1EA2A

Pseudoreversion of the catalytic activity of y14f by the additional tyrosine-to-phenylalanine substitution(s) in the hydrogen bond network of delta-5-3-ketosteroid isomerase from pheudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Pseudoreversion of the Catalytic Activity of Y14F by the Additional Substitution(S) of Tyrosine with Phenylalanine in the Hydrogen Bond Network of Delta (5)-3-Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ea2A00
2A15A 4STDA 1SJWA 4XM4A 4R9LA 5JPPA 3GWRA 2INXA 4KVHA 3B8LA 5DREA 4OUQA 2UX0A 2CKFB 3VGNA 4J9AA 3MG3A 1EG9B 4WYKA 4HM1B 3EJVA 3KSPA 5AIHA 1ZX2A 4K1UA 3NUVA 3OWYA 5AIIA 5DRVA 4OVMA 3FSDA 1NDOB 4XDWA 3CPOA 5FW5A 3JUNA 4L8OA 3MSOA 1JN5A 5AEUB 1OF5B 5BVBA 3LYGA 4XB5A 3NHXA 1GY6A 3DM8A 3NM2A 2GEXA 5CLKA 2I9WA 4HM6B 3FLJA 3MG2A 3D9RA 4HKVB 5AEWB 3DZLA 3GRDA 1O7GB 3BLZA 3FGYA 5TGNA 5D81A 3GZRA 5IG4A 3CNMA 4HJLB 3EHCA 4WYKB 2GBXB 3CNXA 3JUOA 5IEPA 5CF1A 2R4IA 2JQ5A 2YFLB 2HMJB 2BNGA 1W6YA 5KP4A 4R1KA 2F99A 3NXJA 3MYTA 1OGZA 4R9KA 8CHOA 3E99A 3EX9A 1HKXA 2RFRA 1O7MB 3HK4A 2B24B 3FH1A 5AIFA 1JKGB 4N3VA 4L7KA 3GZXB 3NV0B 4RZMA 3WMDA 1ISKA 4FCJA 1O7NB 3FZWA 1E3VA 2OWPA 3S5CA 3LZAA 3Q90A 5IERA 1OCVA 2GBWB 1C7HA 3EF8A 3I0YA 5STDA 3ECFA 3EN8A 3B4PA 1CQSA 1W01A 1Q40B 3DXOA 3HX8A 2Z7AA 3G8ZA 5D82A 1O7PB 3F40A 5D83A 5IEOA 4WP5A 3IPTA 3FF0A 2STDA 3EC9A 2XSHB 1JB5A 2QGUA 2YFIB 1GY5A 3EBYA 4X2HA 3BB9A 3OWUA 4HM7B 2BMOB 3K7CA 1OH0A 4PEJA 3UNLA 1Q42A 5BXQA 3K0ZA 1OPYA 2GXFA 4I4KA 1TP6A 3ER7A 3OWSA 2BMQB 3KE7A 4MJDA 3SEDA 1ULIB 4LEHA 4WWUC 2BMRB 1STDA 3CU3A 3VSYA 3B4OA 2B1XB 5IG0A 4LMIA 4HZBB 1E97A 5AIGA 4GB5A 3G16A 3DUKA 1VZZA 5G2GA 2QIYA 2IMJA 1ZO2A 2F98A 6STDA 3FKAA 1AR0A 4L8PA 1JN5B 3G0KA 4X2OA 1U5OA 3MG1A 4XBYA 5HGRA 4HM3B 2HMOB 4HM8B 1GY7A 1TUHA 5CXOA 1OHPA 4CDLA 3F8XA 2RGQA 3JUQA 3MHEA 2XRXB 1W02A 3KZTA 3H51A 4XDVA 3SOYA 7STDA 1OF5A 2K54A 1GS3A 1OHSA 3F14A 1NU3A 3T8UA 5IG5A 3RGAA 4XBXA 2CHCA 5CF2A 3A76A 1OGXA 3H3HA 3B7CA 2PZVA 5IENA 2YFJB 1ASKA 3EQQB 3DMCA 2HMKB 4FCMA 3SOAA 1EA2A 3RGRA 3UJMA 4HVNA 1E3RA 4U13A 3NBRA 4HM4B 3OX9A 2GEYA 3EBTA 1OUNA 5IG3A 4ORLA 1QJGA 1GYBA 5IF6A 1QMAA 4LGQA 5KP3A 3GZYB 4Q53A 2F86B 1JB2A 1BUQA 3HZPA 2RCDA 4HM0B 1O7WB 3F7XA 3KKGA 4H3UA 5JPUA 3FF2A 1JKGA 2XSOB 2HMLB 4XBTA 1K41A 5EVHA 2HMMB 3M8CA 1NWWA 3ROBA 3NV0A 1S5AA 3OXAA 3F7SA 1OHOA 4HM5B 2W2CA 1JB4A 4HM2B 1DMMA 1UUWB 1UUVB 3OV4A 1Q40A 1ULJB 4J8TA 4IIAA 3STDA 2Z76A 2Z77A 3T8NA 1DMNA 4K1VA 2HMNB 1DMQA 1Z1SA 3EN1B 1WQLB 2XR8B 3F9SA 3JUPA 3JUMA 5CK6A 5KP1A 1IDPA 3MKIA 1W00A 3GZBA 3F8HA 4HZ9B 1O7HB 5AI1A 1A2KA
chains in the Genus database with same CATH superfamily
2A15A 4STDA 1RGFA 1SJWA 4XM4A 2H0GA 1RCKA 3A5EA 4R9LA 4WHAA 2KF6A 2XGNA 4AEQA 5JPPA 3GWRA 3X3XA 3G4S3 3G713 5A0OB 2INXA 4KVHA 1B20A 2E2VA 3B8LA 1MWRA 1M904 2FGTA 4R4KA 2V1LA 2YX9A 5DREA 3HIIA 4CCVA 4OUQA 1IK3A 1RSNA 1YVSA 1YI23 1JBSA 2E2UA 1GOYA 2UX0A 1FGRA 3FG1A 2CKFB 4O02B 1GD3A 1GMRA 2XEPA 4J9AA 3VGNA 3MG3A 1EG9B 4WYKA 4EXRA 4HM1B 2F56A 4RBNA 1TU5A 1RN7A 3EJVA 3KSPA 1FZUA 5LC6A 2O3OA 1TRQA 5AIHA 1SIHA 5AYRB 4N6V0 3SVAA 3JVCA 4EV5A 1ZX2A 4K1UA 4BIRA 1BRJA 3CXC2 3NUVA 4MMZB 1Q7HA 3OWYA 3K63A 2P05A 1RGKA 4MMXB 1IQYA 4BTXA 1EEJA 3X42A 4KZ1A 1FGQA 5AIIA 5DRVA 3GAXA 4AKZA 3AMOB 4OVMA 1N5PA 3FSDA 1NDOB 4XDWA 4N6NB 1V74A 1ROVA 1RGHA 1RN4A 2RSXA 1W6GA 3DGLA 1DE3A 3CPOA 2ZHXB 3WOEB 1FYSA 5FW5A 1DYUA 1LQMB 3V98A 2HOHA 3JUNA 1UGHI 3CC73 2C11A 4L8OA 3MSOA 1Q814 1JN5A 1QAKA 3BNEA 3KCHA 3TDGA 1RNBA 5AEUB 1OF5B 2WO0A 1VQK3 3Q3FA 5BVBA 3LYGA 4XB5A 1BSBA 3NBJA 3IJEB 4J5KA 5GSPA 1UW1A 1RKYA 3NHXA 1PFPA 1GY6A 1WMNA 2CWUA 4OK0A 3K5TA 3DM8A 1A2PA 3NM2A 2L1SA 2GEXA 5CLKA 3CCR3 1MNLA 3LTBA 1LNHA 2I9WA 4RNYA 4TX4A 3FLJA 1ZGXA 3IMAB 4HM6B 3MG2A 1BIRA 3D9RA 1BRKA 1VQL3 1X1YA 4HKVB 5AEWB 2R41A 3DZLA 2ZDJA 1O7GB 3GRDA 3BLZA 4O8SA 3FGYA 5TGNA 3DGOA 5D81A 5M19A 2CC3A 2CFDA 3GZRA 4FMCA 3D79A 5IG4A 1LVNA 3DGMA 1NJI4 3CNMA 1A2VA 4KFFA 4HJLB 3EHCA 4WYKB 2KXGA 2GBXB 7RNTA 5I97A 1UI8A 1Q9EA 2Q07A 3CNXA 1A67A 3JUOA 5IEPA 5CF1A 2R4IA 2ML6A 1J2BA 1JZDA 2JQ5A 2YFLB 4HOHA 2HMJB 1I70A 1GOUA 1LRAA 1TIJA 2BNGA 1W6YA 5KP4A 1R4CA 3LTDA 3LOYA 4R1KA 4KFDA 2F99A 1A90A 1AVLA 2SBLA 3NXJA 1K8A4 1BSAA 3MYTA 4FMAA 1OGZA 3FG3A 4LZIA 4R9KA 4AKYA 8CHOA 1K28A 3LXUX 1RNTA 1RCLA 3E99A 