5IENA 2QIYA 3ECFA 1QAFA 3B4PA 5FGOA 4HM4B 1FGRA 2C10A 4KVHA 5EEOA 1AVKA 3CCM3 4KZ1A 5IG4A 5DREA 1GYBA 1LNHA 4HM7B 1SIHA 3SEDA 3B8LA 1M1XB 2ML6A 4HZBB 1UW1A 3U1WA 1LXEA 2BT3A 2Z7AA 3OX9A 4MJDA 5A0OB 3NQZA 1QVF2 1DYUA 2GBWB 5D83A 1VQ93 3NUVA 3EE1A 3CPW2 2CK3H 5JPUA 3EQQB 1YIT3 3CC73 1RN7A 1IVUA 3CCU3 2BMQB 1Q7Y4 1M9GA 1VQN3 3PYJA 1AV4A 3DGLA 5IG0A 4QWTA 5JPPA 2E2VA 2F98A 3G713 6STDA 4HM0B 1N9JA 3NBBA 3NM7A 1Q40B 1UI8A 1K734 2W56B 3CC43 1VQ73 2XFSA 1NB3I 2Y74A 3X3XA 3RGAA 3FG4A 3LYGA 2W9QA 4IT7A 4HBRA 1CYUA 3D3LA 2OOVC 4BTWA 1JKGB 3QRDA 4JRFA 3F14A 5IEPA 1VZZA 2OWPA 1FA3A 3GRDA 2SBLA 3NBJA 1UUWB 1PU4A 3EX9A 1RRHA 5EVHA 1YJW3 1FGMA 2XF3A 4JF8A 4R9LA 3HZPA 2GEYA 1DVCA 3LXUX 4HM5B 2GU1A 4R9KA 2CC3A 4HM1B 1K28A 2IUJA 2GBXB 1ROVA 2XSHB 1QALA 2CFGA 3S5CA 3LTCA 2E2UA 4MMZB 5CK6A 1TFOA 1VQP3 2FGTA 3PCRA 1UUVB 1OH0A 3GZBA 1YVBI 1KC84 5AIFA 1WNHA 5AYRB 3DXOA 3DGOA 2ZDJA 1OHPA 4EV2A 2CFKA 1R4CA 1IVXA 1HU9A 2WGOA 3SOAA 3PXMA 2CW9A 1A2VA 2STDA 2Y73A 4RZMA 3GZRA 5KP3A 4EV5A 5KP4A 3NV0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUQ A;  4HKV B;  2HMN B;  5CXO A;  4GB5 A;  3KE7 A;  1DMM A;  4XBT A;  1JB2 A;  2F86 B;  2RCD A;  1HKX A;  3CU3 A;  3E99 A;  4HJL B;  3OWS A;  4X2H A;  3F8H A;  1W6Y A;  2YFI B;  5CF2 A;  1TP6 A;  3BLZ A;  2R4I A;  2CKF B;  4HM3 B;  1OF5 B;  4XBX A;  4XM4 A;  4X2O A;  4CDL A;  3EF8 A;  3KSP A;  4FCJ A;  2YFJ B;  3FZW A;  3BB9 A;  3OWU A;  3EJV A;  4LMI A;  1O7N B;  3KZT A;  4K1U A;  1OPY A;  3MKI A;  3K0Z A;  1OF5 A;  1OGX A;  3MSO A;  2K54 A;  2W2C A;  2GEX A;  1NDO B;  2B24 B;  1ULJ B;  3ER7 A;  3FKA A;  3GZY B;  4WYK B;  5CLK A;  3T8U A;  1S5A A;  1OHO A;  2RGQ A;  4I4K A;  5AII A;  5IEO A;  3VSY A;  1E3R A;  3HX8 A;  3JUP A;  2BMO B;  3JUN A;  1NWW A;  3FSD A;  4J9A A;  3FGY A;  2JQ5 A;  1ZX2 A;  1DMN A;  4HM2 B;  1Q40 A;  2BMR B;  4Q53 A;  3FH1 A;  3DUK A;  1O7W B;  5AIH A;  4HVN A;  2XR8 B;  5AEW B;  4HM6 B;  5BVB A;  1JKG A;  3NBR A;  1EG9 B;  7STD A;  3VGN A;  1ZO2 A;  3EBT A;  3ROB A;  3DZL A;  3DMC A;  1C7H A;  3UNL A;  3EBY A;  3NXJ A;  1STD A;  1O7G B;  4XDV A;  3MG2 A;  2RFR A;  1JB5 A;  3EHC A;  1OGZ A;  1EA2 A;  3M8C A;  1OUN A;  3GWR A;  4HZ9 B;  8CHO A;  3MYT A;  3B4O A;  3F9S A;  3MHE A;  4H3U A;  5CF1 A;  5TGN A;  4FCM A;  4U13 A;  3JUO A;  3CNM A;  1JN5 B;  1ISK A;  2INX A;  1E97 A;  2XRX B;  3NV0 A;  1Q42 A;  3G16 A;  2PZV A;  3H51 A;  1OHS A;  3FF0 A;  3F40 A;  4R1K A;  4XBY A;  5HGR A;  4WWU C;  5STD A;  5G2G A;  3EN8 A;  3F7X A;  3JUM A;  2BNG A;  1O7P B;  3OXA A;  4ORL A;  4XB5 A;  1CQS A;  1U5O A;  3G8Z A;  1BUQ A;  2GXF A;  3K7C A;  4J8T A;  3F7S A;  