1RGCA

The complex between ribonuclease t1 and 3'-guanylic acid suggests geometry of enzymatic reaction path. an x-ray study
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title The complex between ribonuclease T1 and 3'GMP suggests geometry of enzymic reaction path. An X-ray study.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 25
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgcA00
5GSPA 1MGWA 1BRGA 1YVSA 2KAAA 1BRHA 1AY7A 3AGOA 3HOHA 1A2PA 1T2HA 2RBIA 1BNIA 1LNIA 2BU4A 1GOYA 3DH2A 3SYUA 1GMRA 2RNTA 1RGFA 2KF3A 1BSEA 1DE3A 1FUTA 1ZGXA 1I2FA 1I8VA 2ZA4A 1T2IA 1X1YA 3AHSA 1BNSA 1MGRA 1BOXA 1UCLA 1BRSA 5HOHA 1RDSA 1BSCA 7GSPA 1C54A 1RSNA 1GSPA 4GHOA 2AAEA 1B20A 1PYLA 1X1WA 1LOYA 3A5EA 1BRKA 1JBRA 1RGHA 1RNTA 1B3SA 1BSAA 1RN4A 3BU4A 1UCIA 1BRIA 1DETA 1I70A 1RCLA 4HAAA 2F5MA 3AHWA 3AGNA 1GOVA 1LOVA 1BNRA 1Q9EA 2F5WA 2GSPA 1X1XA 9RNTA 2F4YA 1BIRA 1R4YA 3WR2A 1BAOA 1RGAA 4J5KA 1B2MA 2KF5A 1X1UA 3Q3FA 1JBSA 1I0VA 1RGGA 4BU4A 8RNTA 1BRJA 5BU4A 1B2SA 1FYSA 1RGLA 1B2ZA 1GMQA 1UCKA 1I2EA 1BSBA 1LOWA 4HOHA 1GMPA 2C4BA 1BUJA 1AQZA 1TTOA 1B2XA 1BSDA 1I2GA 1LRAA 1BU4A 1CH0A 3D5GA 3GSPA 1RGKA 3D5IA 1I3FA 1UCJA 1B2UA 1RLSA 3WHOA 1BANA 1RTUA 1TRPA 1HZ1A 1G02A 1BNEA 1FZUA 1BVIA 2F56A 5RNTA 1RNBA 6GSPA 1BRNL 1YGWA 1FW7A 4GSPA 1I3IA 1RGCA 2AADA 1BNFA 3URPA 2KF4A 7RNTA 1B27A 1RHLA 4RNTA 3DGYA 3BIRA 1I0XA 1B21A 1YNVX 1RN1A 1JBTA 6RNTA 2KF6A 1PY3A 1GOUA 2HOHA 1RCKA 1SARA 1RMSA 1BGSA 2SARA 1BNJA 1HYFA 1IYYA 1RGEA 3RNTA 4J5GA 5BIRA 3D4AA 3KCHA 1BNGA 1TRQA 1FUSA 4BIRA 2BIRA
chains in the Genus database with same CATH superfamily
3VSYA 1W01A 1ZS7A 3V98A 4HM7B 3I563 4GB5A 3FG3A 3KSED 4EC6A 6STDA 5KP3A 5A0OB 1YIT3 3LYGA 3DZLA 1GY7A 3HOHA 2IYJA 1U5OA 2D1WA 3BNDA 4IPBA 3VF1A 2UUGC 4WWUC 3IMAB 1D6ZA 3SYUA 1Q7Y4 1GMRA 1M904 2CG0A 3G8ZA 4HKVB 1K28A 3X42A 2L4VA 2GBXB 1BSEA 1STFI 2PZVA 4L8PA 2IA7A 3MHEA 1ZGXA 4R9KA 4N6OB 2K3DA 1LQGC 1BRSA 3IJEB 5HOHA 1KD14 3LTBA 3D3LA 4NPBA 2D42A 3EN1B 2H0GA 2I9WA 2CX0A 1B20A 3AMOA 4BTYA 3LZAA 3WA2X 2FGTA 3X41A 1OHPA 1TIJA 8CHOA 1O7PB 1RGHA 1RNTA 1VQL3 4N3VA 1OACA 2HMLB 1IVUA 1M1XB 3PYJA 1B3SA 1OF5B 1RN4A 3L0RA 4HM6B 5AIGA 2BMRB 3EX9A 1UCIA 1Q40A 3FF2A 1W5ZA 3LT9A 5IG0A 3FF0A 3T8UA 3AHWA 3AGNA 1GOVA 4O2HA 3LH4A 2GSPA 2ZHXB 3CCM3 3EE1A 4HZ9B 1ZO2A 4HM2B 4LYLB 4WFOA 3RGAA 4Q53A 2R41A 2XGNA 3NUVA 3DGNA 1R4YA 3WR2A 1BAOA 3WODG 2W56B 4J5KA 3WA3A 1VQ83 2O9UX 3G0KA 4EXRA 4TX4A 1N8QA 1NB5I 1IQXA 3NV0A 3OWYA 1JBSA 2CH9A 3MG1A 1RGGA 4BU4A 1YJN3 8RNTA 5BXQA 4KT3B 1CYVA 1QAKA 4K1UA 4GL6A 3B4PA 2CFGA 1ASKA 4J8TA 1RGLA 4HOHA 1UCKA 2E2UA 2UGIA 1JN5B 3K0ZA 2ZL8A 1B2XA 4EV2A 1OUNA 1BSDA 3LTAA 3B7CA 2XSHB 4LZIA 3SXXA 4BL3A 3CME3 2STDA 3D5GA 1ULIB 1QVG2 2CWUA 1JKGA 3NX0A 3CC73 1RLSA 1LNHA 4I5QA 1Q40B 4HM3B 1BNEA 2F56A 2BO9B 