3EX9A 1VQP3 1BNRA 1CYVA 1HKXA 1I8VA 5FGOA 2RFRA 2C4BA 1W5ZA 1O7MB 3HK4A 2B24B 1WMOA 1NB3I 1M9GA 1X1WA 3AHSA 5AYSC 3FH1A 1W6CA 5AIFA 1RDSA 1JBTA 1JKGB 3PYJA 4FR9A 2W03A 4KFEA 1VQM3 4N3VA 1AV4A 1MWTA 4L7KA 2XH9A 2QA43 1V57A 3N54B 4GHOA 1JZOA 2XFSA 3EE1A 3KFQC 4BU4A 2UUGC 1UCKA 2CFWA 1MWSA 2KF5A 4O2HA 4DKIA 3GZXB 1Y4KA 4IT7A 3S67A 3NV0B 4RZMA 3WMDA 1US1A 1ISKA 1RGGA 3DGNA 1IQ8A 3D5GA 4FCJA 9RNTA 1V58A 1O7NB 3FZWA 4NPBA 1E3VA 3NQYA 2OWPA 3QK9A 1X1UA 3S5CA 3PGBA 1IV9A 3LZAA 3Q90A 5IERA 4BL2A 1OCVA 2GBWB 2IUJA 1BRIA 1RRHA 1IVXA 4CPKA 1X1XA 1UDII 1C7HA 3EF8A 1T5YA 1MOLA 3I0YA 2MF7A 5STDA 3ECFA 1RTUA 1BSCA 2FXTA 3EN8A 1FA3A 4BTWA 3B4PA 1G0TA 2F5MA 1CQSA 1W01A 1WTHA 1Q40B 3DXOA 3LT9A 1D6ZA 3HX8A 3G6E3 2Z7AA 3G8ZA 5D82A 1O7PB 1LNIA 4EYCA 3F40A 4GL6A 3WA3A 5D83A 5IEOA 4JRFA 3UL6A 1NNVA 3AHWA 1C54A 4WP5A 3IPTA 3FF0A 3S27A 2XFTA 2K0MA 4G1MB 2RNTA 2STDA 4IPBA 2K3DA 3EC9A 2XSHB 3S29A 1JB5A 3WA2X 4R80A 2QGUA 1TJDA 3U97A 2YFIB 3WODG 3FG4A 1GY5A 3EBYA 2OOVA 8RNTA 4X2HA 3BB9A 3OWUA 1HZ1A 3OW22 4HM7B 1FGOA 2BMOB 1B2ZA 2W56A 3O8YA 4FMDA 4BTYA 3K7CA 1UUGB 1OH0A 1VQ43 1RN1A 3BU4A 3BIRA 5HOHA 4PEJA 5JBSA 3D4AA 3RDEA 3UNLA 1IVVA 1Q42A 1YGWA 1YGEA 1I2FA 1M1XB 3CC43 5BXQA 1CYUA 1SQWA 3K0ZA 1VQQA 1OPYA 1T2IA 5M18A 1STFI 1TRPA 1G96A 1SPUA 2GXFA 2KF4A 1IYYA 2BIRA 1JJ22 3PXMA 3BNCA 4I4KA 2OTJ3 1TP6A 4JF8A 2FNQA 1YJW3 3QRDA 3LH4A 3ER7A 3OWSA 2BT3A 2BMQB 2Y74A 1I0XA 2KF3A 3KE7A 1BAOA 1BNSA 1I0VA 4MJDA 2P38A 1CH0A 1D6YA 2XF3A 3CCJ3 1EQKA 2GU1A 1B21A 1DVCA 1PU4A 1ULIB 3SEDA 4LEHA 2OOVC 3PS8A 3CMA3 5LC7A 1KC84 5IW9A 3SXXA 3CCV3 1VQ93 1N9JA 1N9EA 1YIT3 1BNFA 3ZG0A 2WGQA 2BMRB 2W9QA 1STDA 1OACA 3CU3A 4WWUC 2KAAA 4K61A 4EW5A 1UCLA 5BU4A 3VSYA 3B4OA 3PCSA 2B1XB 2CFKA 5IG0A 1B2MA 4LMIA 1L5GB 2CFGA 1N8QA 4HZBB 1YJN3 1E97A 3VF1A 4HYZA 5AIGA 1MWUA 1K734 2ML5A 1BANA 1AQZA 4GB5A 3UB1A 3G16A 3DUKA 1VZZA 4N6UA 1RMSA 5G2GA 3V99A 2QIYA 3ALAA 1YNVX 1I2EA 1ZO2A 2IMJA 2F98A 6STDA 1UCJA 2RBIA 3T0UA 2J8XB 3FKAA 1WNHA 1AR0A 1GSPA 4L8PA 5EEOA 2C10A 2IA7A 2W56B 3I563 1YHQ3 2D42A 1JN5B 3G0KA 1BU4A 4X2OA 1U5OA 3CCQ3 1IT8A 1YIJ3 1FUWA 2IUKA 3MG1A 4EC6A 3CCU3 1HU9A 4XBYA 1B3SA 5HGRA 4HM3B 2CG1A 2HMOB 3HI7A 4HM8B 2LQVA 3D5IA 1GY7A 1TUHA 5CXOA 1AY7A 2OCTA 1OHPA 5ELJA 3F8XA 2RGQA 4CDLA 4WFOA 1PY3A 4GSPA 1NO3A 3JUQA 3MHEA 3AGOA 2WOFA 2UGIA 2XRXB 2H0IA 4HBRA 1BNEA 1VQ53 1EUIC 1R4YA 1K9M4 1W7CA 1TTOA 1LOVA 1W02A 3KZTA 2LYXA 2OQEA 3H51A 1JNQA 2WGOA 2JDIH 1UI7A 5ELUA 4KT3B 1RGLA 2P0XA 1Q824 4XDVA 3KSED 3SOYA 7STDA 2CIUA 4EV2A 1OF5A 1YVBI 2F5WA 2K54A 3Q2PA 1GS3A 1OHSA 1BRSA 1NU3A 3F14A 3T8UA 1Q864 5IG5A 2Z6BA 4LSOA 3FCSB 1WMPA 1QALA 1LOXA 3RGAA 1UGIA 3SYUA 1BRGA 5BIRA 1SIIA 4XBXA 2CHCA 3LTCA 5CF2A 4N6TA 3A76A 1OGXA 4I5QA 1FW7A 3H3HA 1VQ63 2GSPA 3B7CA 7GSPA 1BVIA 2P0MA 1F8NA 2PZVA 2W0QA 3DGYA 1W2B2 1EKMA 6RNTA 1FGTA 5IENA 1BNJA 2YFJB 1ASKA 1RGAA 2P09A 3EQQB 1CEWI 3DMCA 2GU3A 3NBBA 1JRQA 3X3ZA 2HMKB 4FCZA 1BRNL 4ILFA 3RNTA 2WOHA 1T3BA 4FCMA 3SOAA 2OQEC 1IU7A 1EA2A 2CX1A 3RGRA 3UJMA 1KSIA 2BO9B 4HVNA 3U1WA 2W04A 3ZG5A 1E3RA 2W6JH 3CCL3 1FGMA 3NX0A 1B27A 1B2SA 3NBRA 4HM4B 4MMYB 4U13A 1W4NA 3OX9A 2GEYA 3EBTA 2D1WA 1OUNA 3X3YA 2IYJA 4CJNA 4ORLA 5IG3A 1RJOA 1RHLA 1S723 3L0RA 1QJGA 1GYBA 5IF6A 1QMAA 1VQN3 4MEIA 1MGWA 3MPHA 1QVF2 4QWTA 5G1KA 4FMBA 3KN4A 4LGQA 5KP3A 3GZYB 1FUSA 1KD14 1BSDA 1W2ZA 4Q53A 2F86B 3BNBA 3PZWA 3LTAA 1BNGA 1JB2A 1Q7Y4 1BUQA 1IQXA 3HZPA 1I3FA 2RCDA 1PYLA 2W9PA 4HM0B 3KIIA 1HYFA 1O7WB 1BSEA 3F7XA 3KKGA 4J5GA 3CPW2 3CD63 4H3UA 5JPUA 3FF2A 1DETA 1ROAA 3J7Yd 3LMLA 1JKGA 2PNCA 1RRLA 2XSOB 2IY2A 2CH9A 1BGSA 1BRHA 1LOWA 2HMLB 4XBTA 3X40A 2F4YA 4ZM8A 1K41A 1TFOA 2CWVA 3CME3 5EVHA 2CWTA 2QEX3 1IVUA 1FUTA 2CX0A 3HIGA 1BUJA 2HMMB 3M8CA 4K90B 1NWWA 3ROBA 1G02A 3NV0A 1S5AA 3CCS3 3WDGB 3OXAA 2KCDA 3URPA 1N5HA 1YJ93 3DY5A 3F7SA 2O9UX 1LXEA 5G1LA 3UL5A 1N8R4 1OHOA 1M1K4 1RGCA 1U8CB 2XGLA 4HM5B 1IT7A 1JV2B 4N6LA 1TFKA 4O3VA 2W2CA 3X41A 4BL3A 1JB4A 1GOVA 1KWIA 4H61A 1NB5I 1I2GA 2H0HA 2ZA4A 5M1AA 5EQLA 1IVWA 4HM2B 1VQO3 1DMMA 1QAFA 1MGRA 3CC23 3PCRA 1UUWB 3DH2A 2BU4A 1KQS2 1GMPA 3SX1A 1VQ83 1D6UA 1UUVB 2BHMA 2ZL8A 3AGNA 3OV4A 3ZFZA 3LT8A 3CCE3 1DVDA 2OTL3 4N6MA 4EBGA 3D3LA 3HOHA 4NHFA 1Q40A 1GD4A 1ULJB 2Y73A 2SARA 1SARA 4J8TA 1JBRA 3BNDA 2CK3H 3SLUA 1LOYA 4IIAA 3GSPA 3STDA 3WHOA 1BOXA 2KRTA 2Z76A 3AMOA 2MC8A 2Z77A 4NREA 3T8NA 1DMNA 2E2TA 4K1VA 2AAEA 1AVKA 1UCIA 2HMNB 3S28A 1RGEA 2M7OA 3EB8A 1DMQA 1QVG2 1Z1SA 3EN1B 1IV7A 1I3IA 2CW9A 3N9HA 4RNZA 1WQLB 3NQZA 2XR8B 1T2HA 3F9SA 1ZS7A 3NM7A 3JUPA 4HAAA 2CG0A 3JUMA 1BNIA 3Q1CA 1GMQA 5CK6A 5KP1A 1IDPA 1VQ73 3K9MC 2AADA 3WOFB 3I553 3MWZA 1LQGC 1B2XA 1B2UA 3MKIA 3V92A 2CFLA 3WR2A 1W00A 2L4VA 3GZBA 3F8HA 3N8BA 4HZ9B 4N6OB 4RNTA 1O7HB 1RLSA 5AI1A 6GSPA 1A2KA 5RNTA 3CCM3 4LYLB
