1RGCA

The complex between ribonuclease t1 and 3'-guanylic acid suggests geometry of enzymatic reaction path. an x-ray study
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title The complex between ribonuclease T1 and 3'GMP suggests geometry of enzymic reaction path. An X-ray study.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgcA00
4HAAA 1RLSA 1BGSA 2BU4A 1MGRA 1LNIA 1RTUA 1RGLA 1B20A 1LOVA 1BSDA 1RCKA 2HOHA 2SARA 1RNBA 1BSEA 1RHLA 1BSCA 4RNTA 3WHOA 1LRAA 1RGHA 1RN4A 1RNTA 1G02A 1DETA 2KF4A 1RGEA 1IYYA 1B2ZA 3AGNA 1GMQA 2F5WA 1B21A 1GSPA 1RDSA 1T2IA 1X1XA 1B3SA 1I2EA 2KF3A 3AHSA 1BNFA 3GSPA 2BIRA 3D4AA 1GMPA 3HOHA 1YNVX 2GSPA 1BRJA 2KAAA 1CH0A 1X1WA 1BU4A 2AAEA 3DH2A 1GOYA 3SYUA 6GSPA 1BIRA 1X1UA 1RGAA 1RN1A 1C54A 1BNGA 1BVIA 1FUTA 2F56A 1AY7A 5HOHA 3URPA 1I0VA 3BU4A 5BU4A 9RNTA 1BNRA 1RCLA 1TRQA 2F5MA 1HYFA 4GHOA 1ZGXA 1SARA 1TTOA 1FZUA 1B2SA 1RGKA 1I0XA 1FUSA 1BUJA 8RNTA 1JBSA 3RNTA 1PY3A 1LOYA 1BRHA 1BNJA 5GSPA 1BOXA 1LOWA 1RGFA 7RNTA 2RBIA 1BNSA 7GSPA 1FW7A 1RSNA 1RGCA 1I3IA 3Q3FA 5RNTA 1UCJA 1I3FA 1T2HA 6RNTA 1RMSA 3KCHA 1BANA 1UCIA 1YGWA 1B2UA 1RGGA 1TRPA 3AHWA 1UCLA 2C4BA 4J5GA 2ZA4A 1I70A 1JBRA 2KF6A 1MGWA 1B2MA 1HZ1A 3DGYA 1I8VA 1X1YA 1Q9EA 3AGOA 4J5KA 1BRKA 3A5EA 1FYSA 1AQZA 1PYLA 1YVSA 4BIRA 1DE3A 3D5IA 1R4YA 4HOHA 1UCKA 1GMRA 1B2XA 4BU4A 1JBTA 1BRSA 1B27A 2F4YA 1BRIA 1BAOA 1A2PA 1BSAA 2AADA 2KF5A 3D5GA 4GSPA 1BNIA 1BRGA 2RNTA 3WR2A 1BSBA 1GOUA 5BIRA 1GOVA 1I2FA 1BRNL 3BIRA 1BNEA 1I2GA
chains in the Genus database with same CATH superfamily
4HAAA 1RLSA 3V92A 1BGSA 2BU4A 1MGRA 3E99A 1NO3A 1RTUA 3D79A 4ILFA 1OUNA 5IG0A 1BSDA 3CD63 3S28A 3LTAA 1RHLA 3S5CA 2KXGA 1WTHA 2Z6BA 3LT9A 1JRQA 3NHXA 4R9KA 4AKYA 1JJ22 3WHOA 2WO0A 1LRAA 5CXOA 3V99A 1KD14 5FGOA 1GD4A 3CCL3 4IT7A 1IYYA 3SOYA 1D6ZA 1ULIB 1QMAA 4HKVB 2F5WA 1RDSA 3KE7A 4FMAA 3GSPA 2KF3A 7STDA 2P0XA 3BB9A 2GBWB 3U97A 3PCRA 2KAAA 1IU7A 4K1VA 1T3BA 1BU4A 3MG2A 3X3ZA 3MHEA 4EYCA 4EW5A 4HM5B 5IEPA 1M1K4 2W04A 3S27A 3T0UA 1RN1A 2GEYA 1BNGA 1DMNA 3N54B 1BUQA 3PGBA 5AYRB 1FUTA 1LVNA 3FH1A 1U8CB 1WQLB 2F56A 5HGRA 4CCVA 4AKZA 2YX9A 4EV2A 1Q7Y4 3URPA 3EN8A 5BU4A 1F8NA 9RNTA 3LYGA 3CC73 1RCLA 3U1WA 1DVCA 1QJGA 3H51A 4GHOA 1W01A 3DGLA 4N6MA 1SARA 3AMOA 4WHAA 1IQXA 4GB5A 3EE1A 3SEDA 1FZUA 1YHQ3 3RDEA 1JZDA 1RGKA 1I0XA 3WA2X 4L8OA 5DRVA 2ML6A 8RNTA 1V58A 1Y4KA 3K7CA 2ZHXB 1PY3A 4QWTA 1NB3I 3KFQC 3BLZA 3KSED 4HM2B 4HM3B 1VQ73 4CDLA 2CHCA 3FG1A 3FSDA 2WOHA 3KZTA 3L0RA 2OCTA 2BMRB 3JVCA 2XH9A 1NU3A 1LXEA 1OGZA 3EBTA 4WYKB 2XSHB 3HX8A 4NREA 1OACA 5FW5A 3G4S3 4EXRA 1I3IA 1ZO2A 3FLJA 3KN4A 3LOYA 4RNYA 1PU4A 1SQWA 3J7Yd 1DVDA 1D6YA 4EBGA 2Z7AA 3F14A 1UCIA 1YGWA 3LMLA 4OK0A 4H61A 1VQQA 1TRPA 2QGUA 4FCZA 2CWVA 1AVKA 3AHWA 5I97A 5AIIA 2C4BA 4J5GA 2CWUA 3GZRA 4FR9A 