3MSOA

Crystal structure of a steroid delta-isomerase (np_250810.1) from pseudomonas aeruginosa at 2.57 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
TSLPLEANAAATLAEWHGLIARRDLSGLPRLLHPDAVFRSPMAHKPYAGAPVVSMILNTVLTVFEDFAYHRQLASADGRSVVLEFSARVGERELKGIDMIRFDDDGRIVDFEVMVRPMSGLQALGEEMGRRLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Crystal structure of a STEROID DELTA-ISOMERASE (PA2120) from PSEUDOMONAS AERUGINOSA at 2.57 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3msoA00
3F8HA 1AR0A 5D82A 1BUQA 3FSDA 2K54A 3BLZA 1EA2A 8CHOA 4L8OA 1OGXA 4XBXA 4R9KA 3RGAA 4OVMA 3B8LA 1TP6A 2JQ5A 4HZ9B 4LEHA 3LYGA 3G16A 5CF1A 4Q53A 3EQQB 3MG1A 5AIHA 5STDA 4J8TA 2Z76A 1GY7A 3H3HA 2HMNB 1O7WB 3FH1A 3B4PA 1O7GB 4LMIA 2HMMB 5IG0A 1OH0A 1JB5A 1OUNA 4HM6B 3EBYA 5KP4A 3CPOA 2INXA 3G0KA 1SJWA 2BMOB 1UUWB 3NHXA 1QJGA 3DMCA 2B1XB 3VSYA 3WMDA 5D81A 2STDA 3S5CA 3EF8A 3GZXB 1OHPA 1OHSA 3BB9A 2Z77A 2RCDA 4GB5A 5AIGA 3NV0B 3KZTA 3F8XA 3EHCA 3NV0A 4HM0B 4CDLA 3T8NA 1Q40B 1Q40A 2HMJB 3F7XA 6STDA 4FCJA 3HK4A 5BVBA 2YFLB 3HZPA 5IF6A 1GY6A 3FGYA 1Q42A 1K41A 4HM2B 5KP3A 3VGNA 4KVHA 2BMRB 1OCVA 5BXQA 1A2KA 1OPYA 5CF2A 4HM1B 5CK6A 3NM2A 3OWSA 3CNMA 3GZRA 3Q90A 1JN5B 4RZMA 1JN5A 7STDA 3F7SA 3MKIA 1JB4A 3GZYB 4HKVB 1O7PB 1ZO2A 2Z7AA 3UJMA 3OXAA 4ORLA 5D83A 4XM4A 4STDA 1DMNA 3DZLA 2BMQB 1OF5B 1TUHA 1NU3A 3LZAA 3RGRA 1OF5A 3FLJA 2QIYA 5IG5A 1ASKA 2CHCA 1W6YA 3JUNA 1DMMA 2I9WA 3OWUA 2UX0A 1ULJB 4MJDA 3FZWA 3DUKA 2YFJB 2RGQA 2HMLB 4R1KA 3KE7A 3GRDA 3SOAA 3JUMA 1IDPA 3CU3A 3OWYA 4HVNA 2YFIB 4HJLB 2GEYA 3EJVA 3FKAA 3KKGA 1NDOB 4LGQA 2XRXB 2F98A 1DMQA 1OHOA 3SOYA 1Z1SA 4WWUC 5AEUB 1GYBA 3DXOA 4XDVA 3A76A 1WQLB 2GBXB 1JB2A 2QGUA 3JUQA 1ISKA 4HM3B 4HM5B 4HM7B 3CNXA 4HM4B 4PEJA 5AEWB 3STDA 2HMOB 5AI1A 1VZZA 2IMJA 5CXOA 4XBYA 3GZBA 5DRVA 3ROBA 5G2GA 3ER7A 3F9SA 4OUQA 5IG4A 1EG9B 5IERA 3NUVA 4L8PA 2HMKB 3GWRA 3MG2A 2GEXA 4J9AA 3K0ZA 3B4OA 4X2HA 4X2OA 3JUOA 4R9LA 3H51A 3IPTA 3UNLA 3NXJA 1ZX2A 5HGRA 2A15A 1CQSA 3EN1B 3K7CA 3HX8A 2BNGA 1W00A 4IIAA 2CKFB 3EBTA 2B24B 1W01A 5AIIA 1U5OA 5IENA 5CLKA 3F40A 1NWWA 2OWPA 4N3VA 4FCMA 2W2CA 3MHEA 1C7HA 5TGNA 1O7HB 3T8UA 2R4IA 3DM8A 1O7MB 3FF2A 1E3RA 2RFRA 1JKGB 4XB5A 3B7CA 1JKGA 2F99A 1E97A 1STDA 2XSHB 5IEPA 4HZBB 5JPUA 4K1UA 1W02A 3NBRA 4XDWA 4WYKB 3MSOA 1GY5A 3FF0A 4WYKA 5EVHA 3SEDA 5AIFA 3G8ZA 3D9RA 1O7NB 2GXFA 4WP5A 5IG3A 3EC9A 1S5AA 4XBTA 3MG3A 2PZVA 1UUVB 3E99A 3F14A 2F86B 4K1VA 5IEOA 3I0YA 3OV4A 5KP1A 2XSOB 3JUPA 1E3VA 3M8CA 4H3UA 3OX9A 3ECFA 2XR8B 3MYTA 3KSPA 3EN8A 1QMAA 5JPPA 1GS3A 4I4KA 1OGZA 5FW5A 4L7KA 4HM8B 3EX9A 2GBWB 4U13A 1ULIB 5DREA 1HKXA
chains in the Genus database with same CATH superfamily
2Z6BA 1RN4A 1C54A 1I70A 3F8HA 1BU4A 1DYUA 1W2ZA 1AR0A 1GMPA 2D42A 1JZOA 5D82A 4EV5A 1BUQA 3IJEB 4QWTA 2CX1A 3FSDA 3WODG 1B21A 2K54A 1EEJA 1B2MA 1KWIA 4HAAA 1VQ83 5EEOA 1BIRA 3BLZA 5LC6A 1EA2A 8CHOA 2IYJA 1JRQA 1MNLA 1X1XA 2UUGC 4L8OA 4NREA 3CCM3 1OGXA 1YJ93 2Q07A 3GAXA 4XBXA 1GMRA 4GSPA 4JRFA 3PYJA 6GSPA 3CCL3 4R9KA 3U97A 2O9UX 1B20A 3QK9A 3RGAA 4O8SA 4OVMA 3B8LA 1VQ93 1TP6A 4N6MA 1IQYA 1QAKA 2JQ5A 1U8CB 2E2TA 3ALAA 4HZ9B 4LEHA 3LYGA 1BSAA 1K9M4 3G16A 1QALA 1KQS2 4KFDA 5CF1A 4Q53A 3SXXA 5GSPA 1LVNA 1VQO3 4AKZA 5FGOA 1V74A 3EQQB 1IV9A 3MG1A 4BL3A 5AIHA 1A2PA 1CH0A 1JNQA 2E2VA 3NX0A 3PZWA 1BNEA 1UDII 1L5GB 3KN4A 4BL2A 1RNTA 1UI7A 3K5TA 2L1SA 5STDA 1HU9A 3CME3 4J8TA 1SARA 2BIRA 2Z76A 3LTCA 3CPW2 3KCHA 3AHWA 1GY7A 1RJOA 1IQ8A 2BT3A 1IVVA 1G96A 1I2FA 1T3BA 2E2UA 2FGTA 3H3HA 3QRDA 3X3YA 1US1A 2HMNB 2CWTA 4N6LA 1KC84 1LNHA 1BRKA 2XGLA 1VQ73 1RRLA 1O7WB 3FH1A 1JJ22 1AVKA 1CEWI 3AGOA 3B4PA 3DGYA 1O7GB 3G6E3 2PNCA 1WNHA 4EYCA 1M1K4 2XGNA 1RGGA 2HMMB 4LMIA 1D6YA 1TFKA 2CWUA 1KD14 2P0XA 2CWVA 1Q7Y4 5IG0A 1OH0A 1JB5A 1OUNA 1I3IA 4HM6B 3CCJ3 3EBYA 5KP4A 1YHQ3 2Y73A 3CPOA 3PS8A 2CG0A 3RNTA 1S723 1X1UA 5I97A 2INXA 3G0KA 1SJWA 4N6NB 2P09A 2OQEA 2BMOB 5ELUA 1UUWB 2GU3A 3NHXA 2IY2A 1QJGA 3A5EA 1YJW3 3X40A 2H0GA 4BIRA 2FNQA 3NBBA 1K734 2Y74A 1UGHI 2OOVC 3DGMA 3JVCA 7GSPA 3DMCA 4OK0A 2B1XB 2CFGA 3VSYA 1QVF2 3LXUX 1BRSA 3S27A 3GSPA 1RDSA 1B2SA 3WMDA 5D81A 1FUTA 3LT8A 1W6GA 1BSDA 1UCLA 3N9HA 5EQLA 2STDA 1STFI 3S5CA 3EF8A 3SX1A 3GZXB 1OHPA 4MEIA 1BVIA 3T0UA 1OHSA 1I2EA 3HI7A 3BB9A 2Z77A 3SLUA 7RNTA 1M9GA 2F56A 2RCDA 4GB5A 