1EA2A

Pseudoreversion of the catalytic activity of y14f by the additional tyrosine-to-phenylalanine substitution(s) in the hydrogen bond network of delta-5-3-ketosteroid isomerase from pheudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Pseudoreversion of the Catalytic Activity of Y14F by the Additional Substitution(S) of Tyrosine with Phenylalanine in the Hydrogen Bond Network of Delta (5)-3-Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ea2A00
4OUQA 5IF6A 2QIYA 3DMCA 5JPPA 1OHOA 4RZMA 2INXA 5BVBA 1OH0A 1OCVA 5AEWB 1NU3A 4N3VA 4HM3B 5AIFA 1Z1SA 4XBTA 3DZLA 3JUOA 1EG9B 5IENA 4L7KA 1Q42A 1JB5A 2XRXB 3EF8A 2QGUA 2BNGA 1UUVB 3FGYA 2HMKB 3EQQB 3VSYA 4HM8B 1GS3A 2B1XB 3VGNA 4HM5B 2A15A 3EJVA 2CHCA 4J9AA 2Z7AA 3FSDA 3KZTA 2GEXA 3ROBA 5BXQA 3ER7A 4L8PA 3DXOA 4LMIA 5AEUB 1W6YA 4WP5A 4HM2B 2RCDA 3JUNA 3GRDA 3MG2A 2GBWB 3F40A 1JB4A 2GBXB 4FCMA 3OV4A 5CXOA 2GEYA 3F14A 3DUKA 2HMMB 3B8LA 3EHCA 5AIHA 3CU3A 1NDOB 5IEPA 3CPOA 5DRVA 3UNLA 1E3VA 2HMNB 5KP4A 3LYGA 1CQSA 3NUVA 2BMQB 1GY6A 1ULJB 1O7HB 3BB9A 1Q40A 4MJDA 5IG4A 3FH1A 2W2CA 1U5OA 4WYKA 3T8NA 5IERA 1ZO2A 3GZYB 1E97A 2XSOB 3GZXB 4HVNA 1STDA 2HMLB 1OGXA 1JB2A 1ISKA 1GY5A 3Q90A 1IDPA 3GZRA 5KP1A 3A76A 1O7NB 1DMQA 2F98A 5CF2A 4HZ9B 3MG3A 1Q40B 2UX0A 5DREA 4WYKB 4U13A 2JQ5A 3NHXA 3EN8A 1VZZA 1JN5A 5STDA 3MHEA 4HM4B 2BMRB 1NWWA 1GYBA 3FLJA 1QMAA 5D81A 1AR0A 3CNMA 1OHSA 4I4KA 3UJMA 4R1KA 2IMJA 2R4IA 6STDA 3F8XA 3EN1B 3NBRA 3G16A 5IG0A 3K7CA 3I0YA 3SOYA 1W00A 1JN5B 2CKFB 2RGQA 2GXFA 3JUPA 3B7CA 1DMNA 5AI1A 1ZX2A 5IG5A 3KKGA 4HM1B 3FF0A 3JUMA 4PEJA 3B4PA 5JPUA 2BMOB 4XBXA 1TUHA 4WWUC 3LZAA 3HX8A 3OWYA 1A2KA 3GZBA 3KE7A 3NM2A 4K1VA 3G0KA 1O7WB 4R9LA 4XM4A 2XSHB 3S5CA 3GWRA 4FCJA 4H3UA 1BUQA 5FW5A 3OXAA 5D83A 5EVHA 4K1UA 4ORLA 5KP3A 3H51A 3F7SA 3G8ZA 3NV0A 3B4OA 4HZBB 4LEHA 1O7PB 2YFLB 3OX9A 3FF2A 1S5AA 5IG3A 1HKXA 2Z76A 3F7XA 3HK4A 2XR8B 3EBYA 2HMJB 5CK6A 1C7HA 1UUWB 3OWSA 3DM8A 3EX9A 2YFIB 8CHOA 1OGZA 3K0ZA 3NV0B 5CLKA 4OVMA 1O7GB 3MYTA 2F99A 4X2HA 3FKAA 3E99A 3CNXA 3RGAA 2I9WA 5AIGA 4HM0B 1OUNA 7STDA 1W01A 1W02A 5IEOA 1JKGA 3KSPA 4HM7B 3T8UA 4CDLA 3EBTA 1QJGA 1OPYA 1OHPA 1ULIB 3STDA 4XDWA 5G2GA 3EC9A 2PZVA 1TP6A 4STDA 2RFRA 4L8OA 5AIIA 3F9SA 1SJWA 3M8CA 1WQLB 1JKGB 3NXJA 5D82A 4LGQA 4HKVB 3MKIA 4XB5A 3OWUA 5HGRA 5TGNA 2F86B 2Z77A 1K41A 3IPTA 4KVHA 2B24B 1O7MB 1E3RA 1OF5A 3H3HA 5CF1A 2OWPA 1DMMA 2HMOB 4IIAA 3ECFA 4HM6B 1ASKA 4X2OA 4XBYA 3BLZA 4GB5A 1EA2A 3D9RA 4R9KA 3MSOA 3F8HA 4J8TA 2YFJB 1OF5B 2K54A 3JUQA 4Q53A 3FZWA 2STDA 3MG1A 1GY7A 3RGRA 4HJLB 3HZPA 4XDVA 3SEDA 3SOAA 3WMDA
chains in the Genus database with same CATH superfamily
1LQGC 4OUQA 1ZGXA 5IF6A 1SIHA 3DGNA 1RRHA 1B20A 1LOVA 2JDIH 2QIYA 1IYYA 3DMCA 1BVIA 3ZG5A 4K61A 2IYJA 2K3DA 5JPPA 1BRNL 1OHOA 4JRFA 3S28A 4RZMA 1RNTA 1YJN3 2KAAA 1QAKA 3BNBA 2INXA 5BVBA 1OH0A 5EEOA 1W2B2 1IQYA 1YVBI 3WOFB 1V74A 1OCVA 1C54A 1RSNA 2HOHA 5AEWB 1NU3A 3U1WA 1BIRA 4G1MB 2CC3A 1LXEA 1MWRA 4HM3B 3PCRA 4N3VA 5LC7A 2FGTA 2P0MA 5AIFA 3D4AA 2Z6BA 3NM7A 1V58A 1VQ73 1Z1SA 3GSPA 3DGLA 4EV2A 2KXGA 3CC43 2XFSA 2W0QA 1N8R4 4XBTA 3Q1CA 1N9JA 1M904 2W03A 4WFOA 1DVCA 3MWZA 2ZA4A 3WA2X 3CCL3 3DZLA 3JUOA 1EG9B 1TIJA 2LQVA 4HAAA 3SVAA 5IENA 4L7KA 1Q42A 1QAFA 3K63A 4FMDA 5RNTA 1KSIA 2WO0A 1S723 1JB5A 2XRXB 1IT7A 4N6LA 1IV7A 3EF8A 2QGUA 3KFQC 1BSEA 3KCHA 3HIIA 1VQL3 2BNGA 5ELUA 2CFLA 4BIRA 1UUVB 2SBLA 1EKMA 2KCDA 1W7CA 3FGYA 1YGWA 1R4CA 1LNIA 1MGRA 4N6MA 1DVDA 2HMKB 1GMRA 2CIUA 2H0IA 3LH4A 3LT8A 3EQQB 3VSYA 4HM8B 1RGEA 1VQ63 1X1YA 3PYJA 1GS3A 2F5WA 1Q864 4CJNA 1ZS7A 2B1XB 3VGNA 4BL3A 2XEPA 4HM5B 1RCKA 2A15A 3EJVA 1B2XA 4RBNA 2CHCA 1A90A 4J9AA 2CFKA 2Z7AA 3FSDA 1RLSA 3KZTA 2GEXA 3X40A 4AKZA 2AADA 2CFWA 1KQS2 3WODG 4FR9A 1YVSA 3ROBA 5BXQA 1PY3A 1DE3A 3EE1A 4EV5A 3ER7A 5M19A 5M1AA 1FYSA 2W56A 3SLUA 4L8PA 3CPW2 3DXOA 2SARA 1EUIC 1BSBA 4LMIA 1PFPA 5AEUB 1W6YA 4EC6A 3CXC2 5AYRB 1UDII 1WMNA 4WP5A 1VQ93 4HM2B 2RCDA 3JUNA 3LXUX 1JRQA 5ELJA 4O02B 4AEQA 1RTUA 3CME3 3GRDA 3MG2A 1IVUA 1M1XB 3QRDA 2GBWB 3BNDA 3F40A 1JB4A 4TX4A 2GBXB 4FCMA 3CCE3 3OV4A 1ROVA 1RJOA 5CXOA 3FG1A 5FGOA 2GEYA 4FMAA 1B21A 3F14A 1GSPA 3NQYA 3V99A 1FGQA 3DUKA 1BNRA 2HMMB 4N6UA 3SYUA 1TRPA 3WR2A 2QEX3 3B8LA 3EHCA 2P38A 4ILFA 3CC73 1SPUA 2IA7A 5AIHA 3CU3A 2W56B 1LNHA 1NDOB 5IEPA 