4HM8 B;  4PEJ A;  4L8P A;  1GY5 A;  2I9W A;  3OV4 A;  2HMJ B;  1GS3 A;  5IG3 A;  2UX0 A;  1ULI B;  1ASK A;  2CHC A;  3HK4 A;  1QJG A;  2HMK B;  3LZA A;  3MG1 A;  3H3H A;  1SJW A;  2YFL B;  3B7C A;  1E3V A;  3FF2 A;  4IIA A;  1O7H B;  4WYK A;  3NM2 A;  5FW5 A;  3CPO A;  2A15 A;  1JB4 A;  1K41 A;  5AEU B;  1AR0 A;  3GZX B;  3UJM A;  3EN1 B;  1W02 A;  3WMD A;  2HML B;  1QMA A;  4K1V A;  2IMJ A;  3MG3 A;  4WP5 A;  2Z76 A;  1GY6 A;  1OCV A;  3I0Y A;  4LGQ A;  5BXQ A;  3D9R A;  1A2K A;  5IG5 A;  1Z1S A;  1W01 A;  1O7M B;  1GY7 A;  3NHX A;  3Q90 A;  3FLJ A;  4XDW A;  4L8O A;  3CNX A;  1TUH A;  3STD A;  3SOY A;  2Z77 A;  3A76 A;  2B1X B;  2F99 A;  1WQL B;  4OVM A;  5IER A;  3DM8 A;  4STD A;  1DMQ A;  2HMO B;  3F8X A;  5AIG A;  4L7K A;  1IDP A;  1JN5 A;  3EC9 A;  5D82 A;  2QGU A;  5AI1 A;  3OWY A;  3IPT A;  2XSO B;  3RGR A;  5D81 A;  5IF6 A;  4N3V A;  4LEH A;  1NU3 A;  4OUQ A;  3T8N A;  3KKG A;  5KP1 A;  2HMM B;  3G0K A;  5DRV A;  1W00 A;  5IEN A;  2QIY A;  3ECF A;  3B4P A;  4HM4 B;  4KVH A;  5IG4 A;  5DRE A;  1GYB A;  4HM7 B;  3SED A;  3B8L A;  4HZB B;  2Z7A A;  3OX9 A;  4MJD A;  2GBW B;  5D83 A;  3NUV A;  5JPU A;  3EQQ B;  2BMQ B;  5IG0 A;  5JPP A;  2F98 A;  6STD A;  4HM0 B;  1Q40 B;  3RGA A;  3LYG A;  1JKG B;  3F14 A;  5IEP A;  1VZZ A;  2OWP A;  3GRD A;  1UUW B;  3EX9 A;  5EVH A;  4R9L A;  3HZP A;  2GEY A;  4HM5 B;  4R9K A;  4HM1 B;  2GBX B;  2XSH B;  3S5C A;  5CK6 A;  1UUV B;  1OH0 A;  3GZB A;  5AIF A;  3DXO A;  1OHP A;  3SOA A;  2STD A;  4RZM A;  3GZR A;  5KP3 A;  5KP4 A;  3NV0 B; 
#chains in the Genus database with same CATH topology
 3JUQ A;  4BU4 A;  4CPK A;  3SVA A;  4HKV B;  2HMN B;  1LOY A;  5CXO A;  4GB5 A;  1VQ5 3;  3KE7 A;  2CWT A;  1DMM A;  1I70 A;  4XBT A;  1IV9 A;  4N6N B;  1BRK A;  1BVI A;  1GD3 A;  1JB2 A;  2F86 B;  2KCD A;  1HKX A;  2RCD A;  2UUG C;  3EB8 A;  3CU3 A;  3E99 A;  1RGA A;  4HJL B;  1VQO 3;  1A67 A;  3GSP A;  3OWS A;  4X2H A;  2CFW A;  1W2Z A;  2CWU A;  3F8H A;  1NJI 4;  3DH2 A;  1W6Y A;  2YFI B;  4BTX A;  1RGL A;  1FGO A;  5CF2 A;  1TP6 A;  1VQ4 3;  4O02 B;  3BLZ A;  1LQM B;  2R4I A;  3AHW A;  2CKF B;  4HM3 B;  2P05 A;  4N6O B;  4AKZ A;  1FGQ A;  1OF5 B;  3AGO A;  3NX0 A;  4XBX A;  3G4S 3;  2F4Y A;  3D79 A;  1GOV A;  3LT9 A;  1G96 A;  4XM4 A;  4X2O A;  1VQM 3;  4BTY A;  3KN4 A;  2KF5 A;  2CX1 A;  1LOX A;  2Z6B A;  1AVL A;  4KFF A;  4H61 A;  2OCT A;  4CDL A;  3EF8 A;  3KSP A;  4FCJ A;  4CCV A;  1IQX A;  2YFJ B;  3FZW A;  1JJ2 2;  1V58 A;  3BB9 A;  3OWU A;  2XH9 A;  1JV2 B;  5ELJ A;  2BHM A;  3EJV A;  5ELU A;  1I2G A;  4LMI A;  5M1A A;  1O7N B;  1B2Z A;  2PNC A;  3KZT