chains in the Genus database with same CATH topology
2A15A 4STDA 1SJWA 4XM4A 4WHAA 4R9LA 2XGNA 4AEQA 5JPPA 3GWRA 3X3XA 3G4S3 3G713 5A0OB 2INXA 4KVHA 2E2VA 3B8LA 1M904 2FGTA 4R4KA 2V1LA 2YX9A 5DREA 3HIIA 4CCVA 4OUQA 1IK3A 1YI23 2E2UA 3FG1A 2UX0A 1FGRA 2CKFB 4O02B 1GD3A 2XEPA 3VGNA 4J9AA 3MG3A 1EG9B 4WYKA 4EXRA 4HM1B 4RBNA 1TU5A 1RN7A 3EJVA 3KSPA 5LC6A 2O3OA 5AIHA 1SIHA 5AYRB 4N6V0 3SVAA 3JVCA 4EV5A 1ZX2A 4K1UA 3CXC2 3NUVA 4MMZB 3OWYA 3K63A 2P05A 4MMXB 1IQYA 4BTXA 3X42A 4KZ1A 1FGQA 5AIIA 5DRVA 3GAXA 4AKZA 3AMOB 4OVMA 1N5PA 3FSDA 1NDOB 4XDWA 4N6NB 1V74A 1ROVA 2RSXA 1W6GA 3DGLA 3CPOA 3WOEB 5FW5A 1DYUA 3V98A 3JUNA 3CC73 2C11A 4L8OA 3MSOA 1Q814 1JN5A 1QAKA 3BNEA 3TDGA 5AEUB 1OF5B 2WO0A 1VQK3 5BVBA 3LYGA 4XB5A 3NBJA 3IJEB 1UW1A 1RKYA 3NHXA 1PFPA 1GY6A 1WMNA 2CWUA 4OK0A 3K5TA 3DM8A 3NM2A 2GEXA 5CLKA 3CCR3 1MNLA 3LTBA 1LNHA 2I9WA 4RNYA 4TX4A 3FLJA 3IMAB 4HM6B 3MG2A 3D9RA 1VQL3 4HKVB 5AEWB 3DZLA 2ZDJA 1O7GB 3GRDA 3BLZA 4O8SA 3FGYA 5TGNA 3DGOA 5D81A 2CC3A 2CFDA 3GZRA 4FMCA 5IG4A 1LVNA 3DGMA 1NJI4 3CNMA 1A2VA 4KFFA 4HJLB 3EHCA 4WYKB 2KXGA 2GBXB 5I97A 1UI8A 2Q07A 3CNXA 1A67A 3JUOA 5IEPA 5CF1A 2R4IA 2ML6A 1J2BA 2JQ5A 2YFLB 2HMJB 1TIJA 2BNGA 1W6YA 5KP4A 1R4CA 3LTDA 3LOYA 4R1KA 4KFDA 2F99A 1A90A 1AVLA 2SBLA 3NXJA 1K8A4 3MYTA 4FMAA 1OGZA 3FG3A 4LZIA 4R9KA 4AKYA 8CHOA 1K28A 3LXUX 3E99A 3EX9A 1VQP3 1CYVA 1HKXA 5FGOA 2RFRA 1W5ZA 1O7MB 3HK4A 2B24B 1WMOA 1NB3I 1M9GA 5AYSC 3FH1A 1W6CA 5AIFA 1JKGB 3PYJA 4FR9A 2W03A 4KFEA 1VQM3 4N3VA 1AV4A 4L7KA 2XH9A 2QA43 3N54B 2XFSA 3EE1A 3KFQC 2CFWA 4O2HA 3GZXB 1Y4KA 4IT7A 3S67A 3NV0B 4RZMA 3WMDA 1US1A 1ISKA 3DGNA 1IQ8A 4FCJA 1O7NB 3FZWA 1E3VA 3NQYA 2OWPA 3QK9A 3S5CA 3PGBA 1IV9A 3LZAA 3Q90A 5IERA 1OCVA 2GBWB 2IUJA 1RRHA 1IVXA 1C7HA 3EF8A 1T5YA 1MOLA 3I0YA 2MF7A 5STDA 3ECFA 2FXTA 3EN8A 1FA3A 4BTWA 3B4PA 1CQSA 1W01A 1WTHA 1Q40B 3DXOA 3LT9A 1D6ZA 3HX8A 3G6E3 2Z7AA 3G8ZA 5D82A 1O7PB 4EYCA 3F40A 4GL6A 3WA3A 5D83A 5IEOA 4JRFA 3UL6A 4WP5A 3IPTA 3FF0A 3S27A 2XFTA 2K0MA 4G1MB 2STDA 4IPBA 3WA2X 3EC9A 2XSHB 3S29A 1JB5A 4R80A 2QGUA 3U97A 3WODG 2YFIB 3FG4A 1GY5A 3EBYA 2OOVA 4X2HA 3BB9A 3OWUA 3OW22 4HM7B 1FGOA 2BMOB 2W56A 3O8YA 4FMDA 4BTYA 3K7CA 1OH0A 1VQ43 4PEJA 5JBSA 3RDEA 3UNLA 1IVVA 1Q42A 3CC43 1YGEA 1M1XB 5BXQA 1CYUA 1SQWA 3K0ZA 1OPYA 1STFI 1G96A 1SPUA 2GXFA 1JJ22 3PXMA 3BNCA 4I4KA 2OTJ3 1TP6A 4JF8A 2FNQA 1YJW3 3QRDA 3LH4A 3ER7A 3OWSA 2BT3A 2BMQB 2Y74A 3KE7A 4MJDA 2P38A 1D6YA 2XF3A 3CCJ3 1EQKA 2GU1A 1DVCA 1PU4A 1ULIB 3SEDA 4LEHA 2OOVC 3PS8A 3CMA3 5LC7A 1KC84 5IW9A 3SXXA 3CCV3 1VQ93 1N9JA 1N9EA 1YIT3 2WGQA 2BMRB 2W9QA 1STDA 1OACA 3CU3A 4WWUC 4K61A 3VSYA 3B4OA 3PCSA 2B1XB 2CFKA 5IG0A 4LMIA 1L5GB 2CFGA 1N8QA 4HZBB 1YJN3 1E97A 3VF1A 4HYZA 5AIGA 1K734 2ML5A 4GB5A 3UB1A 3G16A 3DUKA 1VZZA 4N6UA 5G2GA 3V99A 2QIYA 3ALAA 2IMJA 1ZO2A 2F98A 6STDA 3T0UA 3FKAA 1WNHA 1AR0A 4L8PA 5EEOA 2C10A 2IA7A 2W56B 3I563 1YHQ3 2D42A 1JN5B 3G0KA 4X2OA 1U5OA 3CCQ3 1IT8A 1YIJ3 1FUWA 2IUKA 3MG1A 4EC6A 3CCU3 1HU9A 4XBYA 5HGRA 2CG1A 4HM3B 2HMOB 3HI7A 4HM8B 2LQVA 1GY7A 1TUHA 5CXOA 2OCTA 1OHPA 5ELJA 3F8XA 2RGQA 4CDLA 4WFOA 1NO3A 3JUQA 3MHEA 2WOFA 2XRXB 4HBRA 1VQ53 1K9M4 1W02A 1W7CA 3KZTA 2OQEA 2LYXA 3H51A 1JNQA 2WGOA 2JDIH 1UI7A 5ELUA 2P0XA 1Q824 4XDVA 3KSED 3SOYA 7STDA 2CIUA 4EV2A 1OF5A 1YVBI 2K54A 3Q2PA 1GS3A 1OHSA 3F14A 1NU3A 1Q864 3T8UA 5IG5A 2Z6BA 4LSOA 3FCSB 1WMPA 1QALA 1LOXA 3RGAA 1SIIA 4XBXA 2CHCA 3LTCA 5CF2A 4N6TA 3A76A 1OGXA 3H3HA 1VQ63 3B7CA 2P0MA 2PZVA 1F8NA 2W0QA 1W2B2 1EKMA 5IENA 1FGTA 2YFJB 1ASKA 2P09A 3EQQB 1CEWI 3DMCA 2GU3A 3NBBA 1JRQA 3X3ZA 2HMKB 4FCZA 2WOHA 4FCMA 3SOAA 2OQEC 1IU7A 1EA2A 3RGRA 3UJMA 1KSIA 2BO9B 4HVNA 3U1WA 2W04A 1E3RA 2W6JH 3CCL3 1FGMA 3NX0A 4MMYB 4U13A 3NBRA 4HM4B 1W4NA 3OX9A 2GEYA 3EBTA 2D1WA 1OUNA 3X3YA 5IG3A 4ORLA 1RJOA 1S723 3L0RA 1QJGA 1GYBA 5IF6A 1QMAA 