1CH0A 3CPOA 1K734 1GD4A 3CCR3 1JZDA 1GD3A 5DRVA 2WGOA 3UNLA 1E3VA 2HMNB 5KP4A 3LYGA 1CQSA 2CWUA 3AGNA 1BRIA 3NUVA 2W9QA 2OQEC 2BMQB 4J5KA 1GY6A 1ULJB 1O7HB 2YX9A 3BB9A 4O3VA 1I0VA 1Q40A 1IU7A 1YGEA 3X41A 4MJDA 5IG4A 3A5EA 3FH1A 2W2CA 1U5OA 2CWVA 4MMXB 1VQO3 4WYKA 3PCSA 3T8NA 5IERA 4IT7A 7GSPA 1ZO2A 1IQXA 5BIRA 1W2ZA 2CX1A 2V1LA 3GZYB 3NX0A 2OCTA 1BRGA 1AY7A 4EYCA 2IUJA 3CD63 5EQLA 1JBRA 1A2VA 1E97A 2XSOB 1LOWA 3GZXB 1LQMB 1RN4A 1EEJA 4HVNA 1STDA 1BSCA 2HMLB 3Q2PA 1FUWA 2GSPA 1OGXA 1I2EA 3QK9A 4KT3B 1X1XA 1JB2A 1IVXA 3ALAA 1ISKA 1GY5A 1BRHA 1IDPA 3GZRA 2ML5A 3Q90A 3G713 1Q814 1QALA 4LYLB 5KP1A 1B2SA 3A76A 3TDGA 1O7NB 4N6V0 4O8SA 1KD14 1I3FA 5LC6A 5BU4A 5JBSA 3BU4A 1RGCA 1BNJA 1DMQA 3LMLA 2F98A 5CF2A 4HZ9B 1TFOA 1RGFA 2KF6A 1Q40B 3MG3A 1YIT3 2W04A 1W6CA 1Q9EA 2UX0A 4O2HA 5G1KA 5A0OB 2KF3A 5DREA 2H0GA 2L1SA 3PS8A 2BO9B 4WYKB 4U13A 2JQ5A 3RNTA 4KFDA 2GU3A 3NHXA 3EN8A 1U8CB 4RNZA 1VZZA 2CFGA 1VQP3 1JN5A 1IV9A 1WMOA 1HZ1A 5STDA 3MHEA 1GOYA 4KZ1A 4HM4B 4NPBA 2BMRB 1NWWA 4AKYA 4QWTA 1GYBA 3FLJA 4N6OB 2BHMA 4CCVA 1QMAA 5D81A 4ZM8A 1G96A 5AYSC 1AR0A 1GOVA 1DETA 2Y73A 1VQQA 1RHLA 3CNMA 3T0UA 1OHSA 4I4KA 4N6TA 3UJMA 3NQZA 4R1KA 3PZWA 1LOXA 2OQEA 2FXTA 2IMJA 2R4IA 1PYLA 3BNEA 1GOUA 2F56A 6STDA 1IT8A 1I2FA 1G02A 1M9GA 3EN1B 3F8XA 1G0TA 3NBRA 4NREA 3G16A 2ZDJA 2L4VA 3N8BA 5IG0A 2H0HA 1JBTA 1IQ8A 1HYFA 3L0RA 3SX1A 3K7CA 4HOHA 3I0YA 2OOVC 3SOYA 1MOLA 1W00A 1JN5B 1RGLA 2E2VA 2CKFB 2RGQA 1FZUA 2MC8A 1W5ZA 1BAOA 1TRQA 3HI7A 3D3LA 1MWUA 3DY5A 3N54B 3WDGB 1YNVX 4GL6A 4RNTA 3X42A 1MGWA 2GXFA 6RNTA 3DGOA 3JUPA 3B7CA 3CC23 1AQZA 1T2HA 1DMNA 1BU4A 1ZX2A 1AVKA 2RBIA 3MPHA 5AI1A 2W6JH 1OACA 3I553 2Y74A 5IG5A 2CG0A 3KKGA 4HM1B 3LTCA 1K9M4 3CCJ3 3LTBA 2P09A 3FF0A 3JUMA 3CCU3 4PEJA 1VQM3 3B4PA 5JPUA 2WOFA 2D1WA 2BMOB 2BIRA 2KF5A 1W6GA 4XBXA 2E2TA 1TUHA 1I70A 3KSED 4WWUC 3CCM3 1X1UA 3HIGA 3LZAA 3S27A 3HX8A 1IK3A 3OWYA 1JZOA 1TFKA 1A2KA 3GZBA 2FNQA 2K0MA 3AHSA 4KFEA 1F8NA 3KE7A 2D42A 3LTAA 1RDSA 3NM2A 4K1VA 3G0KA 1MNLA 1WMPA 1BOXA 4RNYA 1B27A 1O7WB 4R9LA 4XM4A 3GAXA 1B3SA 2RNTA 1NB5I 1BNEA 1FGMA 2XSHB 1KC84 3S5CA 6GSPA 2M7OA 3GWRA 4FCJA 4MMZB 5I97A 1N5PA 4OK0A 1RGGA 4GSPA 4H3UA 3J7Yd 3PGBA 1BUQA 5FW5A 4R80A 1FGRA 1BRSA 1N8QA 4JF8A 3OXAA 2UUGC 2W9PA 5D83A 4N6NB 5EVHA 4K1UA 4ORLA 2CWTA 3H51A 1NB3I 5KP3A 2OTL3 3F7SA 3G8ZA 3OW22 3NV0A 3B4OA 1KWIA 3WHOA 4HZBB 4LEHA 1O7PB 1NO3A 2Q07A 2YFLB 3Q3FA 4BU4A 8RNTA 1EQKA 3OX9A 3PXMA 1B2UA 1BSAA 2UGIA 2OOVA 3FF2A 1D6ZA 2ZHXB 1BNGA 4LZIA 3X3XA 1S5AA 3O8YA 4WHAA 1R4YA 5IG3A 1RNBA 1HKXA 2KF4A 1CEWI 7RNTA 1RRLA 4K90B 3JVCA 1K8A4 2XGLA 1TTOA 3V98A 3IJEB 2Z76A 1BNIA 3F7XA 3HK4A 2XFTA 3V92A 1D6UA 1UUGB 1BNFA 1UI7A 2XR8B 3HOHA 3EBYA 1FGTA 4EXRA 2OTJ3 1T3BA 1VQ83 2HMJB 5CK6A 1C7HA 1UUWB 1BRJA 3OWSA 3DM8A 3AGOA 3WOEB 3EX9A 1HU9A 1T2IA 2YFIB 3ZG0A 3DGYA 1L5GB 3LTDA 8CHOA 3X3YA 5GSPA 1OGZA 3FG4A 3K0ZA 1FA3A 1D6YA 3NV0B 5CLKA 4BL2A 3UB1A 5G1LA 2BT3A 2RSXA 4OVMA 1O7GB 3VF1A 1IVVA 2P05A 3KN4A 1JV2B 1FW7A 4NHFA 1LVNA 1I2GA 4KFFA 3MYTA 1UGHI 2CX0A 1J2BA 4FCZA 4DKIA 5M18A 1BANA 2F99A 4X2HA 3RDEA 1BSDA 1AVLA 1YIJ3 3FKAA 3E99A 1PU4A 3CNXA 2CH9A 1TU5A 2XH9A 1A2PA 3URPA 2CW9A 3RGAA 2I9WA 1IVWA 5AIGA 2CG1A 4HM0B 3EB8A 2F4YA 1Q7HA 2BU4A 3NBJA 1OUNA 7STDA 1M1K4 1W01A 1RN7A 1W02A 2WGQA 5IEOA 1MWSA 2ZL8A 3U97A 4GHOA 3D5IA 1VQN3 1JKGA 3KSPA 4HM7B 3T8UA 4R4KA 1B2MA 1I0XA 1NJI4 1SIIA 4EW5A 3AMOA 3G6E3 1US1A 4CDLA 3EBTA 3FG3A 1SARA 2C11A 3LOYA 1RCLA 3DGMA 3WA3A 2LYXA 1QJGA 1OPYA 2MF7A 4MMYB 2KRTA 1OHPA 1JBSA 1QVF2 1LRAA 1JJ22 1FGOA 1ULIB 3D79A 1AV4A 2F5MA 1BUJA 1LOYA 3STDA 3S67A 3K9MC 2C4BA 2XGNA 4XDWA 3AHWA 1UCKA 3SXXA 5G2GA 1V57A 3EC9A 1Q824 2PZVA 1TP6A 1STFI 2C10A 3FCSB 4STDA 3G4S3 1CYVA 1CYUA 1RGKA 2RFRA 3K5TA 4FMCA 1BGSA 4L8OA 5AIIA 3S29A 1UCJA 4CPKA 1YHQ3 1N5HA 3F9SA 3X3ZA 1Y4KA 1RGAA 1SJWA 1RGHA 3M8CA 1JKGB 1WQLB 3NXJA 3CMA3 5D82A 1DYUA 4LGQA 5IW9A 2P0XA 4LSOA 4HYZA 1WTHA 2ML6A 3AMOB 1VQ43 4HKVB 4FMBA 1TJDA 3MKIA 1I8VA 1GMPA 1RMSA 3OWUA 4HBRA 2AAEA 2F86B 4XB5A 5HGRA 5TGNA 3UL5A 2Z77A 1X1WA 1K41A 3IPTA 2XF3A 3BIRA 2B24B 4KVHA 1VQ53 2E2UA 3D5GA 1O7MB 1E3RA 2O9UX 5HOHA 2GU1A 1OF5A 1B2ZA 1UGIA 3H3HA 5CF1A 3CCV3 1K28A 1UW1A 2OWPA 3LT9A 2IUKA 3DH2A 1DMMA 2HMOB 4IIAA 2CK3H 2WOHA 1ROAA 2QA43 4IPBA 3ECFA 1UCIA 3I563 4HM6B 1ASKA 1FUTA 4X2OA 1BRKA 2R41A 4XBYA 1WNHA 1YJW3 3BLZA 4EBGA 1FUSA 4GB5A 4I5QA 1EA2A 1MWTA 3D9RA 3IMAB 2IY2A 3BNCA 4BTXA 1RN1A 4R9KA 1RKYA 1YI23 1NNVA 3NBBA 4BTWA 1W4NA 3MSOA 1T5YA 4J5GA 3UL6A 4BTYA 1SQWA 1BNSA 2CFDA 3ZFZA 3CCQ3 3CCS3 1UI8A 3F8HA 4J8TA 2YFJB 2O3OA 1OF5B 2J8XB 2K54A 3JUQA 4Q53A 1N9EA 3N9HA 3FZWA 1I3IA 2STDA 3MG1A 9RNTA 1GY7A 1YJ93 3RGRA 4MEIA 1GMQA 1Q7Y4 1UCLA 4HJLB 3HZPA 1VQK3 4XDVA 3SEDA 1JNQA 2PNCA 3SOAA 1A67A 3KIIA 1QVG2 4H61A 3WMDA