A;  1OPY A;  4K1U A;  1MWS A;  4WFO A;  2QEX 3;  1I0V A;  3MKI A;  3K0Z A;  1OF5 A;  1RN1 A;  1YIJ 3;  4HYZ A;  2K0M A;  1OGX A;  1BSD A;  3MSO A;  4CJN A;  2FNQ A;  2K54 A;  2P09 A;  3LT8 A;  2W2C A;  3N9H A;  4J5G A;  4O8S A;  1VQK 3;  2GEX A;  1NDO B;  2B24 B;  2LQV A;  1MNL A;  1ULJ B;  1Q82 4;  5EQL A;  1K8A 4;  1FUT A;  1M90 4;  1UCL A;  3I55 3;  1D6Y A;  1IVV A;  2SAR A;  1S72 3;  3ER7 A;  1UGI A;  3FKA A;  3GZY B;  3HOH A;  4WYK B;  5CLK A;  3T8U A;  3CCQ 3;  1BRG A;  3FG3 A;  2XGN A;  3S27 A;  1VQL 3;  3BNB A;  9RNT A;  1S5A A;  3BU4 A;  3T0U A;  1OHO A;  3SLU A;  1DVD A;  1ROA A;  1A90 A;  1I8V A;  1BNG A;  3A5E A;  2OQE A;  2RGQ A;  4I4K A;  4EW5 A;  3WA3 A;  2QA4 3;  2V1L A;  4RBN A;  1JBS A;  5M18 A;  1G02 A;  3BIR A;  1Q9E A;  5AII A;  5IEO A;  3VSY A;  4NRE A;  1NNV A;  3AMO B;  1UCI A;  1E3R A;  1YGE A;  3HX8 A;  4N6M A;  1CYV A;  3X3Z A;  2YX9 A;  3JUP A;  3CCV 3;  1RMS A;  2LYX A;  3WDG B;  1RRL A;  1RLS A;  2BMO B;  1NWW A;  3JUN A;  1D6U A;  3FSD A;  7GSP A;  4J9A A;  3FGY A;  1RGH A;  3CCL 3;  2JQ5 A;  1ZX2 A;  1DMN A;  3HII A;  4HM2 B;  1RNB A;  4GL6 A;  1Q40 A;  2BMR B;  5HOH A;  1SPU A;  2ZL8 A;  2W56 A;  4Q53 A;  3FH1 A;  3DUK A;  1O7W B;  2IA7 A;  2C11 A;  5AIH A;  4BL2 A;  4HVN A;  2XR8 B;  1V57 A;  1B2X A;  1Q81 4;  2RBI A;  3V98 A;  2WOF A;  4KFE A;  1QAK A;  1G0T A;  5AEW B;  3Q2P A;  4HM6 B;  5BVB A;  1IQ8 A;  1VQ6 3;  1JKG A;  2CWV A;  3NBR A;  1EG9 B;  1GOU A;  7STD A;  1IT7 A;  3VGN A;  1WMP A;  1YJN 3;  1ZO2 A;  3EBT A;  3ROB A;  4AEQ A;  1CEW I;  1BNS A;  3DZL A;  3WHO A;  3J7Y d;  1RSN A;  1EUI C;  1EKM A;  2CH9 A;  1W5Z A;  3DMC A;  1C7H A;  3UNL A;  2F56 A;  3EBY A;  3NXJ A;  1RGF A;  1FGT A;  3NQY A;  4FMA A;  1STD A;  4R80 A;  2GSP A;  1O7G B;  4XDV A;  3WOF B;  3MG2 A;  2RFR A;  3UB1 A;  1JB5 A;  3EHC A;  2CG1 A;  3VF1 A;  1OGZ A;  2BO9 B;  1EA2 A;  1RGC A;  1BRI A;  4N6V 0;  3M8C A;  1BOX A;  1OUN A;  1TJD A;  3GWR A;  3KSE D;  1B2M A;  1B27 A;  1BNJ A;  4J5K A;  2P0X A;  4HZ9 B;  1BIR A;  3MYT A;  8CHO A;  3LTB A;  1T5Y A;  2W6J H;  1BU4 A;  1RTU A;  1UI7 A;  1BSC A;  1W7C A;  2ML5 A;  3B4O A;  3F9S A;  3MHE A;  4H3U A;  1L5G B;  1MWR A;  5AYS C;  3WA2 X;  5JBS A;  1IK3 A;  1HZ1 A;  2CFL A;  1TU5 A;  1JNQ A;  5CF1 A;  1OAC A;  5TGN A;  2D42 A;  2XGL A;  4FCM A;  3O8Y A;  1WTH A;  3JUO A;  3CNM A;  1RJO A;  4U13 A;  3V92 A;  1KD1 4;  1STF I;  1JN5 B;  3PZW A;  1ISK A;  3JVC A;  3TDG A;  4FCZ A;  4KFD A;  1VQ8 3;  1B2U A;  2KRT A;  2INX A;  1E97 A;  2XRX B;  3DGY A;  3NV0 A;  1Q42 A;  3G16 A;  1CH0 A;  4FMD A;  1FZU A;  1W6C A;  2PZV A;  1EQK A;  1GMP