2CG1A 1DETA 5AIGA 3NV0B 1CYVA 3KZTA 3F8XA 3DGLA 3EHCA 1IVUA 1SIHA 2L4VA 3NV0A 2R41A 3G4S3 3WR2A 4HM0B 4CDLA 1YVBI 4RNYA 2CC3A 3FG4A 1A2VA 3T8NA 3ZFZA 4FMDA 1Q40B 3CCE3 2W9PA 1JBRA 4O2HA 4H61A 1Q40A 2HMJB 3F7XA 6STDA 2OTL3 1BRIA 3I563 4FCJA 3HK4A 3EB8A 4ZM8A 3CC73 3CCU3 1RGEA 4O02B 5BVBA 2YFLB 3CD63 1VQQA 2MF7A 1TJDA 2KXGA 9RNTA 1BNJA 3HZPA 5IF6A 3TDGA 1RLSA 1GY6A 1UUGB 4MMZB 1RNBA 3UL6A 4HBRA 1ROVA 3FGYA 1Y4KA 1Q42A 1K41A 2CFKA 2CK3H 4IT7A 4HM2B 1VQL3 2P0MA 4HOHA 2ML5A 1IT8A 2WO0A 3BNDA 5KP3A 3VGNA 2FXTA 4KVHA 1Q864 2BMRB 2QEX3 1OCVA 5LC7A 2CIUA 2H0HA 5BXQA 1EQKA 3WOEB 1UCKA 3S67A 2GU1A 1A2KA 2KF5A 1TFOA 3Q1CA 3D5GA 1LNIA 1OPYA 1D6UA 1LXEA 4HM1B 5CK6A 3NM2A 4FR9A 5CF2A 3G713 3OWSA 2F4YA 3CNMA 1VQ43 4AKYA 3WDGB 3GZRA 1WMPA 4LSOA 3MWZA 4KFFA 2WGOA 1FGRA 1RGKA 2XH9A 1JN5B 3Q90A 3V98A 3CC43 1W2B2 4RZMA 3DY5A 2IUJA 3D5IA 1SIIA 1TU5A 1JN5A 7STDA 4RNTA 3F7SA 1CYUA 1I0XA 3MKIA 1JB4A 1G02A 3X42A 1YIJ3 3GZYB 4HKVB 1O7PB 1ZO2A 2SARA 2Z7AA 1BRGA 3UJMA 3OXAA 1FGMA 3RDEA 4ORLA 3BNBA 1BSBA 2CX0A 2GSPA 1N5PA 2OQEC 3LH4A 5D83A 2ZHXB 3CCV3 4KT3B 4XM4A 2XFTA 4STDA 1DMNA 3DZLA 2BMQB 2F5WA 4MMYB 1OF5B 4EBGA 1M1XB 5G1KA 1TUHA 1GOUA 2MC8A 3BIRA 1NU3A 1RCKA 3LZAA 3NQZA 1QAFA 1NB3I 3BNCA 3RGRA 4JF8A 1OF5A 3FLJA 1UW1A 1I8VA 2QIYA 3X3XA 1VQ53 5IG5A 2KAAA 3CCQ3 1EKMA 1YVSA 1ASKA 2CHCA 6RNTA 1W6YA 3D3LA 4I5QA 4IPBA 1VQK3 3IMAB 3JUNA 3DGNA 1BUJA 1DMMA 3CXC2 1X1YA 1YGEA 4KZ1A 4CPKA 1GD3A 1BNRA 1LOXA 1I0VA 2I9WA 3OWUA 2KF6A 1BNSA 1JV2B 1GMQA 1V57A 3BU4A 3N54B 2UX0A 1ULJB 2JDIH 1IU7A 3PXMA 3U1WA 4MJDA 2ZDJA 3FZWA 1RHLA 1RRHA 2QA43 3DUKA 2SBLA 2KRTA 2YFJB 2RGQA 3LTDA 2OTJ3 2HMLB 4R1KA 3KE7A 3GRDA 1GOVA 2W6JH 3SOAA 3JUMA 1IDPA 1RGLA 2AAEA 3I553 2ZL8A 3CU3A 3OWYA 3WA2X 3AHSA 5BU4A 1MWUA 4FMCA 5HOHA 1A67A 2IA7A 2YFIB 4HJLB 4HVNA 1IK3A 1W6CA 1IVXA 1DE3A 4CJNA 2GEYA 3EJVA 1KSIA 3LOYA 3FKAA 3KKGA 1NDOB 4LGQA 3UL5A 4O3VA 4CCVA 4EW5A 1PFPA 2W03A 2K0MA 2KF3A 2F98A 2XRXB 1DMQA 5IW9A 1OHOA 2O3OA 1VQP3 1JZDA 1R4YA 3SOYA 3KSED 1Z1SA 4WWUC 5AEUB 1GYBA 2CFLA 3DXOA 4BTWA 4XDVA 1YJN3 3A76A 1B27A 3CC23 1WQLB 2GBXB 1W7CA 4FMAA 1JB2A 1N9JA 2IUKA 2QGUA 3JUQA 4N6OB 1ISKA 3DGOA 3NBJA 4HM3B 4HM5B 4HM7B 1V58A 1FUWA 3CNXA 1FGQA 1MWTA 1BGSA 1I3FA 4HM4B 1VQ63 3BNEA 1YIT3 1FA3A 4PEJA 5AEWB 2J8XB 3STDA 1GD4A 2HMOB 1W5ZA 5AI1A 1VZZA 3NM7A 2IMJA 1VQN3 1IT7A 2BHMA 5CXOA 4XBYA 3GZBA 5DRVA 1UI8A 3ROBA 1YGWA 5G2GA 3ER7A 1Q9EA 1TIJA 3Q2PA 3AMOB 1LOYA 1N5HA 3F9SA 4OUQA 4J5GA 1BRHA 4BTYA 1Q824 1B3SA 5IG4A 1EG9B 1T2HA 5IERA 3AMOA 4N6UA 3NUVA 1RGFA 4N6TA 4WP5A 2F5MA 4L8PA 1BNIA 4BTXA 1LOWA 1DVDA 4R80A 2HMKB 3GWRA 1R4CA 3MG2A 2GEXA 5A0OB 1IV7A 1OACA 2W04A 4J9AA 3K0ZA 5RNTA 2RSXA 1LRAA 1MWSA 5ELJA 1RGCA 1BNGA 3B4OA 4X2HA 2LYXA 4X2OA 3AGNA 3JUOA 4NHFA 5G1LA 4R9LA 4KFEA 1AY7A 4EXRA 1N8R4 4K61A 3H51A 1BANA 2RBIA 1X1WA 4LYLB 1FYSA 1WTHA 3IPTA 1G0TA 4TX4A 3UNLA 3NXJA 2LQVA 5JBSA 1ZX2A 1YI23 2WOHA 5HGRA 1MGRA 2A15A 2P05A 3O8YA 1CQSA 3S28A 1T2IA 3EN1B 3WOFB 1W4NA 3SYUA 3K7CA 3HOHA 1BNFA 3HX8A 4FCZA 2WGQA 1LQGC 1NB5I 2BNGA 4RNZA 1RN7A 1W00A 3PCSA 4J5KA 3L0RA 4IIAA 2CKFB 3NQYA 3D79A 3EBTA 2W0QA 4EV2A 3URPA 3FCSB 2B24B 1TRQA 1B2UA 1W01A 2W56B 1PYLA 5AIIA 1U5OA 5AYRB 1F8NA 3VF1A 5IENA 3PCRA 5CLKA 2W56A 3F40A 4G1MB 1JBSA 1BRNL 1A90A 1FZUA 3ZG0A 1NJI4 3KFQC 2P38A 1K8A4 1FGTA 2CFDA 4R4KA 1MGWA 1MWRA 1RN1A 2XEPA 1FGOA 1NWWA 2OWPA 3Q3FA 2RNTA 4N3VA 4WFOA 4FCMA 1IQXA 2C11A 3LTBA 1TTOA 4AEQA 3CCR3 2HOHA 2W2CA 3WHOA 1BSCA 2W9QA 1NNVA 1RCLA 5BIRA 3MHEA 2C4BA 3J7Yd 3CMA3 2D1WA 1C7HA 4N6V0 3FG3A 5TGNA 1O7HB 3T8UA 2R4IA 1AV4A 3DM8A 3V99A 2K3DA 1O7MB 3FF2A 3X41A 1I2GA 1GOYA 1E3RA 4DKIA 1BOXA 1PY3A 1PU4A 2RFRA 1JKGB 1T5YA 4XB5A 3B7CA 2YX9A 1JKGA 2XF3A 3EE1A 3MPHA 2F99A 2V1LA 1M904 1J2BA 1E97A 1HZ1A 1STDA 2XSHB 5IEPA 4HZBB 3WA3A 2UGIA 1B2XA 1N9EA 1RGHA 4LZIA 1RGAA 5JPUA 3V92A 1WMNA 1VQM3 4K1UA 1FW7A 2C10A 1W02A 3NBRA 2CH9A 2CFWA 4WYKB 2H0IA 4XDWA 1N8QA 3MSOA 1WMOA 1GY5A 2ML6A 3HIGA 3FF0A 4WYKA 1IVWA 5EVHA 3SEDA 1RKYA 1QVG2 1RSNA 1BAOA 2KF4A 1MOLA 1AVLA 5AIFA 2OCTA 4EC6A 3OW22 3G8ZA 1LQMB 4BU4A 1EUIC 1UGIA 3D9RA 1GSPA 1LOVA 1O7NB 2GXFA 1HYFA 1ZGXA 3K63A 2XFSA 3K9MC 4FMBA 5IG3A 5AYSC 4WHAA 3FG1A 4GHOA 1SPUA 3EC9A 1D6ZA 1S5AA 3CCS3 4XBTA 3MG3A 2PZVA 1UUVB 3E99A 2CW9A 2KCDA 1FUSA 1RTUA 2WOFA 3F14A 2F86B 5M1AA 4K90B 4K1VA 5M19A 5IEOA 3I0YA 3OV4A 2BO9B 2ZA4A 1YNVX 3LMLA 3LT9A 3LTAA 3S29A 5KP1A 3X3ZA 2XSOB 3JUPA 1ZS7A 1E3VA 3M8CA 4RBNA 4H3UA 3OX9A 8RNTA 5DREA 1DVCA 3ECFA 1SQWA 1BSEA 4ILFA 2OOVA 2M7OA 2XR8B 3D4AA 1UCJA 3EN8A 1QMAA 2BU4A 3KSPA 3MYTA 5JPPA 1GS3A 1TRPA 1RMSA 4GL6A 1NO3A 1UCIA 3KIIA 4I4KA 1OGZA 5FW5A 4L7KA 4HM8B 1BRJA 1K28A 4HYZA 2AADA 3UB1A 4MMXB 2GBWB 1B2ZA 3HIIA 3DH2A 3PGBA 4NPBA 4U13A 3SVAA 1Q7HA 1ULIB 5M18A 1AQZA 1ROAA 3N8BA 1Q814 3ZG5A 3EX9A 1IYYA 1HKXA 1JBTA