2K0MA 3BLZA 1FW7A 5IG4A 1BRNL 3JUQA 4OK0A 2CFWA 3OW22 2H0IA 7RNTA 1NJI4 5M1AA 3E99A 3GZBA 3UL6A 1AVKA 1I0XA 1UGIA 3JUMA 5KP4A 1S5AA 1JBTA 1ROVA 3LT8A 1GOUA 1D6YA 3G16A 1SARA 1BGSA 1N9EA 1VQQA 3I0YA 2LQVA 1O7MB 3K7CA 3ZG0A 5G1KA 5IERA 3J7Yd 1JNQA 3TDGA 1VQ53 3CC43 1A2KA 1TJDA 3T0UA 1RGEA 4R4KA 3K5TA 2XH9A 3DUKA 3HIGA 3BB9A 4J5GA 1VQ73 2P0XA 1BNGA 2Z6BA 1FUSA 3K63A 3ECFA 2BIRA 3SOYA 5IG5A 5GSPA 3NXJA 4ZM8A 1BRGA 1O7HB 1YVSA 2OCTA 1W6GA 2K54A 3KZTA 1NWWA 2KXGA 3JVCA 4HM8B 3ZFZA 1QAFA 3CMA3 1EEJA 1A2PA 3NM7A 3FGYA 1BNIA 2YFIB 1DVCA 3FLJA 2BU4A 1YJ93 3OX9A 1Q814 5M19A 1V57A 3EHCA 1E3VA 3RGRA 3NHXA 2RNTA 3A76A 3VGNA 1LXEA 3LMLA 3D79A 2H0HA 5AYRB 1IVVA 1I8VA 3PZWA 1Q864 1X1YA 3MYTA 1BNSA 4KFFA 1LVNA 4CPKA 5IW9A 4O02B 4N6MA 3MSOA 4HJLB 4ILFA 3WMDA 1AVLA 1C7HA 3STDA 3UJMA 4GHOA 2C11A 4R1KA 3UB1A 2AAEA 1X1WA 3WOFB 3A5EA 1BRKA 3N9HA 3PGBA 1HKXA 3IPTA 2BMOB 3Q1CA 3CCQ3 1EG9B 3DY5A 1UGHI 3MG3A 3U97A 1WTHA 2OQEC 2OOVC 3S29A 3S28A 4OUQA 3GZRA 5HGRA 2GEXA 3EN8A 1Q7HA 1BRIA 3CNMA 1DETA 4N6NB 2BT3A 4HAAA 1OGXA 1IV7A 1ZX2A 2F5MA 1F8NA 3PCSA 4N6V0 1BNRA 1Q9EA 1JZDA 2CX1A 3Q2PA 2XRXB 5IEPA 3JUNA 9RNTA 2Y73A 2BMQB 1DMQA 3FZWA 1S723 1VZZA 1RJOA 4KFEA 3S5CA 1RGAA 2LYXA 3SOAA 1BUQA 1FGRA 1B2MA 1JRQA 1OCVA 4FMCA 1IVWA 2E2TA 3EF8A 3F7SA 3MWZA 1RKYA 2B24B 1O7WB 4KFDA 3D9RA 2FNQA 3I553 4N6UA 2W03A 4X2OA 1K734 1JB4A 1NDOB 1UW1A 5JBSA 2BNGA 4FMDA 5AEWB 4FR9A 3RDEA 4O3VA 1IQ8A 1TP6A 1UUVB 1WMPA 1B2SA 4MMZB 5LC7A 2QA43 3HX8A 3KIIA 2W9QA 1GMQA 4RZMA 1GMPA 1IT7A 3EBYA 1BUJA 1AQZA 3V92A 4JRFA 4KZ1A 4XB5A 1LRAA 3EB8A 1BU4A 3CPOA 4K1VA 5G2GA 1UI7A 2RCDA 3JUOA 1VQP3 1YVBI 3PCRA 4R9LA 1RTUA 1TRPA 1HZ1A 4RBNA 1BVIA 1W6CA 4STDA 4BTWA 4CCVA 1GD4A 3F9SA 1I3IA 2QIYA 3LTDA 1RGCA 1OHSA 2AADA 4WP5A 1BNFA 1VQN3 3O8YA 3URPA 2W6JH 4MMYB 1B27A 1WMNA 2WOFA 4RNTA 1VQO3 3EQQB 1ULJB 1B21A 1RN1A 6RNTA 2XFTA 3BNBA 1EA2A 1PY3A 1G0TA 1OGZA 1A67A 4WYKA 3BNEA 3FKAA 4H3UA 1RMSA 3AMOB 1BNJA 1IK3A 3WDGB 2WGOA 1HYFA 1MWRA 1NB3I 3GAXA 3FH1A 3H51A 1TU5A 1JJ22 1IYYA 3RNTA 1SIHA 1STDA 1KSIA 2RGQA 3D4AA 5LC6A 1R4CA 2IY2A 3MG2A 2M7OA 3UL5A 1EUIC 2QEX3 1MGWA 4AKYA 3F8HA 3CCS3 3CCE3 2YFJB 2FXTA 4HYZA 1UI8A 1YHQ3 1DMMA 1LNIA 2F98A 1GOYA 3DH2A 1MWUA 3G4S3 3OXAA 5STDA 1LOXA 3DGOA 1RGFA 2CFLA 1CYUA 2ML6A 2XFSA 3NV0B 3DGLA 1MNLA 3H3HA 2BHMA 1M9GA 1T2IA 2CHCA 1N5HA 1Q824 1BOXA 1UCLA 3FSDA 1PFPA 1RDSA 2IMJA 1BSCA 4L7KA 3NQZA 1C54A 1N8R4 4DKIA 4EV5A 3X40A 1KQS2 1JKGB 5AEUB 3CCR3 1BSAA 1FA3A 1EKMA 2W2CA 1IT8A 5EEOA 4QWTA 1FGTA 1LOVA 1L5GB 2Y74A 1RN7A 3KKGA 5CK6A 2KRTA 2ML5A 3GZYB 1X1XA 3HK4A 5CXOA 2RFRA 1GS3A 3OWUA 1ISKA 1W6YA 3CNXA 3LXUX 5IF6A 2Q07A 3UNLA 1BIRA 2B1XB 2OTJ3 4LSOA 1K41A 1SIIA 3FCSB 4WHAA 1NNVA 5DREA 2YFLB 1AV4A 1M1K4 1E3RA 3MPHA 2KF5A 3SVAA 3Q3FA 5IG3A 3QK9A 2JQ5A 1I0VA 3N8BA 1IDPA 1BRJA 