A;  1KWI A;  2CIU A;  3ZG0 A;  2HOH A;  1EEJ A;  3H51 A;  1OHS A;  2OTJ 3;  5LC7 A;  1TRP A;  1Y4K A;  4MMY B;  3FF0 A;  4N6T A;  2CFD A;  4MEI A;  4HOH A;  3F40 A;  3Q1C A;  1MGW A;  3LTD A;  4R1K A;  3QK9 A;  4XBY A;  4WHA A;  1YJ9 3;  4K61 A;  5HGR A;  3DGM A;  2OQE C;  2XFT A;  4R4K A;  4WWU C;  2WOH A;  5STD A;  4O3V A;  3AGN A;  5G2G A;  3S67 A;  1YHQ 3;  2D1W A;  3CCJ 3;  2P38 A;  3EN8 A;  3F7X A;  3V99 A;  2ZA4 A;  3JUM A;  4ZM8 A;  1M1K 4;  2BNG A;  1O7P B;  3OXA A;  4KT3 B;  4LSO A;  4ORL A;  1CQS A;  4XB5 A;  1U5O A;  1V74 A;  1K9M 4;  4RNY A;  5I97 A;  3G8Z A;  1BUQ A;  2GXF A;  1TIJ A;  2O9U X;  1N5H A;  2CX0 A;  1WMO A;  3RDE A;  1X1U A;  3K7C A;  1MWT A;  4OK0 A;  4J8T A;  3F7S A;  4HM8 B;  4PEJ A;  3LH4 A;  4L8P A;  1GY5 A;  5G1L A;  2I9W A;  2J8X B;  3Q3F A;  1AQZ A;  3OV4 A;  2HMJ B;  2O3O A;  1DE3 A;  1GS3 A;  3BND A;  5IG3 A;  3CMA 3;  2UX0 A;  3CD6 3;  2W9P A;  3LML A;  3ZFZ A;  1ZS7 A;  2KXG A;  1ULI B;  1RNT A;  1ASK A;  3HIG A;  2CHC A;  5BIR A;  3HK4 A;  1QJG A;  2HMK B;  3D4A A;  3LZA A;  3MG1 A;  1MOL A;  1U8C B;  5LC6 A;  1IVW A;  2E2T A;  3H3H A;  1SJW A;  3LOY A;  2YFL B;  1RCL A;  3B7C A;  3HI7 A;  1E3V A;  3KII A;  3FF2 A;  3CCS 3;  2F5M A;  1O7H B;  4IIA A;  1NO3 A;  4WYK A;  3CC2 3;  1R4Y A;  1NB5 I;  2H0H A;  3NM2 A;  5BU4 A;  4K90 B;  5FW5 A;  1BNE A;  2Q07 A;  3UL5 A;  1W6G A;  3CPO A;  3PS8 A;  2A15 A;  5G1K A;  3DGN A;  3L0R A;  1JB4 A;  2GU3 A;  2L4V A;  1W2B 2;  2IYJ A;  1SQW A;  1LOW A;  4FR9 A;  1YGW A;  1F8N A;  1K41 A;  5AEU B;  1JBT A;  1I2F A;  4EC6 A;  1LOV A;  2BU4 A;  1AR0 A;  3MPH A;  1YI2 3;  3GZX B;  1BSA A;  3GAX A;  4TX4 A;  3AMO A;  3UJM A;  3EN1 B;  1W02 A;  3LTA A;  3WMD A;  3N8B A;  3PGB A;  2WO0 A;  1UUG B;  2HML B;  3S29 A;  8RNT A;  1QMA A;  2JDI H;  4IPB A;  3BNC A;  1WMN A;  5M19 A;  2KF3 A;  4I5Q A;  3UL6 A;  4K1V A;  2IMJ A;  3MG3 A;  4WP5 A;  1N5P A;  2H0I A;  2Z76 A;  1GY6 A;  3D5G A;  1KQS 2;  1BSB A;  3SX1 A;  1OCV A;  1UCK A;  3WR2 A;  3I0Y A;  1LQG C;  4LGQ A;  4NHF A;  5BXQ A;  2L1S A;  3D9R A;  3KCH A;  3MWZ A;  1BAN A;  1RKY A;  1A2K A;  1US1 A;  1T2H A;  5IG5 A;  1BNI A;  1Z1S A;  1W01 A;  1IU7 A;  4EXR A;  4RNT A;  1O7M B;  1LVN A;  3PCS A;  3K5T A;  1GY7 A;  4N6L A;  3SXX A;  4FMB A;  3WOE B;  3NHX A;  3Q90 A;  3BNE A;  3FLJ A;  2R41 A;  1SAR A;  4XDW A;  2WGQ A;  5IW9 A;  4N6U A;  3G6E 3;  1A2P A;  4L8O A;  1YNV X;  2BIR A;  3AHS A;  1RGK A;  1GD4 A;  3RNT A;  3X40 A;  2IUK A;  1TTO A;  1TUH A;  3CNX A;  1RGE A;  3IJE B;  2FXT A;  1IQY A;  3KFQ C;  1I2E A;  3STD A;  2OTL 3;  3N54 B;  4O2H A;  3SOY A;  3I56 3;  2F5W