chains in the Genus database with same CATH topology
4OUQA 5IF6A 1SIHA 3DGNA 1RRHA 2JDIH 2QIYA 3DMCA 4K61A 5JPPA 1OHOA 4JRFA 3S28A 4RZMA 1YJN3 1QAKA 3BNBA 2INXA 5BVBA 1OH0A 5EEOA 1W2B2 1IQYA 1YVBI 3WOFB 1V74A 1OCVA 5AEWB 1NU3A 3U1WA 4G1MB 2CC3A 1LXEA 4HM3B 4N3VA 3PCRA 5LC7A 2FGTA 2P0MA 5AIFA 2Z6BA 3NM7A 1VQ73 1Z1SA 3DGLA 4EV2A 2KXGA 3CC43 2XFSA 2W0QA 1N8R4 4XBTA 3Q1CA 1N9JA 1M904 2W03A 4WFOA 1DVCA 3MWZA 3WA2X 3CCL3 3DZLA 3JUOA 1EG9B 1TIJA 2LQVA 3SVAA 5IENA 4L7KA 1Q42A 1QAFA 3K63A 4FMDA 1KSIA 2WO0A 1S723 1JB5A 2XRXB 1IT7A 4N6LA 1IV7A 3EF8A 2QGUA 3KFQC 3HIIA 1VQL3 2BNGA 5ELUA 2CFLA 1UUVB 2SBLA 1EKMA 2KCDA 1W7CA 3FGYA 1R4CA 1DVDA 4N6MA 2HMKB 2CIUA 3LH4A 3LT8A 3EQQB 3VSYA 4HM8B 1VQ63 3PYJA 1GS3A 1Q864 2B1XB 3VGNA 2XEPA 4HM5B 2A15A 3EJVA 4RBNA 1A90A 2CHCA 4J9AA 2CFKA 2Z7AA 3FSDA 3KZTA 2GEXA 3X40A 4AKZA 2CFWA 1KQS2 3WODG 4FR9A 3ROBA 5BXQA 3EE1A 4EV5A 3ER7A 2W56A 3SLUA 4L8PA 3CPW2 3DXOA 4LMIA 1PFPA 5AEUB 1W6YA 4EC6A 3CXC2 5AYRB 1WMNA 4WP5A 1VQ93 4HM2B 2RCDA 3JUNA 3LXUX 1JRQA 5ELJA 4O02B 4AEQA 3CME3 3GRDA 3MG2A 1IVUA 1M1XB 3QRDA 2GBWB 3BNDA 3F40A 1JB4A 4TX4A 2GBXB 4FCMA 3CCE3 3OV4A 1ROVA 1RJOA 5CXOA 3FG1A 5FGOA 2GEYA 4FMAA 3F14A 3NQYA 3V99A 1FGQA 3DUKA 2HMMB 4N6UA 2QEX3 3B8LA 3EHCA 2P38A 3CC73 1SPUA 2IA7A 5AIHA 3CU3A 2W56B 1LNHA 1NDOB 5IEPA 1K734 3CPOA 1GD4A 3CCR3 1GD3A 5DRVA 2WGOA 3UNLA 1E3VA 2HMNB 5KP4A 3LYGA 1CQSA 2CWUA 3NUVA 2W9QA 2OQEC 2BMQB 1GY6A 1ULJB 1O7HB 2YX9A 3BB9A 4O3VA 1Q40A 1YGEA 1IU7A 3X41A 4MJDA 5IG4A 3FH1A 2W2CA 1U5OA 2CWVA 4MMXB 1VQO3 4WYKA 3PCSA 3T8NA 5IERA 4IT7A 1ZO2A 1IQXA 1W2ZA 3GZYB 2V1LA 3NX0A 2OCTA 3CD63 4EYCA 2IUJA 5EQLA 1A2VA 1E97A 2XSOB 3GZXB 4HVNA 1STDA 2HMLB 3Q2PA 1FUWA 1OGXA 3QK9A 3ALAA 1JB2A 1IVXA 1ISKA 1GY5A 3Q90A 1IDPA 3GZRA 2ML5A 1Q814 3G713 1QALA 5KP1A 3A76A 3TDGA 1O7NB 4N6V0 4O8SA 1KD14 5LC6A 5JBSA 1DMQA 3LMLA 2F98A 5CF2A 4HZ9B 1TFOA 3MG3A 1Q40B 1YIT3 2W04A 1W6CA 2UX0A 4O2HA 5A0OB 5DREA 3PS8A 2BO9B 4WYKB 4U13A 2JQ5A 4KFDA 2GU3A 3NHXA 3EN8A 1U8CB 4RNZA 1VZZA 2CFGA 1VQP3 1JN5A 1IV9A 1WMOA 5STDA 3MHEA 4KZ1A 4HM4B 2BMRB 1NWWA 4AKYA 4QWTA 1GYBA 3FLJA 4N6OB 2BHMA 4CCVA 1QMAA 5D81A 4ZM8A 1G96A 5AYSC 1AR0A 2Y73A 3CNMA 3T0UA 1OHSA 4I4KA 4N6TA 3UJMA 3NQZA 4R1KA 3PZWA 1LOXA 2OQEA 2FXTA 2IMJA 2R4IA 3BNEA 6STDA 1IT8A 3F8XA 1M9GA 3EN1B 3NBRA 4NREA 3G16A 2ZDJA 2L4VA 3N8BA 5IG0A 1IQ8A 3L0RA 3SX1A 3K7CA 3I0YA 2OOVC 3SOYA 1MOLA 1W00A 1JN5B 2E2VA 2CKFB 2RGQA 2MC8A 1W5ZA 3HI7A 3N54B 3WDGB 3D3LA 3DY5A 4GL6A 3X42A 2GXFA 3DGOA 3JUPA 3B7CA 3CC23 1DMNA 3MPHA 1ZX2A 1AVKA 5AI1A 2W6JH 1OACA 3I553 2Y74A 5IG5A 2CG0A 3KKGA 4HM1B 3LTCA 1K9M4 3CCJ3 3LTBA 2P09A 3FF0A 3JUMA 3CCU3 4PEJA 1VQM3 3B4PA 5JPUA 2WOFA 2D1WA 2BMOB 4XBXA 1W6GA 2E2TA 1TUHA 3KSED 4WWUC 3CCM3 3HIGA 3LZAA 3S27A 3HX8A 1IK3A 3OWYA 1TFKA 1A2KA 3GZBA 2FNQA 2K0MA 4KFEA 1F8NA 3KE7A 2D42A 3LTAA 3NM2A 4K1VA 3G0KA 1MNLA 1WMPA 4RNYA 1O7WB 4R9LA 4XM4A 3GAXA 1NB5I 1FGMA 2XSHB 1KC84 3S5CA 2M7OA 3GWRA 4FCJA 4MMZB 5I97A 1N5PA 4OK0A 3J7Yd 4H3UA 3PGBA 1BUQA 5FW5A 4R80A 1FGRA 1N8QA 4JF8A 3OXAA 2W9PA 5D83A 4N6NB 5EVHA 4K1UA 4ORLA 2CWTA 3H51A 1NB3I 5KP3A 2OTL3 3F7SA 3G8ZA 3OW22 3NV0A 3B4OA 1KWIA 4HZBB 4LEHA 1O7PB 1NO3A 2Q07A 2YFLB 1EQKA 3OX9A 3PXMA 2OOVA 3FF2A 1D6ZA 4LZIA 3X3XA 1S5AA 3O8YA 4WHAA 5IG3A 1HKXA 1CEWI 1RRLA 4K90B 3JVCA 1K8A4 2XGLA 3V98A 3IJEB 2Z76A 3F7XA 3HK4A 2XFTA 3V92A 1D6UA 1UI7A 4EXRA 2XR8B 3EBYA 1FGTA 2OTJ3 1VQ83 2HMJB 5CK6A 1C7HA 1UUWB 3OWSA 3DM8A 3WOEB 3EX9A 1HU9A 2YFIB 1L5GB 3LTDA 8CHOA 3X3YA 1OGZA 3FG4A 3K0ZA 1FA3A 1D6YA 3NV0B 5CLKA 3UB1A 2BT3A 2RSXA 4OVMA 1O7GB 3VF1A 1IVVA 2P05A 3KN4A 1JV2B 4NHFA 1LVNA 4KFFA 3MYTA 1J2BA 4FCZA 2F99A 4X2HA 3RDEA 1AVLA 1YIJ3 3FKAA 3E99A 1PU4A 3CNXA 2CH9A 1TU5A 2XH9A 2CW9A 3RGAA 2I9WA 1IVWA 5AIGA 2CG1A 4HM0B 3EB8A 3NBJA 1OUNA 7STDA 1M1K4 1W01A 1RN7A 1W02A 2WGQA 5IEOA 