1FYSA 1TUHA 4HM5B 1YJW3 1B2ZA 1MWTA 2XF3A 1LOWA 1KC84 1O7GB 1GYBA 3CU3A 2P05A 2CG1A 1I2GA 4LEHA 2GBWB 2F99A 4CDLA 3G6E3 1CH0A 3N54B 1JB2A 5AIFA 1UUGB 3D5IA 2MF7A 1I3FA 4XM4A 1AR0A 1OF5A 3WHOA 2CC3A 1BANA 5RNTA 1G02A 2CFDA 4FCMA 3F14A 1ROAA 4L8OA 6GSPA 1YGWA 1QMAA 4RNZA 3CXC2 4GSPA 3HZPA 2CW9A 4PEJA 1RRLA 3CPW2 4XBTA 2HMMB 3F8XA 2Z76A 3F40A 3CCU3 2GU1A 5CF2A 1US1A 2MC8A 2W56A 2HOHA 5FGOA 4XDVA 1RCKA 3KN4A 3SLUA 2P09A 2SARA 1OPYA 1OHOA 3FG4A 3NBBA 4JF8A 2OQEA 2OOVA 3EC9A 4MEIA 4HM4B 5EVHA 1GD3A 2CKFB 2O3OA 3ER7A 3MKIA 3S67A 3CCL3 4H61A 3BNCA 3DXOA 1EQKA 3X3ZA 1Y4KA 1G96A 1NO3A 2XEPA 3FG1A 1JN5A 5IENA 1IV9A 5CLKA 4XBXA 4AKZA 2IUJA 2KAAA 1BRHA 1FGMA 5ELJA 1U8CB 2JDIH 2XR8B 1AY7A 3T8NA 3AGOA 3NQYA 1VQK3 1T2HA 1JB5A 2RBIA 4LGQA 5G1LA 3ROBA 5I97A 4IT7A 2GXFA 4N6TA 1FUWA 2CFKA 3SX1A 4EYCA 2OWPA 1SJWA 3Q90A 2KF3A 2GU3A 2KCDA 1WNHA 4KVHA 3GZXB 1GY6A 1FUTA 3DM8A 4HM0B 4XBYA 1VQM3 1DE3A 3M8CA 1I2FA 2ZA4A 3OV4A 1DMNA 1V58A 3DGMA 5EQLA 3AHSA 2RSXA 1MGRA 3X3XA 2Z7AA 1OH0A 2W9PA 3WOEB 1Z1SA 1W2B2 1TFOA 3JUPA 1W7CA 4NHFA 7GSPA 3F7XA 2CIUA 1RSNA 1GSPA 1N9JA 2HMKB 4HVNA 4N6LA 1PYLA 1GY5A 4LMIA 1LOYA 1JZOA 1Q42A 1JBRA 1VQ93 2XSOB 1IU7A 1RRHA 3DMCA 3K9MC 1K9M4 1VQ63 1FGQA 1MWSA 1YGEA 2E2VA 3OWSA 2GEYA 1N5PA 5JPUA 2YX9A 1A2VA 1YIJ3 3BU4A 4X2HA 4G1MB 3CCV3 1I70A 1RCLA 1YI23 5ELUA 4BL2A 5KP1A 3LOYA 3GRDA 2F5WA 3KE7A 2CK3H 3GWRA 1QJGA 2P38A 1FGOA 2F4YA 1PU4A 2C10A 1WMOA 2ZDJA 2Z77A 3LTCA 4MJDA 2QGUA 4WYKB 2CWTA 1W00A 2HMJB 4FCZA 4I4KA 4K90B 4RNYA 2XGLA 1X1UA 1J2BA 3NM2A 2R4IA 3HIIA 5JPPA 1DYUA 1UUWB 2L1SA 5D81A 4HBRA 1IQYA 1D6UA 2INXA 2PNCA 4J9AA 4O8SA 5BU4A 5BVBA 2WO0A 7STDA 3B8LA 2OTL3 4HM1B 4ORLA 5AI1A 4K61A 5TGNA 1I2EA 1BSBA 5D82A 2SBLA 1VQ43 2W0QA 2C4BA 4FMAA 5IEOA 1O7NB 1TTOA 3NBJA 3V99A 4EBGA 1A90A 3GSPA 2V1LA 2HMNB 1RGKA 2UX0A 1UCJA 1QALA 1CQSA 1B2UA 4MMXB 3PS8A 5D83A 5CF1A 1SQWA 4XDWA 1T5YA 3CCJ3 4U13A 1FZUA 3ALAA 3PXMA 1RNBA 5AIHA 5AIIA 1SPUA 4FMBA 1UDII 3KFQC 1T3BA 3ZG5A 2F86B 1JV2B 2KF4A 3EBTA 1RHLA 2P0MA 3DGYA 3BIRA 2WGQA 5FW5A 3U1WA 5M18A 1W02A 1YNVX 5AYSC 1KWIA 2KF6A 1LQMB 5DRVA 4IIAA 3NBRA 4BTXA 4NREA 1NU3A 2WOHA 3EJVA 4R80A 1CEWI 1WQLB 3SEDA 1HU9A 3KSPA 2CWVA 3S27A 3CC23 2J8XB 3HI7A 1W4NA 3B4OA 1W2ZA 1K8A4 2A15A 1TFKA 1MOLA 2HMOB 2W04A 4CJNA 4HZBB 1QVF2 3CD63 5BIRA 1E97A 1V74A 2IUKA 3X3YA 3QRDA 3KCHA 1TRQA 1DVDA 4EW5A 4BIRA 3G713 1IVXA 4AEQA 4FCJA 4OVMA
chains in the Genus database with same CATH topology