2ZA4A 1I70A 1JBRA 2Z77A 1A67A 2CH9A 1MGWA 1SIHA 4FCMA 3CCR3 1JKGB 4O8SA 4N6V0 3PS8A 5IG3A 3DGYA 1VQM3 1I8VA 1X1YA 1TFKA 4OVMA 1FGOA 3AGOA 4J5KA 1BRKA 2K54A 1MWTA 3A5EA 2CK3H 2QA43 1DE3A 1JKGA 3LTDA 4GL6A 5G1KA 3DGNA 3CCQ3 1Q814 3CC43 2RGQA 4BU4A 4FCJA 3CCE3 5D81A 1UUGB 2O9UX 4R1KA 4XDWA 1BAOA 1FGMA 2LYXA 2WGQA 3FF0A 1BSAA 2R41A 3B8LA 2H0HA 3OV4A 3STDA 3TDGA 1UUWB 2KF5A 2XEPA 1GS3A 5JPPA 4X2OA 1GOUA 4N6OB 1G0TA 2HMLB 1GOVA 2CC3A 1ZX2A 1BRNL 5AEWB 2OQEA 3HK4A 5M19A 3FKAA 1I2GA 1GY7A 5IEOA 1M904 3CXC2 1AV4A 1LNIA 4JRFA 1CEWI 3GWRA 3I553 3K5TA 5KP4A 4R4KA 4ZM8A 4PEJA 3N8BA 1AR0A 2HOHA 4L8PA 3DMCA 1BSEA 3GZXB 1QVF2 4RBNA 5AI1A 2YFJB 4LYLB 1RGHA 1RNTA 4G1MB 2KF4A 1N8QA 3CPOA 3DM8A 4N6UA 3X3YA 2FXTA 4HBRA 3WODG 1B21A 1OHSA 1T2IA 3VSYA 2F86B 3NBBA 4KFFA 1OF5B 2P0MA 3GRDA 1GMPA 5D83A 3CME3 3HOHA 5AIHA 1UUVB 2YFLB 1IV9A 4O3VA 1KQS2 1JZOA 4HZ9B 1X1WA 3NQYA 3LTCA 4K61A 5JPUA 3MYTA 1JN5A 1YVBI 1OF5A 1EEJA 6GSPA 2CKFB 3NBRA 2QEX3 1RGAA 2CFKA 1A2VA 4FMBA 3SLUA 3LH4A 2P09A 3T8UA 1YJ93 1YJW3 3QRDA 5AYSC 6STDA 1OH0A 1EQKA 1OCVA 1OPYA 3BU4A 2OOVC 1S5AA 4KVHA 5LC7A 3N9HA 2RSXA 1TTOA 2XF3A 3BNCA 4O2HA 1ISKA 1B2SA 4HM8B 3B7CA 1BUJA 5CK6A 4XBTA 4U13A 3UNLA 1IDPA 3RNTA 5A0OB 3FZWA 1J2BA 3EX9A 1LOYA 2B1XB 1N9EA 1RRLA 5ELUA 1KC84 1JV2B 1Q40B 1BOXA 1LOWA 2BT3A 4KZ1A 1E97A 3CCV3 1GY6A 1CYUA 3HIIA 3OWUA 2FNQA 1EKMA 4HM0B 1N8R4 1W6YA 1CYVA 1RRHA 3G8ZA 1SPUA 3Q3FA 1Q40A 3FGYA 1IVVA 5RNTA 3AMOB 3G6E3 1NWWA 1EG9B 1T2HA 1ZS7A 3DXOA 1E3RA 2STDA 3NBJA 4H3UA 3CCU3 2QIYA 3JUNA 3O8YA 4CPKA 1WMOA 3I0YA 2O3OA 2BO9B 1ULJB 2CX1A 3WDGB 3ROBA 2KF6A 2Y74A 1WMPA 5EEOA 1NJI4 2RFRA 4FMCA 1O7GB 3EJVA 1STDA 1IT8A 1PYLA 1ROAA 2CFWA 3HIGA 4HJLB 5IF6A 4LMIA 1TU5A 4HOHA 3PZWA 1GMRA 1B2XA 4EC6A 1JBTA 3K9MC 4RNZA 4I4KA 2W2CA 2BNGA 1A2PA 5IERA 1IV7A 3NV0B 3DUKA 1TP6A 2HMOB 4GSPA 2RNTA 3D3LA 4R9LA 2SBLA 4MMZB 1I2FA 1T5YA 2JDIH 2E2TA 2F99A 4HYZA 1BNEA 4XBYA 3NV0A 1OHOA 1TUHA 2K3DA 2H0IA 4HM4B 1NDOB 3MG3A 3NX0A 3X40A 4NPBA 1B20A 1W02A 1O7NB 2UUGC 1WMNA 3WOEB 4LSOA 1DYUA 1LOVA 1O7HB 1UW1A 1RCKA 2BMOB 2WGOA 2Y73A 3MSOA 3CPW2 3JUOA 2BMQB 4RNTA 1EUIC 4WFOA 1K8A4 1A90A 5CLKA 4L7KA 2MC8A 2M7OA 4HVNA 2XFTA 5IENA 1D6UA 1DETA 3S67A 1RGEA 1K28A 4EV5A 1Q42A 1B2ZA 1V57A 3WMDA 3OWSA 1GMQA 1MWUA 3AHSA 1BNFA 1L5GB 2BIRA 3FG3A 1S723 3MKIA 4JF8A 3EN1B 1YNVX 2I9WA 3BNDA 5M18A 1CH0A 1IQYA 2P38A 4BTWA 1VQ83 3VF1A 2XGNA 2AAEA 5STDA 3KKGA 1IK3A 3KSPA 1YJN3 3MG1A 3SYUA 1VQ53 4KFEA 1V74A 3MPHA 1BVIA 1DMMA 1FGQA 1RJOA 1O7WB 1AY7A 2PNCA 1M9GA 3IPTA 3F40A 1TIJA 2PZVA 3LTBA 3RGRA 3S29A 1I0VA 2KCDA 4MMYB 5AIFA 2XRXB 3G713 1Q864 1VQL3 4BTYA 1VQP3 1YIT3 1HYFA 3OWYA 4LGQA 1FA3A 3VGNA 1YGEA 1Z1SA 1UGIA 1JN5B 2IMJA 1YIJ3 4K1UA 3ZG5A 1FUSA 3QK9A 2ZDJA 4N3VA 1JBSA 2HMMB 2YFIB 1OGXA 3Q1CA 1BRHA 5GSPA 5TGNA 1JB2A 