2ZL8A 3U97A 1VQN3 1JKGA 3KSPA 4HM7B 3T8UA 4R4KA 1NJI4 1SIIA 3AMOA 3G6E3 1US1A 4CDLA 3EBTA 3FG3A 2C11A 3LOYA 3WA3A 3DGMA 2LYXA 1QJGA 1OPYA 2MF7A 4MMYB 2KRTA 1OHPA 1QVF2 1JJ22 1FGOA 1ULIB 1AV4A 3STDA 3S67A 3K9MC 2XGNA 4XDWA 3SXXA 5G2GA 3EC9A 1Q824 2PZVA 1TP6A 1STFI 2C10A 3FCSB 4STDA 3G4S3 1CYVA 1CYUA 2RFRA 3K5TA 4FMCA 4L8OA 5AIIA 3S29A 1YHQ3 1N5HA 3F9SA 3X3ZA 1Y4KA 1SJWA 3M8CA 1JKGB 1WQLB 3NXJA 3CMA3 5D82A 1DYUA 4LGQA 5IW9A 2P0XA 4LSOA 4HYZA 1WTHA 2ML6A 3AMOB 1VQ43 4HKVB 4FMBA 3MKIA 4HBRA 3OWUA 4XB5A 5HGRA 2F86B 5TGNA 3UL5A 2Z77A 1K41A 3IPTA 2XF3A 4KVHA 2B24B 1VQ53 2E2UA 1O7MB 1E3RA 2O9UX 2GU1A 1OF5A 3H3HA 5CF1A 3CCV3 1K28A 1UW1A 2OWPA 3LT9A 2IUKA 1DMMA 2HMOB 4IIAA 2CK3H 2WOHA 1ROAA 2QA43 4IPBA 3ECFA 3I563 4HM6B 1ASKA 4X2OA 4XBYA 1WNHA 1YJW3 3BLZA 4EBGA 4GB5A 1EA2A 3D9RA 3IMAB 1RKYA 4BTXA 3BNCA 4R9KA 1YI23 3NBBA 4BTWA 1W4NA 3MSOA 1T5YA 3UL6A 4BTYA 1SQWA 2CFDA 3CCQ3 3CCS3 1UI8A 3F8HA 4J8TA 2YFJB 2O3OA 1OF5B 2K54A 3JUQA 4Q53A 1N9EA 3N9HA 3FZWA 2STDA 3MG1A 1GY7A 1YJ93 3RGRA 4MEIA 1Q7Y4 4HJLB 3HZPA 1VQK3 4XDVA 3SEDA 1JNQA 2PNCA 3SOAA 1A67A 3KIIA 1QVG2 4H61A 3WMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OUQ A;  5IF6 A;  2QIY A;  3DMC A;  5JPP A;  1OHO A;  4RZM A;  2INX A;  5BVB A;  1OH0 A;  1OCV A;  5AEW B;  1NU3 A;  4N3V A;  4HM3 B;  5AIF A;  1Z1S A;  4XBT A;  3DZL A;  3JUO A;  1EG9 B;  5IEN A;  4L7K A;  1Q42 A;  1JB5 A;  2XRX B;  3EF8 A;  2QGU A;  2BNG A;  1UUV B;  3FGY A;  2HMK B;  3EQQ B;  3VSY A;  4HM8 B;  1GS3 A;  2B1X B;  3VGN A;  4HM5 B;  2A15 A;  3EJV A;  2CHC A;  4J9A A;  2Z7A A;  3FSD A;  3KZT A;  2GEX A;  3ROB A;  5BXQ A;  3ER7 A;  4L8P A;  3DXO A;  4LMI A;  5AEU B;  1W6Y A;  4WP5 A;  4HM2 B;  2RCD A;  3JUN A;  3GRD A;  3MG2 A;  2GBW B;  3F40 A;  1JB4 A;  2GBX B;  4FCM A;  3OV4 A;  5CXO A;  2GEY A;  3F14 A;  3DUK A;  2HMM B;  3B8L A;  3EHC A;  5AIH A;  3CU3 A;  1NDO B;  5IEP A;  3CPO A;  5DRV A;  3UNL A;  1E3V A;  2HMN B;  5KP4 A;  3LYG A;  1CQS A;  3NUV A;  2BMQ B;  1GY6 A;  1ULJ B;  1O7H B;  3BB9 A;  1Q40 A;  4MJD A;  5IG4 A;  3FH1 A;  2W2C A;  1U5O A;  4WYK A;  3T8N A;  5IER A;  1ZO2 A;  3GZY B;  1E97 A;  2XSO B;  3GZX B;  4HVN A;  1STD A;  2HML B;  1OGX A;  1JB2 A;  1ISK A;  1GY5 A;  3Q90 A;  1IDP A;  3GZR A;  5KP1 A;  3A76 A;  1O7N B;  1DMQ A;  2F98 A;  5CF2 A;  4HZ9 B;  3MG3 A;  1Q40 B;  2UX0 A;  5DRE A;  4WYK B;  4U13 A;  2JQ5 A;  3NHX A;  3EN8 A;  1VZZ A;  1JN5 A;  5STD A;  3MHE A;  4HM4 B;  2BMR B;  1NWW A;  1GYB A;  3FLJ A;  1QMA A;  5D81 A;  1AR0 A;  3CNM A;  1OHS A;  4I4K A;  3UJM A;  4R1K A;  2IMJ A;  2R4I A;  6STD A;  3F8X A;  3EN1 B;  3NBR A;  3G16 A;  5IG0 A;  3K7C A;  3I0Y A;  3SOY A;  1W00 A;  1JN5 B;  2CKF B;  2RGQ A;  2GXF A;  3JUP A;  3B7C A;  1DMN A;  5AI1 A;  1ZX2 A;  5IG5 A;  3KKG A;  4HM1 B;  3FF0 A;  3JUM A;  4PEJ A;  3B4P A;  5JPU A;  2BMO B;  4XBX A;  1TUH A;  4WWU C;  3LZA A;  3HX8 A;  3OWY A;  1A2K A;  3GZB A;  3KE7 A;  3NM2 A;  4K1V A;  3G0K A;  1O7W B;  4R9L A;  4XM4 A;  2XSH B;  3S5C A;  3GWR A;  4FCJ A;  4H3U A;  1BUQ A;  5FW5 A;  3OXA A;  5D83 A;  5EVH A;  4K1U A;  4ORL A;  5KP3 A;  3H51 A;  3F7S A;  3G8Z A;  3NV0 A;  3B4O A;  4HZB B;  4LEH A;  1O7P B;  2YFL B;  3OX9 A;  3FF2 A;  1S5A A;  5IG3 A;  1HKX A;  2Z76 A;  3F7X A;  3HK4 A;  2XR8 B;  3EBY A;  2HMJ B;  5CK6 A;  1C7H A;  1UUW B;  3OWS A;  3DM8 A;  3EX9 A;  2YFI B;  8CHO A;  1OGZ A;  3K0Z A;  3NV0 B;  5CLK A;  4OVM A;  1O7G B;  3MYT A;  2F99 A;  4X2H A;  3FKA A;  3E99 A;  3CNX A;  3RGA A;  2I9W A;  5AIG A;  4HM0 B;  1OUN A;  7STD A;  1W01 A;  1W02 A;  5IEO A;  1JKG A;  3KSP A;  4HM7 B;  3T8U A;  4CDL A;  3EBT A;  1QJG A;  1OPY A;  1OHP A;  1ULI B;  3STD A;  4XDW A;  5G2G A;  3EC9 A;  2PZV A;  1TP6 A;  4STD A;  2RFR A;  4L8O A;  5AII A;  3F9S A;  1SJW A;  3M8C A;  1WQL B;  1JKG B;  3NXJ A;  5D82 A;  4LGQ A;  4HKV B;  3MKI A;  4XB5 A;  3OWU A;  5HGR A;  5TGN A;  2F86 B;  2Z77 A;  1K41 A;  3IPT A;  4KVH A;  2B24 B;  1O7M B;  1E3R A;  1OF5 A;  3H3H A;  5CF1 A;  2OWP A;  1DMM A;  2HMO B;  4IIA A;  3ECF A;  4HM6 B;  1ASK A;  4X2O A;  4XBY A;  3BLZ A;  4GB5 A;  1EA2 A;  3D9R A;  4R9K A;  3MSO A;  3F8H A;  4J8T A;  2YFJ B;  1OF5 B;  2K54 A;  3JUQ A;  4Q53 A;  3FZW A;  2STD A;  3MG1 A;  1GY7 A;  3RGR A;  4HJL B;  3HZP A;  4XDV A;  3SED A;  3SOA A;  3WMD A; 