chains in the Genus database with same CATH topology
2Z6BA 3F8HA 1DYUA 1W2ZA 1AR0A 2D42A 5D82A 4EV5A 1BUQA 3IJEB 4QWTA 3FSDA 3WODG 2K54A 1KWIA 1VQ83 5EEOA 5LC6A 3BLZA 1EA2A 8CHOA 1JRQA 1MNLA 4L8OA 4NREA 3CCM3 1OGXA 1YJ93 2Q07A 3GAXA 4XBXA 4JRFA 3PYJA 3CCL3 4R9KA 3U97A 2O9UX 3QK9A 3RGAA 4O8SA 4OVMA 3B8LA 1VQ93 1TP6A 4N6MA 1IQYA 1QAKA 2JQ5A 1U8CB 2E2TA 3ALAA 4HZ9B 4LEHA 3LYGA 1K9M4 3G16A 1QALA 1KQS2 4KFDA 5CF1A 4Q53A 3SXXA 1VQO3 1LVNA 4AKZA 5FGOA 1V74A 3EQQB 1IV9A 3MG1A 5AIHA 1JNQA 2E2VA 3NX0A 3PZWA 1L5GB 3KN4A 1UI7A 3K5TA 5STDA 1HU9A 3CME3 4J8TA 2Z76A 3LTCA 3CPW2 1GY7A 1RJOA 1IQ8A 2FGTA 2BT3A 1IVVA 1G96A 2E2UA 3QRDA 3H3HA 1KC84 3X3YA 1US1A 2HMNB 2CWTA 4N6LA 1LNHA 2XGLA 1VQ73 1RRLA 1O7WB 3FH1A 1JJ22 1AVKA 1CEWI 3B4PA 3G6E3 1O7GB 2PNCA 1WNHA 4EYCA 1M1K4 2XGNA 4LMIA 2HMMB 1D6YA 1TFKA 2CWUA 1KD14 2P0XA 2CWVA 1Q7Y4 5IG0A 1OH0A 1JB5A 1OUNA 3CCJ3 4HM6B 1YHQ3 3EBYA 5KP4A 2Y73A 3CPOA 3PS8A 2CG0A 1S723 5I97A 2INXA 3G0KA 1SJWA 4N6NB 2P09A 2OQEA 2BMOB 5ELUA 1UUWB 2GU3A 3NHXA 1QJGA 1YJW3 3X40A 2FNQA 3NBBA 1K734 2Y74A 2OOVC 3DGMA 3JVCA 3DMCA 4OK0A 2B1XB 2CFGA 3VSYA 1QVF2 3LXUX 3S27A 3WMDA 5D81A 3LT8A 1W6GA 3N9HA 5EQLA 2STDA 1STFI 3S5CA 3EF8A 3SX1A 3GZXB 1OHPA 4MEIA 3T0UA 1OHSA 3HI7A 3BB9A 2Z77A 3SLUA 1M9GA 2RCDA 4GB5A 2CG1A 5AIGA 3NV0B 1CYVA 3KZTA 3F8XA 3DGLA 3EHCA 1IVUA 1SIHA 2L4VA 3NV0A 3G4S3 4HM0B 4CDLA 1YVBI 4RNYA 2CC3A 3FG4A 1A2VA 3T8NA 4FMDA 1Q40B 3CCE3 2W9PA 4O2HA 4H61A 1Q40A 2HMJB 3F7XA 6STDA 2OTL3 3I563 4FCJA 3HK4A 3EB8A 4ZM8A 3CC73 3CCU3 4O02B 5BVBA 2YFLB 2MF7A 2KXGA 3HZPA 5IF6A 3TDGA 1GY6A 4MMZB 3UL6A 4HBRA 1ROVA 3FGYA 1Y4KA 1Q42A 1K41A 2CFKA 2CK3H 4IT7A 4HM2B 1VQL3 2P0MA 2ML5A 1IT8A 2WO0A 3BNDA 5KP3A 3VGNA 2FXTA 4KVHA 1Q864 2BMRB 2QEX3 1OCVA 5LC7A 2CIUA 5BXQA 1EQKA 3WOEB 3S67A 2GU1A 1A2KA 1TFOA 3Q1CA 1OPYA 5CF2A 1D6UA 1LXEA 4HM1B 5CK6A 3NM2A 4FR9A 3G713 3OWSA 3CNMA 1VQ43 4AKYA 3WDGB 3GZRA 1WMPA 4LSOA 3MWZA 4KFFA 2WGOA 1FGRA 2XH9A 1JN5B 3Q90A 3V98A 1W2B2 4RZMA 3DY5A 2IUJA 1SIIA 1TU5A 1JN5A 7STDA 3F7SA 1CYUA 3MKIA 1JB4A 3X42A 1YIJ3 3GZYB 4HKVB 1O7PB 1ZO2A 2Z7AA 3UJMA 3OXAA 1FGMA 3RDEA 4ORLA 3BNBA 1N5PA 2OQEC 3LH4A 5D83A 3CCV3 4XM4A 2XFTA 4STDA 1DMNA 3DZLA 2BMQB 4MMYB 1OF5B 4EBGA 1M1XB 1TUHA 3CD63 2MC8A 1NU3A 3LZAA 3NQZA 1QAFA 1NB3I 3BNCA 3RGRA 4JF8A 1OF5A 3FLJA 1UW1A 2QIYA 3X3XA 1VQ53 5IG5A 3CCQ3 1EKMA 1ASKA 2CHCA 1W6YA 3D3LA 4IPBA 1VQK3 3IMAB 3JUNA 3DGNA 1DMMA 3CXC2 1YGEA 4KZ1A 1GD3A 1LOXA 2I9WA 3OWUA 1JV2B 3N54B 2UX0A 1ULJB 2JDIH 1IU7A 3PXMA 3U1WA 4MJDA 2ZDJA 3FZWA 2QA43 1RRHA 3DUKA 2SBLA 2KRTA 2YFJB 2RGQA 3LTDA 2OTJ3 2HMLB 4R1KA 3KE7A 3GRDA 2W6JH 3SOAA 3JUMA 1IDPA 3I553 2ZL8A 3CU3A 3OWYA 3WA2X 1A67A 4FMCA 2IA7A 2YFIB 4HJLB 4HVNA 1IK3A 1W6CA 1IVXA 2GEYA 3EJVA 1KSIA 3LOYA 3FKAA 3KKGA 1NDOB 4LGQA 3UL5A 4O3VA 4CCVA 1PFPA 2W03A 2K0MA 2XRXB 2F98A 5IW9A 1DMQA 1VQP3 1OHOA 2O3OA 3SOYA 3KSED 1Z1SA 4WWUC 5AEUB 1GYBA 2CFLA 3DXOA 4BTWA 4XDVA 1YJN3 3A76A 3CC23 1WQLB 2GBXB 1W7CA 4FMAA 1JB2A 1N9JA 2IUKA 2QGUA 3JUQA 4N6OB 1ISKA 3DGOA 3NBJA 4HM3B 4HM5B 4HM7B 1FUWA 3CNXA 1FGQA 4HM4B 1VQ63 3BNEA 1YIT3 1FA3A 4PEJA 5AEWB 3STDA 1GD4A 2HMOB 1W5ZA 5AI1A 1VZZA 3NM7A 2IMJA 1VQN3 1IT7A 2BHMA 5CXOA 4XBYA 3GZBA 5DRVA 1UI8A 3ROBA 5G2GA 3ER7A 1TIJA 3Q2PA 3AMOB 1N5HA 3F9SA 4OUQA 1Q824 4BTYA 5IG4A 1EG9B 5IERA 3AMOA 4N6UA 3NUVA 4N6TA 4L8PA 4BTXA 1DVDA 4R80A 2HMKB 3GWRA 1R4CA 3MG2A 2GEXA 5A0OB 1IV7A 1OACA 2W04A 4J9AA 3K0ZA 2RSXA 5ELJA 3B4OA 4X2HA 2LYXA 4X2OA 3JUOA 4NHFA 4R9LA 4KFEA 4EXRA 1N8R4 4K61A 3H51A 1WTHA 3IPTA 4TX4A 1YI23 3UNLA 3NXJA 2LQVA 5JBSA 1ZX2A 2WOHA 5HGRA 2A15A 2P05A 3O8YA 1CQSA 3S28A 3WOFB 3EN1B 1W4NA 3K7CA 3HX8A 4FCZA 2WGQA 1NB5I 2BNGA 4RNZA 1RN7A 1W00A 3PCSA 3L0RA 4IIAA 2CKFB 3NQYA 3EBTA 2W0QA 4EV2A 3FCSB 2B24B 1W01A 2W56B 5AIIA 1U5OA 5AYRB 1F8NA 3VF1A 5IENA 