5GSPA 1MGWA 1BRGA 1YVSA 2KAAA 1BRHA 1AY7A 3AGOA 3HOHA 1A2PA 1T2HA 2RBIA 1BNIA 1LNIA 2BU4A 1GOYA 3DH2A 3SYUA 1GMRA 2RNTA 1RGFA 2KF3A 1BSEA 1DE3A 1FUTA 1ZGXA 1I2FA 1I8VA 2ZA4A 1T2IA 1X1YA 3AHSA 1BNSA 1MGRA 1BOXA 1UCLA 1BRSA 5HOHA 1RDSA 1BSCA 7GSPA 1C54A 1RSNA 1GSPA 4GHOA 2AAEA 1B20A 1PYLA 1X1WA 1LOYA 3A5EA 1BRKA 1JBRA 1RGHA 1RNTA 1B3SA 1BSAA 1RN4A 3BU4A 1UCIA 1BRIA 1DETA 1I70A 1RCLA 4HAAA 2F5MA 3AHWA 3AGNA 1GOVA 1LOVA 1BNRA 1Q9EA 2F5WA 2GSPA 1X1XA 9RNTA 2F4YA 1BIRA 1R4YA 3WR2A 1BAOA 1RGAA 4J5KA 1B2MA 2KF5A 1X1UA 3Q3FA 1JBSA 1I0VA 1RGGA 4BU4A 8RNTA 1BRJA 5BU4A 1B2SA 1FYSA 1RGLA 1B2ZA 1GMQA 1UCKA 1I2EA 1BSBA 1LOWA 4HOHA 1GMPA 2C4BA 1BUJA 1AQZA 1TTOA 1B2XA 1BSDA 1I2GA 1LRAA 1BU4A 1CH0A 3D5GA 3GSPA 1RGKA 3D5IA 1I3FA 1UCJA 1B2UA 1RLSA 3WHOA 1BANA 1RTUA 1TRPA 1HZ1A 1G02A 1BNEA 1FZUA 1BVIA 2F56A 5RNTA 1RNBA 6GSPA 1BRNL 1YGWA 1FW7A 4GSPA 1I3IA 1RGCA 2AADA 1BNFA 3URPA 2KF4A 7RNTA 1B27A 1RHLA 4RNTA 3DGYA 3BIRA 1I0XA 1B21A 1YNVX 1RN1A 1JBTA 6RNTA 2KF6A 1PY3A 1GOUA 2HOHA 1RCKA 1SARA 1RMSA 1BGSA 2SARA 1BNJA 1HYFA 1IYYA 1RGEA 3RNTA 4J5GA 5BIRA 3D4AA 3KCHA 1BNGA 1TRQA 1FUSA 4BIRA 2BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSP A;  1MGW A;  1BRG A;  1YVS A;  2KAA A;  1BRH A;  1AY7 A;  3AGO A;  3HOH A;  1A2P A;  1T2H A;  2RBI A;  1BNI A;  1LNI A;  2BU4 A;  1GOY A;  3DH2 A;  3SYU A;  1GMR A;  2RNT A;  1RGF A;  2KF3 A;  1BSE A;  1DE3 A;  1FUT A;  1ZGX A;  1I2F A;  1I8V A;  2ZA4 A;  1T2I A;  1X1Y A;  3AHS A;  1BNS A;  1MGR A;  1BOX A;  1UCL A;  1BRS A;  5HOH A;  1RDS A;  1BSC A;  7GSP A;  1C54 A;  1RSN A;  1GSP A;  4GHO A;  2AAE A;  1B20 A;  1PYL A;  1X1W A;  1LOY A;  3A5E A;  1BRK A;  1JBR A;  1RGH A;  1RNT A;  1B3S A;  1BSA A;  1RN4 A;  3BU4 A;  1UCI A;  1BRI A;  1DET A;  1I70 A;  1RCL A;  4HAA A;  2F5M A;  3AHW A;  3AGN A;  1GOV A;  1LOV A;  1BNR A;  1Q9E A;  2F5W A;  2GSP A;  1X1X A;  9RNT A;  2F4Y A;  1BIR A;  1R4Y A;  3WR2 A;  1BAO A;  1RGA A;  4J5K A;  1B2M A;  2KF5 A;  1X1U A;  3Q3F A;  1JBS A;  1I0V A;  1RGG A;  4BU4 A;  8RNT A;  1BRJ A;  5BU4 A;  1B2S A;  1FYS A;  1RGL A;  1B2Z A;  1GMQ A;  1UCK A;  1I2E A;  1BSB A;  1LOW A;  4HOH A;  1GMP A;  2C4B A;  1BUJ A;  1AQZ A;  1TTO A;  1B2X A;  1BSD A;  1I2G A;  1LRA A;  1BU4 A;  1CH0 A;  3D5G A;  3GSP A;  1RGK A;  3D5I A;  1I3F A;  1UCJ A;  1B2U A;  1RLS A;  3WHO A;  1BAN A;  1RTU A;  1TRP A;  1HZ1 A;  1G02 A;  1BNE A;  1FZU A;  1BVI A;  2F56 A;  5RNT A;  1RNB A;  6GSP A;  1BRN L;  1YGW A;  1FW7 A;  4GSP A;  1I3I A;  1RGC A;  2AAD A;  1BNF A;  3URP A;  2KF4 A;  7RNT A;  1B27 A;  1RHL A;  4RNT A;  3DGY A;  3BIR A;  1I0X A;  1B21 A;  1YNV X;  1RN1 A;  1JBT A;  6RNT A;  2KF6 A;  1PY3 A;  1GOU A;  2HOH A;  1RCK A;  1SAR A;  1RMS A;  1BGS A;  2SAR A;  1BNJ A;  1HYF A;  1IYY A;  1RGE A;  3RNT A;  4J5G A;  5BIR A;  3D4A A;  3KCH A;  1BNG A;  1TRQ A;  1FUS A;  4BIR A;  2BIR A; 
#chains in the Genus database with same CATH topology