#chains in the Genus database with same CATH topology
 1LQG C;  4OUQ A;  1ZGX A;  5IF6 A;  1SIH A;  3DGN A;  1RRH A;  1B20 A;  1LOV A;  2JDI H;  2QIY A;  1IYY A;  3DMC A;  1BVI A;  3ZG5 A;  4K61 A;  2IYJ A;  2K3D A;  5JPP A;  1BRN L;  1OHO A;  4JRF A;  3S28 A;  4RZM A;  1RNT A;  1YJN 3;  2KAA A;  1QAK A;  3BNB A;  2INX A;  5BVB A;  1OH0 A;  5EEO A;  1W2B 2;  1IQY A;  1YVB I;  3WOF B;  1V74 A;  1OCV A;  1C54 A;  1RSN A;  2HOH A;  5AEW B;  1NU3 A;  3U1W A;  1BIR A;  4G1M B;  2CC3 A;  1LXE A;  1MWR A;  4HM3 B;  3PCR A;  4N3V A;  5LC7 A;  2FGT A;  2P0M A;  5AIF A;  3D4A A;  2Z6B A;  3NM7 A;  1V58 A;  1VQ7 3;  1Z1S A;  3GSP A;  3DGL A;  4EV2 A;  2KXG A;  3CC4 3;  2XFS A;  2W0Q A;  1N8R 4;  4XBT A;  3Q1C A;  1N9J A;  1M90 4;  2W03 A;  4WFO A;  1DVC A;  3MWZ A;  2ZA4 A;  3WA2 X;  3CCL 3;  3DZL A;  3JUO A;  1EG9 B;  1TIJ A;  2LQV A;  4HAA A;  3SVA A;  5IEN A;  4L7K A;  1Q42 A;  1QAF A;  3K63 A;  4FMD A;  5RNT A;  1KSI A;  2WO0 A;  1S72 3;  1JB5 A;  2XRX B;  1IT7 A;  4N6L A;  1IV7 A;  3EF8 A;  2QGU A;  3KFQ C;  1BSE A;  3KCH A;  3HII A;  1VQL 3;  2BNG A;  5ELU A;  2CFL A;  4BIR A;  1UUV B;  2SBL A;  1EKM A;  2KCD A;  1W7C A;  3FGY A;  1YGW A;  1R4C A;  1LNI A;  1MGR A;  4N6M A;  1DVD A;  2HMK B;  1GMR A;  2CIU A;  2H0I A;  3LH4 A;  3LT8 A;  3EQQ B;  3VSY A;  4HM8 B;  1RGE A;  1VQ6 3;  1X1Y A;  3PYJ A;  1GS3 A;  2F5W A;  1Q86 4;  4CJN A;  1ZS7 A;  2B1X B;  3VGN A;  4BL3 A;  2XEP A;  4HM5 B;  1RCK A;  2A15 A;  3EJV A;  1B2X A;  4RBN A;  2CHC A;  1A90 A;  4J9A A;  2CFK A;  2Z7A A;  3FSD A;  1RLS A;  3KZT A;  2GEX A;  3X40 A;  4AKZ A;  2AAD A;  2CFW A;  1KQS 2;  3WOD G;  4FR9 A;  1YVS A;  3ROB A;  5BXQ A;  1PY3 A;  1DE3 A;  3EE1 A;  4EV5 A;  3ER7 A;  5M19 A;  5M1A A;  1FYS A;  2W56 A;  3SLU A;  4L8P A;  3CPW 2;  3DXO A;  2SAR A;  1EUI C;  1BSB A;  4LMI A;  1PFP A;  5AEU B;  1W6Y A;  4EC6 A;  3CXC 2;  5AYR B;  1UDI I;  1WMN A;  4WP5 A;  1VQ9 3;  4HM2 B;  2RCD A;  3JUN A;  3LXU X;  1JRQ A;  5ELJ A;  4O02 B;  4AEQ A;  1RTU A;  3CME 3;  3GRD A;  3MG2 A;  1IVU A;  1M1X B;  3QRD A;  2GBW B;  3BND A;  3F40 A;  1JB4 A;  4TX4 A;  2GBX B;  4FCM A;  3CCE 3;  3OV4 A;  1ROV A;  1RJO A;  5CXO A;  3FG1 A;  5FGO A;  2GEY A;  4FMA A;  1B21 A;  3F14 A;  1GSP A;  3NQY A;  3V99 A;  1FGQ A;  3DUK A;  1BNR A;  2HMM B;  4N6U A;  3SYU A;  1TRP A;  3WR2 A;  2QEX 3;  3B8L A;  3EHC A;  2P38 A;  4ILF A;  3CC7 3;  1SPU A;  2IA7 A;  5AIH A;  3CU3 A;  2W56 B;  1LNH A;  1NDO B;  5IEP A;  1CH0 A;  3CPO A;  1K73 4;  1GD4 A;  3CCR 3;  1JZD A;  1GD3 A;  5DRV A;  2WGO A;  3UNL A;  1E3V A;  2HMN B;  5KP4 A;  3LYG A;  1CQS A;  2CWU A;  3AGN A;  1BRI A;  3NUV A;  2W9Q A;  2OQE C;  2BMQ B;  4J5K A;  1GY6 A;  1ULJ B;  1O7H B;  2YX9 A;  3BB9 A;  4O3V A;  1I0V A;  1Q40 A;  1IU7 A;  1YGE A;  3X41 A;  4MJD A;  5IG4 A;  3A5E A;  3FH1 A;  2W2C A;  1U5O A;  2CWV A;  4MMX B;  1VQO 3;  4WYK A;  3PCS A;  3T8N A;  5IER A;  4IT7 A;  7GSP A;  1ZO2 A;  1IQX A;  5BIR A;  1W2Z A;  2CX1 A;  2V1L A;  3GZY B;  3NX0 A;  2OCT A;  1BRG A;  1AY7 A;  4EYC A;  2IUJ A;  3CD6 3;  5EQL A;  1JBR A;  1A2V A;  1E97 A;  2XSO B;  1LOW A;  3GZX B;  1LQM B;  1RN4 A;  1EEJ A;  4HVN A;  1STD A;  1BSC A;  2HML B;  3Q2P A;  1FUW A;  2GSP A;  1OGX A;  1I2E A;  3QK9 A;  4KT3 B;  1X1X A;  1JB2 A;  1IVX A;  3ALA A;  1ISK A;  1GY5 A;  1BRH A;  1IDP A;  3GZR A;  2ML5 A;  3Q90 A;  3G71 3;  1Q81 4;  1QAL A;  4LYL B;  5KP1 A;  1B2S A;  3A76 A;  3TDG A;  1O7N B;  4N6V 0;  4O8S A;  1KD1 4;  1I3F A;  5LC6 A;  5BU4 A;  5JBS A;  3BU4 A;  1RGC A;  1BNJ A;  1DMQ A;  3LML A;  2F98 A;  5CF2 A;  4HZ9 B;  1TFO A;  1RGF A;  2KF6 A;  1Q40 B;  3MG3 A;  1YIT 3;  2W04 A;  1W6C A;  1Q9E A;  2UX0 A;  4O2H A;  5G1K A;  5A0O B;  2KF3 A;  5DRE A;  2H0G A;  2L1S A;  3PS8 A;  2BO9 B;  4WYK B;  4U13 A;  2JQ5 A;  3RNT A;  4KFD A;  2GU3 A;  3NHX A;  3EN8 A;  1U8C B;  4RNZ A;  1VZZ A;  2CFG A;  1VQP 3;  1JN5 A;  1IV9 A;  1WMO A;  1HZ1 A;  5STD A;  3MHE A;  1GOY A;  4KZ1 A;  4HM4 B;  4NPB A;  2BMR B;  1NWW A;  4AKY A;  4QWT A;  1GYB A;  3FLJ A;  4N6O B;  2BHM A;  4CCV A;  1QMA A;  5D81 A;  4ZM8 A;  1G96 A;  5AYS C;  1AR0 A;  1GOV A;  1DET A;  2Y73 A;  1VQQ A;  1RHL A;  3CNM A;  