1EA2A

Pseudoreversion of the catalytic activity of y14f by the additional tyrosine-to-phenylalanine substitution(s) in the hydrogen bond network of delta-5-3-ketosteroid isomerase from pheudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Pseudoreversion of the Catalytic Activity of Y14F by the Additional Substitution(S) of Tyrosine with Phenylalanine in the Hydrogen Bond Network of Delta (5)-3-Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ea2A00
3G0KA 1JKGA 5IEPA 3BLZA 3JUMA 3FGYA 3GZXB 1OGXA 3ER7A 4WYKB 1Q40A 1IDPA 3MHEA 4RZMA 2GBWB 5CXOA 3F8XA 1GY5A 2UX0A 3BB9A 3RGRA 2YFLB 1VZZA 1ISKA 3MG3A 3EC9A 4HM6B 3EN8A 1JB5A 3OV4A 4L8OA 4HM2B 2HMMB 4XM4A 3K7CA 2PZVA 3NHXA 2HMOB 2F99A 2BNGA 3NUVA 3HX8A 2GEXA 3EN1B 1JB2A 1GY6A 2RFRA 3KE7A 1ZO2A 5BXQA 5JPUA 2HMNB 3H51A 5IENA 1ULIB 4XB5A 3KZTA 4HM0B 4FCJA 4XDVA 5IG5A 1OHPA 3EF8A 2HMKB 1OCVA 3B8LA 4U13A 4LEHA 4K1VA 3VSYA 2I9WA 2XSHB 1JN5B 3JUPA 3KSPA 8CHOA 3OWSA 1NU3A 1W6YA 3NM2A 2A15A 5JPPA 2HMJB 5D83A 1EG9B 2B1XB 3MG2A 4HM4B 2QGUA 1JB4A 4R9KA 2OWPA 1BUQA 4WP5A 3F7SA 1JKGB 3D9RA 3NV0A 1EA2A 2IMJA 3E99A 4GB5A 3FLJA 3K0ZA 3F7XA 1OUNA 1E97A 1Q40B 4XBTA 4KVHA 4WWUC 5EVHA 1NWWA 3RGAA 4XDWA 3DZLA 5IG0A 1UUVB 3B4OA 3JUNA 3KKGA 5D81A 3T8NA 6STDA 3SOAA 1O7NB 4X2OA 1C7HA 2YFIB 1DMMA 1QJGA 3EQQB 5CLKA 4HJLB 3JUQA 1DMNA 5AIGA 4LGQA 4STDA 3LYGA 3MSOA 1GYBA 1ZX2A 3LZAA 5AIIA 5KP4A 4HKVB 2XRXB 1W00A 1O7PB 1ULJB 1WQLB 4OUQA 3EBTA 3FZWA 1O7WB 5HGRA 4L7KA 3F40A 3CNMA 2YFJB 2Z76A 3EX9A 4ORLA 3UNLA 3GZYB 3GRDA 4XBYA 2B24B 4H3UA 5CF2A 3G16A 4HM3B 1GY7A 3SOYA 3NV0B 4L8PA 3NBRA 7STDA 3H3HA 3DMCA 5AI1A 4HM7B 1K41A 1W01A 1TUHA 2BMQB 1OH0A 1OHSA 5FW5A 3FH1A 5TGNA 3F8HA 3T8UA 4HM5B 3FF0A 1E3VA 2QIYA 2BMRB 1O7HB 5STDA 2JQ5A 3B7CA 5IG3A 2GXFA 3SEDA 2Z7AA 4FCMA 3EJVA 1Z1SA 4CDLA 3HK4A 1DMQA 1OF5A 5D82A 4K1UA 3MYTA 1GS3A 3F14A 3IPTA 3NXJA 3HZPA 1TP6A 1Q42A 3FSDA 5IF6A 2RGQA 3I0YA 3ROBA 4HZBB 2CKFB 1W02A 2GBXB 1SJWA 5AEUB 3G8ZA 4PEJA 1E3RA 4HM1B 3FF2A 3EBYA 3OWYA 1UUWB 2F98A 3OXAA 1NDOB 1ASKA 4R1KA 1A2KA 3JUOA 5DREA 5AIFA 4WYKA 3DM8A 1CQSA 4XBXA 5CK6A 1O7MB 2BMOB 4X2HA 3EHCA 1AR0A 5G2GA 5IEOA 1O7GB 2W2CA 3STDA 3B4PA 3DUKA 4OVMA 3VGNA 1HKXA 3ECFA 3FKAA 4LMIA 5KP3A 4J9AA 3UJMA 5AIHA 2XR8B 5AEWB 3CPOA 1S5AA 4R9LA 3CU3A 1QMAA 3GWRA 2HMLB 4J8TA 4MJDA 2CHCA 3MKIA 1OPYA 4I4KA 4IIAA 4Q53A 5IERA 3M8CA 2Z77A 5CF1A 5KP1A 1STDA 3A76A 5DRVA 1U5OA 2GEYA 1OF5B 3F9SA 1JN5A 4HM8B 2INXA 2STDA 4N3VA 3WMDA 3OX9A 3OWUA 3CNXA 1OGZA 3GZRA 2XSOB 2R4IA 3Q90A 2F86B 4HZ9B 5BVBA 5IG4A 3GZBA 3MG1A 1OHOA 3DXOA 2K54A 2RCDA 3S5CA 4HVNA
chains in the Genus database with same CATH superfamily
1IVXA 3G0KA 1I2FA 1JKGA 1NO3A 1I2EA 5IEPA 1Q9EA 1Q7HA 1HZ1A 3BLZA 3JUMA 3LT9A 3FGYA 4QWTA 3GZXB 1W4NA 3QK9A 2D1WA 1OGXA 1FYSA 2GU3A 3ER7A 3BU4A 4WYKB 1Q40A 1RGLA 4N6V0 1IDPA 1RGGA 1J2BA 4BU4A 1YJW3 4BL3A 3MHEA 4KZ1A 1B27A 4RZMA 3SXXA 6RNTA 2GBWB 2ML5A 4EV2A 8RNTA 1M904 3HOHA 5CXOA 1DVDA 1RKYA 2OCTA 2RBIA 1BNGA 3BIRA 3F8XA 1GY5A 3X3ZA 2Z6BA 1CH0A 2UX0A 3BB9A 3RGRA 2YFLB 3CC43 4LYLB 5ELJA 1VZZA 1X1YA 1K734 1ISKA 4KFDA 3MG3A 4R4KA 3EC9A 4HM6B 1MNLA 4EBGA 1WMNA 2GU1A 3EN8A 1JB5A 3OV4A 1YHQ3 2BT3A 2XFSA 4L8OA 1EQKA 1IT8A 1JRQA 4HM2B 4J5GA 1RGAA 2HMMB 4XM4A 3K7CA 2PZVA 1MWSA 1IVUA 4K90B 2KF5A 1LOVA 2F5WA 1GD3A 3NHXA 1JBTA 2HMOB 3CC73 2F99A 1ROVA 2BNGA 3DGMA 3HIIA 3NUVA 4EW5A 3HX8A 1LOYA 2GEXA 1JB2A 1GY6A 1I0XA 3EN1B 1I3IA 1I2GA 2RFRA 3NQZA 3KE7A 1ZO2A 5BXQA 1RGCA 5JPUA 2HMNB 2CW9A 1MWUA 1T2HA 3H51A 1DETA 1BRGA 3AMOB 5IENA 4KFFA 1ULIB 5GSPA 1TFOA 1MGWA 4XB5A 3KZTA 4HM0B 9RNTA 4FCJA 1MGRA 7RNTA 4TX4A 4XDVA 1VQ73 5IG5A 3DGNA 1OHPA 3EF8A 1AV4A 2HMKB 3AHWA 1K9M4 1STFI 2KF4A 1FGMA 3AHSA 1JBSA 1GSPA 2L4VA 2XFTA 1B2UA 3BNDA 1RCKA 3PCSA 1DYUA 1I70A 3KFQC 2WOFA 1OCVA 2IA7A 3B8LA 1F8NA 4U13A 1TU5A 4LEHA 2SBLA 1UCIA 4K1VA 3VSYA 1HYFA 3CC23 1IT7A 1GOYA 2SARA 3CCJ3 2Y74A 3LMLA 1M9GA 2I9WA 2KRTA 3A5EA 1BRKA 2XSHB 1JN5B 4EC6A 3WA3A 1BNSA 3JUPA 5BIRA 1I0VA 3KSPA 1PYLA 3U1WA 1TRQA 1R4YA 4O2HA 4BTXA 2BHMA 8CHOA 3OWSA 1PY3A 5IW9A 1BSBA 2K3DA 2IY2A 1N9EA 3HIGA 1NU3A 1W6YA 3N54B 3NM2A 1BNFA 2A15A 5LC7A 1Q864 2QEX3 3V98A 5RNTA 5JPPA 1C54A 2H0HA 2E2TA 2HMJB 1B21A 1RHLA 1RLSA 1YGEA 5D83A 1EG9B 4J5KA 2B1XB 1MOLA 3S27A 3WODG 1VQ63 2E2VA 3MG2A 3WOEB 2FGTA 3LTBA 