3PCRA 5CLKA 2W56A 3F40A 4G1MB 1A90A 1NJI4 3KFQC 2P38A 1K8A4 1FGTA 2CFDA 4R4KA 2XEPA 1FGOA 1NWWA 2OWPA 4N3VA 4WFOA 4FCMA 1IQXA 2C11A 3LTBA 4AEQA 3CCR3 2W2CA 2W9QA 3MHEA 3J7Yd 3CMA3 2D1WA 1C7HA 4N6V0 3FG3A 5TGNA 1O7HB 3T8UA 2R4IA 1AV4A 3DM8A 3V99A 1O7MB 3FF2A 3X41A 1E3RA 1PU4A 2RFRA 1JKGB 1T5YA 4XB5A 3B7CA 2YX9A 1JKGA 2XF3A 3EE1A 3MPHA 2F99A 2V1LA 1M904 1J2BA 1E97A 1STDA 2XSHB 5IEPA 4HZBB 3WA3A 1N9EA 4LZIA 5JPUA 3V92A 1WMNA 1VQM3 4K1UA 2C10A 1W02A 3NBRA 2CH9A 2CFWA 4WYKB 4XDWA 1N8QA 3MSOA 1WMOA 1GY5A 2ML6A 3HIGA 3FF0A 4WYKA 1IVWA 5EVHA 3SEDA 1RKYA 1QVG2 1MOLA 1AVLA 5AIFA 2OCTA 4EC6A 3OW22 3G8ZA 3D9RA 3K63A 1O7NB 2GXFA 3K9MC 4WP5A 3CC43 2XFSA 4FMBA 5IG3A 5AYSC 4WHAA 3FG1A 1SPUA 3EC9A 1D6ZA 1S5AA 3CCS3 4XBTA 3MG3A 2PZVA 1UUVB 3E99A 2CW9A 2KCDA 2WOFA 3F14A 2F86B 4K90B 4K1VA 5IEOA 3I0YA 3OV4A 2BO9B 3LMLA 3LT9A 3S29A 3LTAA 5KP1A 3X3ZA 2XSOB 3JUPA 1E3VA 3M8CA 4RBNA 4H3UA 3OX9A 5DREA 1DVCA 3ECFA 1SQWA 2OOVA 2M7OA 2XR8B 3MYTA 3KSPA 3EN8A 1QMAA 5JPPA 1GS3A 4GL6A 1NO3A 4I4KA 3KIIA 1OGZA 5FW5A 4L7KA 4HM8B 1K28A 4HYZA 3UB1A 4MMXB 2GBWB 3HIIA 3SVAA 3PGBA 4U13A 1ULIB 1ROAA 3N8BA 1Q814 3EX9A 1HKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8H A;  1AR0 A;  5D82 A;  1BUQ A;  3FSD A;  2K54 A;  3BLZ A;  1EA2 A;  8CHO A;  4L8O A;  1OGX A;  4XBX A;  4R9K A;  3RGA A;  4OVM A;  3B8L A;  1TP6 A;  2JQ5 A;  4HZ9 B;  4LEH A;  3LYG A;  3G16 A;  5CF1 A;  4Q53 A;  3EQQ B;  3MG1 A;  5AIH A;  5STD A;  4J8T A;  2Z76 A;  1GY7 A;  3H3H A;  2HMN B;  1O7W B;  3FH1 A;  3B4P A;  1O7G B;  4LMI A;  2HMM B;  5IG0 A;  1OH0 A;  1JB5 A;  1OUN A;  4HM6 B;  3EBY A;  5KP4 A;  3CPO A;  2INX A;  3G0K A;  1SJW A;  2BMO B;  1UUW B;  3NHX A;  1QJG A;  3DMC A;  2B1X B;  3VSY A;  3WMD A;  5D81 A;  2STD A;  3S5C A;  3EF8 A;  3GZX B;  1OHP A;  1OHS A;  3BB9 A;  2Z77 A;  2RCD A;  4GB5 A;  5AIG A;  3NV0 B;  3KZT A;  3F8X A;  3EHC A;  3NV0 A;  4HM0 B;  4CDL A;  3T8N A;  1Q40 B;  1Q40 A;  2HMJ B;  3F7X A;  6STD A;  4FCJ A;  3HK4 A;  5BVB A;  2YFL B;  3HZP A;  5IF6 A;  1GY6 A;  3FGY A;  1Q42 A;  1K41 A;  4HM2 B;  5KP3 A;  3VGN A;  4KVH A;  2BMR B;  1OCV A;  5BXQ A;  1A2K A;  1OPY A;  5CF2 A;  4HM1 B;  5CK6 A;  3NM2 A;  3OWS A;  3CNM A;  3GZR A;  3Q90 A;  1JN5 B;  4RZM A;  1JN5 A;  7STD A;  3F7S A;  3MKI A;  1JB4 A;  3GZY B;  4HKV B;  1O7P B;  1ZO2 A;  2Z7A A;  3UJM A;  3OXA A;  4ORL A;  5D83 A;  4XM4 A;  4STD A;  1DMN A;  3DZL A;  2BMQ B;  1OF5 B;  1TUH A;  1NU3 A;  3LZA A;  3RGR A;  1OF5 A;  3FLJ A;  2QIY A;  5IG5 A;  1ASK A;  2CHC A;  1W6Y A;  3JUN A;  1DMM A;  2I9W A;  3OWU A;  2UX0 A;  1ULJ B;  4MJD A;  3FZW A;  3DUK A;  2YFJ B;  2RGQ A;  2HML B;  4R1K A;  3KE7 A;  3GRD A;  3SOA A;  3JUM A;  1IDP A;  3CU3 A;  3OWY A;  4HVN A;  2YFI B;  4HJL B;  2GEY A;  3EJV A;  3FKA A;  3KKG A;  1NDO B;  4LGQ A;  2XRX B;  2F98 A;  1DMQ A;  1OHO A;  3SOY A;  1Z1S A;  4WWU C;  5AEU B;  1GYB A;  3DXO A;  4XDV A;  3A76 A;  1WQL B;  2GBX B;  1JB2 A;  2QGU A;  3JUQ A;  1ISK A;  4HM3 B;  4HM5 B;  4HM7 B;  3CNX A;  4HM4 B;  4PEJ A;  5AEW B;  3STD A;  2HMO B;  5AI1 A;  1VZZ A;  2IMJ A;  5CXO A;  4XBY A;  3GZB A;  5DRV A;  3ROB A;  5G2G A;  3ER7 A;  3F9S A;  4OUQ A;  5IG4 A;  1EG9 B;  5IER A;  3NUV A;  4L8P A;  2HMK B;  3GWR A;  3MG2 A;  2GEX A;  4J9A A;  3K0Z A;  3B4O A;  4X2H A;  4X2O A;  3JUO A;  4R9L A;  3H51 A;  3IPT A;  3UNL A;  3NXJ A;  1ZX2 A;  5HGR A;  2A15 A;  1CQS A;  3EN1 B;  3K7C A;  3HX8 A;  2BNG A;  1W00 A;  4IIA A;  2CKF B;  3EBT A;  2B24 B;  1W01 A;  5AII A;  1U5O A;  5IEN A;  5CLK A;  3F40 A;  1NWW A;  2OWP A;  4N3V A;  4FCM A;  2W2C A;  3MHE A;  1C7H A;  5TGN A;  1O7H B;  3T8U A;  2R4I A;  3DM8 A;  1O7M B;  3FF2 A;  1E3R A;  2RFR A;  1JKG B;  4XB5 A;  3B7C A;  1JKG A;  2F99 A;  1E97 A;  1STD A;  2XSH B;  5IEP A;  4HZB B;  5JPU A;  4K1U A;  1W02 A;  3NBR A;  4XDW A;  4WYK B;  3MSO A;  1GY5 A;  3FF0 A;  4WYK A;  5EVH A;  3SED A;  5AIF A;  3G8Z A;  3D9R A;  1O7N B;  2GXF A;  4WP5 A;  5IG3 A;  3EC9 A;  1S5A A;  4XBT A;  3MG3 A;  2PZV A;  1UUV B;  3E99 A;  3F14 A;  2F86 B;  4K1V A;  5IEO A;  3I0Y A;  3OV4 A;  5KP1 A;  2XSO B;  3JUP A;  1E3V A;  3M8C A;  4H3U A;  3OX9 A;  3ECF A;  2XR8 B;  3MYT A;  3KSP A;  3EN8 A;  1QMA A;  5JPP A;  1GS3 A;  4I4K A;  1OGZ A;  5FW5 A;  4L7K A;  4HM8 B;  3EX9 A;  2GBW B;  4U13 A;  1ULI B;  5DRE A;  1HKX A; 