3T0U A;  1OHS A;  4I4K A;  4N6T A;  3UJM A;  3NQZ A;  4R1K A;  3PZW A;  1LOX A;  2OQE A;  2FXT A;  2IMJ A;  2R4I A;  1PYL A;  3BNE A;  1GOU A;  2F56 A;  6STD A;  1IT8 A;  1I2F A;  1G02 A;  1M9G A;  3EN1 B;  3F8X A;  1G0T A;  3NBR A;  4NRE A;  3G16 A;  2ZDJ A;  2L4V A;  3N8B A;  5IG0 A;  2H0H A;  1JBT A;  1IQ8 A;  1HYF A;  3L0R A;  3SX1 A;  3K7C A;  4HOH A;  3I0Y A;  2OOV C;  3SOY A;  1MOL A;  1W00 A;  1JN5 B;  1RGL A;  2E2V A;  2CKF B;  2RGQ A;  1FZU A;  2MC8 A;  1W5Z A;  1BAO A;  1TRQ A;  3HI7 A;  3D3L A;  1MWU A;  3DY5 A;  3N54 B;  3WDG B;  1YNV X;  4GL6 A;  4RNT A;  3X42 A;  1MGW A;  2GXF A;  6RNT A;  3DGO A;  3JUP A;  3B7C A;  3CC2 3;  1AQZ A;  1T2H A;  1DMN A;  1BU4 A;  1ZX2 A;  1AVK A;  2RBI A;  3MPH A;  5AI1 A;  2W6J H;  1OAC A;  3I55 3;  2Y74 A;  5IG5 A;  2CG0 A;  3KKG A;  4HM1 B;  3LTC A;  1K9M 4;  3CCJ 3;  3LTB A;  2P09 A;  3FF0 A;  3JUM A;  3CCU 3;  4PEJ A;  1VQM 3;  3B4P A;  5JPU A;  2WOF A;  2D1W A;  2BMO B;  2BIR A;  2KF5 A;  1W6G A;  4XBX A;  2E2T A;  1TUH A;  1I70 A;  3KSE D;  4WWU C;  3CCM 3;  1X1U A;  3HIG A;  3LZA A;  3S27 A;  3HX8 A;  1IK3 A;  3OWY A;  1JZO A;  1TFK A;  1A2K A;  3GZB A;  2FNQ A;  2K0M A;  3AHS A;  4KFE A;  1F8N A;  3KE7 A;  2D42 A;  3LTA A;  1RDS A;  3NM2 A;  4K1V A;  3G0K A;  1MNL A;  1WMP A;  1BOX A;  4RNY A;  1B27 A;  1O7W B;  4R9L A;  4XM4 A;  3GAX A;  1B3S A;  2RNT A;  1NB5 I;  1BNE A;  1FGM A;  2XSH B;  1KC8 4;  3S5C A;  6GSP A;  2M7O A;  3GWR A;  4FCJ A;  4MMZ B;  5I97 A;  1N5P A;  4OK0 A;  1RGG A;  4GSP A;  4H3U A;  3J7Y d;  3PGB A;  1BUQ A;  5FW5 A;  4R80 A;  1FGR A;  1BRS A;  1N8Q A;  4JF8 A;  3OXA A;  2UUG C;  2W9P A;  5D83 A;  4N6N B;  5EVH A;  4K1U A;  4ORL A;  2CWT A;  3H51 A;  1NB3 I;  5KP3 A;  2OTL 3;  3F7S A;  3G8Z A;  3OW2 2;  3NV0 A;  3B4O A;  1KWI A;  3WHO A;  4HZB B;  4LEH A;  1O7P B;  1NO3 A;  2Q07 A;  2YFL B;  3Q3F A;  4BU4 A;  8RNT A;  1EQK A;  3OX9 A;  3PXM A;  1B2U A;  1BSA A;  2UGI A;  2OOV A;  3FF2 A;  1D6Z A;  2ZHX B;  1BNG A;  4LZI A;  3X3X A;  1S5A A;  3O8Y A;  4WHA A;  1R4Y A;  5IG3 A;  1RNB A;  1HKX A;  2KF4 A;  1CEW I;  7RNT A;  1RRL A;  4K90 B;  3JVC A;  1K8A 4;  2XGL A;  1TTO A;  3V98 A;  3IJE B;  2Z76 A;  1BNI A;  3F7X A;  3HK4 A;  2XFT A;  3V92 A;  1D6U A;  1UUG B;  1BNF A;  1UI7 A;  2XR8 B;  3HOH A;  3EBY A;  1FGT A;  4EXR A;  2OTJ 3;  1T3B A;  1VQ8 3;  2HMJ B;  5CK6 A;  1C7H A;  1UUW B;  1BRJ A;  3OWS A;  3DM8 A;  3AGO A;  3WOE B;  3EX9 A;  1HU9 A;  1T2I A;  2YFI B;  3ZG0 A;  3DGY A;  1L5G B;  3LTD A;  8CHO A;  3X3Y A;  5GSP A;  1OGZ A;  3FG4 A;  3K0Z A;  1FA3 A;  1D6Y A;  3NV0 B;  5CLK A;  4BL2 A;  3UB1 A;  5G1L A;  2BT3 A;  2RSX A;  4OVM A;  1O7G B;  3VF1 A;  1IVV A;  2P05 A;  3KN4 A;  1JV2 B;  1FW7 A;  4NHF A;  1LVN A;  1I2G A;  4KFF A;  3MYT A;  1UGH I;  2CX0 A;  1J2B A;  4FCZ A;  4DKI A;  5M18 A;  1BAN A;  2F99 A;  4X2H A;  3RDE A;  1BSD A;  1AVL A;  1YIJ 3;  3FKA A;  3E99 A;  1PU4 A;  3CNX A;  2CH9 A;  1TU5 A;  2XH9 A;  1A2P A;  3URP A;  2CW9 A;  3RGA A;  2I9W A;  1IVW A;  5AIG A;  2CG1 A;  4HM0 B;  3EB8 A;  2F4Y A;  1Q7H A;  2BU4 A;  3NBJ A;  1OUN A;  7STD A;  1M1K 4;  1W01 A;  1RN7 A;  1W02 A;  2WGQ A;  5IEO A;  1MWS A;  2ZL8 A;  3U97 A;  4GHO A;  3D5I A;  1VQN 3;  1JKG A;  3KSP A;  4HM7 B;  3T8U A;  4R4K A;  1B2M A;  1I0X A;  1NJI 4;  1SII A;  4EW5 A;  3AMO A;  3G6E 3;  1US1 A;  4CDL A;  3EBT A;  3FG3 A;  1SAR A;  2C11 A;  3LOY A;  1RCL A;  3DGM A;  3WA3 A;  2LYX A;  1QJG A;  1OPY A;  2MF7 A;  4MMY B;  2KRT A;  1OHP A;  1JBS A;  1QVF 2;  1LRA A;  1JJ2 2;  1FGO A;  1ULI B;  3D79 A;  1AV4 A;  2F5M A;  1BUJ A;  1LOY A;  3STD A;  3S67 A;  3K9M C;  2C4B A;  2XGN A;  4XDW A;  3AHW A;  1UCK A;  3SXX A;  5G2G A;  1V57 A;  3EC9 A;  1Q82 4;  2PZV A;  1TP6 A;  1STF I;  2C10 A;  3FCS B;  4STD A;  3G4S 3;  1CYV A;  1CYU A;  1RGK A;  2RFR A;  3K5T A;  4FMC A;  1BGS A;  4L8O A;  5AII A;  3S29 A;  1UCJ A;  4CPK A;  1YHQ 3;  1N5H A;  3F9S A;  3X3Z A;  1Y4K A;  1RGA A;  1SJW A;  1RGH A;  3M8C A;  1JKG B;  1WQL B;  3NXJ A;  3CMA 3;  5D82 A;  1DYU A;  4LGQ A;  5IW9 A;  2P0X A;  4LSO A;  4HYZ A;  1WTH A;  2ML6 A;  3AMO B;  1VQ4 3;  4HKV B;  4FMB A;  1TJD A;  3MKI A;  1I8V A;  1GMP A;  1RMS A;  3OWU A;  4HBR A;  2AAE A;  2F86 B;  4XB5 A;  