3WDGB 1AVKA 1BNIA 4HM4B 1M1XB 2QGUA 4FMBA 1JB4A 3HI7A 4R9KA 2OWPA 4BTWA 3CCL3 1GMQA 3X3XA 3V99A 1BUQA 1LOXA 1BIRA 3LOYA 4WP5A 3IMAB 1WMPA 1RDSA 3F7SA 5JBSA 1JKGB 2W56A 3CD63 3D9RA 3NV0A 3RDEA 2W9QA 1EA2A 2IMJA 3E99A 4GB5A 3FLJA 3URPA 1KC84 3K0ZA 3F7XA 1T3BA 1OUNA 3PXMA 1E97A 1Q40B 5FGOA 3CXC2 2KAAA 1Y4KA 1K28A 1X1UA 2KXGA 2PNCA 4O02B 4XBTA 4KVHA 3CCR3 2ML6A 2YX9A 4WWUC 5EVHA 2Q07A 1NWWA 3UL6A 3RGAA 2WGQA 2CWVA 1EKMA 4N6NB 2CFDA 1VQM3 1GMPA 4XDWA 1BAOA 3CPW2 4BTYA 1DVCA 3DZLA 4OK0A 1UCJA 1GD4A 2AADA 1FGQA 1QVF2 2CX1A 5IG0A 1BOXA 1UUVB 1BRSA 3B4OA 3JUNA 3KKGA 3K5TA 5D81A 1BNJA 2OOVA 2UUGC 1RTUA 3SOAA 1BRIA 1T2IA 3T8NA 6STDA 3DGYA 1O7NB 1YVBI 2GSPA 2P09A 3BNEA 1BSCA 4X2OA 1LQGC 1C7HA 2YFIB 4AEQA 2QA43 2M7OA 1SQWA 3LT8A 1IVWA 1DMMA 2OTL3 1Q7Y4 1TIJA 1VQ93 1QJGA 2XGLA 3EQQB 1WMOA 5CLKA 1CYVA 4HJLB 2KF3A 1DMNA 3JUQA 3KSED 2F4YA 5AIGA 1BSEA 1D6ZA 4LGQA 4STDA 1B2ZA 1BRJA 3LYGA 4FMDA 1PU4A 3WHOA 3NX0A 1QAFA 4DKIA 1FGRA 3MSOA 1GYBA 1ZX2A 3NBBA 3O8YA 3SYUA 1TTOA 4ZM8A 1JNQA 3LZAA 5AIIA 3UL5A 3FCSB 1VQO3 3TDGA 4N6UA 5KP4A 3NQYA 4HKVB 1IU7A 5ELUA 1BSAA 1I3FA 2O3OA 2P38A 2XRXB 1RGEA 2OOVC 1N5PA 3PCRA 4JF8A 1GOUA 1W00A 1RGFA 2FNQA 1W2B2 1O7PB 2RNTA 1ULJB 2OQEA 2J8XB 1WQLB 4OUQA 3RNTA 2KF6A 3X42A 1BANA 3D5GA 3EBTA 1VQ43 2WGOA 3FZWA 1O7WB 4EYCA 3AGOA 3ALAA 3LXUX 4RNZA 1SARA 2F5MA 5HGRA 1VQQA 5LC6A 3T0UA 1JZDA 3F40A 4IT7A 4L7KA 5M18A 1LNIA 3S29A 1OACA 2Y73A 2BU4A 1YNVX 2CC3A 1UCLA 2BIRA 3PS8A 3CNMA 1PFPA 1UUGB 1VQK3 2YFJB 3VF1A 1UGHI 1RMSA 1D6YA 1LXEA 2Z76A 3EX9A 4ORLA 3UNLA 3GZYB 1BVIA 4JRFA 4RBNA 3SX1A 1BU4A 1FGTA 1SIIA 4RNYA 3CCQ3 2L1SA 1RRLA 1RNTA 3GRDA 2D42A 4XBYA 2ZA4A 2B24B 2XGNA 4FR9A 4H3UA 4GHOA 4CJNA 5CF2A 1M1K4 2OQEC 4G1MB 3BNBA 3G16A 4HM3B 4ILFA 1GY7A 3X3YA 2RSXA 1N5HA 3SOYA 3NV0B 1LNHA 1FZUA 2W03A 4L8PA 3NBRA 7STDA 2C10A 3H3HA 3DMCA 5AI1A 5EEOA 4HM7B 1K41A 1W01A 5A0OB 3MWZA 3J7Yd 3I553 1VQ83 1RN1A 2KCDA 2P0MA 4HYZA 1TJDA 1TUHA 4O8SA 2BMQB 1RN4A 1OH0A 1OHSA 2CFGA 5FW5A 3FH1A 3KIIA 5TGNA 1NJI4 3F8HA 1EEJA 1YI23 1VQP3 1BUJA 3T8UA 4LZIA 1QVG2 1JJ22 1GOVA 4HM5B 1D6UA 3FF0A 1E3VA 4BIRA 2QIYA 5AYRB 4R80A 1RNBA 1MWRA 3S28A 1AY7A 1KSIA 1A2VA 1RCLA 1RSNA 3PZWA 3G6E3 1KWIA 1I8VA 5M1AA 1YJ93 1W5ZA 2BMRB 1O7HB 5STDA 2JQ5A 3ZFZA 3B7CA 1IV9A 3CMA3 1N9JA 2W6JH 4GL6A 6GSPA 1R4CA 1TRPA 5IG3A 1CEWI 3K63A 2GXFA 2AAEA 3SEDA 1BNEA 1IK3A 2Z7AA 1FW7A 4FCMA 1W2ZA 1UCKA 1N8R4 3EJVA 1Z1SA 3CME3 1IQXA 1B2SA 1B3SA 3HK4A 3JVCA 1DMQA 4CDLA 1BRHA 2MF7A 2CWTA 3KCHA 4EXRA 4NPBA 3CCU3 2CK3H 4K61A 2W04A 1OF5A 4KT3B 4N6OB 5D82A 3N8BA 4K1UA 3MYTA 1MWTA 1GS3A 2O9UX 3F14A 3N9HA 1TFKA 3WR2A 3IPTA 3NXJA 1JBRA 4BL2A 3DGOA 3G713 3OW22 3HZPA 2FXTA 3GSPA 1TP6A 1Q42A 2LYXA 3WA2X 3FSDA 1IQYA 2CH9A 1WNHA 5IF6A 2LQVA 2RGQA 4HAAA 1IVVA 4CCVA 1U8CB 2CWUA 1LVNA 1N8QA 2ZL8A 1WTHA 3AGNA 1UI8A 3I0YA 4HOHA 1KD14 1FGOA 1RJOA 3ROBA 1SIHA 1UI7A 2K0MA 3LH4A 2CG1A 1YVSA 4HZBB 1YIT3 1BRNL 3NBJA 2CKFB 1FA3A 3D4AA 1W02A 2GBXB 1A67A 5G1LA 1SJWA 1HU9A 5AEUB 1RRHA 4IPBA 3G8ZA 3MPHA 4PEJA 4CPKA 1GMRA 7GSPA 1E3RA 4HM1B 3CCS3 1VQ53 3QRDA 1W7CA 3ZG0A 5AYSC 4EV5A 4WHAA 1FUSA 3FF2A 4HBRA 2H0IA 3EBYA 1X1XA 1UUWB 3DGLA 3OWYA 1BSDA 1IYYA 2C11A 2F98A 3OXAA 1NDOB 1ASKA 3KN4A 4MMXB 1BGSA 4R1KA 1A2KA 5M19A 3JUOA 1KQS2 5DREA 4NHFA 2P0XA 5AIFA 4N6TA 2CG0A 1FUTA 1IV7A 2CFKA 1UDII 4WYKA 4AKZA 1JV2B 3D79A 1AVLA 1QAKA 1CQSA 3DM8A 1G02A 2HOHA 4XBXA 5CK6A 2MC8A 1CYUA 1O7MB 2BMOB 2E2UA 4X2HA 3BNCA 1L5GB 1UW1A 3EHCA 1AR0A 5G2GA 5IEOA 3V92A 3GAXA 4LSOA 1O7GB 1T5YA 1EUIC 2JDIH 2W2CA 1NNVA 3DY5A 1V74A 2ZHXB 3STDA 3B4PA 1B2XA 1ROAA 3CCE3 1ZGXA 1Q814 3DUKA 3Q3FA 4OVMA 3VGNA 1HKXA 1RGHA 2WOHA 2XH9A 3LTDA 3ECFA 3FKAA 2F56A 2ZDJA 3S67A 3WOFB 3IJEB 3Q2PA 4LMIA 5KP3A 3I563 1RGKA 4J9AA 4O3VA 2XEPA 1X1WA 3LTAA 3SLUA 1VQL3 1B2MA 3UJMA 2W9PA 1B20A 1RN7A 3K9MC 5AIHA 2XR8B 5AEWB 3EB8A 2W56B 3CPOA 2P05A 2CX0A 1S5AA 3EE1A 3PGBA 1UGIA 4R9LA 2OTJ3 3CU3A 3FG1A 3D3LA 4MMZB 1QMAA 2UGIA 3GWRA 2HMLB 3L0RA 3ZG5A 1G96A 4J8TA 4MJDA 1IQ8A 5I97A 2CHCA 3AMOA 2IUJA 3FG4A 3MKIA 4MMYB 1S723 1JZOA 4FMAA 3X40A 4FMCA 1W6GA 4N6LA 3LTCA 1OPYA 2CIUA 4I5QA 4I4KA 4RNTA 5BU4A 4IIAA 1AQZA 3CCV3 1BNRA 3X41A 4Q53A 5IERA 3M8CA 3CCM3 2Z77A 5EQLA 5CF1A 2C4BA 1STDA 2IUKA 4H61A 3SVAA 5KP1A 3A76A 5DRVA 3G4S3 1QALA 2CFLA 1U5OA 2BO9B 4FCZA 2GEYA 1OF5B 2V1LA 4AKYA 3NM7A 2H0GA 1ZS7A 4GSPA 1Q824 1LOWA 2CFWA 4KFEA 3U97A 3F9SA 4MEIA 1JN5A 4HM8B 2INXA 2STDA 4N3VA 3WMDA 1K8A4 3OX9A 1YGWA 3UB1A 5G1KA 1FUWA 1LRAA 1YIJ3 1V57A 3DH2A 1NB3I 3PYJA 3OWUA 3CNXA 1OGZA 1SPUA 5HOHA 1LQMB 1YJN3 3GZRA 2XSOB 2R4IA 3Q1CA 1G0TA 1V58A 1DE3A 1A2PA 2XF3A 4N6MA 2R41A 3Q90A 2F86B 4HZ9B 5BVBA 3D5IA 4WFOA 1US1A 5IG4A 3GZBA 1A90A 3MG1A 1NB5I 1OHOA 2IYJA 2WO0A 3DXOA 3FG3A 2W0QA 2K54A 2RCDA 3S5CA 1VQN3 4NREA 4HVNA 1W6CA