A;  3FCS B;  4AKY A;  2H0G A;  2MF7 A;  4GSP A;  1QVG 2;  1IT8 A;  4EYC A;  2OOV A;  3X42 A;  1YVS A;  4NPB A;  3IMA B;  1Q7H A;  3U97 A;  2MC8 A;  1JRQ A;  1BAO A;  1KSI A;  1N9E A;  2W03 A;  2Z77 A;  3K63 A;  3A76 A;  4LYL B;  4BIR A;  1N8Q A;  1PYL A;  2B1X B;  3FG1 A;  4EBG A;  1RGG A;  2F99 A;  1WQL B;  2W04 A;  4OVM A;  3CXC 2;  1JBR A;  1RCK A;  2KAA A;  3OW2 2;  3X41 A;  5IER A;  3DM8 A;  4STD A;  1BRN L;  1X1Y A;  1GMR A;  2XEP A;  1DMQ A;  2HMO B;  1PY3 A;  1X1X A;  3F8X A;  5AIG A;  1J2B A;  4L7K A;  2RNT A;  4G1M B;  1RDS A;  1IDP A;  1B20 A;  2P0M A;  1JN5 A;  1HYF A;  4GHO A;  2CG0 A;  3CME 3;  1BRS A;  2M7O A;  4LZI A;  3X3Y A;  1PFP A;  1FUW A;  3EC9 A;  5D82 A;  3S28 A;  3URP A;  2AAD A;  2W0Q A;  1VQQ A;  3CCR 3;  2QGU A;  5AI1 A;  1GMQ A;  3OWY A;  1IV7 A;  2RSX A;  2XSO B;  3IPT A;  1RHL A;  4RNZ A;  5D81 A;  3RGR A;  1MGR A;  1W4N A;  4N3V A;  5IF6 A;  4LEH A;  1NU3 A;  3K9M C;  1SII A;  4MMX B;  4OUQ A;  3T8N A;  1Q86 4;  4FMC A;  3KKG A;  6GSP A;  1N8R 4;  1D6Z A;  5KP1 A;  1ZGX A;  2HMM B;  1TFK A;  3ALA A;  3G0K A;  5DRV A;  1W00 A;  3DY5 A;  3WOD G;  1LRA A;  1BNF A;  5IEN A;  2QIY A;  1DET A;  3ECF A;  1QAF A;  3B4P A;  5FGO A;  4HM4 B;  1FGR A;  2C10 A;  4KVH A;  2KF4 A;  1AVK A;  4HAA A;  5EEO A;  3CCM 3;  2IY2 A;  4KZ1 A;  5IG4 A;  1C54 A;  1AY7 A;  6RNT A;  5DRE A;  1GYB A;  1LNH A;  4HM7 B;  1SIH A;  3SED A;  1BUJ A;  3B8L A;  1GOY A;  1M1X B;  2ML6 A;  4HZB B;  1UW1 A;  3U1W A;  1LXE A;  2BT3 A;  2Z7A A;  3OX9 A;  4MJD A;  5A0O B;  3NQZ A;  1QVF 2;  1DYU A;  2GBW B;  5D83 A;  1VQ9 3;  3NUV A;  3EE1 A;  3CPW 2;  2CK3 H;  5JPU A;  3ZG5 A;  1B2S A;  2AAE A;  3EQQ B;  1YIT 3;  3CC7 3;  1RN7 A;  1IVU A;  3CCU 3;  2BMQ B;  1Q7Y 4;  1M9G A;  1VQN 3;  1MWU A;  3PYJ A;  1AV4 A;  3DGL A;  5IG0 A;  1FUS A;  5GSP A;  4QWT A;  5JPP A;  2E2V A;  2F98 A;  2ZHX B;  3G71 3;  1BRH A;  1X1W A;  6STD A;  1BNR A;  4HM0 B;  1N9J A;  3NBB A;  3NM7 A;  1Q40 B;  1UI8 A;  1K73 4;  1FW7 A;  2W56 B;  7RNT A;  1VQ7 3;  1JZO A;  2XFS A;  3CC4 3;  1I3F A;  1NB3 I;  2Y74 A;  3X3X A;  3RGA A;  1BSE A;  3FG4 A;  3LYG A;  2W9Q A;  4IT7 A;  4HBR A;  1CYU A;  1UGH I;  3D3L A;  1UCJ A;  2OOV C;  4BTW A;  1I3I A;  1JKG B;  1RN4 A;  3QRD A;  4JRF A;  3F14 A;  2KF6 A;  5IEP A;  1VZZ A;  2OWP A;  1I0X A;  1FA3 A;  1IYY A;  3GRD A;  2SBL A;  3NBJ A;  1UUW B;  1PU4 A;  1UDI I;  3EX9 A;  1T3B A;  1RRH A;  5EVH A;  4BL3 A;  1YJW 3;  1FGM A;  2XF3 A;  4JF8 A;  4R9L A;  3HZP A;  2GEY A;  5RNT A;  1DVC A;  2C4B A;  3LXU X;  1JZD A;  4HM5 B;  2GU1 A;  3SYU A;  2K3D A;  1LNI A;  4R9K A;  2CC3 A;  4HM1 B;  