1KWIA 2A15A 3DY5A 2GXFA 3X42A 2W03A 4N6TA 3IMAB 2ZL8A 2RBIA 1BNSA 7GSPA 4BL2A 7RNTA 1QVG2 3NM2A 1SIIA 1RSNA 3WA3A 4N6LA 3BNEA 3F7SA 3M8CA 3UL5A 2J8XB 1LNHA 1I3FA 2LQVA 1A2KA 3X3XA 1CQSA 1TFOA 1W5ZA 2W9PA 3X41A 3CCS3 3Q90A 3LXUX 4X2HA 1NNVA 3G0KA 3T8NA 3DZLA 1UDII 1HKXA 3DGOA 4Q53A 1DMQA 3SOAA 4DKIA 1LQGC 2W56B 4NHFA 1C7HA 2CFDA 4LEHA 5LC6A 2OOVA 3JUQA 3GAXA 3ZFZA 3G16A 1O7PB 3PYJA 4CJNA 1TJDA 4BL3A 1N9JA 1HZ1A 1RN7A 2HMJB 3ECFA 2D42A 3NXJA 2W56A 1US1A 2E2UA 3MWZA 1QALA 1AQZA 1YVSA 1HU9A 3GZYB 4BIRA 1K734 3D9RA 2F98A 2CW9A 3B4PA 2CFLA 3LT8A 5G2GA 5IG5A 1IVXA 3EHCA 3KIIA 4WP5A 1BRSA 3CMA3 3EC9A 1B27A 2F4YA 3DGMA 4RZMA 4WWUC 5EQLA 1VQK3 1M1XB 1UI8A 1KSIA 2V1LA 3HZPA 4LZIA 2CFGA 2K0MA 3BNBA 3D5GA 4XDVA 5IG4A 3H3HA 2D1WA 2OWPA 3WR2A 5KP1A 5BIRA 2L1SA 1VZZA 2XFSA 3CNMA 2B24B 1QAFA 1MNLA 2W0QA 3K63A 4TX4A 3FG4A 2XSOB 4HM6B 2L4VA 2P05A 1FGRA 3OW22 2INXA 1RGLA 3SXXA 3OXAA 1W2B2 2R4IA 2HMKB 2SARA 1RNBA 4MEIA 1GYBA 1BSCA 2ML5A 3F8HA 4N6NB 3LZAA 1RN4A 3CCJ3 1G02A 2Q07A 1PFPA 1JB5A 3AGNA 3PCSA 4HM1B 1Q7HA 1X1XA 1GSPA 2XR8B 1B3SA 1I2EA 2C10A 3UJMA 3F8XA 1MWSA 3D4AA 2CG0A 2MF7A 3OX9A 2JQ5A 4J9AA 1W00A 4BTXA 4XB5A 2GSPA 1BRJA 3FF2A 2IA7A 4MMXB 1VQ93 4ORLA 3V98A 3SVAA 5CF2A 3DH2A 4AEQA 1SJWA 1GOYA 1MOLA 2CWTA 4HZBB 1LOXA 8CHOA 1OHPA 3JUMA 4KT3B 2IUKA 1BIRA 1JB4A 1X1UA 2CG1A 1C54A 3IJEB 3NUVA 2E2VA 3ER7A 3EBYA 4J8TA 3ZG0A 5AIGA 5HOHA 4XBXA 1YI23 1IVWA 2C11A 1BNRA 1EA2A 1LQMB 4R80A 4WYKA 1O7MB 5CF1A 1GY5A 1TRQA 2F5MA 1FUWA 1ZGXA 2OTL3 3Q2PA 1VQN3 1JNQA 2OTJ3 3B4OA 1VQ63 1IT7A 5BXQA 1K9M4 2IY2A 3A76A 1W2ZA 2CX0A 5DREA 1BNJA 1IQ8A 1GD3A 4K90B 2GBXB 1R4CA 3CNXA 2RCDA 1IVUA 1RGFA 2IYJA 5M1AA 5D82A 1WNHA 1K41A 2W9QA 1VQ43 1FW7A 1U5OA 5KP3A 2W6JH 1UGHI 1RGCA 1N5HA 1FGTA 5BVBA 4OUQA 1UCJA 5G1LA 2GU3A 1W4NA 3CCM3 1Q824 1NB5I 4IPBA 1G96A 2OQEC 6RNTA 1RMSA 2XGLA 3KCHA 1STFI 1BANA 1UI7A 5JBSA 1B2UA 1RGGA 2UX0A 5EVHA 4I5QA 3EQQB 1W6CA 2GEXA 3NQZA 3UB1A 5IW9A 1MWRA 1UCLA 4FMDA 4O02B 3UL6A 3K0ZA 2BHMA 1VQO3 1E3VA 3WOFB 2WOFA 3RGAA 3F9SA 1RKYA 3I563 3EF8A 3NM7A 3EB8A 2IUJA 1B2MA 1Q9EA 1N5PA 1FYSA 3CU3A 3CC23 3FCSB 5AEUB 3D5IA 1R4YA 3HI7A 1AVLA 1UCKA 4XM4A 2CIUA 1ROVA 1W7CA 1QAKA 1BRIA 2KRTA 1W6GA 3PXMA 2HMNB 2UGIA 2AADA 2H0GA 3GZBA 3F7XA 5ELJA 3JUPA 1BNIA 1BRGA 4MJDA 4STDA 1BSBA 2FGTA 3SX1A 2Z76A 1ASKA 3ALAA 4HM7B 3BIRA 2GU1A 4IIAA 4KFDA
chains in the Genus database with same CATH topology