chains in the Genus database with same CATH topology
1IVXA 3G0KA 1JKGA 1NO3A 5IEPA 3BLZA 3JUMA 3LT9A 3FGYA 4QWTA 3GZXB 1W4NA 3QK9A 2D1WA 1OGXA 2GU3A 3ER7A 4WYKB 1J2BA 1Q40A 4N6V0 1IDPA 1YJW3 3MHEA 4KZ1A 4RZMA 3SXXA 2GBWB 2ML5A 4EV2A 1M904 5CXOA 1DVDA 1RKYA 2OCTA 3F8XA 1GY5A 3X3ZA 2Z6BA 2UX0A 3BB9A 3RGRA 2YFLB 3CC43 5ELJA 1K734 1VZZA 1ISKA 4KFDA 3MG3A 4R4KA 3EC9A 4HM6B 1MNLA 4EBGA 1WMNA 2GU1A 3EN8A 1JB5A 3OV4A 1YHQ3 2BT3A 2XFSA 4L8OA 1EQKA 1IT8A 1JRQA 4HM2B 2HMMB 4XM4A 3K7CA 2PZVA 1IVUA 4K90B 1GD3A 3NHXA 2HMOB 3CC73 2F99A 1ROVA 2BNGA 3DGMA 3HIIA 3NUVA 3HX8A 2GEXA 3EN1B 1JB2A 1GY6A 2RFRA 3NQZA 3KE7A 1ZO2A 5BXQA 5JPUA 2HMNB 2CW9A 3H51A 3AMOB 5IENA 4KFFA 1ULIB 1TFOA 4XB5A 3KZTA 4HM0B 4FCJA 1VQ73 4TX4A 4XDVA 5IG5A 3DGNA 1OHPA 3EF8A 1AV4A 2HMKB 1K9M4 1STFI 1FGMA 3PCSA 2L4VA 2XFTA 3BNDA 1DYUA 3KFQC 2WOFA 1OCVA 2IA7A 3B8LA 1F8NA 4U13A 1TU5A 4LEHA 2SBLA 4K1VA 3VSYA 3CC23 1IT7A 3CCJ3 2Y74A 3LMLA 1M9GA 2I9WA 2KRTA 2XSHB 1JN5B 4EC6A 3WA3A 3JUPA 3KSPA 3U1WA 4O2HA 4BTXA 2BHMA 8CHOA 3OWSA 5IW9A 1N9EA 3HIGA 1NU3A 1W6YA 3N54B 3NM2A 2A15A 5LC7A 2QEX3 3V98A 5JPPA 2E2TA 2HMJB 1YGEA 5D83A 1EG9B 2B1XB 1MOLA 3S27A 3WODG 1VQ63 2E2VA 3MG2A 3WOEB 2FGTA 3LTBA 3WDGB 1AVKA 4HM4B 1M1XB 2QGUA 4FMBA 1JB4A 3HI7A 4R9KA 2OWPA 4BTWA 3CCL3 3X3XA 3V99A 1BUQA 1LOXA 3LOYA 4WP5A 3IMAB 1WMPA 3F7SA 5JBSA 1JKGB 2W56A 3CD63 3D9RA 3NV0A 3RDEA 2W9QA 1EA2A 2IMJA 3E99A 4GB5A 3FLJA 1KC84 3K0ZA 3F7XA 1OUNA 3PXMA 1E97A 1Q40B 5FGOA 3CXC2 1Y4KA 1K28A 2KXGA 2PNCA 4O02B 4XBTA 4KVHA 3CCR3 2ML6A 2YX9A 4WWUC 5EVHA 2Q07A 1NWWA 3UL6A 3RGAA 2WGQA 2CWVA 1EKMA 4N6NB 2CFDA 1VQM3 4XDWA 3CPW2 4BTYA 1DVCA 3DZLA 4OK0A 1GD4A 1FGQA 1QVF2 5IG0A 1UUVB 3B4OA 3JUNA 3KKGA 3K5TA 5D81A 2OOVA 3T8NA 6STDA 1Q864 3SOAA 1O7NB 1YVBI 2P09A 3BNEA 4X2OA 1C7HA 2YFIB 4AEQA 2QA43 2M7OA 1SQWA 3LT8A 1IVWA 1DMMA 2OTL3 1Q7Y4 1TIJA 1VQ93 1QJGA 2XGLA 3EQQB 1WMOA 5CLKA 1CYVA 4HJLB 3JUQA 1DMNA 3KSED 5AIGA 1D6ZA 4LGQA 4STDA 3LYGA 4FMDA 1PU4A 3NX0A 1QAFA 1FGRA 3MSOA 1GYBA 1ZX2A 3NBBA 3O8YA 4ZM8A 1JNQA 3LZAA 5AIIA 3UL5A 3FCSB 1VQO3 3TDGA 4N6UA 5KP4A 3NQYA 4HKVB 1IU7A 5ELUA 2P38A 2XRXB 2O3OA 2OOVC 1N5PA 3PCRA 4JF8A 1W00A 2FNQA 1W2B2 1O7PB 1ULJB 2OQEA 1WQLB 4OUQA 3X42A 3EBTA 1VQ43 2WGOA 3FZWA 1O7WB 4EYCA 3ALAA 3LXUX 4RNZA 5HGRA 5LC6A 3T0UA 4L7KA 3F40A 4IT7A 3S29A 1OACA 2Y73A 2CC3A 3PS8A 3CNMA 1PFPA 1VQK3 2YFJB 3VF1A 1D6YA 1LXEA 2Z76A 3EX9A 4ORLA 3UNLA 3GZYB 4JRFA 4RBNA 3SX1A 1SIIA 1FGTA 4RNYA 3CCQ3 1RRLA 3GRDA 2D42A 4XBYA 2B24B 2XGNA 4FR9A 4H3UA 5CF2A 1M1K4 2OQEC 4G1MB 3BNBA 3G16A 4HM3B 1GY7A 3X3YA 2RSXA 1N5HA 3SOYA 3NV0B 1LNHA 2W03A 4L8PA 3NBRA 7STDA 2C10A 3H3HA 3DMCA 5AI1A 5EEOA 4HM7B 1K41A 1W01A 5A0OB 3MWZA 3J7Yd 3I553 1VQ83 2KCDA 2P0MA 4HYZA 4O8SA 1TUHA 2BMQB 1OH0A 1OHSA 2CFGA 5FW5A 3FH1A 3KIIA 5TGNA 1NJI4 3F8HA 1YI23 1VQP3 3T8UA 4LZIA 1QVG2 1JJ22 4HM5B 1D6UA 3FF0A 1E3VA 2QIYA 5AYRB 4R80A 3S28A 1KSIA 1A2VA 3PZWA 3G6E3 1KWIA 1YJ93 1W5ZA 2BMRB 1O7HB 5STDA 2JQ5A 3B7CA 1IV9A 3CMA3 1N9JA 2W6JH 4GL6A 1R4CA 5IG3A 1CEWI 3K63A 2GXFA 3SEDA 1IK3A 2Z7AA 4FCMA 1W2ZA 1N8R4 3EJVA 1Z1SA 3CME3 1IQXA 3JVCA 4CDLA 3HK4A 1DMQA 2MF7A 2CWTA 4EXRA 3CCU3 2CK3H 4K61A 2W04A 1OF5A 4N6OB 5D82A 3N8BA 4K1UA 3MYTA 1GS3A 2O9UX 3F14A 3N9HA 1TFKA 3IPTA 3NXJA 3DGOA 3G713 3OW22 3HZPA 2FXTA 3WA2X 1TP6A 1Q42A 2LYXA 3FSDA 1IQYA 2CH9A 1WNHA 5IF6A 2LQVA 2RGQA 1IVVA 4CCVA 1U8CB 2CWUA 2ZL8A 1LVNA 1N8QA 1WTHA 3I0YA 1UI8A 1KD14 1FGOA 1RJOA 3ROBA 1SIHA 1UI7A 2K0MA 3LH4A 2CG1A 1YIT3 4HZBB 1FA3A 3NBJA 2CKFB 1W02A 2GBXB 1A67A 1SJWA 1HU9A 5AEUB 1RRHA 4IPBA 3G8ZA 3MPHA 4PEJA 1E3RA 4HM1B 3CCS3 1VQ53 3QRDA 1W7CA 5AYSC 4EV5A 4WHAA 3FF2A 4HBRA 3EBYA 3OWYA 1UUWB 3DGLA 2C11A 2F98A 3OXAA 1NDOB 1ASKA 3KN4A 4MMXB 4R1KA 1A2KA 3JUOA 1KQS2 5DREA 4NHFA 2P0XA 5AIFA 4N6TA 2CG0A 1IV7A 2CFKA 4WYKA 4AKZA 1JV2B 1AVLA 1QAKA 1CQSA 