5HGR A;  5TGN A;  3UL5 A;  2Z77 A;  1X1W A;  1K41 A;  3IPT A;  2XF3 A;  3BIR A;  2B24 B;  4KVH A;  1VQ5 3;  2E2U A;  3D5G A;  1O7M B;  1E3R A;  2O9U X;  5HOH A;  2GU1 A;  1OF5 A;  1B2Z A;  1UGI A;  3H3H A;  5CF1 A;  3CCV 3;  1K28 A;  1UW1 A;  2OWP A;  3LT9 A;  2IUK A;  3DH2 A;  1DMM A;  2HMO B;  4IIA A;  2CK3 H;  2WOH A;  1ROA A;  2QA4 3;  4IPB A;  3ECF A;  1UCI A;  3I56 3;  4HM6 B;  1ASK A;  1FUT A;  4X2O A;  1BRK A;  2R41 A;  4XBY A;  1WNH A;  1YJW 3;  3BLZ A;  4EBG A;  1FUS A;  4GB5 A;  4I5Q A;  1EA2 A;  1MWT A;  3D9R A;  3IMA B;  2IY2 A;  3BNC A;  4BTX A;  1RN1 A;  4R9K A;  1RKY A;  1YI2 3;  1NNV A;  3NBB A;  4BTW A;  1W4N A;  3MSO A;  1T5Y A;  4J5G A;  3UL6 A;  4BTY A;  1SQW A;  1BNS A;  2CFD A;  3ZFZ A;  3CCQ 3;  3CCS 3;  1UI8 A;  3F8H A;  4J8T A;  2YFJ B;  2O3O A;  1OF5 B;  2J8X B;  2K54 A;  3JUQ A;  4Q53 A;  1N9E A;  3N9H A;  3FZW A;  1I3I A;  2STD A;  3MG1 A;  9RNT A;  1GY7 A;  1YJ9 3;  3RGR A;  4MEI A;  1GMQ A;  1Q7Y 4;  1UCL A;  4HJL B;  3HZP A;  1VQK 3;  4XDV A;  3SED A;  1JNQ A;  2PNC A;  3SOA A;  1A67 A;  3KII A;  1QVG 2;  4H61 A;  3WMD A; 
#chains in the Genus database with same CATH homology
 4OUQ A;  5IF6 A;  1SIH A;  3DGN A;  1RRH A;  2JDI H;  2QIY A;  3DMC A;  4K61 A;  5JPP A;  1OHO A;  4JRF A;  3S28 A;  4RZM A;  1YJN 3;  1QAK A;  3BNB A;  2INX A;  5BVB A;  1OH0 A;  5EEO A;  1W2B 2;  1IQY A;  1YVB I;  3WOF B;  1V74 A;  1OCV A;  5AEW B;  1NU3 A;  3U1W A;  4G1M B;  2CC3 A;  1LXE A;  4HM3 B;  4N3V A;  3PCR A;  5LC7 A;  2FGT A;  2P0M A;  5AIF A;  2Z6B A;  3NM7 A;  1VQ7 3;  1Z1S A;  3DGL A;  4EV2 A;  2KXG A;  3CC4 3;  2XFS A;  2W0Q A;  1N8R 4;  4XBT A;  3Q1C A;  1N9J A;  1M90 4;  2W03 A;  4WFO A;  1DVC A;  3MWZ A;  3WA2 X;  3CCL 3;  3DZL A;  3JUO A;  1EG9 B;  1TIJ A;  2LQV A;  3SVA A;  5IEN A;  4L7K A;  1Q42 A;  1QAF A;  3K63 A;  4FMD A;  1KSI A;  2WO0 A;  1S72 3;  1JB5 A;  2XRX B;  1IT7 A;  4N6L A;  1IV7 A;  3EF8 A;  2QGU A;  3KFQ C;  3HII A;  1VQL 3;  2BNG A;  5ELU A;  2CFL A;  1UUV B;  2SBL A;  1EKM A;  2KCD A;  1W7C A;  3FGY A;  1R4C A;  1DVD A;  4N6M A;  2HMK B;  2CIU A;  3LH4 A;  3LT8 A;  3EQQ B;  3VSY A;  4HM8 B;  1VQ6 3;  3PYJ A;  1GS3 A;  1Q86 4;  2B1X B;  3VGN A;  2XEP A;  4HM5 B;  2A15 A;  3EJV A;  4RBN A;  1A90 A;  2CHC A;  4J9A A;  2CFK A;  2Z7A A;  3FSD A;  3KZT A;  2GEX A;  3X40 A;  4AKZ A;  2CFW A;  1KQS 2;  3WOD G;  4FR9 A;  3ROB A;  5BXQ A;  3EE1 A;  4EV5 A;  3ER7 A;  2W56 A;  3SLU A;  4L8P A;  3CPW 2;  3DXO A;  4LMI A;  1PFP A;  5AEU B;  1W6Y A;  4EC6 A;  3CXC 2;  5AYR B;  1WMN A;  4WP5 A;  1VQ9 3;  4HM2 B;  2RCD A;  3JUN A;  3LXU X;  1JRQ A;  5ELJ A;  4O02 B;  4AEQ A;  3CME 3;  3GRD A;  3MG2 A;  1IVU A;  1M1X B;  3QRD A;  2GBW B;  3BND A;  3F40 A;  1JB4 A;  4TX4 A;  2GBX B;  4FCM A;  3CCE 3;  3OV4 A;  1ROV A;  1RJO A;  5CXO A;  3FG1 A;  5FGO A;  2GEY A;  4FMA A;  3F14 A;  3NQY A;  3V99 A;  1FGQ A;  3DUK A;  2HMM B;  4N6U A;  2QEX 3;  3B8L A;  3EHC A;  2P38 A;  3CC7 3;  1SPU A;  2IA7 A;  5AIH A;  3CU3 A;  2W56 B;  1LNH A;  1NDO B;  5IEP A;  1K73 4;  3CPO A;  1GD4 A;  3CCR 3;  1GD3 A;  5DRV A;  2WGO A;  3UNL A;  1E3V A;  2HMN B;  5KP4 A;  3LYG A;  1CQS A;  2CWU A;  3NUV A;  2W9Q A;  2OQE C;  2BMQ B;  1GY6 A;  1ULJ B;  1O7H B;  2YX9 A;  3BB9 A;  4O3V A;  1Q40 A;  1YGE A;  1IU7 A;  3X41 A;  4MJD A;  5IG4 A;  3FH1 A;  2W2C A;  1U5O A;  2CWV A;  4MMX B;  1VQO 3;  4WYK A;  3PCS A;  3T8N A;  5IER A;  4IT7 A;  1ZO2 A;  1IQX A;  1W2Z A;  3GZY B;  2V1L A;  3NX0 A;  2OCT A;  3CD6 3;  4EYC A;  2IUJ A;  5EQL A;  1A2V A;  1E97 A;  2XSO B;  3GZX B;  4HVN A;  1STD A;  2HML B;  3Q2P A;  1FUW A;  1OGX A;  3QK9 A;  3ALA A;  1JB2 A;  1IVX A;  1ISK A;  1GY5 A;  3Q90 A;  1IDP A;  3GZR A;  2ML5 A;  1Q81 4;  3G71 3;  1QAL A;  5KP1 A;  3A76 A;  3TDG A;  1O7N B;  4N6V 0;  4O8S A;  1KD1 4;  5LC6 A;  5JBS A;  1DMQ A;  3LML A;  2F98 A;  5CF2 A;  4HZ9 B;  1TFO A;  3MG3 A;  1Q40 B;  1YIT 3;  2W04 A;  1W6C A;  2UX0 A;  4O2H A;  5A0O B;  5DRE A;  3PS8 A;  2BO9 B;  4WYK B;  4U13 A;  2JQ5 A;  4KFD A;  2GU3 A;  3NHX A;  3EN8 A;  1U8C B;  4RNZ A;  1VZZ A;  2CFG A;  1VQP 3;  1JN5 A;  1IV9 A;  1WMO A;  5STD A;  3MHE A;  4KZ1 A;  4HM4 B;  2BMR B;  1NWW A;  4AKY A;  4QWT A;  1GYB A;  3FLJ A;  4N6O B;  2BHM