1K28 A;  2IUJ A;  2GBX B;  3CCE 3;  1ROV A;  2XSH B;  1QAL A;  1TRQ A;  2CFG A;  3S5C A;  3LTC A;  1FYS A;  2E2U A;  4MMZ B;  5CK6 A;  1TFO A;  1VQP 3;  2FGT A;  3PCR A;  1UUV B;  1OH0 A;  3D5I A;  3GZB A;  1BRJ A;  1YVB I;  5AIF A;  1KC8 4;  1WNH A;  5AYR B;  1GSP A;  4DKI A;  3DXO A;  1BGS A;  3DGO A;  2ZDJ A;  1OHP A;  4ILF A;  4EV2 A;  2CFK A;  1R4C A;  1IVX A;  1HU9 A;  2WGO A;  3SOA A;  3PXM A;  2CW9 A;  1A2V A;  1T2I A;  2UGI A;  2STD A;  2Y73 A;  4RZM A;  3GZR A;  5KP3 A;  4EV5 A;  1B3S A;  1B21 A;  5KP4 A;  3NV0 B; 
#chains in the Genus database with same CATH homology
 3JUQ A;  3SVA A;  4HKV B;  2HMN B;  5CXO A;  4GB5 A;  1VQ5 3;  3KE7 A;  2CWT A;  1DMM A;  4XBT A;  1IV9 A;  4N6N B;  1GD3 A;  1JB2 A;  2F86 B;  2KCD A;  1HKX A;  2RCD A;  3EB8 A;  3CU3 A;  3E99 A;  1VQO 3;  4HJL B;  1A67 A;  3OWS A;  4X2H A;  2CFW A;  1W2Z A;  2CWU A;  3F8H A;  1NJI 4;  1W6Y A;  2YFI B;  4BTX A;  1FGO A;  5CF2 A;  1TP6 A;  1VQ4 3;  4O02 B;  3BLZ A;  2R4I A;  4N6O B;  2CKF B;  4HM3 B;  2P05 A;  4AKZ A;  1FGQ A;  1OF5 B;  3NX0 A;  4XBX A;  3G4S 3;  3LT9 A;  1G96 A;  4XM4 A;  4X2O A;  1VQM 3;  4BTY A;  3KN4 A;  1LOX A;  2Z6B A;  1AVL A;  4KFF A;  4H61 A;  2OCT A;  4CDL A;  3EF8 A;  3KSP A;  4FCJ A;  4CCV A;  1IQX A;  2YFJ B;  3FZW A;  1JJ2 2;  3BB9 A;  3OWU A;  2XH9 A;  1JV2 B;  5ELJ A;  2BHM A;  3EJV A;  5ELU A;  4LMI A;  1O7N B;  3KZT A;  2PNC A;  4K1U A;  1OPY A;  4WFO A;  2QEX 3;  1K8A 4;  3MKI A;  3K0Z A;  1OF5 A;  1YIJ 3;  4HYZ A;  2K0M A;  1OGX A;  3MSO A;  2FNQ A;  2K54 A;  2P09 A;  3LT8 A;  2W2C A;  3N9H A;  4O8S A;  1VQK 3;  2GEX A;  1NDO B;  2B24 B;  2LQV A;  1MNL A;  1ULJ B;  1Q82 4;  5EQL A;  1M90 4;  3I55 3;  1D6Y A;  1IVV A;  1S72 3;  3ER7 A;  3FKA A;  3GZY B;  4WYK B;  5CLK A;  3T8U A;  3CCQ 3;  3FG3 A;  2XGN A;  3S27 A;  1VQL 3;  3BNB A;  1S5A A;  3T0U A;  1OHO A;  3SLU A;  1DVD A;  1ROA A;  1A90 A;  2OQE A;  2RGQ A;  4I4K A;  3WA3 A;  2QA4 3;  2V1L A;  4RBN A;  5AII A;  5IEO A;  3VSY A;  4NRE A;  3AMO B;  1E3R A;  1YGE A;  3HX8 A;  4N6M A;  1CYV A;  3X3Z A;  2YX9 A;  3JUP A;  3CCV 3;  2LYX A;  3WDG B;  1RRL A;  2BMO B;  3JUN A;  1NWW A;  1D6U A;  3FSD A;  4J9A A;  3FGY A;  3CCL 3;  2JQ5 A;  1ZX2 A;  1DMN A;  3HII A;  4HM2 B;  4GL6 A;  1Q40 A;  2BMR B;  1SPU A;  2ZL8 A;  2W56 A;  4Q53 A;  3FH1 A;  3DUK A;  1O7W B;  2IA7 A;  2C11 A;  5AIH A;  4HVN A;  2XR8 B;  1Q81 4;  3V98 A;  2WOF A;  4KFE A;  1QAK A;  5AEW B;  3Q2P A;  4HM6 B;  5BVB A;  1IQ8 A;  1VQ6 3;  1JKG A;  2CWV A;  3NBR A;  1EG9 B;  7STD A;  1IT7 A;  3VGN A;  1WMP A;  1YJN 3;  1ZO2 A;  3EBT A;  3ROB A;  4AEQ A;  1CEW I;  3DZL A;  