 3VSY A;  1W01 A;  1ZS7 A;  3V98 A;  4HM7 B;  3I56 3;  4GB5 A;  3FG3 A;  3KSE D;  4EC6 A;  6STD A;  5KP3 A;  5A0O B;  1YIT 3;  3LYG A;  3DZL A;  1GY7 A;  3HOH A;  2IYJ A;  1U5O A;  2D1W A;  3BND A;  4IPB A;  3VF1 A;  2UUG C;  4WWU C;  3IMA B;  1D6Z A;  3SYU A;  1Q7Y 4;  1GMR A;  1M90 4;  2CG0 A;  3G8Z A;  4HKV B;  1K28 A;  3X42 A;  2L4V A;  2GBX B;  1BSE A;  1STF I;  2PZV A;  4L8P A;  2IA7 A;  3MHE A;  1ZGX A;  4R9K A;  4N6O B;  2K3D A;  1LQG C;  1BRS A;  3IJE B;  5HOH A;  1KD1 4;  3LTB A;  3D3L A;  4NPB A;  2D42 A;  3EN1 B;  2H0G A;  2I9W A;  2CX0 A;  1B20 A;  3AMO A;  4BTY A;  3LZA A;  3WA2 X;  2FGT A;  3X41 A;  1OHP A;  1TIJ A;  8CHO A;  1O7P B;  1RGH A;  1RNT A;  1VQL 3;  4N3V A;  1OAC A;  2HML B;  1IVU A;  1M1X B;  3PYJ A;  1B3S A;  1OF5 B;  1RN4 A;  3L0R A;  4HM6 B;  5AIG A;  2BMR B;  3EX9 A;  1UCI A;  1Q40 A;  3FF2 A;  1W5Z A;  3LT9 A;  5IG0 A;  3FF0 A;  3T8U A;  3AHW A;  3AGN A;  1GOV A;  4O2H A;  3LH4 A;  2GSP A;  2ZHX B;  3CCM 3;  3EE1 A;  4HZ9 B;  1ZO2 A;  4HM2 B;  4LYL B;  4WFO A;  3RGA A;  4Q53 A;  2R41 A;  2XGN A;  3NUV A;  3DGN A;  1R4Y A;  3WR2 A;  1BAO A;  3WOD G;  2W56 B;  4J5K A;  3WA3 A;  1VQ8 3;  2O9U X;  3G0K A;  4EXR A;  4TX4 A;  1N8Q A;  1NB5 I;  1IQX A;  3NV0 A;  3OWY A;  1JBS A;  2CH9 A;  3MG1 A;  1RGG A;  4BU4 A;  1YJN 3;  8RNT A;  5BXQ A;  4KT3 B;  1CYV A;  1QAK A;  4K1U A;  4GL6 A;  3B4P A;  2CFG A;  1ASK A;  4J8T A;  1RGL A;  4HOH A;  1UCK A;  2E2U A;  2UGI A;  1JN5 B;  3K0Z A;  2ZL8 A;  1B2X A;  4EV2 A;  1OUN A;  1BSD A;  3LTA A;  3B7C A;  2XSH B;  4LZI A;  3SXX A;  4BL3 A;  3CME 3;  2STD A;  3D5G A;  1ULI B;  1QVG 2;  2CWU A;  1JKG A;  3NX0 A;  3CC7 3;  1RLS A;  1LNH A;  4I5Q A;  1Q40 B;  4HM3 B;  1BNE A;  2F56 A;  2BO9 B;  2K0M A;  3BLZ A;  1FW7 A;  5IG4 A;  1BRN L;  3JUQ A;  4OK0 A;  2CFW A;  3OW2 2;  2H0I A;  7RNT A;  1NJI 4;  5M1A A;  3E99 A;  3GZB A;  3UL6 A;  1AVK A;  1I0X A;  1UGI A;  3JUM A;  5KP4 A;  1S5A A;  1JBT A;  1ROV A;  3LT8 A;  1GOU A;  1D6Y A;  3G16 A;  1SAR A;  1BGS A;  1N9E A;  1VQQ A;  3I0Y A;  2LQV A;  1O7M B;  3K7C A;  3ZG0 A;  5G1K A;  5IER A;  3J7Y d;  1JNQ A;  3TDG A;  1VQ5 3;  3CC4 3;  1A2K A;  1TJD A;  3T0U A;  1RGE A;  4R4K A;  3K5T A;  2XH9 A;  3DUK A;  3HIG A;  3BB9 A;  4J5G A;  1VQ7 3;  2P0X A;  1BNG A;  2Z6B A;  1FUS A;  3K63 A;  3ECF A;  2BIR A;  3SOY A;  5IG5 A;  5GSP A;  3NXJ A;  4ZM8 A;  1BRG A;  1O7H B;  1YVS A;  2OCT A;  1W6G A;  2K54 A;  3KZT A;  1NWW A;  2KXG A;  3JVC A;  4HM8 B;  3ZFZ A;  1QAF A;  3CMA 3;  1EEJ A;  1A2P A;  3NM7 A;  3FGY A;  1BNI A;  2YFI B;  1DVC A;  3FLJ A;  2BU4 A;  1YJ9 3;  3OX9 A;  1Q81 4;  5M19 A;  1V57 A;  3EHC A;  1E3V A;  3RGR A;  3NHX A;  2RNT A;  3A76 A;  3VGN A;  1LXE A;  3LML A;  3D79 A;  2H0H A;  5AYR B;  1IVV A;  1I8V A;  3PZW A;  1Q86 4;  1X1Y A;  3MYT A;  1BNS A;  4KFF A;  1LVN A;  4CPK A;  5IW9 A;  4O02 B;  4N6M A;  3MSO A;  4HJL B;  4ILF A;  3WMD A;  1AVL A;  1C7H A;  3STD A;  3UJM A;  