3DM8A 4XBXA 2MC8A 5CK6A 1CYUA 1O7MB 2BMOB 2E2UA 4X2HA 3BNCA 1L5GB 1UW1A 3EHCA 1AR0A 5G2GA 5IEOA 3V92A 3GAXA 4LSOA 1O7GB 1T5YA 2JDIH 3DY5A 2W2CA 1V74A 3STDA 3B4PA 3CCE3 1ROAA 1Q814 3DUKA 4OVMA 3VGNA 1HKXA 2WOHA 2XH9A 3LTDA 3ECFA 3FKAA 2ZDJA 3S67A 3WOFB 3IJEB 3Q2PA 4LMIA 5KP3A 3I563 4J9AA 4O3VA 3SLUA 2XEPA 1VQL3 3LTAA 3UJMA 2W9PA 1RN7A 3K9MC 5AIHA 2XR8B 5AEWB 3EB8A 2W56B 3CPOA 2P05A 3EE1A 1S5AA 3PGBA 4R9LA 2OTJ3 3CU3A 3FG1A 3D3LA 4MMZB 1QMAA 3GWRA 2HMLB 3L0RA 1G96A 4J8TA 4MJDA 1IQ8A 5I97A 2CHCA 3AMOA 2IUJA 3FG4A 3MKIA 4MMYB 1S723 4FMAA 3X40A 4FMCA 1W6GA 4N6LA 3LTCA 1OPYA 2CIUA 4I4KA 4IIAA 3CCV3 3X41A 4Q53A 5IERA 3M8CA 3CCM3 2Z77A 5EQLA 5CF1A 3SVAA 1STDA 2IUKA 4H61A 5KP1A 3A76A 5DRVA 3G4S3 1QALA 2CFLA 1U5OA 2BO9B 4FCZA 2GEYA 1OF5B 2V1LA 4AKYA 3NM7A 1Q824 2CFWA 4KFEA 3U97A 3F9SA 4MEIA 1JN5A 4HM8B 2INXA 2STDA 4N3VA 3WMDA 1K8A4 3OX9A 3UB1A 1FUWA 1YIJ3 1NB3I 3PYJA 3OWUA 3CNXA 1OGZA 1SPUA 1YJN3 3GZRA 2XSOB 2R4IA 3Q1CA 2XF3A 4N6MA 3Q90A 2F86B 4HZ9B 5BVBA 4WFOA 1US1A 5IG4A 3GZBA 1A90A 3MG1A 1NB5I 1OHOA 2WO0A 3DXOA 3FG3A 2W0QA 2K54A 2RCDA 3S5CA 1VQN3 4NREA 4HVNA 1W6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0K A;  1JKG A;  5IEP A;  3BLZ A;  3JUM A;  3FGY A;  3GZX B;  1OGX A;  3ER7 A;  4WYK B;  1Q40 A;  1IDP A;  3MHE A;  4RZM A;  2GBW B;  5CXO A;  3F8X A;  1GY5 A;  2UX0 A;  3BB9 A;  3RGR A;  2YFL B;  1VZZ A;  1ISK A;  3MG3 A;  3EC9 A;  4HM6 B;  3EN8 A;  1JB5 A;  3OV4 A;  4L8O A;  4HM2 B;  2HMM B;  4XM4 A;  3K7C A;  2PZV A;  3NHX A;  2HMO B;  2F99 A;  2BNG A;  3NUV A;  3HX8 A;  2GEX A;  3EN1 B;  1JB2 A;  1GY6 A;  2RFR A;  3KE7 A;  1ZO2 A;  5BXQ A;  5JPU A;  2HMN B;  3H51 A;  5IEN A;  1ULI B;  4XB5 A;  3KZT A;  4HM0 B;  4FCJ A;  4XDV A;  5IG5 A;  1OHP A;  3EF8 A;  2HMK B;  1OCV A;  3B8L A;  4U13 A;  4LEH A;  4K1V A;  3VSY A;  2I9W A;  2XSH B;  1JN5 B;  3JUP A;  3KSP A;  8CHO A;  3OWS A;  1NU3 A;  1W6Y A;  3NM2 A;  2A15 A;  5JPP A;  2HMJ B;  5D83 A;  1EG9 B;  2B1X B;  3MG2 A;  4HM4 B;  2QGU A;  1JB4 A;  4R9K A;  2OWP A;  1BUQ A;  4WP5 A;  3F7S A;  1JKG B;  3D9R A;  3NV0 A;  1EA2 A;  2IMJ A;  3E99 A;  4GB5 A;  3FLJ A;  3K0Z A;  3F7X A;  1OUN A;  1E97 A;  1Q40 B;  4XBT A;  4KVH A;  4WWU C;  5EVH A;  1NWW A;  3RGA A;  4XDW A;  3DZL A;  5IG0 A;  1UUV B;  3B4O A;  3JUN A;  3KKG A;  5D81 A;  3T8N A;  6STD A;  3SOA A;  1O7N B;  4X2O A;  1C7H A;  2YFI B;  1DMM A;  1QJG A;  3EQQ B;  5CLK A;  4HJL B;  3JUQ A;  1DMN A;  5AIG A;  4LGQ A;  4STD A;  3LYG A;  3MSO A;  1GYB A;  1ZX2 A;  3LZA A;  5AII A;  5KP4 A;  4HKV B;  2XRX B;  1W00 A;  1O7P B;  1ULJ B;  1WQL B;  4OUQ A;  3EBT A;  3FZW A;  1O7W B;  5HGR A;  4L7K A;  3F40 A;  3CNM A;  2YFJ B;  2Z76 A;  3EX9 A;  4ORL A;  3UNL A;  3GZY B;  3GRD A;  4XBY A;  2B24 B;  4H3U A;  5CF2 A;  3G16 A;  4HM3 B;  1GY7 A;  3SOY A;  3NV0 B;  4L8P A;  3NBR A;  7STD A;  3H3H A;  3DMC A;  5AI1 A;  4HM7 B;  1K41 A;  1W01 A;  1TUH A;  2BMQ B;  1OH0 A;  1OHS A;  5FW5 A;  3FH1 A;  5TGN A;  3F8H A;  3T8U A;  4HM5 B;  3FF0 A;  1E3V A;  2QIY A;  2BMR B;  1O7H B;  5STD A;  2JQ5 A;  3B7C A;  5IG3 A;  2GXF A;  3SED A;  2Z7A A;  4FCM A;  3EJV A;  1Z1S A;  4CDL A;  3HK4 A;  1DMQ A;  1OF5 A;  5D82 A;  4K1U A;  3MYT A;  1GS3 A;  3F14 A;  3IPT A;  3NXJ A;  3HZP A;  1TP6 A;  1Q42 A;  3FSD A;  5IF6 A;  2RGQ A;  3I0Y A;  3ROB A;  4HZB B;  2CKF B;  1W02 A;  2GBX B;  1SJW A;  5AEU B;  3G8Z A;  4PEJ A;  1E3R A;  4HM1 B;  3FF2 A;  3EBY A;  3OWY A;  1UUW B;  2F98 A;  3OXA A;  1NDO B;  1ASK A;  4R1K A;  1A2K A;  3JUO A;  5DRE A;  5AIF A;  4WYK A;  3DM8 A;  1CQS A;  4XBX A;  5CK6 A;  1O7M B;  2BMO B;  4X2H A;  3EHC A;  1AR0 A;  5G2G A;  5IEO A;  1O7G B;  2W2C A;  3STD A;  3B4P A;  3DUK A;  4OVM A;  3VGN A;  1HKX A;  3ECF A;  3FKA A;  4LMI A;  5KP3 A;  4J9A A;  3UJM A;  5AIH A;  2XR8 B;  5AEW B;  3CPO A;  1S5A A;  4R9L A;  3CU3 A;  1QMA A;  3GWR A;  2HML B;  4J8T A;  4MJD A;  2CHC A;  3MKI A;  1OPY A;  4I4K A;  4IIA A;  4Q53 A;  5IER A;  3M8C A;  2Z77 A;  5CF1 A;  5KP1 A;  1STD A;  3A76 A;  5DRV A;  1U5O A;  2GEY A;  1OF5 B;  3F9S A;  1JN5 A;  4HM8 B;  2INX A;  2STD A;  4N3V A;  3WMD A;  3OX9 A;  3OWU A;  3CNX A;  1OGZ A;  3GZR A;  2XSO B;  2R4I A;  3Q90 A;  2F86 B;  4HZ9 B;  5BVB A;  5IG4 A;  3GZB A;  3MG1 A;  1OHO A;  3DXO A;  2K54 A;  2RCD A;  3S5C A;  4HVN A; 