3J7Y d;  1EKM A;  2CH9 A;  1W5Z A;  3DMC A;  1C7H A;  3UNL A;  3EBY A;  3NXJ A;  1FGT A;  3NQY A;  4FMA A;  1STD A;  4R80 A;  3WOF B;  1O7G B;  4XDV A;  3MG2 A;  2RFR A;  3UB1 A;  1JB5 A;  3EHC A;  2CG1 A;  3VF1 A;  1OGZ A;  2BO9 B;  1EA2 A;  4N6V 0;  3M8C A;  1OUN A;  3KSE D;  3GWR A;  2P0X A;  4HZ9 B;  8CHO A;  3MYT A;  3LTB A;  1T5Y A;  2W6J H;  1UI7 A;  2ML5 A;  1W7C A;  3B4O A;  3F9S A;  3CCE 3;  3MHE A;  4H3U A;  1L5G B;  3WA2 X;  5JBS A;  5AYS C;  1IK3 A;  3G6E 3;  1TU5 A;  2CFL A;  1JNQ A;  5CF1 A;  1OAC A;  5TGN A;  2D42 A;  2XGL A;  4FCM A;  3O8Y A;  1WTH A;  3JUO A;  3CNM A;  1RJO A;  4U13 A;  3V92 A;  1KD1 4;  1STF I;  1JN5 B;  3PZW A;  1ISK A;  3JVC A;  3TDG A;  4FCZ A;  4KFD A;  1VQ8 3;  2KRT A;  2INX A;  1E97 A;  2XRX B;  3NV0 A;  1Q42 A;  3G16 A;  4FMD A;  2PZV A;  1W6C A;  1EQK A;  1KWI A;  2CIU A;  3H51 A;  1OHS A;  2OTJ 3;  5LC7 A;  1Y4K A;  4MMY B;  3FF0 A;  4N6T A;  2CFD A;  4MEI A;  3F40 A;  3Q1C A;  3LTD A;  4R1K A;  4XBY A;  3QK9 A;  4WHA A;  1YJ9 3;  4K61 A;  5HGR A;  3DGM A;  2OQE C;  2XFT A;  4R4K A;  4WWU C;  2WOH A;  5STD A;  4O3V A;  5G2G A;  3S67 A;  1YHQ 3;  2D1W A;  3CCJ 3;  2P38 A;  3EN8 A;  3F7X A;  3V99 A;  3JUM A;  4ZM8 A;  1M1K 4;  2BNG A;  1O7P B;  3OXA A;  4LSO A;  4ORL A;  4XB5 A;  1CQS A;  1U5O A;  1V74 A;  1K9M 4;  4RNY A;  5I97 A;  3G8Z A;  1BUQ A;  2GXF A;  1TIJ A;  2O9U X;  1N5H A;  1WMO A;  3RDE A;  3K7C A;  4OK0 A;  4J8T A;  3F7S A;  4HM8 B;  4PEJ A;  3LH4 A;  4L8P A;  1GY5 A;  2I9W A;  3OV4 A;  2HMJ B;  2O3O A;  1GS3 A;  3BND A;  5IG3 A;  3CMA 3;  2UX0 A;  3CD6 3;  2W9P A;  3LML A;  2KXG A;  1ULI B;  1ASK A;  3HIG A;  2CHC A;  3HK4 A;  1QJG A;  2HMK B;  3LZA A;  3MG1 A;  1MOL A;  1U8C B;  5LC6 A;  1IVW A;  2E2T A;  3H3H A;  1SJW A;  3LOY A;  2YFL B;  3HI7 A;  3B7C A;  1E3V A;  3KII A;  3FF2 A;  3CCS 3;  4IIA A;  1O7H B;  1NO3 A;  4WYK A;  3CC2 3;  1NB5 I;  3NM2 A;  4K90 B;  5FW5 A;  2Q07 A;  3UL5 A;  1W6G A;  3CPO A;  3PS8 A;  2A15 A;  3DGN A;  3L0R A;  1JB4 A;  2GU3 A;  2L4V A;  1W2B 2;  1SQW A;  4FR9 A;  1F8N A;  1K41 A;  5AEU B;  4EC6 A;  1AR0 A;  3MPH A;  1YI2 3;  3GZX B;  3GAX A;  4TX4 A;  3AMO A;  3UJM A;  3EN1 B;  1W02 A;  3LTA A;  3WMD A;  3N8B A;  3PGB A;  2WO0 A;  2HML B;  3S29 A;  1QMA A;  2JDI H;  4IPB A;  3BNC A;  1WMN A;  3UL6 A;  4K1V A;  2IMJ A;  3MG3 A;  4WP5 A;  1N5P A;  2Z76 A;  1GY6 A;  1KQS 2;  3SX1 A;  1OCV A;  3I0Y A;  4LGQ A;  4NHF A;  5BXQ A;  1RKY A;  3D9R A;  3MWZ A;  1A2K A;  1US1 A;  5IG5 A;  1Z1S A;  1W01 A;  1IU7 A;  4EXR A;  1O7M B;  1LVN A;  3PCS A;  3K5T A;  1GY7 A;  4N6L A;  3SXX A;  4FMB A;  3WOE B;  3NHX A;  