1VQN3 4MEIA 3MPHA 1QVF2 4QWTA 4FMBA 3KN4A 4LGQA 5KP3A 3GZYB 1KD14 1W2ZA 4Q53A 2F86B 3BNBA 3PZWA 3LTAA 1JB2A 1Q7Y4 1BUQA 1IQXA 3HZPA 2RCDA 2W9PA 4HM0B 3KIIA 1O7WB 3F7XA 3KKGA 3CPW2 3CD63 4H3UA 5JPUA 3FF2A 1ROAA 3J7Yd 3LMLA 1JKGA 2PNCA 1RRLA 2XSOB 2CH9A 3X40A 2HMLB 4XBTA 4ZM8A 1K41A 1TFOA 2CWVA 3CME3 5EVHA 2CWTA 2QEX3 1IVUA 3HIGA 2HMMB 3M8CA 4K90B 1NWWA 3ROBA 3NV0A 1S5AA 3CCS3 3WDGB 3OXAA 2KCDA 1N5HA 1YJ93 3DY5A 3F7SA 2O9UX 1LXEA 3UL5A 1N8R4 1OHOA 1M1K4 2XGLA 1U8CB 4N6LA 4HM5B 1IT7A 1JV2B 4O3VA 1TFKA 3X41A 2W2CA 1NB5I 1JB4A 1KWIA 4H61A 5EQLA 1IVWA 4HM2B 1VQO3 1DMMA 1QAFA 3CC23 3PCRA 1UUWB 1KQS2 3SX1A 1VQ83 1D6UA 1UUVB 2BHMA 2ZL8A 3OV4A 3CCE3 1DVDA 3LT8A 2OTL3 4N6MA 4EBGA 3D3LA 4NHFA 1Q40A 1GD4A 1ULJB 2Y73A 4J8TA 3BNDA 2CK3H 3SLUA 4IIAA 3STDA 2KRTA 2Z76A 3AMOA 2MC8A 2Z77A 4NREA 3T8NA 1DMNA 2E2TA 4K1VA 1AVKA 2HMNB 3S28A 2M7OA 3EB8A 1DMQA 1QVG2 1Z1SA 3EN1B 1IV7A 2CW9A 4RNZA 3N9HA 1WQLB 3NQZA 2XR8B 3F9SA 3NM7A 3JUPA 2CG0A 3JUMA 3Q1CA 5CK6A 1VQ73 5KP1A 1IDPA 3K9MC 3WOFB 3I553 3MWZA 3MKIA 3V92A 2CFLA 1W00A 2L4VA 3GZBA 3F8HA 3N8BA 4HZ9B 4N6OB 1O7HB 5AI1A 1A2KA 3CCM3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A15 A;  4STD A;  1SJW A;  4XM4 A;  4R9L A;  5JPP A;  3GWR A;  2INX A;  4KVH A;  3B8L A;  5DRE A;  4OUQ A;  2UX0 A;  2CKF B;  3VGN A;  4J9A A;  3MG3 A;  1EG9 B;  4WYK A;  4HM1 B;  3EJV A;  3KSP A;  5AIH A;  1ZX2 A;  4K1U A;  3NUV A;  3OWY A;  5AII A;  5DRV A;  4OVM A;  3FSD A;  1NDO B;  4XDW A;  3CPO A;  5FW5 A;  3JUN A;  4L8O A;  3MSO A;  1JN5 A;  5AEU B;  1OF5 B;  5BVB A;  3LYG A;  4XB5 A;  3NHX A;  1GY6 A;  3DM8 A;  3NM2 A;  2GEX A;  5CLK A;  2I9W A;  4HM6 B;  3FLJ A;  3MG2 A;  3D9R A;  4HKV B;  5AEW B;  3DZL A;  3GRD A;  1O7G B;  3BLZ A;  3FGY A;  5TGN A;  5D81 A;  3GZR A;  5IG4 A;  3CNM A;  4HJL B;  3EHC A;  4WYK B;  2GBX B;  3CNX A;  3JUO A;  5IEP A;  5CF1 A;  2R4I A;  2JQ5 A;  2YFL B;  2HMJ B;  2BNG A;  1W6Y A;  5KP4 A;  4R1K A;  2F99 A;  3NXJ A;  3MYT A;  1OGZ A;  4R9K A;  8CHO A;  3E99 A;  3EX9 A;  1HKX A;  2RFR A;  1O7M B;  3HK4 A;  2B24 B;  3FH1 A;  5AIF A;  1JKG B;  4N3V A;  4L7K A;  3GZX B;  3NV0 B;  4RZM A;  3WMD A;  1ISK A;  4FCJ A;  1O7N B;  3FZW A;  1E3V A;  2OWP A;  3S5C A;  3LZA A;  3Q90 A;  5IER A;  1OCV A;  2GBW B;  1C7H A;  3EF8 A;  3I0Y A;  5STD A;  3ECF A;  3EN8 A;  3B4P A;  1CQS A;  1W01 A;  1Q40 B;  3DXO A;  3HX8 A;  2Z7A A;  3G8Z A;  5D82 A;  1O7P B;  3F40 A;  5D83 A;  5IEO A;  4WP5 A;  3IPT A;  3FF0 A;  2STD A;  3EC9 A;  2XSH B;  1JB5 A;  2QGU A;  2YFI B;  1GY5 A;  3EBY A;  4X2H A;  3BB9 A;  3OWU A;  4HM7 B;  2BMO B;  3K7C A;  1OH0 A;  4PEJ A;  3UNL A;  1Q42 A;  5BXQ A;  3K0Z A;  1OPY A;  2GXF A;  4I4K A;  1TP6 A;  3ER7 A;  3OWS A;  2BMQ B;  3KE7 A;  4MJD A;  3SED A;  1ULI B;  4LEH A;  4WWU C;  2BMR B;  1STD A;  3CU3 A;  3VSY A;  3B4O A;  2B1X B;  5IG0 A;  4LMI A;  4HZB B;  1E97 A;  5AIG A;  4GB5 A;  3G16 A;  3DUK A;  1VZZ A;  5G2G A;  2QIY A;  2IMJ A;  1ZO2 A;  2F98 A;  6STD A;  3FKA A;  1AR0 A;  4L8P A;  1JN5 B;  3G0K A;  4X2O A;  1U5O A;  3MG1 A;  4XBY A;  5HGR A;  4HM3 B;  2HMO B;  4HM8 B;  1GY7 A;  1TUH A;  5CXO A;  1OHP A;  4CDL A;  3F8X A;  2RGQ A;  3JUQ A;  3MHE A;  2XRX B;  1W02 A;  3KZT A;  3H51 A;  4XDV A;  3SOY A;  7STD A;  1OF5 A;  2K54 A;  1GS3 A;  1OHS A;  3F14 A;  1NU3 A;  3T8U A;  5IG5 A;  3RGA A;  4XBX A;  2CHC A;  5CF2 A;  3A76 A;  1OGX A;  3H3H A;  3B7C A;  2PZV A;  5IEN A;  2YFJ B;  1ASK A;  3EQQ B;  3DMC A;  2HMK B;  4FCM A;  3SOA A;  1EA2 A;  3RGR A;  3UJM A;  4HVN A;  1E3R A;  4U13 A;  3NBR A;  4HM4 B;  3OX9 A;  2GEY A;  3EBT A;  1OUN A;  5IG3 A;  4ORL A;  1QJG A;  1GYB A;  5IF6 A;  1QMA A;  4LGQ A;  5KP3 A;  3GZY B;  4Q53 A;  2F86 B;  1JB2 A;  1BUQ A;  3HZP A;  2RCD A;  4HM0 B;  1O7W B;  3F7X A;  3KKG A;  4H3U A;  5JPU A;  3FF2 A;  1JKG A;  2XSO B;  2HML B;  4XBT A;  1K41 A;  5EVH A;  2HMM B;  3M8C A;  1NWW A;  3ROB A;  3NV0 A;  1S5A A;  3OXA A;  3F7S A;  1OHO A;  4HM5 B;  2W2C A;  1JB4 A;  4HM2 B;  1DMM A;  1UUW B;  1UUV B;  3OV4 A;  1Q40 A;  1ULJ B;  4J8T A;  4IIA A;  3STD A;  2Z76 A;  2Z77 A;  3T8N A;  1DMN A;  4K1V A;  2HMN B;  1DMQ A;  1Z1S A;  3EN1 B;  1WQL B;  2XR8 B;  3F9S A;  3JUP A;  3JUM A;  5CK6 A;  5KP1 A;  1IDP A;  3MKI A;  1W00 A;  3GZB A;  3F8H A;  4HZ9 B;  1O7H B;  5AI1 A;  1A2K A; 