#chains in the Genus database with same CATH topology
 1IVX A;  3G0K A;  1I2F A;  1JKG A;  1NO3 A;  1I2E A;  5IEP A;  1Q9E A;  1Q7H A;  1HZ1 A;  3BLZ A;  3JUM A;  3LT9 A;  3FGY A;  4QWT A;  3GZX B;  1W4N A;  3QK9 A;  2D1W A;  1OGX A;  1FYS A;  2GU3 A;  3ER7 A;  3BU4 A;  4WYK B;  1Q40 A;  1RGL A;  4N6V 0;  1IDP A;  1RGG A;  1J2B A;  4BU4 A;  1YJW 3;  4BL3 A;  3MHE A;  4KZ1 A;  1B27 A;  4RZM A;  3SXX A;  6RNT A;  2GBW B;  2ML5 A;  4EV2 A;  8RNT A;  1M90 4;  3HOH A;  5CXO A;  1DVD A;  1RKY A;  2OCT A;  2RBI A;  1BNG A;  3BIR A;  3F8X A;  1GY5 A;  3X3Z A;  2Z6B A;  1CH0 A;  2UX0 A;  3BB9 A;  3RGR A;  2YFL B;  3CC4 3;  4LYL B;  5ELJ A;  1VZZ A;  1X1Y A;  1K73 4;  1ISK A;  4KFD A;  3MG3 A;  4R4K A;  3EC9 A;  4HM6 B;  1MNL A;  4EBG A;  1WMN A;  2GU1 A;  3EN8 A;  1JB5 A;  3OV4 A;  1YHQ 3;  2BT3 A;  2XFS A;  4L8O A;  1EQK A;  1IT8 A;  1JRQ A;  4HM2 B;  4J5G A;  1RGA A;  2HMM B;  4XM4 A;  3K7C A;  2PZV A;  1MWS A;  1IVU A;  4K90 B;  2KF5 A;  1LOV A;  2F5W A;  1GD3 A;  3NHX A;  1JBT A;  2HMO B;  3CC7 3;  2F99 A;  1ROV A;  2BNG A;  3DGM A;  3HII A;  3NUV A;  4EW5 A;  3HX8 A;  1LOY A;  2GEX A;  1JB2 A;  1GY6 A;  1I0X A;  3EN1 B;  1I3I A;  1I2G A;  2RFR A;  3NQZ A;  3KE7 A;  1ZO2 A;  5BXQ A;  1RGC A;  5JPU A;  2HMN B;  2CW9 A;  1MWU A;  1T2H A;  3H51 A;  1DET A;  1BRG A;  3AMO B;  5IEN A;  4KFF A;  1ULI B;  5GSP A;  1TFO A;  1MGW A;  4XB5 A;  3KZT A;  4HM0 B;  9RNT A;  4FCJ A;  1MGR A;  7RNT A;  4TX4 A;  4XDV A;  1VQ7 3;  5IG5 A;  3DGN A;  1OHP A;  3EF8 A;  1AV4 A;  2HMK B;  3AHW A;  1K9M 4;  1STF I;  2KF4 A;  1FGM A;  3AHS A;  1JBS A;  1GSP A;  2L4V A;  2XFT A;  1B2U A;  3BND A;  1RCK A;  3PCS A;  1DYU A;  1I70 A;  3KFQ C;  2WOF A;  1OCV A;  2IA7 A;  3B8L A;  1F8N A;  4U13 A;  1TU5 A;  4LEH A;  2SBL A;  1UCI A;  4K1V A;  3VSY A;  1HYF A;  3CC2 3;  1IT7 A;  1GOY A;  2SAR A;  3CCJ 3;  2Y74 A;  3LML A;  1M9G A;  2I9W A;  2KRT A;  3A5E A;  1BRK A;  2XSH B;  1JN5 B;  4EC6 A;  3WA3 A;  1BNS A;  3JUP A;  5BIR A;  1I0V A;  3KSP A;  1PYL A;  3U1W A;  1TRQ A;  1R4Y A;  4O2H A;  4BTX A;  2BHM A;  8CHO A;  3OWS A;  1PY3 A;  5IW9 A;  1BSB A;  2K3D A;  2IY2 A;  1N9E A;  3HIG A;  1NU3 A;  1W6Y A;  3N54 B;  3NM2 A;  1BNF A;  2A15 A;  5LC7 A;  1Q86 4;  2QEX 3;  3V98 A;  5RNT A;  5JPP A;  1C54 A;  2H0H A;  2E2T A;  2HMJ B;  1B21 A;  1RHL A;  1RLS A;  1YGE A;  5D83 A;  1EG9 B;  4J5K A;  2B1X B;  1MOL A;  3S27 A;  3WOD G;  1VQ6 3;  2E2V A;  3MG2 A;  3WOE B;  2FGT A;  3LTB A;  3WDG B;  1AVK A;  1BNI A;  4HM4 B;  1M1X B;  2QGU A;  4FMB A;  1JB4 A;  3HI7 A;  4R9K A;  2OWP A;  4BTW A;  3CCL 3;  1GMQ A;  3X3X A;  3V99 A;  1BUQ A;  1LOX A;  1BIR A;  3LOY A;  4WP5 A;  3IMA B;  1WMP A;  1RDS A;  3F7S A;  5JBS A;  1JKG B;  2W56 A;  3CD6 3;  3D9R A;  3NV0 A;  3RDE A;  2W9Q A;  1EA2 A;  2IMJ A;  3E99 A;  4GB5 A;  3FLJ A;  3URP A;  1KC8 4;  3K0Z A;  3F7X A;  1T3B A;  1OUN A;  3PXM A;  1E97 A;  1Q40 B;  5FGO A;  3CXC 2;  2KAA A;  1Y4K A;  1K28 A;  1X1U A;  2KXG A;  2PNC A;  4O02 B;  4XBT A;  4KVH A;  3CCR 3;  2ML6 A;  2YX9 A;  4WWU C;  5EVH A;  2Q07 A;  1NWW A;  3UL6 A;  3RGA A;  2WGQ A;  2CWV A;  1EKM A;  4N6N B;  2CFD A;  1VQM 3;  1GMP A;  4XDW A;  1BAO A;  3CPW 2;  4BTY A;  1DVC A;  3DZL A;  4OK0 A;  1UCJ A;  1GD4 A;  2AAD A;  1FGQ A;  1QVF 2;  2CX1 A;  5IG0 A;  1BOX A;  1UUV B;  1BRS A;  3B4O A;  3JUN A;  3KKG A;  3K5T A;  5D81 A;  1BNJ A;  2OOV A;  2UUG C;  1RTU A;  3SOA A;  1BRI A;  1T2I A;  3T8N A;  6STD A;  3DGY A;  1O7N B;  1YVB I;  2GSP A;  2P09 A;  3BNE A;  1BSC A;  4X2O A;  1LQG C;  1C7H A;  2YFI B;  4AEQ A;  2QA4 3;  2M7O A;  1SQW A;  3LT8 A;  1IVW A;  1DMM A;  2OTL 3;  1Q7Y 4;  1TIJ A;  1VQ9 3;  1QJG A;  2XGL A;  3EQQ B;  1WMO A;  5CLK A;  1CYV A;  4HJL B;  2KF3 A;  1DMN A;  3JUQ A;  3KSE D;  2F4Y A;  5AIG A;  1BSE A;  1D6Z A;  4LGQ A;  4STD A;  1B2Z A;  1BRJ A;  3LYG A;  4FMD A;  1PU4 A;  3WHO A;  3NX0 A;  1QAF A;  4DKI A;  1FGR A;  3MSO A;  1GYB A;  1ZX2 A;  3NBB A;  3O8Y A;  3SYU A;  1TTO A;  4ZM8 A;  1JNQ A;  3LZA A;  5AII A;  3UL5 A;  3FCS B;  1VQO 3;  3TDG A;  4N6U A;  5KP4 A;  3NQY A;  4HKV B;  1IU7 A;  5ELU A;  1BSA A;  1I3F A;  2O3O A;  2P38 A;  2XRX B;  1RGE A;  2OOV C;  