#chains in the Genus database with same CATH topology
 2Z6B A;  1RN4 A;  1C54 A;  1I70 A;  3F8H A;  1BU4 A;  1DYU A;  1W2Z A;  1AR0 A;  1GMP A;  2D42 A;  1JZO A;  5D82 A;  4EV5 A;  1BUQ A;  3IJE B;  4QWT A;  2CX1 A;  3FSD A;  3WOD G;  1B21 A;  2K54 A;  1EEJ A;  1B2M A;  1KWI A;  4HAA A;  1VQ8 3;  5EEO A;  1BIR A;  3BLZ A;  5LC6 A;  1EA2 A;  8CHO A;  2IYJ A;  1JRQ A;  1MNL A;  1X1X A;  2UUG C;  4L8O A;  4NRE A;  3CCM 3;  1OGX A;  1YJ9 3;  2Q07 A;  3GAX A;  4XBX A;  1GMR A;  4GSP A;  4JRF A;  3PYJ A;  6GSP A;  3CCL 3;  4R9K A;  3U97 A;  2O9U X;  1B20 A;  3QK9 A;  3RGA A;  4O8S A;  4OVM A;  3B8L A;  1VQ9 3;  1TP6 A;  4N6M A;  1IQY A;  1QAK A;  2JQ5 A;  1U8C B;  2E2T A;  3ALA A;  4HZ9 B;  4LEH A;  3LYG A;  1BSA A;  1K9M 4;  3G16 A;  1QAL A;  1KQS 2;  4KFD A;  5CF1 A;  4Q53 A;  3SXX A;  5GSP A;  1LVN A;  1VQO 3;  4AKZ A;  5FGO A;  1V74 A;  3EQQ B;  1IV9 A;  3MG1 A;  4BL3 A;  5AIH A;  1A2P A;  1CH0 A;  1JNQ A;  2E2V A;  3NX0 A;  3PZW A;  1BNE A;  1UDI I;  1L5G B;  3KN4 A;  4BL2 A;  1RNT A;  1UI7 A;  3K5T A;  2L1S A;  5STD A;  1HU9 A;  3CME 3;  4J8T A;  1SAR A;  2BIR A;  2Z76 A;  3LTC A;  3CPW 2;  3KCH A;  3AHW A;  1GY7 A;  1RJO A;  1IQ8 A;  2BT3 A;  1IVV A;  1G96 A;  1I2F A;  1T3B A;  2E2U A;  2FGT A;  3H3H A;  3QRD A;  3X3Y A;  1US1 A;  2HMN B;  2CWT A;  4N6L A;  1KC8 4;  1LNH A;  1BRK A;  2XGL A;  1VQ7 3;  1RRL A;  1O7W B;  3FH1 A;  1JJ2 2;  1AVK A;  1CEW I;  3AGO A;  3B4P A;  3DGY A;  1O7G B;  3G6E 3;  2PNC A;  1WNH A;  4EYC A;  1M1K 4;  2XGN A;  1RGG A;  2HMM B;  4LMI A;  1D6Y A;  1TFK A;  2CWU A;  1KD1 4;  2P0X A;  2CWV A;  1Q7Y 4;  5IG0 A;  1OH0 A;  1JB5 A;  1OUN A;  1I3I A;  4HM6 B;  3CCJ 3;  3EBY A;  5KP4 A;  1YHQ 3;  2Y73 A;  3CPO A;  3PS8 A;  2CG0 A;  3RNT A;  1S72 3;  1X1U A;  5I97 A;  2INX A;  3G0K A;  1SJW A;  4N6N B;  2P09 A;  2OQE A;  2BMO B;  5ELU A;  1UUW B;  2GU3 A;  3NHX A;  2IY2 A;  1QJG A;  3A5E A;  1YJW 3;  3X40 A;  2H0G A;  4BIR A;  2FNQ A;  3NBB A;  1K73 4;  2Y74 A;  1UGH I;  2OOV C;  3DGM A;  3JVC A;  7GSP A;  3DMC A;  4OK0 A;  2B1X B;  2CFG A;  3VSY A;  1QVF 2;  3LXU X;  1BRS A;  3S27 A;  3GSP A;  1RDS A;  1B2S A;  3WMD A;  5D81 A;  1FUT A;  3LT8 A;  1W6G A;  1BSD A;  1UCL A;  3N9H A;  5EQL A;  2STD A;  1STF I;  3S5C A;  3EF8 A;  3SX1 A;  3GZX B;  1OHP A;  4MEI A;  1BVI A;  3T0U A;  1OHS A;  1I2E A;  3HI7 A;  3BB9 A;  2Z77 A;  3SLU A;  7RNT A;  1M9G A;  2F56 A;  2RCD A;  4GB5 A;  2CG1 A;  1DET A;  5AIG A;  3NV0 B;  1CYV A;  3KZT A;  3F8X A;  3DGL A;  3EHC A;  1IVU A;  1SIH A;  2L4V A;  3NV0 A;  2R41 A;  3G4S 3;  3WR2 A;  4HM0 B;  4CDL A;  1YVB I;  4RNY A;  2CC3 A;  3FG4 A;  1A2V A;  3T8N A;  3ZFZ A;  4FMD A;  1Q40 B;  3CCE 3;  2W9P A;  1JBR A;  4O2H A;  4H61 A;  1Q40 A;  2HMJ B;  3F7X A;  6STD A;  2OTL 3;  1BRI A;  3I56 3;  4FCJ A;  3HK4 A;  3EB8 A;  4ZM8 A;  3CC7 3;  3CCU 3;  1RGE A;  4O02 B;  5BVB A;  2YFL B;  3CD6 3;  1VQQ A;  2MF7 A;  1TJD A;  2KXG A;  9RNT A;  1BNJ A;  3HZP A;  5IF6 A;  3TDG A;  1RLS A;  1GY6 A;  1UUG B;  4MMZ B;  1RNB A;  3UL6 A;  4HBR A;  1ROV A;  3FGY A;  1Y4K A;  1Q42 A;  1K41 A;  2CFK A;  2CK3 H;  4IT7 A;  4HM2 B;  1VQL 3;  2P0M A;  4HOH A;  2ML5 A;  1IT8 A;  2WO0 A;  3BND A;  5KP3 A;  3VGN A;  2FXT A;  4KVH A;  1Q86 4;  2BMR B;  2QEX 3;  1OCV A;  5LC7 A;  2CIU A;  2H0H A;  5BXQ A;  1EQK A;  3WOE B;  1UCK A;  3S67 A;  2GU1 A;  1A2K A;  2KF5 A;  1TFO A;  3Q1C A;  3D5G A;  1LNI A;  1OPY A;  1D6U A;  1LXE A;  4HM1 B;  5CK6 A;  3NM2 A;  4FR9 A;  5CF2 A;  3G71 3;  3OWS A;  2F4Y A;  3CNM A;  1VQ4 3;  4AKY A;  3WDG B;  3GZR A;  1WMP A;  4LSO A;  3MWZ A;  4KFF A;  2WGO A;  1FGR A;  1RGK A;  2XH9 A;  1JN5 B;  3Q90 A;  3V98 A;  3CC4 3;  1W2B 2;  4RZM A;  3DY5 A;  2IUJ A;  3D5I A;  1SII A;  1TU5 A;  1JN5 A;  7STD A;  4RNT A;  3F7S A;  1CYU A;  1I0X A;  3MKI A;  1JB4 A;  1G02 A;  3X42 A;  1YIJ 3;  3GZY B;  4HKV B;  1O7P B;  1ZO2 A;  2SAR A;  2Z7A A;  1BRG A;  3UJM A;  3OXA A;  1FGM A;  3RDE A;  4ORL A;  3BNB A;  1BSB A;  2CX0 A;  2GSP A;  1N5P A;  2OQE C;  3LH4 A;  5D83 A;  2ZHX B;  3CCV 3;  4KT3 B;  4XM4 A;  2XFT A;  4STD A;  1DMN A;  3DZL A;  2BMQ B;  2F5W A;  4MMY B;  1OF5 B;  4EBG A;  1M1X B;  5G1K