#chains in the Genus database with same CATH topology
 2A15 A;  4STD A;  1RGF A;  1SJW A;  4XM4 A;  2H0G A;  1RCK A;  3A5E A;  4R9L A;  4WHA A;  2KF6 A;  2XGN A;  4AEQ A;  5JPP A;  3GWR A;  3X3X A;  3G4S 3;  3G71 3;  5A0O B;  2INX A;  4KVH A;  1B20 A;  2E2V A;  3B8L A;  1MWR A;  1M90 4;  2FGT A;  4R4K A;  2V1L A;  2YX9 A;  5DRE A;  3HII A;  4CCV A;  4OUQ A;  1IK3 A;  1RSN A;  1YVS A;  1YI2 3;  1JBS A;  2E2U A;  1GOY A;  2UX0 A;  1FGR A;  3FG1 A;  2CKF B;  4O02 B;  1GD3 A;  1GMR A;  2XEP A;  4J9A A;  3VGN A;  3MG3 A;  1EG9 B;  4WYK A;  4EXR A;  4HM1 B;  2F56 A;  4RBN A;  1TU5 A;  1RN7 A;  3EJV A;  3KSP A;  1FZU A;  5LC6 A;  2O3O A;  1TRQ A;  5AIH A;  1SIH A;  5AYR B;  4N6V 0;  3SVA A;  3JVC A;  4EV5 A;  1ZX2 A;  4K1U A;  4BIR A;  1BRJ A;  3CXC 2;  3NUV A;  4MMZ B;  1Q7H A;  3OWY A;  3K63 A;  2P05 A;  1RGK A;  4MMX B;  1IQY A;  4BTX A;  1EEJ A;  3X42 A;  4KZ1 A;  1FGQ A;  5AII A;  5DRV A;  3GAX A;  4AKZ A;  3AMO B;  4OVM A;  1N5P A;  3FSD A;  1NDO B;  4XDW A;  4N6N B;  1V74 A;  1ROV A;  1RGH A;  1RN4 A;  2RSX A;  1W6G A;  3DGL A;  1DE3 A;  3CPO A;  2ZHX B;  3WOE B;  1FYS A;  5FW5 A;  1DYU A;  1LQM B;  3V98 A;  2HOH A;  3JUN A;  1UGH I;  3CC7 3;  2C11 A;  4L8O A;  3MSO A;  1Q81 4;  1JN5 A;  1QAK A;  3BNE A;  3KCH A;  3TDG A;  1RNB A;  5AEU B;  1OF5 B;  2WO0 A;  1VQK 3;  3Q3F A;  5BVB A;  3LYG A;  4XB5 A;  1BSB A;  3NBJ A;  3IJE B;  4J5K A;  5GSP A;  1UW1 A;  1RKY A;  3NHX A;  1PFP A;  1GY6 A;  1WMN A;  2CWU A;  4OK0 A;  3K5T A;  3DM8 A;  1A2P A;  3NM2 A;  2L1S A;  2GEX A;  5CLK A;  3CCR 3;  1MNL A;  3LTB A;  1LNH A;  2I9W A;  4RNY A;  4TX4 A;  3FLJ A;  1ZGX A;  3IMA B;  4HM6 B;  3MG2 A;  1BIR A;  3D9R A;  1BRK A;  1VQL 3;  1X1Y A;  4HKV B;  5AEW B;  2R41 A;  3DZL A;  2ZDJ A;  1O7G B;  3GRD A;  3BLZ A;  4O8S A;  3FGY A;  5TGN A;  3DGO A;  5D81 A;  5M19 A;  2CC3 A;  2CFD A;  3GZR A;  4FMC A;  3D79 A;  5IG4 A;  1LVN A;  3DGM A;  1NJI 4;  3CNM A;  1A2V A;  4KFF A;  4HJL B;  3EHC A;  4WYK B;  2KXG A;  2GBX B;  7RNT A;  5I97 A;  1UI8 A;  1Q9E A;  2Q07 A;  3CNX A;  1A67 A;  3JUO A;  5IEP A;  5CF1 A;  2R4I A;  2ML6 A;  1J2B A;  1JZD A;  2JQ5 A;  2YFL B;  4HOH A;  2HMJ B;  1I70 A;  1GOU A;  1LRA A;  1TIJ A;  2BNG A;  1W6Y A;  5KP4 A;  1R4C A;  3LTD A;  3LOY A;  4R1K A;  4KFD A;  2F99 A;  1A90 A;  1AVL A;  2SBL A;  3NXJ A;  1K8A 4;  1BSA A;  3MYT A;  4FMA A;  1OGZ A;  3FG3 A;  4LZI A;  4R9K A;  4AKY A;  8CHO A;  1K28 A;  3LXU X;  1RNT A;  1RCL A;  3E99 A;  3EX9 A;  1VQP 3;  1BNR A;  1CYV A;  1HKX A;  1I8V A;  5FGO A;  2RFR A;  2C4B A;  1W5Z A;  1O7M B;  3HK4 A;  2B24 B;  1WMO A;  1NB3 I;  1M9G A;  1X1W A;  3AHS A;  5AYS C;  3FH1 A;  1W6C A;  5AIF A;  1RDS A;  1JBT A;  1JKG B;  3PYJ A;  4FR9 A;  2W03 A;  4KFE A;  1VQM 3;  4N3V A;  1AV4 A;  1MWT A;  4L7K A;  2XH9 A;  2QA4 3;  1V57 A;  3N54 B;  4GHO A;  1JZO A;  2XFS A;  3EE1 A;  3KFQ C;  4BU4 A;  2UUG C;  1UCK A;  2CFW A;  1MWS A;  2KF5 A;  4O2H A;  4DKI A;  3GZX B;  1Y4K A;  4IT7 A;  3S67 A;  3NV0 B;  4RZM A;  3WMD A;  1US1 A;  1ISK A;  1RGG A;  3DGN A;  1IQ8 A;  3D5G A;  4FCJ A;  9RNT A;  1V58 A;  1O7N B;  3FZW A;  4NPB A;  1E3V A;  3NQY A;  2OWP A;  3QK9 A;  1X1U A;  3S5C A;  3PGB A;  1IV9 A;  3LZA A;  3Q90 A;  5IER A;  4BL2 A;  1OCV A;  2GBW B;  2IUJ A;  1BRI A;  1RRH A;  1IVX A;  4CPK A;  1X1X A;  1UDI I;  1C7H A;  3EF8 A;  1T5Y A;  1MOL A;  3I0Y A;  2MF7 A;  5STD A;  3ECF A;  1RTU A;  1BSC A;  2FXT A;  3EN8 A;  1FA3 A;  4BTW A;  3B4P A;  1G0T A;  2F5M A;  1CQS A;  1W01 A;  1WTH A;  1Q40 B;  3DXO A;  3LT9 A;  1D6Z A;  3HX8 A;  3G6E 3;  2Z7A A;  3G8Z A;  5D82 A;  1O7P B;  1LNI A;  4EYC A;  3F40 A;  4GL6 A;  3WA3 A;  5D83 A;  5IEO A;  4JRF A;  3UL6 A;  1NNV A;  3AHW A;  1C54 A;  4WP5 A;  3IPT A;  3FF0 A;  3S27 A;  2XFT A;  2K0M A;  4G1M B;  2RNT A;  2STD A;  4IPB A;  2K3D A;  3EC9 A;  2XSH B;  3S29 A;  1JB5 A;  3WA2 X;  4R80 A;  2QGU A;  1TJD A;  3U97 A;  2YFI B;  3WOD G;  3FG4 A;  1GY5 A;  3EBY A;  2OOV A;  8RNT A;  4X2H A;  3BB9 A;  3OWU A;  1HZ1 A;  3OW2 2;  4HM7 B;  1FGO A;  2BMO B;  1B2Z A;  2W56 A;  3O8Y A;  4FMD A;  4BTY A;  3K7C A;  1UUG B;  1OH0 A;  1VQ4 3;  1RN1 A;  3BU4 A;  3BIR A;  5HOH A;  4PEJ A;  