1N5P A;  3PCR A;  4JF8 A;  1GOU A;  1W00 A;  1RGF A;  2FNQ A;  1W2B 2;  1O7P B;  2RNT A;  1ULJ B;  2OQE A;  2J8X B;  1WQL B;  4OUQ A;  3RNT A;  2KF6 A;  3X42 A;  1BAN A;  3D5G A;  3EBT A;  1VQ4 3;  2WGO A;  3FZW A;  1O7W B;  4EYC A;  3AGO A;  3ALA A;  3LXU X;  4RNZ A;  1SAR A;  2F5M A;  5HGR A;  1VQQ A;  5LC6 A;  3T0U A;  1JZD A;  3F40 A;  4IT7 A;  4L7K A;  5M18 A;  1LNI A;  3S29 A;  1OAC A;  2Y73 A;  2BU4 A;  1YNV X;  2CC3 A;  1UCL A;  2BIR A;  3PS8 A;  3CNM A;  1PFP A;  1UUG B;  1VQK 3;  2YFJ B;  3VF1 A;  1UGH I;  1RMS A;  1D6Y A;  1LXE A;  2Z76 A;  3EX9 A;  4ORL A;  3UNL A;  3GZY B;  1BVI A;  4JRF A;  4RBN A;  3SX1 A;  1BU4 A;  1FGT A;  1SII A;  4RNY A;  3CCQ 3;  2L1S A;  1RRL A;  1RNT A;  3GRD A;  2D42 A;  4XBY A;  2ZA4 A;  2B24 B;  2XGN A;  4FR9 A;  4H3U A;  4GHO A;  4CJN A;  5CF2 A;  1M1K 4;  2OQE C;  4G1M B;  3BNB A;  3G16 A;  4HM3 B;  4ILF A;  1GY7 A;  3X3Y A;  2RSX A;  1N5H A;  3SOY A;  3NV0 B;  1LNH A;  1FZU A;  2W03 A;  4L8P A;  3NBR A;  7STD A;  2C10 A;  3H3H A;  3DMC A;  5AI1 A;  5EEO A;  4HM7 B;  1K41 A;  1W01 A;  5A0O B;  3MWZ A;  3J7Y d;  3I55 3;  1VQ8 3;  1RN1 A;  2KCD A;  2P0M A;  4HYZ A;  1TJD A;  1TUH A;  4O8S A;  2BMQ B;  1RN4 A;  1OH0 A;  1OHS A;  2CFG A;  5FW5 A;  3FH1 A;  3KII A;  5TGN A;  1NJI 4;  3F8H A;  1EEJ A;  1YI2 3;  1VQP 3;  1BUJ A;  3T8U A;  4LZI A;  1QVG 2;  1JJ2 2;  1GOV A;  4HM5 B;  1D6U A;  3FF0 A;  1E3V A;  4BIR A;  2QIY A;  5AYR B;  4R80 A;  1RNB A;  1MWR A;  3S28 A;  1AY7 A;  1KSI A;  1A2V A;  1RCL A;  1RSN A;  3PZW A;  3G6E 3;  1KWI A;  1I8V A;  5M1A A;  1YJ9 3;  1W5Z A;  2BMR B;  1O7H B;  5STD A;  2JQ5 A;  3ZFZ A;  3B7C A;  1IV9 A;  3CMA 3;  1N9J A;  2W6J H;  4GL6 A;  6GSP A;  1R4C A;  1TRP A;  5IG3 A;  1CEW I;  3K63 A;  2GXF A;  2AAE A;  3SED A;  1BNE A;  1IK3 A;  2Z7A A;  1FW7 A;  4FCM A;  1W2Z A;  1UCK A;  1N8R 4;  3EJV A;  1Z1S A;  3CME 3;  1IQX A;  1B2S A;  1B3S A;  3HK4 A;  3JVC A;  1DMQ A;  4CDL A;  1BRH A;  2MF7 A;  2CWT A;  3KCH A;  4EXR A;  4NPB A;  3CCU 3;  2CK3 H;  4K61 A;  2W04 A;  1OF5 A;  4KT3 B;  4N6O B;  5D82 A;  3N8B A;  4K1U A;  3MYT A;  1MWT A;  1GS3 A;  2O9U X;  3F14 A;  3N9H A;  1TFK A;  3WR2 A;  3IPT A;  3NXJ A;  1JBR A;  4BL2 A;  3DGO A;  3G71 3;  3OW2 2;  3HZP A;  2FXT A;  3GSP A;  1TP6 A;  1Q42 A;  2LYX A;  3WA2 X;  3FSD A;  1IQY A;  2CH9 A;  1WNH A;  5IF6 A;  2LQV A;  2RGQ A;  4HAA A;  1IVV A;  4CCV A;  1U8C B;  2CWU A;  1LVN A;  1N8Q A;  2ZL8 A;  1WTH A;  3AGN A;  1UI8 A;  3I0Y A;  4HOH A;  1KD1 4;  1FGO A;  1RJO A;  3ROB A;  1SIH A;  1UI7 A;  2K0M A;  3LH4 A;  2CG1 A;  1YVS A;  4HZB B;  1YIT 3;  1BRN L;  3NBJ A;  2CKF B;  1FA3 A;  3D4A A;  1W02 A;  2GBX B;  1A67 A;  5G1L A;  1SJW A;  1HU9 A;  5AEU B;  1RRH A;  4IPB A;  3G8Z A;  3MPH A;  4PEJ A;  4CPK A;  1GMR A;  7GSP A;  1E3R A;  4HM1 B;  3CCS 3;  1VQ5 3;  3QRD A;  1W7C A;  3ZG0 A;  5AYS C;  4EV5 A;  4WHA A;  1FUS A;  3FF2 A;  4HBR A;  2H0I A;  3EBY A;  1X1X A;  1UUW B;  3DGL A;  3OWY A;  1BSD A;  1IYY A;  2C11 A;  2F98 A;  3OXA A;  1NDO B;  1ASK A;  3KN4 A;  4MMX B;  1BGS A;  4R1K A;  1A2K A;  5M19 A;  3JUO A;  1KQS 2;  5DRE A;  4NHF A;  2P0X A;  5AIF A;  4N6T A;  2CG0 A;  1FUT A;  1IV7 A;  2CFK A;  1UDI I;  4WYK A;  4AKZ A;  1JV2 B;  3D79 A;  1AVL A;  1QAK A;  1CQS A;  3DM8 A;  1G02 A;  2HOH A;  4XBX A;  5CK6 A;  2MC8 A;  1CYU A;  1O7M B;  2BMO B;  2E2U A;  4X2H A;  3BNC A;  1L5G B;  1UW1 A;  3EHC A;  1AR0 A;  5G2G A;  5IEO A;  3V92 A;  3GAX A;  4LSO A;  1O7G B;  1T5Y A;  1EUI C;  2JDI H;  2W2C A;  1NNV A;  3DY5 A;  1V74 A;  2ZHX B;  3STD A;  3B4P A;  1B2X A;  1ROA A;  3CCE 3;  1ZGX A;  1Q81 4;  3DUK A;  3Q3F A;  4OVM A;  3VGN A;  1HKX A;  1RGH A;  2WOH A;  2XH9 A;  3LTD A;  3ECF A;  3FKA A;  2F56 A;  2ZDJ A;  3S67 A;  3WOF B;  3IJE B;  3Q2P A;  4LMI A;  5KP3 A;  3I56 3;  1RGK A;  4J9A A;  4O3V A;  2XEP A;  1X1W A;  3LTA A;  3SLU A;  1VQL 3;  1B2M A;  3UJM A;  2W9P A;  1B20 A;  1RN7 A;  3K9M C;  5AIH A;  2XR8 B;  5AEW B;  3EB8 A;  2W56 B;  3CPO A;  2P05 A;  2CX0 A;  1S5A A;  3EE1 A;  3PGB A;  1UGI A;  4R9L A;  2OTJ 3;  3CU3 A;  3FG1 A;  3D3L A;  4MMZ B;  1QMA A;  2UGI A;  3GWR A;  2HML B;  3L0R A;  3ZG5 A;  1G96 A;  4J8T A;  4MJD A;  1IQ8 A;  5I97 A;  2CHC A;  3AMO A;  2IUJ A;  