4HAAA 1RLSA 1BGSA 2BU4A 1MGRA 1LNIA 1RTUA 1RGLA 1B20A 1LOVA 1BSDA 1RCKA 2HOHA 2SARA 1RNBA 1BSEA 1RHLA 1BSCA 4RNTA 3WHOA 1LRAA 1RGHA 1RN4A 1RNTA 1G02A 1DETA 2KF4A 1RGEA 1IYYA 1B2ZA 3AGNA 1GMQA 2F5WA 1B21A 1GSPA 1RDSA 1T2IA 1X1XA 1B3SA 1I2EA 2KF3A 3AHSA 1BNFA 3GSPA 2BIRA 3D4AA 1GMPA 3HOHA 1YNVX 2GSPA 1BRJA 2KAAA 1CH0A 1X1WA 1BU4A 2AAEA 3DH2A 1GOYA 3SYUA 6GSPA 1BIRA 1X1UA 1RGAA 1RN1A 1C54A 1BNGA 1BVIA 1FUTA 2F56A 1AY7A 5HOHA 3URPA 1I0VA 3BU4A 5BU4A 9RNTA 1BNRA 1RCLA 1TRQA 2F5MA 1HYFA 4GHOA 1ZGXA 1SARA 1TTOA 1FZUA 1B2SA 1RGKA 1I0XA 1FUSA 1BUJA 8RNTA 1JBSA 3RNTA 1PY3A 1LOYA 1BRHA 1BNJA 5GSPA 1BOXA 1LOWA 1RGFA 7RNTA 2RBIA 1BNSA 7GSPA 1FW7A 1RSNA 1RGCA 1I3IA 3Q3FA 5RNTA 1UCJA 1I3FA 1T2HA 6RNTA 1RMSA 3KCHA 1BANA 1UCIA 1YGWA 1B2UA 1RGGA 1TRPA 3AHWA 1UCLA 2C4BA 4J5GA 2ZA4A 1I70A 1JBRA 2KF6A 1MGWA 1B2MA 1HZ1A 3DGYA 1I8VA 1X1YA 1Q9EA 3AGOA 4J5KA 1BRKA 3A5EA 1FYSA 1AQZA 1PYLA 1YVSA 4BIRA 1DE3A 3D5IA 1R4YA 4HOHA 1UCKA 1GMRA 1B2XA 4BU4A 1JBTA 1BRSA 1B27A 2F4YA 1BRIA 1BAOA 1A2PA 1BSAA 2AADA 2KF5A 3D5GA 4GSPA 1BNIA 1BRGA 2RNTA 3WR2A 1BSBA 1GOUA 5BIRA 1GOVA 1I2FA 1BRNL 3BIRA 1BNEA 1I2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAA A;  1RLS A;  1BGS A;  2BU4 A;  1MGR A;  1LNI A;  1RTU A;  1RGL A;  1B20 A;  1LOV A;  1BSD A;  1RCK A;  2HOH A;  2SAR A;  1RNB A;  1BSE A;  1RHL A;  1BSC A;  4RNT A;  3WHO A;  1LRA A;  1RGH A;  1RN4 A;  1RNT A;  1G02 A;  1DET A;  2KF4 A;  1RGE A;  1IYY A;  1B2Z A;  3AGN A;  1GMQ A;  2F5W A;  1B21 A;  1GSP A;  1RDS A;  1T2I A;  1X1X A;  1B3S A;  1I2E A;  2KF3 A;  3AHS A;  1BNF A;  3GSP A;  2BIR A;  3D4A A;  1GMP A;  3HOH A;  1YNV X;  2GSP A;  1BRJ A;  2KAA A;  1CH0 A;  1X1W A;  1BU4 A;  2AAE A;  3DH2 A;  1GOY A;  3SYU A;  6GSP A;  1BIR A;  1X1U A;  1RGA A;  1RN1 A;  1C54 A;  1BNG A;  1BVI A;  1FUT A;  2F56 A;  1AY7 A;  5HOH A;  3URP A;  1I0V A;  3BU4 A;  5BU4 A;  9RNT A;  1BNR A;  1RCL A;  1TRQ A;  2F5M A;  1HYF A;  4GHO A;  1ZGX A;  1SAR A;  1TTO A;  1FZU A;  1B2S A;  1RGK A;  1I0X A;  1FUS A;  1BUJ A;  8RNT A;  1JBS A;  3RNT A;  1PY3 A;  1LOY A;  1BRH A;  1BNJ A;  5GSP A;  1BOX A;  1LOW A;  1RGF A;  7RNT A;  2RBI A;  1BNS A;  7GSP A;  1FW7 A;  1RSN A;  1RGC A;  1I3I A;  3Q3F A;  5RNT A;  1UCJ A;  1I3F A;  1T2H A;  6RNT A;  1RMS A;  3KCH A;  1BAN A;  1UCI A;  1YGW A;  1B2U A;  1RGG A;  1TRP A;  3AHW A;  1UCL A;  2C4B A;  4J5G A;  2ZA4 A;  1I70 A;  1JBR A;  2KF6 A;  1MGW A;  1B2M A;  1HZ1 A;  3DGY A;  1I8V A;  1X1Y A;  1Q9E A;  3AGO A;  4J5K A;  1BRK A;  3A5E A;  1FYS A;  1AQZ A;  1PYL A;  1YVS A;  4BIR A;  1DE3 A;  3D5I A;  1R4Y A;  4HOH A;  1UCK A;  1GMR A;  1B2X A;  4BU4 A;  1JBT A;  1BRS A;  1B27 A;  2F4Y A;  1BRI A;  1BAO A;  1A2P A;  1BSA A;  2AAD A;  2KF5 A;  3D5G A;  4GSP A;  1BNI A;  1BRG A;  2RNT A;  3WR2 A;  1BSB A;  1GOU A;  5BIR A;  1GOV A;  1I2F A;  1BRN L;  3BIR A;  1BNE A;  1I2G A; 
#chains in the Genus database with same CATH topology