A;  1TUH A;  1GOU A;  2MC8 A;  3BIR A;  1NU3 A;  1RCK A;  3LZA A;  3NQZ A;  1QAF A;  1NB3 I;  3BNC A;  3RGR A;  4JF8 A;  1OF5 A;  3FLJ A;  1UW1 A;  1I8V A;  2QIY A;  3X3X A;  1VQ5 3;  5IG5 A;  2KAA A;  3CCQ 3;  1EKM A;  1YVS A;  1ASK A;  2CHC A;  6RNT A;  1W6Y A;  3D3L A;  4I5Q A;  4IPB A;  1VQK 3;  3IMA B;  3JUN A;  3DGN A;  1BUJ A;  1DMM A;  3CXC 2;  1X1Y A;  1YGE A;  4KZ1 A;  4CPK A;  1GD3 A;  1BNR A;  1LOX A;  1I0V A;  2I9W A;  3OWU A;  2KF6 A;  1BNS A;  1JV2 B;  1GMQ A;  1V57 A;  3BU4 A;  3N54 B;  2UX0 A;  1ULJ B;  2JDI H;  1IU7 A;  3PXM A;  3U1W A;  4MJD A;  2ZDJ A;  3FZW A;  1RHL A;  1RRH A;  2QA4 3;  3DUK A;  2SBL A;  2KRT A;  2YFJ B;  2RGQ A;  3LTD A;  2OTJ 3;  2HML B;  4R1K A;  3KE7 A;  3GRD A;  1GOV A;  2W6J H;  3SOA A;  3JUM A;  1IDP A;  1RGL A;  2AAE A;  3I55 3;  2ZL8 A;  3CU3 A;  3OWY A;  3WA2 X;  3AHS A;  5BU4 A;  1MWU A;  4FMC A;  5HOH A;  1A67 A;  2IA7 A;  2YFI B;  4HJL B;  4HVN A;  1IK3 A;  1W6C A;  1IVX A;  1DE3 A;  4CJN A;  2GEY A;  3EJV A;  1KSI A;  3LOY A;  3FKA A;  3KKG A;  1NDO B;  4LGQ A;  3UL5 A;  4O3V A;  4CCV A;  4EW5 A;  1PFP A;  2W03 A;  2K0M A;  2KF3 A;  2F98 A;  2XRX B;  1DMQ A;  5IW9 A;  1OHO A;  2O3O A;  1VQP 3;  1JZD A;  1R4Y A;  3SOY A;  3KSE D;  1Z1S A;  4WWU C;  5AEU B;  1GYB A;  2CFL A;  3DXO A;  4BTW A;  4XDV A;  1YJN 3;  3A76 A;  1B27 A;  3CC2 3;  1WQL B;  2GBX B;  1W7C A;  4FMA A;  1JB2 A;  1N9J A;  2IUK A;  2QGU A;  3JUQ A;  4N6O B;  1ISK A;  3DGO A;  3NBJ A;  4HM3 B;  4HM5 B;  4HM7 B;  1V58 A;  1FUW A;  3CNX A;  1FGQ A;  1MWT A;  1BGS A;  1I3F A;  4HM4 B;  1VQ6 3;  3BNE A;  1YIT 3;  1FA3 A;  4PEJ A;  5AEW B;  2J8X B;  3STD A;  1GD4 A;  2HMO B;  1W5Z A;  5AI1 A;  1VZZ A;  3NM7 A;  2IMJ A;  1VQN 3;  1IT7 A;  2BHM A;  5CXO A;  4XBY A;  3GZB A;  5DRV A;  1UI8 A;  3ROB A;  1YGW A;  5G2G A;  3ER7 A;  1Q9E A;  1TIJ A;  3Q2P A;  3AMO B;  1LOY A;  1N5H A;  3F9S A;  4OUQ A;  4J5G A;  1BRH A;  4BTY A;  1Q82 4;  1B3S A;  5IG4 A;  1EG9 B;  1T2H A;  5IER A;  3AMO A;  4N6U A;  3NUV A;  1RGF A;  4N6T A;  4WP5 A;  2F5M A;  4L8P A;  1BNI A;  4BTX A;  1LOW A;  1DVD A;  4R80 A;  2HMK B;  3GWR A;  1R4C A;  3MG2 A;  2GEX A;  5A0O B;  1IV7 A;  1OAC A;  2W04 A;  4J9A A;  3K0Z A;  5RNT A;  2RSX A;  1LRA A;  1MWS A;  5ELJ A;  1RGC A;  1BNG A;  3B4O A;  4X2H A;  2LYX A;  4X2O A;  3AGN A;  3JUO A;  4NHF A;  5G1L A;  4R9L A;  4KFE A;  1AY7 A;  4EXR A;  1N8R 4;  4K61 A;  3H51 A;  1BAN A;  2RBI A;  1X1W A;  4LYL B;  1FYS A;  1WTH A;  3IPT A;  1G0T A;  4TX4 A;  3UNL A;  3NXJ A;  2LQV A;  5JBS A;  1ZX2 A;  1YI2 3;  2WOH A;  5HGR A;  1MGR A;  2A15 A;  2P05 A;  3O8Y A;  1CQS A;  3S28 A;  1T2I A;  3EN1 B;  3WOF B;  1W4N A;  3SYU A;  3K7C A;  3HOH A;  1BNF A;  3HX8 A;  4FCZ A;  2WGQ A;  1LQG C;  1NB5 I;  2BNG A;  4RNZ A;  1RN7 A;  1W00 A;  3PCS A;  4J5K A;  3L0R A;  4IIA A;  2CKF B;  3NQY A;  3D79 A;  3EBT A;  2W0Q A;  4EV2 A;  3URP A;  3FCS B;  2B24 B;  1TRQ A;  1B2U A;  1W01 A;  2W56 B;  1PYL A;  5AII A;  1U5O A;  5AYR B;  1F8N A;  3VF1 A;  5IEN A;  3PCR A;  5CLK A;  2W56 A;  3F40 A;  4G1M B;  1JBS A;  1BRN L;  1A90 A;  1FZU A;  3ZG0 A;  1NJI 4;  3KFQ C;  2P38 A;  1K8A 4;  1FGT A;  2CFD A;  4R4K A;  1MGW A;  1MWR A;  1RN1 A;  2XEP A;  1FGO A;  1NWW A;  2OWP A;  3Q3F A;  2RNT A;  4N3V A;  4WFO A;  4FCM A;  1IQX A;  2C11 A;  3LTB A;  1TTO A;  4AEQ A;  3CCR 3;  2HOH A;  2W2C A;  3WHO A;  1BSC A;  2W9Q A;  1NNV A;  1RCL A;  5BIR A;  3MHE A;  2C4B A;  3J7Y d;  3CMA 3;  2D1W A;  1C7H A;  4N6V 0;  3FG3 A;  5TGN A;  1O7H B;  3T8U A;  2R4I A;  1AV4 A;  3DM8 A;  3V99 A;  2K3D A;  1O7M B;  3FF2 A;  3X41 A;  1I2G A;  1GOY A;  1E3R A;  4DKI A;  1BOX A;  1PY3 A;  1PU4 A;  2RFR A;  1JKG B;  1T5Y A;  4XB5 A;  3B7C A;  2YX9 A;  1JKG A;  2XF3 A;  3EE1 A;  3MPH A;  2F99 A;  2V1L A;  1M90 4;  1J2B A;  1E97 A;  1HZ1 A;  1STD A;  2XSH B;  5IEP A;  4HZB B;  3WA3 A;  2UGI A;  1B2X A;  1N9E A;  1RGH A;  4LZI A;  1RGA A;  5JPU A;  3V92 A;  1WMN A;  1VQM 3;  4K1U A;  1FW7 A;  2C10 A;  1W02 A;  3NBR A;  2CH9 A;  2CFW A;  4WYK B;  2H0I A;  4XDW A;  1N8Q A;  3MSO A;  1WMO A;  1GY5 A;  2ML6 A;  3HIG A;  3FF0 A;  4WYK A;  1IVW A;  5EVH A;  3SED A;  1RKY A;  1QVG 2;  1RSN A;  1BAO A;  2KF4 A;  1MOL A;  1AVL A;  5AIF A;  2OCT A;  