3Q90 A;  3BNE A;  3FLJ A;  4XDW A;  2WGQ A;  5IW9 A;  4N6U A;  4L8O A;  1GD4 A;  3X40 A;  2IUK A;  3CNX A;  1TUH A;  3IJE B;  2FXT A;  1IQY A;  3KFQ C;  3STD A;  2OTL 3;  3N54 B;  4O2H A;  3SOY A;  3I56 3;  3FCS B;  4AKY A;  2MF7 A;  1QVG 2;  1IT8 A;  4EYC A;  2OOV A;  3X42 A;  3IMA B;  3U97 A;  2MC8 A;  1JRQ A;  1KSI A;  1N9E A;  2W03 A;  2Z77 A;  3K63 A;  3A76 A;  1N8Q A;  2B1X B;  3FG1 A;  4EBG A;  2F99 A;  1WQL B;  2W04 A;  4OVM A;  3CXC 2;  3OW2 2;  3X41 A;  5IER A;  3DM8 A;  4STD A;  2XEP A;  1DMQ A;  2HMO B;  3F8X A;  5AIG A;  1J2B A;  4L7K A;  4G1M B;  1IDP A;  2P0M A;  1JN5 A;  2CG0 A;  3CME 3;  2M7O A;  4LZI A;  3X3Y A;  1PFP A;  1FUW A;  3EC9 A;  5D82 A;  3S28 A;  2W0Q A;  3CCR 3;  2QGU A;  5AI1 A;  3OWY A;  1IV7 A;  2RSX A;  2XSO B;  3IPT A;  3RGR A;  4RNZ A;  5D81 A;  1W4N A;  4N3V A;  5IF6 A;  4LEH A;  1NU3 A;  3K9M C;  1SII A;  4MMX B;  4OUQ A;  3T8N A;  1Q86 4;  4FMC A;  3KKG A;  1N8R 4;  1D6Z A;  5KP1 A;  3ALA A;  2HMM B;  1TFK A;  3G0K A;  5DRV A;  1W00 A;  3DY5 A;  3WOD G;  5IEN A;  2QIY A;  3ECF A;  1QAF A;  3B4P A;  5FGO A;  4HM4 B;  1FGR A;  2C10 A;  4KVH A;  5EEO A;  1AVK A;  3CCM 3;  4KZ1 A;  5IG4 A;  5DRE A;  1GYB A;  1LNH A;  4HM7 B;  1SIH A;  3SED A;  3B8L A;  1M1X B;  2ML6 A;  4HZB B;  1UW1 A;  3U1W A;  1LXE A;  2BT3 A;  2Z7A A;  3OX9 A;  4MJD A;  5A0O B;  3NQZ A;  1QVF 2;  1DYU A;  2GBW B;  5D83 A;  1VQ9 3;  3NUV A;  3EE1 A;  3CPW 2;  2CK3 H;  5JPU A;  3EQQ B;  1YIT 3;  3CC7 3;  1RN7 A;  1IVU A;  3CCU 3;  2BMQ B;  1Q7Y 4;  1M9G A;  1VQN 3;  3PYJ A;  1AV4 A;  3DGL A;  5IG0 A;  4QWT A;  5JPP A;  2E2V A;  2F98 A;  3G71 3;  6STD A;  4HM0 B;  1N9J A;  3NBB A;  3NM7 A;  1Q40 B;  1UI8 A;  1K73 4;  2W56 B;  3CC4 3;  1VQ7 3;  2XFS A;  1NB3 I;  2Y74 A;  3X3X A;  3RGA A;  3FG4 A;  3LYG A;  2W9Q A;  4IT7 A;  4HBR A;  1CYU A;  3D3L A;  2OOV C;  4BTW A;  1JKG B;  3QRD A;  4JRF A;  3F14 A;  5IEP A;  1VZZ A;  2OWP A;  1FA3 A;  3GRD A;  2SBL A;  3NBJ A;  1UUW B;  1PU4 A;  3EX9 A;  1RRH A;  5EVH A;  1YJW 3;  1FGM A;  2XF3 A;  4JF8 A;  4R9L A;  3HZP A;  2GEY A;  1DVC A;  3LXU X;  4HM5 B;  2GU1 A;  4R9K A;  2CC3 A;  4HM1 B;  1K28 A;  2IUJ A;  2GBX B;  1ROV A;  2XSH B;  1QAL A;  2CFG A;  3S5C A;  3LTC A;  2E2U A;  4MMZ B;  5CK6 A;  1TFO A;  1VQP 3;  2FGT A;  3PCR A;  1UUV B;  1OH0 A;  3GZB A;  1YVB I;  1KC8 4;  5AIF A;  1WNH A;  5AYR B;  3DXO A;  3DGO A;  2ZDJ A;  1OHP A;  4EV2 A;  2CFK A;  1R4C A;  1IVX A;  1HU9 A;  2WGO A;  3SOA A;  3PXM A;  2CW9 A;  1A2V A;  2STD A;  2Y73 A;  4RZM A;  3GZR A;  5KP3 A;  4EV5 A;  5KP4 A;  3NV0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...