 4HAA A;  1RLS A;  3V92 A;  1BGS A;  2BU4 A;  1MGR A;  3E99 A;  1NO3 A;  1RTU A;  3D79 A;  4ILF A;  1OUN A;  5IG0 A;  1BSD A;  3CD6 3;  3S28 A;  3LTA A;  1RHL A;  3S5C A;  2KXG A;  1WTH A;  2Z6B A;  3LT9 A;  1JRQ A;  3NHX A;  4R9K A;  4AKY A;  1JJ2 2;  3WHO A;  2WO0 A;  1LRA A;  5CXO A;  3V99 A;  1KD1 4;  5FGO A;  1GD4 A;  3CCL 3;  4IT7 A;  1IYY A;  3SOY A;  1D6Z A;  1ULI B;  1QMA A;  4HKV B;  2F5W A;  1RDS A;  3KE7 A;  4FMA A;  3GSP A;  2KF3 A;  7STD A;  2P0X A;  3BB9 A;  2GBW B;  3U97 A;  3PCR A;  2KAA A;  1IU7 A;  4K1V A;  1T3B A;  1BU4 A;  3MG2 A;  3X3Z A;  3MHE A;  4EYC A;  4EW5 A;  4HM5 B;  5IEP A;  1M1K 4;  2W04 A;  3S27 A;  3T0U A;  1RN1 A;  2GEY A;  1BNG A;  1DMN A;  3N54 B;  1BUQ A;  3PGB A;  5AYR B;  1FUT A;  1LVN A;  3FH1 A;  1U8C B;  1WQL B;  2F56 A;  5HGR A;  4CCV A;  4AKZ A;  2YX9 A;  4EV2 A;  1Q7Y 4;  3URP A;  3EN8 A;  5BU4 A;  1F8N A;  9RNT A;  3LYG A;  3CC7 3;  1RCL A;  3U1W A;  1DVC A;  1QJG A;  3H51 A;  4GHO A;  1W01 A;  3DGL A;  4N6M A;  1SAR A;  3AMO A;  4WHA A;  1IQX A;  4GB5 A;  3EE1 A;  3SED A;  1FZU A;  1YHQ 3;  3RDE A;  1JZD A;  1RGK A;  1I0X A;  3WA2 X;  4L8O A;  5DRV A;  2ML6 A;  8RNT A;  1V58 A;  1Y4K A;  3K7C A;  2ZHX B;  1PY3 A;  4QWT A;  1NB3 I;  3KFQ C;  3BLZ A;  3KSE D;  4HM2 B;  4HM3 B;  1VQ7 3;  4CDL A;  2CHC A;  3FG1 A;  3FSD A;  2WOH A;  3KZT A;  3L0R A;  2OCT A;  2BMR B;  3JVC A;  2XH9 A;  1NU3 A;  1LXE A;  1OGZ A;  3EBT A;  4WYK B;  2XSH B;  3HX8 A;  4NRE A;  1OAC A;  5FW5 A;  3G4S 3;  4EXR A;  1I3I A;  1ZO2 A;  3FLJ A;  3KN4 A;  3LOY A;  4RNY A;  1PU4 A;  1SQW A;  3J7Y d;  1DVD A;  1D6Y A;  4EBG A;  2Z7A A;  3F14 A;  1UCI A;  1YGW A;  3LML A;  4OK0 A;  4H61 A;  1VQQ A;  1TRP A;  2QGU A;  4FCZ A;  2CWV A;  1AVK A;  3AHW A;  5I97 A;  5AII A;  2C4B A;  4J5G A;  2CWU A;  3GZR A;  4FR9 A;  2ZA4 A;  1I70 A;  1JBR A;  2Z77 A;  1A67 A;  2CH9 A;  1MGW A;  1SIH A;  4FCM A;  3CCR 3;  1JKG B;  4O8S A;  4N6V 0;  3PS8 A;  5IG3 A;  3DGY A;  1VQM 3;  1I8V A;  1X1Y A;  1TFK A;  4OVM A;  1FGO A;  3AGO A;  4J5K A;  1BRK A;  2K54 A;  1MWT A;  3A5E A;  2CK3 H;  2QA4 3;  1DE3 A;  1JKG A;  3LTD A;  4GL6 A;  5G1K A;  3DGN A;  3CCQ 3;  1Q81 4;  3CC4 3;  2RGQ A;  4BU4 A;  4FCJ A;  3CCE 3;  5D81 A;  1UUG B;  2O9U X;  4R1K A;  4XDW A;  1BAO A;  1FGM A;  2LYX A;  2WGQ A;  3FF0 A;  1BSA A;  2R41 A;  3B8L A;  2H0H A;  3OV4 A;  3STD A;  3TDG A;  1UUW B;  2KF5 A;  2XEP A;  1GS3 A;  5JPP A;  4X2O A;  1GOU A;  4N6O B;  1G0T A;  2HML B;  1GOV A;  2CC3 A;  1ZX2 A;  1BRN L;  5AEW B;  2OQE A;  3HK4 A;  5M19 A;  3FKA A;  1I2G A;  1GY7 A;  5IEO A;  1M90 4;  3CXC 2;  1AV4 A;  1LNI A;  4JRF A;  1CEW I;  3GWR A;  3I55 3;  3K5T A;  5KP4 A;  4R4K A;  4ZM8 A;  4PEJ A;  3N8B A;  1AR0 A;  2HOH A;  4L8P A;  3DMC A;  1BSE A;  3GZX B;  1QVF 2;  4RBN A;  5AI1 A;  2YFJ B;  4LYL B;  1RGH A;  1RNT A;  4G1M B;  2KF4 A;  1N8Q A;  3CPO A;  3DM8 A;  4N6U A;  3X3Y A;  2FXT A;  4HBR A;  3WOD G;  1B21 A;  1OHS A;  1T2I A;  3VSY A;  2F86 