4EC6 A;  3OW2 2;  3G8Z A;  1LQM B;  4BU4 A;  1EUI C;  1UGI A;  3D9R A;  1GSP A;  1LOV A;  1O7N B;  2GXF A;  1HYF A;  1ZGX A;  3K63 A;  2XFS A;  3K9M C;  4FMB A;  5IG3 A;  5AYS C;  4WHA A;  3FG1 A;  4GHO A;  1SPU A;  3EC9 A;  1D6Z A;  1S5A A;  3CCS 3;  4XBT A;  3MG3 A;  2PZV A;  1UUV B;  3E99 A;  2CW9 A;  2KCD A;  1FUS A;  1RTU A;  2WOF A;  3F14 A;  2F86 B;  5M1A A;  4K90 B;  4K1V A;  5M19 A;  5IEO A;  3I0Y A;  3OV4 A;  2BO9 B;  2ZA4 A;  1YNV X;  3LML A;  3LT9 A;  3LTA A;  3S29 A;  5KP1 A;  3X3Z A;  2XSO B;  3JUP A;  1ZS7 A;  1E3V A;  3M8C A;  4RBN A;  4H3U A;  3OX9 A;  8RNT A;  5DRE A;  1DVC A;  3ECF A;  1SQW A;  1BSE A;  4ILF A;  2OOV A;  2M7O A;  2XR8 B;  3D4A A;  1UCJ A;  3EN8 A;  1QMA A;  2BU4 A;  3KSP A;  3MYT A;  5JPP A;  1GS3 A;  1TRP A;  1RMS A;  4GL6 A;  1NO3 A;  1UCI A;  3KII A;  4I4K A;  1OGZ A;  5FW5 A;  4L7K A;  4HM8 B;  1BRJ A;  1K28 A;  4HYZ A;  2AAD A;  3UB1 A;  4MMX B;  2GBW B;  1B2Z A;  3HII A;  3DH2 A;  3PGB A;  4NPB A;  4U13 A;  3SVA A;  1Q7H A;  1ULI B;  5M18 A;  1AQZ A;  1ROA A;  3N8B A;  1Q81 4;  3ZG5 A;  3EX9 A;  1IYY A;  1HKX A;  1JBT A; 
#chains in the Genus database with same CATH homology
 2Z6B A;  3F8H A;  1DYU A;  1W2Z A;  1AR0 A;  2D42 A;  5D82 A;  4EV5 A;  1BUQ A;  3IJE B;  4QWT A;  3FSD A;  3WOD G;  2K54 A;  1KWI A;  1VQ8 3;  5EEO A;  5LC6 A;  3BLZ A;  1EA2 A;  8CHO A;  1JRQ A;  1MNL A;  4L8O A;  4NRE A;  3CCM 3;  1OGX A;  1YJ9 3;  2Q07 A;  3GAX A;  4XBX A;  4JRF A;  3PYJ A;  3CCL 3;  4R9K A;  3U97 A;  2O9U X;  3QK9 A;  3RGA A;  4O8S A;  4OVM A;  3B8L A;  1VQ9 3;  1TP6 A;  4N6M A;  1IQY A;  1QAK A;  2JQ5 A;  1U8C B;  2E2T A;  3ALA A;  4HZ9 B;  4LEH A;  3LYG A;  1K9M 4;  3G16 A;  1QAL A;  1KQS 2;  4KFD A;  5CF1 A;  4Q53 A;  3SXX A;  1VQO 3;  1LVN A;  4AKZ A;  5FGO A;  1V74 A;  3EQQ B;  1IV9 A;  3MG1 A;  5AIH A;  1JNQ A;  2E2V A;  3NX0 A;  3PZW A;  1L5G B;  3KN4 A;  1UI7 A;  3K5T A;  5STD A;  1HU9 A;  3CME 3;  4J8T A;  2Z76 A;  3LTC A;  3CPW 2;  1GY7 A;  1RJO A;  1IQ8 A;  2FGT A;  2BT3 A;  1IVV A;  1G96 A;  2E2U A;  3QRD A;  3H3H A;  1KC8 4;  3X3Y A;  1US1 A;  2HMN B;  2CWT A;  4N6L A;  1LNH A;  2XGL A;  1VQ7 3;  1RRL A;  1O7W B;  3FH1 A;  1JJ2 2;  1AVK A;  1CEW I;  3B4P A;  3G6E 3;  1O7G B;  2PNC A;  1WNH A;  4EYC A;  1M1K 4;  2XGN A;  4LMI A;  2HMM B;  1D6Y A;  1TFK A;  2CWU A;  1KD1 4;  2P0X A;  2CWV A;  1Q7Y 4;  5IG0 A;  1OH0 A;  1JB5 A;  1OUN A;  3CCJ 3;  4HM6 B;  1YHQ 3;  3EBY A;  5KP4 A;  2Y73 A;  3CPO A;  3PS8 A;  2CG0 A;  1S72 3;  5I97 A;  2INX A;  3G0K A;  1SJW A;  4N6N B;  2P09 A;  2OQE A;  2BMO B;  5ELU A;  1UUW B;  2GU3 A;  3NHX A;  1QJG A;  1YJW 3;  3X40 A;  2FNQ A;  3NBB A;  1K73 4;  2Y74 A;  2OOV C;  3DGM A;  3JVC A;  3DMC A;  4OK0 A;  2B1X B;  2CFG A;  3VSY A;  1QVF 2;  3LXU X;  3S27 A;  3WMD A;  5D81 A;  3LT8 A;  1W6G A;  3N9H A;  5EQL A;  2STD A;  1STF I;  3S5C A;  3EF8 A;  3SX1 A;  3GZX B;  1OHP A;  4MEI A;  3T0U A;  1OHS A;  3HI7 A;  3BB9 A;  2Z77 A;  3SLU A;  1M9G A;  2RCD A;  4GB5 A;  2CG1 A;  5AIG A;  3NV0 B;  1CYV A;  3KZT A;  3F8X A;  3DGL A;  3EHC A;  1IVU A;  1SIH A;  2L4V A;  3NV0 A;  3G4S 3;  4HM0 B;  4CDL A;  1YVB I;  4RNY A;  2CC3 A;  3FG4 A;  1A2V A;  3T8N A;  4FMD A;  1Q40 B;  3CCE 3;  2W9P A;  4O2H A;  4H61 A;  1Q40 A;  2HMJ B;  3F7X A;  6STD A;  2OTL 3;  3I56 3;  4FCJ A;  3HK4 A;  3EB8 A;  4ZM8 A;  3CC7 3;  3CCU 3;  4O02 B;  5BVB A;  2YFL B;  2MF7 A;  2KXG A;  3HZP A;  5IF6 A;  3TDG A;  1GY6 A;  4MMZ B;  3UL6 A;  4HBR A;  1ROV A;  3FGY A;  1Y4K A;  1Q42 A;  1K41 A;  2CFK A;  2CK3 H;  4IT7 A;  4HM2 B;  1VQL 3;  2P0M A;  2ML5 A;  1IT8 A;  2WO0 A;  3BND A;  5KP3 A;  3VGN A;  2FXT A;  4KVH A;  1Q86 4;  2BMR B;  2QEX 3;  1OCV A;  5LC7 A;  2CIU A;  5BXQ A;  1EQK A;  3WOE B;  3S67 A;  2GU1 A;  1A2K A;  1TFO A;  3Q1C A;  1OPY A;  5CF2 A;  1D6U A;  1LXE A;  4HM1 B;  5CK6 A;  3NM2 A;  4FR9 A;  3G71 3;  3OWS A;  3CNM A;  1VQ4 3;  4AKY A;  3WDG B;  3GZR A;  1WMP A;  4LSO A;  3MWZ A;  4KFF A;  2WGO A;  1FGR A;  2XH9 A;  1JN5 B;  3Q90 A;  3V98 A;  1W2B 2;  4RZM A;  3DY5 A;  2IUJ A;  1SII A;  1TU5 A;  1JN5 A;  7STD A;  3F7S A;  1CYU A;  3MKI A;  1JB4 A;  3X42 A;  1YIJ 3;  3GZY B;  4HKV B;  1O7P B;  1ZO2 A;  2Z7A A;  3UJM A;  3OXA A;  1FGM A;  3RDE A;  