5JBS A;  3D4A A;  3RDE A;  3UNL A;  1IVV A;  1Q42 A;  1YGW A;  1YGE A;  1I2F A;  1M1X B;  3CC4 3;  5BXQ A;  1CYU A;  1SQW A;  3K0Z A;  1VQQ A;  1OPY A;  1T2I A;  5M18 A;  1STF I;  1TRP A;  1G96 A;  1SPU A;  2GXF A;  2KF4 A;  1IYY A;  2BIR A;  1JJ2 2;  3PXM A;  3BNC A;  4I4K A;  2OTJ 3;  1TP6 A;  4JF8 A;  2FNQ A;  1YJW 3;  3QRD A;  3LH4 A;  3ER7 A;  3OWS A;  2BT3 A;  2BMQ B;  2Y74 A;  1I0X A;  2KF3 A;  3KE7 A;  1BAO A;  1BNS A;  1I0V A;  4MJD A;  2P38 A;  1CH0 A;  1D6Y A;  2XF3 A;  3CCJ 3;  1EQK A;  2GU1 A;  1B21 A;  1DVC A;  1PU4 A;  1ULI B;  3SED A;  4LEH A;  2OOV C;  3PS8 A;  3CMA 3;  5LC7 A;  1KC8 4;  5IW9 A;  3SXX A;  3CCV 3;  1VQ9 3;  1N9J A;  1N9E A;  1YIT 3;  1BNF A;  3ZG0 A;  2WGQ A;  2BMR B;  2W9Q A;  1STD A;  1OAC A;  3CU3 A;  4WWU C;  2KAA A;  4K61 A;  4EW5 A;  1UCL A;  5BU4 A;  3VSY A;  3B4O A;  3PCS A;  2B1X B;  2CFK A;  5IG0 A;  1B2M A;  4LMI A;  1L5G B;  2CFG A;  1N8Q A;  4HZB B;  1YJN 3;  1E97 A;  3VF1 A;  4HYZ A;  5AIG A;  1MWU A;  1K73 4;  2ML5 A;  1BAN A;  1AQZ A;  4GB5 A;  3UB1 A;  3G16 A;  3DUK A;  1VZZ A;  4N6U A;  1RMS A;  5G2G A;  3V99 A;  2QIY A;  3ALA A;  1YNV X;  1I2E A;  1ZO2 A;  2IMJ A;  2F98 A;  6STD A;  1UCJ A;  2RBI A;  3T0U A;  2J8X B;  3FKA A;  1WNH A;  1AR0 A;  1GSP A;  4L8P A;  5EEO A;  2C10 A;  2IA7 A;  2W56 B;  3I56 3;  1YHQ 3;  2D42 A;  1JN5 B;  3G0K A;  1BU4 A;  4X2O A;  1U5O A;  3CCQ 3;  1IT8 A;  1YIJ 3;  1FUW A;  2IUK A;  3MG1 A;  4EC6 A;  3CCU 3;  1HU9 A;  4XBY A;  1B3S A;  5HGR A;  4HM3 B;  2CG1 A;  2HMO B;  3HI7 A;  4HM8 B;  2LQV A;  3D5I A;  1GY7 A;  1TUH A;  5CXO A;  1AY7 A;  2OCT A;  1OHP A;  5ELJ A;  3F8X A;  2RGQ A;  4CDL A;  4WFO A;  1PY3 A;  4GSP A;  1NO3 A;  3JUQ A;  3MHE A;  3AGO A;  2WOF A;  2UGI A;  2XRX B;  2H0I A;  4HBR A;  1BNE A;  1VQ5 3;  1EUI C;  1R4Y A;  1K9M 4;  1W7C A;  1TTO A;  1LOV A;  1W02 A;  3KZT A;  2LYX A;  2OQE A;  3H51 A;  1JNQ A;  2WGO A;  2JDI H;  1UI7 A;  5ELU A;  4KT3 B;  1RGL A;  2P0X A;  1Q82 4;  4XDV A;  3KSE D;  3SOY A;  7STD A;  2CIU A;  4EV2 A;  1OF5 A;  1YVB I;  2F5W A;  2K54 A;  3Q2P A;  1GS3 A;  1OHS A;  1BRS A;  1NU3 A;  3F14 A;  3T8U A;  1Q86 4;  5IG5 A;  2Z6B A;  4LSO A;  3FCS B;  1WMP A;  1QAL A;  1LOX A;  3RGA A;  1UGI A;  3SYU A;  1BRG A;  5BIR A;  1SII A;  4XBX A;  2CHC A;  3LTC A;  5CF2 A;  4N6T A;  3A76 A;  1OGX A;  4I5Q A;  1FW7 A;  3H3H A;  1VQ6 3;  2GSP A;  3B7C A;  7GSP A;  1BVI A;  2P0M A;  1F8N A;  2PZV A;  2W0Q A;  3DGY A;  1W2B 2;  1EKM A;  6RNT A;  1FGT A;  5IEN A;  1BNJ A;  2YFJ B;  1ASK A;  1RGA A;  2P09 A;  3EQQ B;  1CEW I;  3DMC A;  2GU3 A;  3NBB A;  1JRQ A;  3X3Z A;  2HMK B;  4FCZ A;  1BRN L;  4ILF A;  3RNT A;  2WOH A;  1T3B A;  4FCM A;  3SOA A;  2OQE C;  1IU7 A;  1EA2 A;  2CX1 A;  3RGR A;  3UJM A;  1KSI A;  2BO9 B;  4HVN A;  3U1W A;  2W04 A;  3ZG5 A;  1E3R A;  2W6J H;  3CCL 3;  1FGM A;  3NX0 A;  1B27 A;  1B2S A;  3NBR A;  4HM4 B;  4MMY B;  4U13 A;  1W4N A;  3OX9 A;  2GEY A;  3EBT A;  2D1W A;  1OUN A;  3X3Y A;  2IYJ A;  4CJN A;  4ORL A;  5IG3 A;  1RJO A;  1RHL A;  1S72 3;  3L0R A;  1QJG A;  1GYB A;  5IF6 A;  1QMA A;  1VQN 3;  4MEI A;  1MGW A;  3MPH A;  1QVF 2;  4QWT A;  5G1K A;  4FMB A;  3KN4 A;  4LGQ A;  5KP3 A;  3GZY B;  1FUS A;  1KD1 4;  1BSD A;  1W2Z A;  4Q53 A;  2F86 B;  3BNB A;  3PZW A;  3LTA A;  1BNG A;  1JB2 A;  1Q7Y 4;  1BUQ A;  1IQX A;  3HZP A;  1I3F A;  2RCD A;  1PYL A;  2W9P A;  4HM0 B;  3KII A;  1HYF A;  1O7W B;  1BSE A;  3F7X A;  3KKG A;  4J5G A;  3CPW 2;  3CD6 3;  4H3U A;  5JPU A;  3FF2 A;  1DET A;  1ROA A;  3J7Y d;  3LML A;  1JKG A;  2PNC A;  1RRL A;  2XSO B;  2IY2 A;  2CH9 A;  1BGS A;  1BRH A;  1LOW A;  2HML B;  4XBT A;  3X40 A;  2F4Y A;  4ZM8 A;  1K41 A;  1TFO A;  2CWV A;  3CME 3;  5EVH A;  2CWT A;  2QEX 3;  1IVU A;  1FUT A;  2CX0 A;  3HIG A;  1BUJ A;  2HMM B;  3M8C A;  4K90 B;  1NWW A;  3ROB A;  1G02 A;  3NV0 A;  1S5A A;  3CCS 3;  3WDG B;  3OXA A;  2KCD A;  3URP A;  1N5H A;  1YJ9 3;  3DY5 A;  3F7S A;  2O9U X;  1LXE A;  5G1L A;  3UL5 A;  1N8R 4;  1OHO A;  1M1K 4;  1RGC A;  1U8C B;  2XGL A;  4HM5 B;  1IT7 A;  1JV2 B;  4N6L A;  1TFK A;  4O3V A;  2W2C A;  3X41 A;  4BL3 A;  1JB4 A;  1GOV A;  1KWI A;  4H61 A;  1NB5 I;  1I2G A;  2H0H A;  2ZA4 A;  5M1A A;  5EQL A;  1IVW A;  4HM2 B;  