B;  3NBB A;  4KFF A;  1OF5 B;  2P0M A;  3GRD A;  1GMP A;  5D83 A;  3CME 3;  3HOH A;  5AIH A;  1UUV B;  2YFL B;  1IV9 A;  4O3V A;  1KQS 2;  1JZO A;  4HZ9 B;  1X1W A;  3NQY A;  3LTC A;  4K61 A;  5JPU A;  3MYT A;  1JN5 A;  1YVB I;  1OF5 A;  1EEJ A;  6GSP A;  2CKF B;  3NBR A;  2QEX 3;  1RGA A;  2CFK A;  1A2V A;  4FMB A;  3SLU A;  3LH4 A;  2P09 A;  3T8U A;  1YJ9 3;  1YJW 3;  3QRD A;  5AYS C;  6STD A;  1OH0 A;  1EQK A;  1OCV A;  1OPY A;  3BU4 A;  2OOV C;  1S5A A;  4KVH A;  5LC7 A;  3N9H A;  2RSX A;  1TTO A;  2XF3 A;  3BNC A;  4O2H A;  1ISK A;  1B2S A;  4HM8 B;  3B7C A;  1BUJ A;  5CK6 A;  4XBT A;  4U13 A;  3UNL A;  1IDP A;  3RNT A;  5A0O B;  3FZW A;  1J2B A;  3EX9 A;  1LOY A;  2B1X B;  1N9E A;  1RRL A;  5ELU A;  1KC8 4;  1JV2 B;  1Q40 B;  1BOX A;  1LOW A;  2BT3 A;  4KZ1 A;  1E97 A;  3CCV 3;  1GY6 A;  1CYU A;  3HII A;  3OWU A;  2FNQ A;  1EKM A;  4HM0 B;  1N8R 4;  1W6Y A;  1CYV A;  1RRH A;  3G8Z A;  1SPU A;  3Q3F A;  1Q40 A;  3FGY A;  1IVV A;  5RNT A;  3AMO B;  3G6E 3;  1NWW A;  1EG9 B;  1T2H A;  1ZS7 A;  3DXO A;  1E3R A;  2STD A;  3NBJ A;  4H3U A;  3CCU 3;  2QIY A;  3JUN A;  3O8Y A;  4CPK A;  1WMO A;  3I0Y A;  2O3O A;  2BO9 B;  1ULJ B;  2CX1 A;  3WDG B;  3ROB A;  2KF6 A;  2Y74 A;  1WMP A;  5EEO A;  1NJI 4;  2RFR A;  4FMC A;  1O7G B;  3EJV A;  1STD A;  1IT8 A;  1PYL A;  1ROA A;  2CFW A;  3HIG A;  4HJL B;  5IF6 A;  4LMI A;  1TU5 A;  4HOH A;  3PZW A;  1GMR A;  1B2X A;  4EC6 A;  1JBT A;  3K9M C;  4RNZ A;  4I4K A;  2W2C A;  2BNG A;  1A2P A;  5IER A;  1IV7 A;  3NV0 B;  3DUK A;  1TP6 A;  2HMO B;  4GSP A;  2RNT A;  3D3L A;  4R9L A;  2SBL A;  4MMZ B;  1I2F A;  1T5Y A;  2JDI H;  2E2T A;  2F99 A;  4HYZ A;  1BNE A;  4XBY A;  3NV0 A;  1OHO A;  1TUH A;  2K3D A;  2H0I A;  4HM4 B;  1NDO B;  3MG3 A;  3NX0 A;  3X40 A;  4NPB A;  1B20 A;  1W02 A;  1O7N B;  2UUG C;  1WMN A;  3WOE B;  4LSO A;  1DYU A;  1LOV A;  1O7H B;  1UW1 A;  1RCK A;  2BMO B;  2WGO A;  2Y73 A;  3MSO A;  3CPW 2;  3JUO A;  2BMQ B;  4RNT A;  1EUI C;  4WFO A;  1K8A 4;  1A90 A;  5CLK A;  4L7K A;  2MC8 A;  2M7O A;  4HVN A;  2XFT A;  5IEN A;  1D6U A;  1DET A;  3S67 A;  1RGE A;  1K28 A;  4EV5 A;  1Q42 A;  1B2Z A;  1V57 A;  3WMD A;  3OWS A;  1GMQ A;  1MWU A;  3AHS A;  1BNF A;  1L5G B;  2BIR A;  3FG3 A;  1S72 3;  3MKI A;  4JF8 A;  3EN1 B;  1YNV X;  2I9W A;  3BND A;  5M18 A;  1CH0 A;  1IQY A;  2P38 A;  4BTW A;  1VQ8 3;  3VF1 A;  2XGN A;  2AAE A;  5STD A;  3KKG A;  1IK3 A;  3KSP A;  1YJN 3;  3MG1 A;  3SYU A;  1VQ5 3;  4KFE A;  1V74 A;  3MPH A;  1BVI A;  1DMM A;  1FGQ A;  1RJO A;  1O7W B;  1AY7 A;  2PNC A;  1M9G A;  3IPT A;  3F40 A;  1TIJ A;  2PZV A;  3LTB A;  3RGR A;  3S29 A;  1I0V A;  2KCD A;  4MMY B;  5AIF A;  2XRX B;  3G71 3;  1Q86 4;  1VQL 3;  4BTY A;  1VQP 3;  1YIT 3;  1HYF A;  