4ORL A;  3BNB A;  1N5P A;  2OQE C;  3LH4 A;  5D83 A;  3CCV 3;  4XM4 A;  2XFT A;  4STD A;  1DMN A;  3DZL A;  2BMQ B;  4MMY B;  1OF5 B;  4EBG A;  1M1X B;  1TUH A;  3CD6 3;  2MC8 A;  1NU3 A;  3LZA A;  3NQZ A;  1QAF A;  1NB3 I;  3BNC A;  3RGR A;  4JF8 A;  1OF5 A;  3FLJ A;  1UW1 A;  2QIY A;  3X3X A;  1VQ5 3;  5IG5 A;  3CCQ 3;  1EKM A;  1ASK A;  2CHC A;  1W6Y A;  3D3L A;  4IPB A;  1VQK 3;  3IMA B;  3JUN A;  3DGN A;  1DMM A;  3CXC 2;  1YGE A;  4KZ1 A;  1GD3 A;  1LOX A;  2I9W A;  3OWU A;  1JV2 B;  3N54 B;  2UX0 A;  1ULJ B;  2JDI H;  1IU7 A;  3PXM A;  3U1W A;  4MJD A;  2ZDJ A;  3FZW A;  2QA4 3;  1RRH A;  3DUK A;  2SBL A;  2KRT A;  2YFJ B;  2RGQ A;  3LTD A;  2OTJ 3;  2HML B;  4R1K A;  3KE7 A;  3GRD A;  2W6J H;  3SOA A;  3JUM A;  1IDP A;  3I55 3;  2ZL8 A;  3CU3 A;  3OWY A;  3WA2 X;  1A67 A;  4FMC A;  2IA7 A;  2YFI B;  4HJL B;  4HVN A;  1IK3 A;  1W6C A;  1IVX A;  2GEY A;  3EJV A;  1KSI A;  3LOY A;  3FKA A;  3KKG A;  1NDO B;  4LGQ A;  3UL5 A;  4O3V A;  4CCV A;  1PFP A;  2W03 A;  2K0M A;  2XRX B;  2F98 A;  5IW9 A;  1DMQ A;  1VQP 3;  1OHO A;  2O3O A;  3SOY A;  3KSE D;  1Z1S A;  4WWU C;  5AEU B;  1GYB A;  2CFL A;  3DXO A;  4BTW A;  4XDV A;  1YJN 3;  3A76 A;  3CC2 3;  1WQL B;  2GBX B;  1W7C A;  4FMA A;  1JB2 A;  1N9J A;  2IUK A;  2QGU A;  3JUQ A;  4N6O B;  1ISK A;  3DGO A;  3NBJ A;  4HM3 B;  4HM5 B;  4HM7 B;  1FUW A;  3CNX A;  1FGQ A;  4HM4 B;  1VQ6 3;  3BNE A;  1YIT 3;  1FA3 A;  4PEJ A;  5AEW B;  3STD A;  1GD4 A;  2HMO B;  1W5Z A;  5AI1 A;  1VZZ A;  3NM7 A;  2IMJ A;  1VQN 3;  1IT7 A;  2BHM A;  5CXO A;  4XBY A;  3GZB A;  5DRV A;  1UI8 A;  3ROB A;  5G2G A;  3ER7 A;  1TIJ A;  3Q2P A;  3AMO B;  1N5H A;  3F9S A;  4OUQ A;  1Q82 4;  4BTY A;  5IG4 A;  1EG9 B;  5IER A;  3AMO A;  4N6U A;  3NUV A;  4N6T A;  4L8P A;  4BTX A;  1DVD A;  4R80 A;  2HMK B;  3GWR A;  1R4C A;  3MG2 A;  2GEX A;  5A0O B;  1IV7 A;  1OAC A;  2W04 A;  4J9A A;  3K0Z A;  2RSX A;  5ELJ A;  3B4O A;  4X2H A;  2LYX A;  4X2O A;  3JUO A;  4NHF A;  4R9L A;  4KFE A;  4EXR A;  1N8R 4;  4K61 A;  3H51 A;  1WTH A;  3IPT A;  4TX4 A;  1YI2 3;  3UNL A;  3NXJ A;  2LQV A;  5JBS A;  1ZX2 A;  2WOH A;  5HGR A;  2A15 A;  2P05 A;  3O8Y A;  1CQS A;  3S28 A;  3WOF B;  3EN1 B;  1W4N A;  3K7C A;  3HX8 A;  4FCZ A;  2WGQ A;  1NB5 I;  2BNG A;  4RNZ A;  1RN7 A;  1W00 A;  3PCS A;  3L0R A;  4IIA A;  2CKF B;  3NQY A;  3EBT A;  2W0Q A;  4EV2 A;  3FCS B;  2B24 B;  1W01 A;  2W56 B;  5AII A;  1U5O A;  5AYR B;  1F8N A;  3VF1 A;  5IEN A;  3PCR A;  5CLK A;  2W56 A;  3F40 A;  4G1M B;  1A90 A;  1NJI 4;  3KFQ C;  2P38 A;  1K8A 4;  1FGT A;  2CFD A;  4R4K A;  2XEP A;  1FGO A;  1NWW A;  2OWP A;  4N3V A;  4WFO A;  4FCM A;  1IQX A;  2C11 A;  3LTB A;  4AEQ A;  3CCR 3;  2W2C A;  2W9Q A;  3MHE A;  3J7Y d;  3CMA 3;  2D1W A;  1C7H A;  4N6V 0;  3FG3 A;  5TGN A;  1O7H B;  3T8U A;  2R4I A;  1AV4 A;  3DM8 A;  3V99 A;  1O7M B;  3FF2 A;  3X41 A;  1E3R A;  1PU4 A;  2RFR A;  1JKG B;  1T5Y A;  4XB5 A;  3B7C A;  2YX9 A;  1JKG A;  2XF3 A;  3EE1 A;  3MPH A;  2F99 A;  2V1L A;  1M90 4;  1J2B A;  1E97 A;  1STD A;  2XSH B;  5IEP A;  4HZB B;  3WA3 A;  1N9E A;  4LZI A;  5JPU A;  3V92 A;  1WMN A;  1VQM 3;  4K1U A;  2C10 A;  1W02 A;  3NBR A;  2CH9 A;  2CFW A;  4WYK B;  4XDW A;  1N8Q A;  3MSO A;  1WMO A;  1GY5 A;  2ML6 A;  3HIG A;  3FF0 A;  4WYK A;  1IVW A;  5EVH A;  3SED A;  1RKY A;  1QVG 2;  1MOL A;  1AVL A;  5AIF A;  2OCT A;  4EC6 A;  3OW2 2;  3G8Z A;  3D9R A;  3K63 A;  1O7N B;  2GXF A;  3K9M C;  4WP5 A;  3CC4 3;  2XFS A;  4FMB A;  5IG3 A;  5AYS C;  4WHA A;  3FG1 A;  1SPU A;  3EC9 A;  1D6Z A;  1S5A A;  3CCS 3;  4XBT A;  3MG3 A;  2PZV A;  1UUV B;  3E99 A;  2CW9 A;  2KCD A;  2WOF A;  3F14 A;  2F86 B;  4K90 B;  4K1V A;  5IEO A;  3I0Y A;  3OV4 A;  2BO9 B;  3LML A;  3LT9 A;  3S29 A;  3LTA A;  5KP1 A;  3X3Z A;  2XSO B;  3JUP A;  1E3V A;  3M8C A;  4RBN A;  4H3U A;  3OX9 A;  5DRE A;  1DVC A;  3ECF A;  1SQW A;  2OOV A;  2M7O A;  2XR8 B;  3MYT A;  3KSP A;  3EN8 A;  1QMA A;  5JPP A;  1GS3 A;  4GL6 A;  1NO3 A;  4I4K A;  3KII A;  1OGZ A;  5FW5 A;  4L7K A;  4HM8 B;  1K28 A;  4HYZ A;  3UB1 A;  4MMX B;  2GBW B;  3HII A;  3SVA A;  3PGB A;  4U13 A;  1ULI B;  1ROA A;  3N8B A;  1Q81 4;  3EX9 A;  1HKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...