1VQO 3;  1DMM A;  1QAF A;  1MGR A;  3CC2 3;  3PCR A;  1UUW B;  3DH2 A;  2BU4 A;  1KQS 2;  1GMP A;  3SX1 A;  1VQ8 3;  1D6U A;  1UUV B;  2BHM A;  2ZL8 A;  3AGN A;  3OV4 A;  3ZFZ A;  3LT8 A;  3CCE 3;  1DVD A;  2OTL 3;  4N6M A;  4EBG A;  3D3L A;  3HOH A;  4NHF A;  1Q40 A;  1GD4 A;  1ULJ B;  2Y73 A;  2SAR A;  1SAR A;  4J8T A;  1JBR A;  3BND A;  2CK3 H;  3SLU A;  1LOY A;  4IIA A;  3GSP A;  3STD A;  3WHO A;  1BOX A;  2KRT A;  2Z76 A;  3AMO A;  2MC8 A;  2Z77 A;  4NRE A;  3T8N A;  1DMN A;  2E2T A;  4K1V A;  2AAE A;  1AVK A;  1UCI A;  2HMN B;  3S28 A;  1RGE A;  2M7O A;  3EB8 A;  1DMQ A;  1QVG 2;  1Z1S A;  3EN1 B;  1IV7 A;  1I3I A;  2CW9 A;  3N9H A;  4RNZ A;  1WQL B;  3NQZ A;  2XR8 B;  1T2H A;  3F9S A;  1ZS7 A;  3NM7 A;  3JUP A;  4HAA A;  2CG0 A;  3JUM A;  1BNI A;  3Q1C A;  1GMQ A;  5CK6 A;  5KP1 A;  1IDP A;  1VQ7 3;  3K9M C;  2AAD A;  3WOF B;  3I55 3;  3MWZ A;  1LQG C;  1B2X A;  1B2U A;  3MKI A;  3V92 A;  2CFL A;  3WR2 A;  1W00 A;  2L4V A;  3GZB A;  3F8H A;  3N8B A;  4HZ9 B;  4N6O B;  4RNT A;  1O7H B;  1RLS A;  5AI1 A;  6GSP A;  1A2K A;  5RNT A;  3CCM 3;  4LYL B; 
#chains in the Genus database with same CATH homology
 2A15 A;  4STD A;  1SJW A;  4XM4 A;  4WHA A;  4R9L A;  2XGN A;  4AEQ A;  5JPP A;  3GWR A;  3X3X A;  3G4S 3;  3G71 3;  5A0O B;  2INX A;  4KVH A;  2E2V A;  3B8L A;  1M90 4;  2FGT A;  4R4K A;  2V1L A;  2YX9 A;  5DRE A;  3HII A;  4CCV A;  4OUQ A;  1IK3 A;  1YI2 3;  2E2U A;  3FG1 A;  2UX0 A;  1FGR A;  2CKF B;  4O02 B;  1GD3 A;  2XEP A;  3VGN A;  4J9A A;  3MG3 A;  1EG9 B;  4WYK A;  4EXR A;  4HM1 B;  4RBN A;  1TU5 A;  1RN7 A;  3EJV A;  3KSP A;  5LC6 A;  2O3O A;  5AIH A;  1SIH A;  5AYR B;  4N6V 0;  3SVA A;  3JVC A;  4EV5 A;  1ZX2 A;  4K1U A;  3CXC 2;  3NUV A;  4MMZ B;  3OWY A;  3K63 A;  2P05 A;  4MMX B;  1IQY A;  4BTX A;  3X42 A;  4KZ1 A;  1FGQ A;  5AII A;  5DRV A;  3GAX A;  4AKZ A;  3AMO B;  4OVM A;  1N5P A;  3FSD A;  1NDO B;  4XDW A;  4N6N B;  1V74 A;  1ROV A;  2RSX A;  1W6G A;  3DGL A;  3CPO A;  3WOE B;  5FW5 A;  1DYU A;  3V98 A;  3JUN A;  3CC7 3;  2C11 A;  4L8O A;  3MSO A;  1Q81 4;  1JN5 A;  1QAK A;  3BNE A;  3TDG A;  5AEU B;  1OF5 B;  2WO0 A;  1VQK 3;  5BVB A;  3LYG A;  4XB5 A;  3NBJ A;  3IJE B;  1UW1 A;  1RKY A;  3NHX A;  1PFP A;  1GY6 A;  1WMN A;  2CWU A;  4OK0 A;  3K5T A;  3DM8 A;  3NM2 A;  2GEX A;  5CLK A;  3CCR 3;  1MNL A;  3LTB A;  1LNH A;  2I9W A;  4RNY A;  4TX4 A;  3FLJ A;  3IMA B;  4HM6 B;  3MG2 A;  3D9R A;  1VQL 3;  4HKV B;  5AEW B;  3DZL A;  2ZDJ A;  1O7G B;  3GRD A;  3BLZ A;  4O8S A;  3FGY A;  5TGN A;  3DGO A;  5D81 A;  2CC3 A;  2CFD A;  3GZR A;  4FMC A;  5IG4 A;  1LVN A;  3DGM A;  1NJI 4;  3CNM A;  1A2V A;  4KFF A;  4HJL B;  3EHC A;  4WYK B;  2KXG A;  2GBX B;  5I97 A;  1UI8 A;  2Q07 A;  3CNX A;  1A67 A;  3JUO A;  5IEP A;  5CF1 A;  2R4I A;  2ML6 A;  1J2B A;  2JQ5 A;  2YFL B;  2HMJ B;  1TIJ A;  2BNG A;  1W6Y A;  5KP4 A;  1R4C A;  3LTD A;  3LOY A;  4R1K A;  4KFD A;  2F99 A;  1A90 A;  1AVL A;  2SBL A;  3NXJ A;  1K8A 4;  3MYT A;  4FMA A;  1OGZ A;  3FG3 A;  4LZI A;  4R9K A;  4AKY A;  8CHO A;  1K28 A;  3LXU X;  3E99 A;  3EX9 A;  1VQP 3;  1CYV A;  1HKX A;  5FGO A;  2RFR A;  1W5Z A;  1O7M B;  3HK4 A;  2B24 B;  1WMO A;  1NB3 I;  1M9G A;  5AYS C;  3FH1 A;  1W6C A;  5AIF A;  1JKG B;  3PYJ A;  4FR9 A;  2W03 A;  4KFE A;  1VQM 3;  4N3V A;  1AV4 A;  4L7K A;  2XH9 A;  2QA4 3;  3N54 B;  2XFS A;  3EE1 A;  3KFQ C;  2CFW A;  4O2H A;  3GZX B;  1Y4K A;  4IT7 A;  3S67 A;  3NV0 B;  4RZM A;  3WMD A;  1US1 A;  1ISK A;  3DGN A;  1IQ8 A;  4FCJ A;  1O7N B;  3FZW A;  1E3V A;  3NQY A;  2OWP A;  3QK9 A;  3S5C A;  3PGB A;  1IV9 A;  3LZA A;  3Q90 A;  5IER A;  1OCV A;  2GBW B;  2IUJ A;  1RRH A;  1IVX A;  1C7H A;  3EF8 A;  1T5Y A;  1MOL A;  3I0Y A;  2MF7 A;  5STD A;  3ECF A;  2FXT A;  3EN8 A;  1FA3 A;  4BTW A;  3B4P A;  1CQS A;  1W01 A;  1WTH A;  1Q40 B;  3DXO A;  3LT9 A;  1D6Z A;  3HX8 A;  3G6E 3;  2Z7A A;  3G8Z A;  5D82 A;  1O7P B;  4EYC A;  3F40 A;  4GL6 A;  3WA3 A;  5D83 A;  5IEO A;  4JRF A;  3UL6 A;  4WP5 A;  3IPT A;  3FF0 A;  3S27 A;  2XFT A;  2K0M A;  4G1M B;  2STD A;  4IPB A;  3WA2 X;  3EC9 A;  2XSH B;  3S29 A;  1JB5 A;  4R80 A;  2QGU A;  3U97 A;  3WOD G;  2YFI B;  3FG4 A;  1GY5 A;  3EBY A;  2OOV A;  4X2H A;  3BB9 A;  