3FG4 A;  3MKI A;  4MMY B;  1S72 3;  1JZO A;  4FMA A;  3X40 A;  4FMC A;  1W6G A;  4N6L A;  3LTC A;  1OPY A;  2CIU A;  4I5Q A;  4I4K A;  4RNT A;  5BU4 A;  4IIA A;  1AQZ A;  3CCV 3;  1BNR A;  3X41 A;  4Q53 A;  5IER A;  3M8C A;  3CCM 3;  2Z77 A;  5EQL A;  5CF1 A;  2C4B A;  1STD A;  2IUK A;  4H61 A;  3SVA A;  5KP1 A;  3A76 A;  5DRV A;  3G4S 3;  1QAL A;  2CFL A;  1U5O A;  2BO9 B;  4FCZ A;  2GEY A;  1OF5 B;  2V1L A;  4AKY A;  3NM7 A;  2H0G A;  1ZS7 A;  4GSP A;  1Q82 4;  1LOW A;  2CFW A;  4KFE A;  3U97 A;  3F9S A;  4MEI A;  1JN5 A;  4HM8 B;  2INX A;  2STD A;  4N3V A;  3WMD A;  1K8A 4;  3OX9 A;  1YGW A;  3UB1 A;  5G1K A;  1FUW A;  1LRA A;  1YIJ 3;  1V57 A;  3DH2 A;  1NB3 I;  3PYJ A;  3OWU A;  3CNX A;  1OGZ A;  1SPU A;  5HOH A;  1LQM B;  1YJN 3;  3GZR A;  2XSO B;  2R4I A;  3Q1C A;  1G0T A;  1V58 A;  1DE3 A;  1A2P A;  2XF3 A;  4N6M A;  2R41 A;  3Q90 A;  2F86 B;  4HZ9 B;  5BVB A;  3D5I A;  4WFO A;  1US1 A;  5IG4 A;  3GZB A;  1A90 A;  3MG1 A;  1NB5 I;  1OHO A;  2IYJ A;  2WO0 A;  3DXO A;  3FG3 A;  2W0Q A;  2K54 A;  2RCD A;  3S5C A;  1VQN 3;  4NRE A;  4HVN A;  1W6C A; 
#chains in the Genus database with same CATH homology
 1IVX A;  3G0K A;  1JKG A;  1NO3 A;  5IEP A;  3BLZ A;  3JUM A;  3LT9 A;  3FGY A;  4QWT A;  3GZX B;  1W4N A;  3QK9 A;  2D1W A;  1OGX A;  2GU3 A;  3ER7 A;  4WYK B;  1J2B A;  1Q40 A;  4N6V 0;  1IDP A;  1YJW 3;  3MHE A;  4KZ1 A;  4RZM A;  3SXX A;  2GBW B;  2ML5 A;  4EV2 A;  1M90 4;  5CXO A;  1DVD A;  1RKY A;  2OCT A;  3F8X A;  1GY5 A;  3X3Z A;  2Z6B A;  2UX0 A;  3BB9 A;  3RGR A;  2YFL B;  3CC4 3;  5ELJ A;  1K73 4;  1VZZ A;  1ISK A;  4KFD A;  3MG3 A;  4R4K A;  3EC9 A;  4HM6 B;  1MNL A;  4EBG A;  1WMN A;  2GU1 A;  3EN8 A;  1JB5 A;  3OV4 A;  1YHQ 3;  2BT3 A;  2XFS A;  4L8O A;  1EQK A;  1IT8 A;  1JRQ A;  4HM2 B;  2HMM B;  4XM4 A;  3K7C A;  2PZV A;  1IVU A;  4K90 B;  1GD3 A;  3NHX A;  2HMO B;  3CC7 3;  2F99 A;  1ROV A;  2BNG A;  3DGM A;  3HII A;  3NUV A;  3HX8 A;  2GEX A;  3EN1 B;  1JB2 A;  1GY6 A;  2RFR A;  3NQZ A;  3KE7 A;  1ZO2 A;  5BXQ A;  5JPU A;  2HMN B;  2CW9 A;  3H51 A;  3AMO B;  5IEN A;  4KFF A;  1ULI B;  1TFO A;  4XB5 A;  3KZT A;  4HM0 B;  4FCJ A;  1VQ7 3;  4TX4 A;  4XDV A;  5IG5 A;  3DGN A;  1OHP A;  3EF8 A;  1AV4 A;  2HMK B;  1K9M 4;  1STF I;  1FGM A;  3PCS A;  2L4V A;  2XFT A;  3BND A;  1DYU A;  3KFQ C;  2WOF A;  1OCV A;  2IA7 A;  3B8L A;  1F8N A;  4U13 A;  1TU5 A;  4LEH A;  2SBL A;  4K1V A;  3VSY A;  3CC2 3;  1IT7 A;  3CCJ 3;  2Y74 A;  3LML A;  1M9G A;  2I9W A;  2KRT A;  2XSH B;  1JN5 B;  4EC6 A;  3WA3 A;  3JUP A;  3KSP A;  3U1W A;  4O2H A;  4BTX A;  2BHM A;  8CHO A;  3OWS A;  5IW9 A;  1N9E A;  3HIG A;  1NU3 A;  1W6Y A;  3N54 B;  3NM2 A;  2A15 A;  5LC7 A;  2QEX 3;  3V98 A;  5JPP A;  2E2T A;  2HMJ B;  1YGE A;  5D83 A;  1EG9 B;  2B1X B;  1MOL A;  3S27 A;  3WOD G;  1VQ6 3;  2E2V A;  3MG2 A;  3WOE B;  2FGT A;  3LTB A;  3WDG B;  1AVK A;  4HM4 B;  1M1X B;  2QGU A;  4FMB A;  1JB4 A;  3HI7 A;  4R9K A;  2OWP A;  4BTW A;  3CCL 3;  3X3X A;  3V99 A;  1BUQ A;  1LOX A;  3LOY A;  4WP5 A;  3IMA B;  1WMP A;  3F7S A;  5JBS A;  1JKG B;  2W56 A;  3CD6 3;  3D9R A;  3NV0 A;  3RDE A;  2W9Q A;  1EA2 A;  2IMJ A;  3E99 A;  4GB5 A;  3FLJ A;  1KC8 4;  3K0Z A;  3F7X A;  1OUN A;  3PXM A;  1E97 A;  1Q40 B;  5FGO A;  3CXC 2;  1Y4K A;  1K28 A;  2KXG A;  2PNC A;  4O02 B;  4XBT A;  4KVH A;  3CCR 3;  2ML6 A;  2YX9 A;  4WWU C;  5EVH A;  2Q07 A;  1NWW A;  3UL6 A;  3RGA A;  2WGQ A;  2CWV A;  1EKM A;  4N6N B;  2CFD A;  1VQM 3;  4XDW A;  3CPW 2;  4BTY A;  1DVC A;  3DZL A;  4OK0 A;  1GD4 A;  1FGQ A;  1QVF 2;  5IG0 A;  1UUV B;  3B4O A;  3JUN A;  3KKG A;  3K5T A;  5D81 A;  2OOV A;  3T8N A;  6STD A;  1Q86 4;  3SOA A;  1O7N B;  1YVB I;  2P09 A;  3BNE A;  4X2O A;  1C7H A;  2YFI B;  4AEQ A;  2QA4 3;  2M7O A;  1SQW A;  3LT8 A;  1IVW A;  1DMM A;  2OTL 3;  1Q7Y 4;  1TIJ A;  1VQ9 3;  1QJG A;  2XGL A;  3EQQ B;  1WMO A;  5CLK A;  1CYV A;  4HJL B;  3JUQ A;  1DMN A;  3KSE D;  5AIG A;  1D6Z A;  4LGQ A;  4STD A;  3LYG A;  4FMD A;  1PU4 A;  3NX0 A;  1QAF A;  1FGR A;  3MSO A;  1GYB A;  1ZX2 A;  3NBB A;  3O8Y A;  4ZM8 A;  1JNQ A;  3LZA A;  5AII A;  3UL5 A;  3FCS B;  1VQO 3;  3TDG A;  4N6U A;  5KP4 A;  3NQY A;  4HKV B;  1IU7 A;  5ELU A;  2P38 A;  2XRX