3OWY A;  4LGQ A;  1FA3 A;  3VGN A;  1YGE A;  1Z1S A;  1UGI A;  1JN5 B;  2IMJ A;  1YIJ 3;  4K1U A;  3ZG5 A;  1FUS A;  3QK9 A;  2ZDJ A;  4N3V A;  1JBS A;  2HMM B;  2YFI B;  1OGX A;  3Q1C A;  1BRH A;  5GSP A;  5TGN A;  1JB2 A;  1KWI A;  2A15 A;  3DY5 A;  2GXF A;  3X42 A;  2W03 A;  4N6T A;  3IMA B;  2ZL8 A;  2RBI A;  1BNS A;  7GSP A;  4BL2 A;  7RNT A;  1QVG 2;  3NM2 A;  1SII A;  1RSN A;  3WA3 A;  4N6L A;  3BNE A;  3F7S A;  3M8C A;  3UL5 A;  2J8X B;  1LNH A;  1I3F A;  2LQV A;  1A2K A;  3X3X A;  1CQS A;  1TFO A;  1W5Z A;  2W9P A;  3X41 A;  3CCS 3;  3Q90 A;  3LXU X;  4X2H A;  1NNV A;  3G0K A;  3T8N A;  3DZL A;  1UDI I;  1HKX A;  3DGO A;  4Q53 A;  1DMQ A;  3SOA A;  4DKI A;  1LQG C;  2W56 B;  4NHF A;  1C7H A;  2CFD A;  4LEH A;  5LC6 A;  2OOV A;  3JUQ A;  3GAX A;  3ZFZ A;  3G16 A;  1O7P B;  3PYJ A;  4CJN A;  1TJD A;  4BL3 A;  1N9J A;  1HZ1 A;  1RN7 A;  2HMJ B;  3ECF A;  2D42 A;  3NXJ A;  2W56 A;  1US1 A;  2E2U A;  3MWZ A;  1QAL A;  1AQZ A;  1YVS A;  1HU9 A;  3GZY B;  4BIR A;  1K73 4;  3D9R A;  2F98 A;  2CW9 A;  3B4P A;  2CFL A;  3LT8 A;  5G2G A;  5IG5 A;  1IVX A;  3EHC A;  3KII A;  4WP5 A;  1BRS A;  3CMA 3;  3EC9 A;  1B27 A;  2F4Y A;  3DGM A;  4RZM A;  4WWU C;  5EQL A;  1VQK 3;  1M1X B;  1UI8 A;  1KSI A;  2V1L A;  3HZP A;  4LZI A;  2CFG A;  2K0M A;  3BNB A;  3D5G A;  4XDV A;  5IG4 A;  3H3H A;  2D1W A;  2OWP A;  3WR2 A;  5KP1 A;  5BIR A;  2L1S A;  1VZZ A;  2XFS A;  3CNM A;  2B24 B;  1QAF A;  1MNL A;  2W0Q A;  3K63 A;  4TX4 A;  3FG4 A;  2XSO B;  4HM6 B;  2L4V A;  2P05 A;  1FGR A;  3OW2 2;  2INX A;  1RGL A;  3SXX A;  3OXA A;  1W2B 2;  2R4I A;  2HMK B;  2SAR A;  1RNB A;  4MEI A;  1GYB A;  1BSC A;  2ML5 A;  3F8H A;  4N6N B;  3LZA A;  1RN4 A;  3CCJ 3;  1G02 A;  2Q07 A;  1PFP A;  1JB5 A;  3AGN A;  3PCS A;  4HM1 B;  1Q7H A;  1X1X A;  1GSP A;  2XR8 B;  1B3S A;  1I2E A;  2C10 A;  3UJM A;  3F8X A;  1MWS A;  3D4A A;  2CG0 A;  2MF7 A;  3OX9 A;  2JQ5 A;  4J9A A;  1W00 A;  4BTX A;  4XB5 A;  2GSP A;  1BRJ A;  3FF2 A;  2IA7 A;  4MMX B;  1VQ9 3;  4ORL A;  3V98 A;  3SVA A;  5CF2 A;  3DH2 A;  4AEQ A;  1SJW A;  1GOY A;  1MOL A;  2CWT A;  4HZB B;  1LOX A;  8CHO A;  1OHP A;  3JUM A;  4KT3 B;  2IUK A;  1BIR A;  1JB4 A;  1X1U A;  2CG1 A;  1C54 A;  3IJE B;  3NUV A;  2E2V A;  3ER7 A;  3EBY A;  4J8T A;  3ZG0 A;  5AIG A;  5HOH A;  4XBX A;  1YI2 3;  1IVW A;  2C11 A;  1BNR A;  1EA2 A;  1LQM B;  4R80 A;  4WYK A;  1O7M B;  5CF1 A;  1GY5 A;  1TRQ A;  2F5M A;  1FUW A;  1ZGX A;  2OTL 3;  3Q2P A;  1VQN 3;  1JNQ A;  2OTJ 3;  3B4O A;  1VQ6 3;  1IT7 A;  5BXQ A;  1K9M 4;  2IY2 A;  3A76 A;  1W2Z A;  2CX0 A;  5DRE A;  1BNJ A;  1IQ8 A;  1GD3 A;  4K90 B;  2GBX B;  1R4C A;  3CNX A;  2RCD A;  1IVU A;  1RGF A;  2IYJ A;  5M1A A;  5D82 A;  1WNH A;  1K41 A;  2W9Q A;  1VQ4 3;  