4GHO A;  2C11 A;  4R1K A;  3UB1 A;  2AAE A;  1X1W A;  3WOF B;  3A5E A;  1BRK A;  3N9H A;  3PGB A;  1HKX A;  3IPT A;  2BMO B;  3Q1C A;  3CCQ 3;  1EG9 B;  3DY5 A;  1UGH I;  3MG3 A;  3U97 A;  1WTH A;  2OQE C;  2OOV C;  3S29 A;  3S28 A;  4OUQ A;  3GZR A;  5HGR A;  2GEX A;  3EN8 A;  1Q7H A;  1BRI A;  3CNM A;  1DET A;  4N6N B;  2BT3 A;  4HAA A;  1OGX A;  1IV7 A;  1ZX2 A;  2F5M A;  1F8N A;  3PCS A;  4N6V 0;  1BNR A;  1Q9E A;  1JZD A;  2CX1 A;  3Q2P A;  2XRX B;  5IEP A;  3JUN A;  9RNT A;  2Y73 A;  2BMQ B;  1DMQ A;  3FZW A;  1S72 3;  1VZZ A;  1RJO A;  4KFE A;  3S5C A;  1RGA A;  2LYX A;  3SOA A;  1BUQ A;  1FGR A;  1B2M A;  1JRQ A;  1OCV A;  4FMC A;  1IVW A;  2E2T A;  3EF8 A;  3F7S A;  3MWZ A;  1RKY A;  2B24 B;  1O7W B;  4KFD A;  3D9R A;  2FNQ A;  3I55 3;  4N6U A;  2W03 A;  4X2O A;  1K73 4;  1JB4 A;  1NDO B;  1UW1 A;  5JBS A;  2BNG A;  4FMD A;  5AEW B;  4FR9 A;  3RDE A;  4O3V A;  1IQ8 A;  1TP6 A;  1UUV B;  1WMP A;  1B2S A;  4MMZ B;  5LC7 A;  2QA4 3;  3HX8 A;  3KII A;  2W9Q A;  1GMQ A;  4RZM A;  1GMP A;  1IT7 A;  3EBY A;  1BUJ A;  1AQZ A;  3V92 A;  4JRF A;  4KZ1 A;  4XB5 A;  1LRA A;  3EB8 A;  1BU4 A;  3CPO A;  4K1V A;  5G2G A;  1UI7 A;  2RCD A;  3JUO A;  1VQP 3;  1YVB I;  3PCR A;  4R9L A;  1RTU A;  1TRP A;  1HZ1 A;  4RBN A;  1BVI A;  1W6C A;  4STD A;  4BTW A;  4CCV A;  1GD4 A;  3F9S A;  1I3I A;  2QIY A;  3LTD A;  1RGC A;  1OHS A;  2AAD A;  4WP5 A;  1BNF A;  1VQN 3;  3O8Y A;  3URP A;  2W6J H;  4MMY B;  1B27 A;  1WMN A;  2WOF A;  4RNT A;  1VQO 3;  3EQQ B;  1ULJ B;  1B21 A;  1RN1 A;  6RNT A;  2XFT A;  3BNB A;  1EA2 A;  1PY3 A;  1G0T A;  1OGZ A;  1A67 A;  4WYK A;  3BNE A;  3FKA A;  4H3U A;  1RMS A;  3AMO B;  1BNJ A;  1IK3 A;  3WDG B;  2WGO A;  1HYF A;  1MWR A;  1NB3 I;  3GAX A;  3FH1 A;  3H51 A;  1TU5 A;  1JJ2 2;  1IYY A;  3RNT A;  1SIH A;  1STD A;  1KSI A;  2RGQ A;  3D4A A;  5LC6 A;  1R4C A;  2IY2 A;  3MG2 A;  2M7O A;  3UL5 A;  1EUI C;  2QEX 3;  1MGW A;  4AKY A;  3F8H A;  3CCS 3;  3CCE 3;  2YFJ B;  2FXT A;  4HYZ A;  1UI8 A;  1YHQ 3;  1DMM A;  1LNI A;  2F98 A;  1GOY A;  3DH2 A;  1MWU A;  3G4S 3;  3OXA A;  5STD A;  1LOX A;  3DGO A;  1RGF A;  2CFL A;  1CYU A;  2ML6 A;  2XFS A;  3NV0 B;  3DGL A;  1MNL A;  3H3H A;  2BHM A;  1M9G A;  1T2I A;  2CHC A;  1N5H A;  1Q82 4;  1BOX A;  1UCL A;  3FSD A;  1PFP A;  1RDS A;  2IMJ A;  1BSC A;  4L7K A;  3NQZ A;  1C54 A;  1N8R 4;  4DKI A;  4EV5 A;  3X40 A;  1KQS 2;  1JKG B;  5AEU B;  3CCR 3;  1BSA A;  1FA3 A;  1EKM A;  2W2C A;  1IT8 A;  5EEO A;  4QWT A;  1FGT A;  1LOV A;  1L5G B;  2Y74 A;  1RN7 A;  3KKG A;  5CK6 A;  2KRT A;  2ML5 A;  3GZY B;  1X1X A;  3HK4 A;  5CXO A;  2RFR A;  1GS3 A;  3OWU A;  1ISK A;  1W6Y A;  3CNX A;  3LXU X;  5IF6 A;  2Q07 A;  3UNL A;  1BIR A;  2B1X B;  2OTJ 3;  4LSO A;  1K41 A;  1SII