B;  2O3O A;  2OOV C;  1N5P A;  3PCR A;  4JF8 A;  1W00 A;  2FNQ A;  1W2B 2;  1O7P B;  1ULJ B;  2OQE A;  1WQL B;  4OUQ A;  3X42 A;  3EBT A;  1VQ4 3;  2WGO A;  3FZW A;  1O7W B;  4EYC A;  3ALA A;  3LXU X;  4RNZ A;  5HGR A;  5LC6 A;  3T0U A;  4L7K A;  3F40 A;  4IT7 A;  3S29 A;  1OAC A;  2Y73 A;  2CC3 A;  3PS8 A;  3CNM A;  1PFP A;  1VQK 3;  2YFJ B;  3VF1 A;  1D6Y A;  1LXE A;  2Z76 A;  3EX9 A;  4ORL A;  3UNL A;  3GZY B;  4JRF A;  4RBN A;  3SX1 A;  1SII A;  1FGT A;  4RNY A;  3CCQ 3;  1RRL A;  3GRD A;  2D42 A;  4XBY A;  2B24 B;  2XGN A;  4FR9 A;  4H3U A;  5CF2 A;  1M1K 4;  2OQE C;  4G1M B;  3BNB A;  3G16 A;  4HM3 B;  1GY7 A;  3X3Y A;  2RSX A;  1N5H A;  3SOY A;  3NV0 B;  1LNH A;  2W03 A;  4L8P A;  3NBR A;  7STD A;  2C10 A;  3H3H A;  3DMC A;  5AI1 A;  5EEO A;  4HM7 B;  1K41 A;  1W01 A;  5A0O B;  3MWZ A;  3J7Y d;  3I55 3;  1VQ8 3;  2KCD A;  2P0M A;  4HYZ A;  4O8S A;  1TUH A;  2BMQ B;  1OH0 A;  1OHS A;  2CFG A;  5FW5 A;  3FH1 A;  3KII A;  5TGN A;  1NJI 4;  3F8H A;  1YI2 3;  1VQP 3;  3T8U A;  4LZI A;  1QVG 2;  1JJ2 2;  4HM5 B;  1D6U A;  3FF0 A;  1E3V A;  2QIY A;  5AYR B;  4R80 A;  3S28 A;  1KSI A;  1A2V A;  3PZW A;  3G6E 3;  1KWI A;  1YJ9 3;  1W5Z A;  2BMR B;  1O7H B;  5STD A;  2JQ5 A;  3B7C A;  1IV9 A;  3CMA 3;  1N9J A;  2W6J H;  4GL6 A;  1R4C A;  5IG3 A;  1CEW I;  3K63 A;  2GXF A;  3SED A;  1IK3 A;  2Z7A A;  4FCM A;  1W2Z A;  1N8R 4;  3EJV A;  1Z1S A;  3CME 3;  1IQX A;  3JVC A;  4CDL A;  3HK4 A;  1DMQ A;  2MF7 A;  2CWT A;  4EXR A;  3CCU 3;  2CK3 H;  4K61 A;  2W04 A;  1OF5 A;  4N6O B;  5D82 A;  3N8B A;  4K1U A;  3MYT A;  1GS3 A;  2O9U X;  3F14 A;  3N9H A;  1TFK A;  3IPT A;  3NXJ A;  3DGO A;  3G71 3;  3OW2 2;  3HZP A;  2FXT A;  3WA2 X;  1TP6 A;  1Q42 A;  2LYX A;  3FSD A;  1IQY A;  2CH9 A;  1WNH A;  5IF6 A;  2LQV A;  2RGQ A;  1IVV A;  4CCV A;  1U8C B;  2CWU A;  2ZL8 A;  1LVN A;  1N8Q A;  1WTH A;  3I0Y A;  1UI8 A;  1KD1 4;  1FGO A;  1RJO A;  3ROB A;  1SIH A;  1UI7 A;  2K0M A;  3LH4 A;  2CG1 A;  1YIT 3;  4HZB B;  1FA3 A;  3NBJ A;  2CKF B;  1W02 A;  2GBX B;  1A67 A;  1SJW A;  1HU9 A;  5AEU B;  1RRH A;  4IPB A;  3G8Z A;  3MPH A;  4PEJ A;  1E3R A;  4HM1 B;  3CCS 3;  1VQ5 3;  3QRD A;  1W7C A;  5AYS C;  4EV5 A;  4WHA A;  3FF2 A;  4HBR A;  3EBY A;  3OWY A;  1UUW B;  3DGL A;  2C11 A;  2F98 A;  3OXA A;  1NDO B;  1ASK A;  3KN4 A;  4MMX B;  4R1K A;  1A2K A;  3JUO A;  1KQS 2;  5DRE A;  4NHF A;  2P0X A;  5AIF A;  4N6T A;  2CG0 A;  1IV7 A;  2CFK A;  4WYK A;  4AKZ A;  1JV2 B;  1AVL A;  1QAK A;  1CQS A;  3DM8 A;  4XBX A;  2MC8 A;  5CK6 A;  1CYU A;  1O7M B;  2BMO B;  2E2U A;  4X2H A;  3BNC A;  1L5G B;  1UW1 A;  3EHC A;  1AR0 A;  5G2G A;  5IEO A;  3V92 A;  3GAX A;  4LSO A;  1O7G B;  1T5Y A;  2JDI H;  3DY5 A;  2W2C A;  1V74 A;  3STD A;  3B4P A;  3CCE 3;  1ROA A;  1Q81 4;  3DUK A;  4OVM A;  3VGN A;  1HKX A;  2WOH A;  2XH9 A;  3LTD A;  3ECF A;  3FKA A;  2ZDJ A;  3S67 A;  3WOF B;  3IJE B;  3Q2P A;  4LMI A;  5KP3 A;  3I56 3;  4J9A A;  4O3V A;  3SLU A;  2XEP A;  1VQL 3;  3LTA A;  3UJM A;  2W9P A;  1RN7 A;  3K9M C;  5AIH A;  2XR8 B;  5AEW B;  3EB8 A;  2W56 B;  3CPO A;  2P05 A;  3EE1 A;  1S5A A;  3PGB A;  4R9L A;  2OTJ 3;  3CU3 A;  3FG1 A;  3D3L A;  4MMZ B;  1QMA A;  3GWR A;  2HML B;  3L0R A;  1G96 A;  4J8T A;  4MJD A;  1IQ8 A;  5I97 A;  2CHC A;  3AMO A;  2IUJ A;  3FG4 A;  3MKI A;  4MMY B;  1S72 3;  4FMA A;  3X40 A;  4FMC A;  1W6G A;  4N6L A;  3LTC A;  1OPY A;  2CIU A;  4I4K A;  4IIA A;  3CCV 3;  3X41 A;  4Q53 A;  5IER A;  3M8C A;  3CCM 3;  2Z77 A;  5EQL A;  5CF1 A;  3SVA A;  1STD A;  2IUK A;  4H61 A;  5KP1 A;  3A76 A;  5DRV A;  3G4S 3;  1QAL A;  2CFL A;  1U5O A;  2BO9 B;  4FCZ A;  2GEY A;  1OF5 B;  2V1L A;  4AKY A;  3NM7 A;  1Q82 4;  2CFW A;  4KFE A;  3U97 A;  3F9S A;  4MEI A;  1JN5 A;  4HM8 B;  2INX A;  2STD A;  4N3V A;  3WMD A;  1K8A 4;  3OX9 A;  3UB1 A;  1FUW A;  1YIJ 3;  1NB3 I;  3PYJ A;  3OWU A;  3CNX A;  1OGZ A;  1SPU A;  1YJN 3;  3GZR A;  2XSO B;  2R4I A;  3Q1C A;  2XF3 A;  4N6M A;  3Q90 A;  2F86 B;  4HZ9 B;  5BVB A;  4WFO A;  1US1 A;  5IG4 A;  3GZB A;  1A90 A;  3MG1 A;  1NB5 I;  1OHO A;  2WO0 A;  3DXO A;  3FG3 A;  2W0Q A;  2K54 A;  2RCD A;  3S5C A;  1VQN 3;  4NRE A;  4HVN A;  1W6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...