A;  4CCV A;  1QMA A;  5D81 A;  4ZM8 A;  1G96 A;  5AYS C;  1AR0 A;  2Y73 A;  3CNM A;  3T0U A;  1OHS A;  4I4K A;  4N6T A;  3UJM A;  3NQZ A;  4R1K A;  3PZW A;  1LOX A;  2OQE A;  2FXT A;  2IMJ A;  2R4I A;  3BNE A;  6STD A;  1IT8 A;  3F8X A;  1M9G A;  3EN1 B;  3NBR A;  4NRE A;  3G16 A;  2ZDJ A;  2L4V A;  3N8B A;  5IG0 A;  1IQ8 A;  3L0R A;  3SX1 A;  3K7C A;  3I0Y A;  2OOV C;  3SOY A;  1MOL A;  1W00 A;  1JN5 B;  2E2V A;  2CKF B;  2RGQ A;  2MC8 A;  1W5Z A;  3HI7 A;  3N54 B;  3WDG B;  3D3L A;  3DY5 A;  4GL6 A;  3X42 A;  2GXF A;  3DGO A;  3JUP A;  3B7C A;  3CC2 3;  1DMN A;  3MPH A;  1ZX2 A;  1AVK A;  5AI1 A;  2W6J H;  1OAC A;  3I55 3;  2Y74 A;  5IG5 A;  2CG0 A;  3KKG A;  4HM1 B;  3LTC A;  1K9M 4;  3CCJ 3;  3LTB A;  2P09 A;  3FF0 A;  3JUM A;  3CCU 3;  4PEJ A;  1VQM 3;  3B4P A;  5JPU A;  2WOF A;  2D1W A;  2BMO B;  4XBX A;  1W6G A;  2E2T A;  1TUH A;  3KSE D;  4WWU C;  3CCM 3;  3HIG A;  3LZA A;  3S27 A;  3HX8 A;  1IK3 A;  3OWY A;  1TFK A;  1A2K A;  3GZB A;  2FNQ A;  2K0M A;  4KFE A;  1F8N A;  3KE7 A;  2D42 A;  3LTA A;  3NM2 A;  4K1V A;  3G0K A;  1MNL A;  1WMP A;  4RNY A;  1O7W B;  4R9L A;  4XM4 A;  3GAX A;  1NB5 I;  1FGM A;  2XSH B;  1KC8 4;  3S5C A;  2M7O A;  3GWR A;  4FCJ A;  4MMZ B;  5I97 A;  1N5P A;  4OK0 A;  3J7Y d;  4H3U A;  3PGB A;  1BUQ A;  5FW5 A;  4R80 A;  1FGR A;  1N8Q A;  4JF8 A;  3OXA A;  2W9P A;  5D83 A;  4N6N B;  5EVH A;  4K1U A;  4ORL A;  2CWT A;  3H51 A;  1NB3 I;  5KP3 A;  2OTL 3;  3F7S A;  3G8Z A;  3OW2 2;  3NV0 A;  3B4O A;  1KWI A;  4HZB B;  4LEH A;  1O7P B;  1NO3 A;  2Q07 A;  2YFL B;  1EQK A;  3OX9 A;  3PXM A;  2OOV A;  3FF2 A;  1D6Z A;  4LZI A;  3X3X A;  1S5A A;  3O8Y A;  4WHA A;  5IG3 A;  1HKX A;  1CEW I;  1RRL A;  4K90 B;  3JVC A;  1K8A 4;  2XGL A;  3V98 A;  3IJE B;  2Z76 A;  3F7X A;  3HK4 A;  2XFT A;  3V92 A;  1D6U A;  1UI7 A;  4EXR A;  2XR8 B;  3EBY A;  1FGT A;  2OTJ 3;  1VQ8 3;  2HMJ B;  5CK6 A;  1C7H A;  1UUW B;  3OWS A;  3DM8 A;  3WOE B;  3EX9 A;  1HU9 A;  2YFI B;  1L5G B;  3LTD A;  8CHO A;  3X3Y A;  1OGZ A;  3FG4 A;  3K0Z A;  1FA3 A;  1D6Y A;  3NV0 B;  5CLK A;  3UB1 A;  2BT3 A;  2RSX A;  4OVM A;  1O7G B;  3VF1 A;  1IVV A;  2P05 A;  3KN4 A;  1JV2 B;  4NHF A;  1LVN A;  4KFF A;  3MYT A;  1J2B A;  4FCZ A;  2F99 A;  4X2H A;  3RDE A;  1AVL A;  1YIJ 3;  3FKA A;  3E99 A;  1PU4 A;  3CNX A;  2CH9 A;  1TU5 A;  2XH9 A;  2CW9 A;  3RGA A;  2I9W A;  1IVW A;  5AIG A;  2CG1 A;  4HM0 B;  3EB8 A;  3NBJ A;  1OUN A;  7STD A;  1M1K 4;  1W01 A;  1RN7 A;  1W02 A;  2WGQ A;  5IEO A;  2ZL8 A;  3U97 A;  1VQN 3;  1JKG A;  3KSP A;  4HM7 B;  3T8U A;  4R4K A;  1NJI 4;  1SII A;  3AMO A;  3G6E 3;  1US1 A;  4CDL A;  3EBT A;  3FG3 A;  2C11 A;  3LOY A;  3WA3 A;  3DGM A;  2LYX A;  1QJG A;  1OPY A;  2MF7 A;  4MMY B;  2KRT A;  1OHP A;  1QVF 2;  1JJ2 2;  1FGO A;  1ULI B;  1AV4 A;  3STD A;  3S67 A;  3K9M C;  2XGN A;  4XDW A;  3SXX A;  5G2G A;  3EC9 A;  1Q82 4;  2PZV A;  1TP6 A;  1STF I;  2C10 A;  3FCS B;  4STD A;  3G4S 3;  1CYV A;  1CYU A;  2RFR A;  3K5T A;  4FMC A;  4L8O A;  5AII A;  3S29 A;  1YHQ 3;  1N5H A;  3F9S A;  3X3Z A;  1Y4K A;  1SJW A;  3M8C A;  1JKG B;  1WQL B;  3NXJ A;  3CMA 3;  5D82 A;  1DYU A;  4LGQ A;  5IW9 A;  2P0X A;  4LSO A;  4HYZ A;  1WTH A;  2ML6 A;  3AMO B;  1VQ4 3;  4HKV B;  4FMB A;  3MKI A;  4HBR A;  3OWU A;  4XB5 A;  5HGR A;  2F86 B;  5TGN A;  3UL5 A;  2Z77 A;  1K41 A;  3IPT A;  2XF3 A;  4KVH A;  2B24 B;  1VQ5 3;  2E2U A;  1O7M B;  1E3R A;  2O9U X;  2GU1 A;  1OF5 A;  3H3H A;  5CF1 A;  3CCV 3;  1K28 A;  1UW1 A;  2OWP A;  3LT9 A;  2IUK A;  1DMM A;  2HMO B;  4IIA A;  2CK3 H;  2WOH A;  1ROA A;  2QA4 3;  4IPB A;  3ECF A;  3I56 3;  4HM6 B;  1ASK A;  4X2O A;  4XBY A;  1WNH A;  1YJW 3;  3BLZ A;  4EBG A;  4GB5 A;  1EA2 A;  3D9R A;  3IMA B;  1RKY A;  4BTX A;  3BNC A;  4R9K A;  1YI2 3;  3NBB A;  4BTW A;  1W4N A;  3MSO A;  1T5Y A;  3UL6 A;  4BTY A;  1SQW A;  2CFD A;  3CCQ 3;  3CCS 3;  1UI8 A;  3F8H A;  4J8T A;  2YFJ B;  2O3O A;  1OF5 B;  2K54 A;  3JUQ A;  4Q53 A;  1N9E A;  3N9H A;  3FZW A;  2STD A;  3MG1 A;  1GY7 A;  1YJ9 3;  3RGR A;  4MEI A;  1Q7Y 4;  4HJL B;  3HZP A;  1VQK 3;  4XDV A;  3SED A;  1JNQ A;  2PNC A;  3SOA A;  1A67 A;  3KII A;  1QVG 2;  4H61 A;  3WMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...