A;  3FCS B;  4WHA A;  1NNV A;  5DRE A;  2YFL B;  1AV4 A;  1M1K 4;  1E3R A;  3MPH A;  2KF5 A;  3SVA A;  3Q3F A;  5IG3 A;  3QK9 A;  2JQ5 A;  1I0V A;  3N8B A;  1IDP A;  1BRJ A;  1FYS A;  1TUH A;  4HM5 B;  1YJW 3;  1B2Z A;  1MWT A;  2XF3 A;  1LOW A;  1KC8 4;  1O7G B;  1GYB A;  3CU3 A;  2P05 A;  2CG1 A;  1I2G A;  4LEH A;  2GBW B;  2F99 A;  4CDL A;  3G6E 3;  1CH0 A;  3N54 B;  1JB2 A;  5AIF A;  1UUG B;  3D5I A;  2MF7 A;  1I3F A;  4XM4 A;  1AR0 A;  1OF5 A;  3WHO A;  2CC3 A;  1BAN A;  5RNT A;  1G02 A;  2CFD A;  4FCM A;  3F14 A;  1ROA A;  4L8O A;  6GSP A;  1YGW A;  1QMA A;  4RNZ A;  3CXC 2;  4GSP A;  3HZP A;  2CW9 A;  4PEJ A;  1RRL A;  3CPW 2;  4XBT A;  2HMM B;  3F8X A;  2Z76 A;  3F40 A;  3CCU 3;  2GU1 A;  5CF2 A;  1US1 A;  2MC8 A;  2W56 A;  2HOH A;  5FGO A;  4XDV A;  1RCK A;  3KN4 A;  3SLU A;  2P09 A;  2SAR A;  1OPY A;  1OHO A;  3FG4 A;  3NBB A;  4JF8 A;  2OQE A;  2OOV A;  3EC9 A;  4MEI A;  4HM4 B;  5EVH A;  1GD3 A;  2CKF B;  2O3O A;  3ER7 A;  3MKI A;  3S67 A;  3CCL 3;  4H61 A;  3BNC A;  3DXO A;  1EQK A;  3X3Z A;  1Y4K A;  1G96 A;  1NO3 A;  2XEP A;  3FG1 A;  1JN5 A;  5IEN A;  1IV9 A;  5CLK A;  4XBX A;  4AKZ A;  2IUJ A;  2KAA A;  1BRH A;  1FGM A;  5ELJ A;  1U8C B;  2JDI H;  2XR8 B;  1AY7 A;  3T8N A;  3AGO A;  3NQY A;  1VQK 3;  1T2H A;  1JB5 A;  2RBI A;  4LGQ A;  5G1L A;  3ROB A;  5I97 A;  4IT7 A;  2GXF A;  4N6T A;  1FUW A;  2CFK A;  3SX1 A;  4EYC A;  2OWP A;  1SJW A;  3Q90 A;  2KF3 A;  2GU3 A;  2KCD A;  1WNH A;  4KVH A;  3GZX B;  1GY6 A;  1FUT A;  3DM8 A;  4HM0 B;  4XBY A;  1VQM 3;  1DE3 A;  3M8C A;  1I2F A;  2ZA4 A;  3OV4 A;  1DMN A;  1V58 A;  3DGM A;  5EQL A;  3AHS A;  2RSX A;  1MGR A;  3X3X A;  2Z7A A;  1OH0 A;  2W9P A;  3WOE B;  1Z1S A;  1W2B 2;  1TFO A;  3JUP A;  1W7C A;  4NHF A;  7GSP A;  3F7X A;  2CIU A;  1RSN A;  1GSP A;  1N9J A;  2HMK B;  4HVN A;  4N6L A;  1PYL A;  1GY5 A;  4LMI A;  1LOY A;  1JZO A;  1Q42 A;  1JBR A;  1VQ9 3;  2XSO B;  1IU7 A;  1RRH A;  3DMC A;  3K9M C;  1K9M 4;  1VQ6 3;  1FGQ A;  1MWS A;  1YGE A;  2E2V A;  3OWS A;  2GEY A;  1N5P A;  5JPU A;  2YX9 A;  1A2V A;  1YIJ 3;  3BU4 A;  4X2H A;  4G1M B;  3CCV 3;  1I70 A;  1RCL A;  1YI2 3;  5ELU A;  4BL2 A;  5KP1 A;  3LOY A;  3GRD A;  2F5W A;  3KE7 A;  2CK3 H;  3GWR A;  1QJG A;  2P38 A;  1FGO A;  2F4Y A;  1PU4 A;  2C10 A;  1WMO A;  2ZDJ A;  2Z77 A;  3LTC A;  4MJD A;  2QGU A;  4WYK B;  2CWT A;  1W00 A;  2HMJ B;  4FCZ A;  4I4K A;  4K90 B;  4RNY A;  2XGL A;  1X1U A;  1J2B A;  3NM2 A;  2R4I A;  3HII A;  5JPP A;  1DYU A;  1UUW B;  2L1S A;  5D81 A;  4HBR A;  1IQY A;  1D6U A;  2INX A;  2PNC A;  4J9A A;  4O8S A;  5BU4 A;  5BVB A;  2WO0 A;  7STD A;  3B8L A;  2OTL 3;  4HM1 B;  4ORL A;  5AI1 A;  4K61 A;  5TGN A;  1I2E A;  1BSB A;  5D82 A;  2SBL A;  1VQ4 3;  2W0Q A;  2C4B A;  