3OWU A;  3OW2 2;  4HM7 B;  1FGO A;  2BMO B;  2W56 A;  3O8Y A;  4FMD A;  4BTY A;  3K7C A;  1OH0 A;  1VQ4 3;  4PEJ A;  5JBS A;  3RDE A;  3UNL A;  1IVV A;  1Q42 A;  3CC4 3;  1YGE A;  1M1X B;  5BXQ A;  1CYU A;  1SQW A;  3K0Z A;  1OPY A;  1STF I;  1G96 A;  1SPU A;  2GXF A;  1JJ2 2;  3PXM A;  3BNC A;  4I4K A;  2OTJ 3;  1TP6 A;  4JF8 A;  2FNQ A;  1YJW 3;  3QRD A;  3LH4 A;  3ER7 A;  3OWS A;  2BT3 A;  2BMQ B;  2Y74 A;  3KE7 A;  4MJD A;  2P38 A;  1D6Y A;  2XF3 A;  3CCJ 3;  1EQK A;  2GU1 A;  1DVC A;  1PU4 A;  1ULI B;  3SED A;  4LEH A;  2OOV C;  3PS8 A;  3CMA 3;  5LC7 A;  1KC8 4;  5IW9 A;  3SXX A;  3CCV 3;  1VQ9 3;  1N9J A;  1N9E A;  1YIT 3;  2WGQ A;  2BMR B;  2W9Q A;  1STD A;  1OAC A;  3CU3 A;  4WWU C;  4K61 A;  3VSY A;  3B4O A;  3PCS A;  2B1X B;  2CFK A;  5IG0 A;  4LMI A;  1L5G B;  2CFG A;  1N8Q A;  4HZB B;  1YJN 3;  1E97 A;  3VF1 A;  4HYZ A;  5AIG A;  1K73 4;  2ML5 A;  4GB5 A;  3UB1 A;  3G16 A;  3DUK A;  1VZZ A;  4N6U A;  5G2G A;  3V99 A;  2QIY A;  3ALA A;  2IMJ A;  1ZO2 A;  2F98 A;  6STD A;  3T0U A;  3FKA A;  1WNH A;  1AR0 A;  4L8P A;  5EEO A;  2C10 A;  2IA7 A;  2W56 B;  3I56 3;  1YHQ 3;  2D42 A;  1JN5 B;  3G0K A;  4X2O A;  1U5O A;  3CCQ 3;  1IT8 A;  1YIJ 3;  1FUW A;  2IUK A;  3MG1 A;  4EC6 A;  3CCU 3;  1HU9 A;  4XBY A;  5HGR A;  2CG1 A;  4HM3 B;  2HMO B;  3HI7 A;  4HM8 B;  2LQV A;  1GY7 A;  1TUH A;  5CXO A;  2OCT A;  1OHP A;  5ELJ A;  3F8X A;  2RGQ A;  4CDL A;  4WFO A;  1NO3 A;  3JUQ A;  3MHE A;  2WOF A;  2XRX B;  4HBR A;  1VQ5 3;  1K9M 4;  1W02 A;  1W7C A;  3KZT A;  2OQE A;  2LYX A;  3H51 A;  1JNQ A;  2WGO A;  2JDI H;  1UI7 A;  5ELU A;  2P0X A;  1Q82 4;  4XDV A;  3KSE D;  3SOY A;  7STD A;  2CIU A;  4EV2 A;  1OF5 A;  1YVB I;  2K54 A;  3Q2P A;  1GS3 A;  1OHS A;  3F14 A;  1NU3 A;  1Q86 4;  3T8U A;  5IG5 A;  2Z6B A;  4LSO A;  3FCS B;  1WMP A;  1QAL A;  1LOX A;  3RGA A;  1SII A;  4XBX A;  2CHC A;  3LTC A;  5CF2 A;  4N6T A;  3A76 A;  1OGX A;  3H3H A;  1VQ6 3;  3B7C A;  2P0M A;  2PZV A;  1F8N A;  2W0Q A;  1W2B 2;  1EKM A;  5IEN A;  1FGT A;  2YFJ B;  1ASK A;  2P09 A;  3EQQ B;  1CEW I;  3DMC A;  2GU3 A;  3NBB A;  1JRQ A;  3X3Z A;  2HMK B;  4FCZ A;  2WOH A;  4FCM A;  3SOA A;  2OQE C;  1IU7 A;  1EA2 A;  3RGR A;  3UJM A;  1KSI A;  2BO9 B;  4HVN A;  3U1W A;  2W04 A;  1E3R A;  2W6J H;  3CCL 3;  1FGM A;  3NX0 A;  4MMY B;  4U13 A;  3NBR A;  4HM4 B;  1W4N A;  3OX9 A;  2GEY A;  3EBT A;  2D1W A;  1OUN A;  3X3Y A;  5IG3 A;  4ORL A;  1RJO A;  1S72 3;  3L0R A;  1QJG A;  1GYB A;  5IF6 A;  1QMA A;  1VQN 3;  4MEI A;  3MPH A;  1QVF 2;  4QWT A;  4FMB A;  3KN4 A;  4LGQ A;  5KP3 A;  3GZY B;  1KD1 4;  1W2Z A;  4Q53 A;  2F86 B;  3BNB A;  3PZW A;  3LTA A;  1JB2 A;  1Q7Y 4;  1BUQ A;  1IQX A;  3HZP A;  2RCD A;  2W9P A;  4HM0 B;  3KII A;  1O7W B;  3F7X A;  3KKG A;  3CPW 2;  3CD6 3;  4H3U A;  5JPU A;  3FF2 A;  1ROA A;  3J7Y d;  3LML A;  1JKG A;  2PNC A;  1RRL A;  2XSO B;  2CH9 A;  3X40 A;  2HML B;  4XBT A;  4ZM8 A;  1K41 A;  1TFO A;  2CWV A;  3CME 3;  5EVH A;  2CWT A;  2QEX 3;  1IVU A;  3HIG A;  2HMM B;  3M8C A;  4K90 B;  1NWW A;  3ROB A;  3NV0 A;  1S5A A;  3CCS 3;  3WDG B;  3OXA A;  2KCD A;  1N5H A;  1YJ9 3;  3DY5 A;  3F7S A;  2O9U X;  1LXE A;  3UL5 A;  1N8R 4;  1OHO A;  1M1K 4;  2XGL A;  1U8C B;  4N6L A;  4HM5 B;  1IT7 A;  1JV2 B;  4O3V A;  1TFK A;  3X41 A;  2W2C A;  1NB5 I;  1JB4 A;  1KWI A;  4H61 A;  5EQL A;  1IVW A;  4HM2 B;  1VQO 3;  1DMM A;  1QAF A;  3CC2 3;  3PCR A;  1UUW B;  1KQS 2;  3SX1 A;  1VQ8 3;  1D6U A;  1UUV B;  2BHM A;  2ZL8 A;  3OV4 A;  3CCE 3;  1DVD A;  3LT8 A;  2OTL 3;  4N6M A;  4EBG A;  3D3L A;  4NHF A;  1Q40 A;  1GD4 A;  1ULJ B;  2Y73 A;  4J8T A;  3BND A;  2CK3 H;  3SLU A;  4IIA A;  3STD A;  2KRT A;  2Z76 A;  3AMO A;  2MC8 A;  2Z77 A;  4NRE A;  3T8N A;  1DMN A;  2E2T A;  4K1V A;  1AVK A;  2HMN B;  3S28 A;  2M7O A;  3EB8 A;  1DMQ A;  1QVG 2;  1Z1S A;  3EN1 B;  1IV7 A;  2CW9 A;  4RNZ A;  3N9H A;  1WQL B;  3NQZ A;  2XR8 B;  3F9S A;  3NM7 A;  3JUP A;  2CG0 A;  3JUM A;  3Q1C A;  5CK6 A;  1VQ7 3;  5KP1 A;  1IDP A;  3K9M C;  3WOF B;  3I55 3;  3MWZ A;  3MKI A;  3V92 A;  2CFL A;  1W00 A;  2L4V A;  3GZB A;  3F8H A;  3N8B A;  4HZ9 B;  4N6O B;  1O7H B;  5AI1 A;  1A2K A;  3CCM 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...