1FW7 A;  1U5O A;  5KP3 A;  2W6J H;  1UGH I;  1RGC A;  1N5H A;  1FGT A;  5BVB A;  4OUQ A;  1UCJ A;  5G1L A;  2GU3 A;  1W4N A;  3CCM 3;  1Q82 4;  1NB5 I;  4IPB A;  1G96 A;  2OQE C;  6RNT A;  1RMS A;  2XGL A;  3KCH A;  1STF I;  1BAN A;  1UI7 A;  5JBS A;  1B2U A;  1RGG A;  2UX0 A;  5EVH A;  4I5Q A;  3EQQ B;  1W6C A;  2GEX A;  3NQZ A;  3UB1 A;  5IW9 A;  1MWR A;  1UCL A;  4FMD A;  4O02 B;  3UL6 A;  3K0Z A;  2BHM A;  1VQO 3;  1E3V A;  3WOF B;  2WOF A;  3RGA A;  3F9S A;  1RKY A;  3I56 3;  3EF8 A;  3NM7 A;  3EB8 A;  2IUJ A;  1B2M A;  1Q9E A;  1N5P A;  1FYS A;  3CU3 A;  3CC2 3;  3FCS B;  5AEU B;  3D5I A;  1R4Y A;  3HI7 A;  1AVL A;  1UCK A;  4XM4 A;  2CIU A;  1ROV A;  1W7C A;  1QAK A;  1BRI A;  2KRT A;  1W6G A;  3PXM A;  2HMN B;  2UGI A;  2AAD A;  2H0G A;  3GZB A;  3F7X A;  5ELJ A;  3JUP A;  1BNI A;  1BRG A;  4MJD A;  4STD A;  1BSB A;  2FGT A;  3SX1 A;  2Z76 A;  1ASK A;  3ALA A;  4HM7 B;  3BIR A;  2GU1 A;  4IIA A;  4KFD A; 
#chains in the Genus database with same CATH homology
 4HAA A;  1RLS A;  1BGS A;  2BU4 A;  1MGR A;  1LNI A;  1RTU A;  1RGL A;  1B20 A;  1LOV A;  1BSD A;  1RCK A;  2HOH A;  2SAR A;  1RNB A;  1BSE A;  1RHL A;  1BSC A;  4RNT A;  3WHO A;  1LRA A;  1RGH A;  1RN4 A;  1RNT A;  1G02 A;  1DET A;  2KF4 A;  1RGE A;  1IYY A;  1B2Z A;  3AGN A;  1GMQ A;  2F5W A;  1B21 A;  1GSP A;  1RDS A;  1T2I A;  1X1X A;  1B3S A;  1I2E A;  2KF3 A;  3AHS A;  1BNF A;  3GSP A;  2BIR A;  3D4A A;  1GMP A;  3HOH A;  1YNV X;  2GSP A;  1BRJ A;  2KAA A;  1CH0 A;  1X1W A;  1BU4 A;  2AAE A;  3DH2 A;  1GOY A;  3SYU A;  6GSP A;  1BIR A;  1X1U A;  1RGA A;  1RN1 A;  1C54 A;  1BNG A;  1BVI A;  1FUT A;  2F56 A;  1AY7 A;  5HOH A;  3URP A;  1I0V A;  3BU4 A;  5BU4 A;  9RNT A;  1BNR A;  1RCL A;  1TRQ A;  2F5M A;  1HYF A;  4GHO A;  1ZGX A;  1SAR A;  1TTO A;  1FZU A;  1B2S A;  1RGK A;  1I0X A;  1FUS A;  1BUJ A;  8RNT A;  1JBS A;  3RNT A;  1PY3 A;  1LOY A;  1BRH A;  1BNJ A;  5GSP A;  1BOX A;  1LOW A;  1RGF A;  7RNT A;  2RBI A;  1BNS A;  7GSP A;  1FW7 A;  1RSN A;  1RGC A;  1I3I A;  3Q3F A;  5RNT A;  1UCJ A;  1I3F A;  1T2H A;  6RNT A;  1RMS A;  3KCH A;  1BAN A;  1UCI A;  1YGW A;  1B2U A;  1RGG A;  1TRP A;  3AHW A;  1UCL A;  2C4B A;  4J5G A;  2ZA4 A;  1I70 A;  1JBR A;  2KF6 A;  1MGW A;  1B2M A;  1HZ1 A;  3DGY A;  1I8V A;  1X1Y A;  1Q9E A;  3AGO A;  4J5K A;  1BRK A;  3A5E A;  1FYS A;  1AQZ A;  1PYL A;  1YVS A;  4BIR A;  1DE3 A;  3D5I A;  1R4Y A;  4HOH A;  1UCK A;  1GMR A;  1B2X A;  4BU4 A;  1JBT A;  1BRS A;  1B27 A;  2F4Y A;  1BRI A;  1BAO A;  1A2P A;  1BSA A;  2AAD A;  2KF5 A;  3D5G A;  4GSP A;  1BNI A;  1BRG A;  2RNT A;  3WR2 A;  1BSB A;  1GOU A;  5BIR A;  1GOV A;  1I2F A;  1BRN L;  3BIR A;  1BNE A;  1I2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...