4FMA A;  5IEO A;  1O7N B;  1TTO A;  3NBJ A;  3V99 A;  4EBG A;  1A90 A;  3GSP A;  2V1L A;  2HMN B;  1RGK A;  2UX0 A;  1UCJ A;  1QAL A;  1CQS A;  1B2U A;  4MMX B;  3PS8 A;  5D83 A;  5CF1 A;  1SQW A;  4XDW A;  1T5Y A;  3CCJ 3;  4U13 A;  1FZU A;  3ALA A;  3PXM A;  1RNB A;  5AIH A;  5AII A;  1SPU A;  4FMB A;  1UDI I;  3KFQ C;  1T3B A;  3ZG5 A;  2F86 B;  1JV2 B;  2KF4 A;  3EBT A;  1RHL A;  2P0M A;  3DGY A;  3BIR A;  2WGQ A;  5FW5 A;  3U1W A;  5M18 A;  1W02 A;  1YNV X;  5AYS C;  1KWI A;  2KF6 A;  1LQM B;  5DRV A;  4IIA A;  3NBR A;  4BTX A;  4NRE A;  1NU3 A;  2WOH A;  3EJV A;  4R80 A;  1CEW I;  1WQL B;  3SED A;  1HU9 A;  3KSP A;  2CWV A;  3S27 A;  3CC2 3;  2J8X B;  3HI7 A;  1W4N A;  3B4O A;  1W2Z A;  1K8A 4;  2A15 A;  1TFK A;  1MOL A;  2HMO B;  2W04 A;  4CJN A;  4HZB B;  1QVF 2;  3CD6 3;  5BIR A;  1E97 A;  1V74 A;  2IUK A;  3X3Y A;  3QRD A;  3KCH A;  1TRQ A;  1DVD A;  4EW5 A;  4BIR A;  3G71 3;  1IVX A;  4AEQ A;  4FCJ A;  4OVM A; 
#chains in the Genus database with same CATH homology
 5GSP A;  1MGW A;  1BRG A;  1YVS A;  2KAA A;  1BRH A;  1AY7 A;  3AGO A;  3HOH A;  1A2P A;  1T2H A;  2RBI A;  1BNI A;  1LNI A;  2BU4 A;  1GOY A;  3DH2 A;  3SYU A;  1GMR A;  2RNT A;  1RGF A;  2KF3 A;  1BSE A;  1DE3 A;  1FUT A;  1ZGX A;  1I2F A;  1I8V A;  2ZA4 A;  1T2I A;  1X1Y A;  3AHS A;  1BNS A;  1MGR A;  1BOX A;  1UCL A;  1BRS A;  5HOH A;  1RDS A;  1BSC A;  7GSP A;  1C54 A;  1RSN A;  1GSP A;  4GHO A;  2AAE A;  1B20 A;  1PYL A;  1X1W A;  1LOY A;  3A5E A;  1BRK A;  1JBR A;  1RGH A;  1RNT A;  1B3S A;  1BSA A;  1RN4 A;  3BU4 A;  1UCI A;  1BRI A;  1DET A;  1I70 A;  1RCL A;  4HAA A;  2F5M A;  3AHW A;  3AGN A;  1GOV A;  1LOV A;  1BNR A;  1Q9E A;  2F5W A;  2GSP A;  1X1X A;  9RNT A;  2F4Y A;  1BIR A;  1R4Y A;  3WR2 A;  1BAO A;  1RGA A;  4J5K A;  1B2M A;  2KF5 A;  1X1U A;  3Q3F A;  1JBS A;  1I0V A;  1RGG A;  4BU4 A;  8RNT A;  1BRJ A;  5BU4 A;  1B2S A;  1FYS A;  1RGL A;  1B2Z A;  1GMQ A;  1UCK A;  1I2E A;  1BSB A;  1LOW A;  4HOH A;  1GMP A;  2C4B A;  1BUJ A;  1AQZ A;  1TTO A;  1B2X A;  1BSD A;  1I2G A;  1LRA A;  1BU4 A;  1CH0 A;  3D5G A;  3GSP A;  1RGK A;  3D5I A;  1I3F A;  1UCJ A;  1B2U A;  1RLS A;  3WHO A;  1BAN A;  1RTU A;  1TRP A;  1HZ1 A;  1G02 A;  1BNE A;  1FZU A;  1BVI A;  2F56 A;  5RNT A;  1RNB A;  6GSP A;  1BRN L;  1YGW A;  1FW7 A;  4GSP A;  1I3I A;  1RGC A;  2AAD A;  1BNF A;  3URP A;  2KF4 A;  7RNT A;  1B27 A;  1RHL A;  4RNT A;  3DGY A;  3BIR A;  1I0X A;  1B21 A;  1YNV X;  1RN1 A;  1JBT A;  6RNT A;  2KF6 A;  1PY3 A;  1GOU A;  2HOH A;  1RCK A;  1SAR A;  1RMS A;  1BGS A;  2SAR A;  1BNJ A;  1HYF A;  1IYY A;  1RGE A;  3RNT A;  4J5G A;  5BIR A;  3D4A A;  3KCH A;  1BNG A;  1TRQ A;  1FUS A;  4BIR A;  2BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...