1OHSA

Crystal structure of 5-3-ketosteroid isomerase mutant y14f/d38n from pseudomonas testosteroni complexed with androstanedione
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRFVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 5-3-Ketosteroid Isomerase Mutant Y14F/D38N from Pseudomonas Testosteroni Complexed with Androstanedione
rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
total genus 33
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ohsA00
2F86B 4HM0B 1JB2A 4N3VA 3EF8A 3DXOA 3Q90A 3HK4A 5IG0A 3ROBA 2BMQB 3T8UA 3F9SA 4XM4A 3I0YA 5AEUB 1Q42A 2YFIB 5IEOA 3DZLA 5DREA 1EG9B 2HMJB 1W02A 3OWSA 3A76A 4HM4B 2XR8B 3STDA 3OXAA 2F98A 1O7NB 2JQ5A 2GEXA 1OHOA 3BB9A 2A15A 2UX0A 3G8ZA 3JUQA 3LYGA 4L7KA 4CDLA 4WYKB 5IEPA 2I9WA 4L8PA 5HGRA 3B7CA 2BMRB 4WYKA 3EC9A 1WQLB 2B1XB 1EA2A 3FLJA 3LZAA 3MG2A 1NU3A 3MKIA 1JKGB 4FCJA 1NWWA 1OUNA 1OGZA 3NV0A 1OF5B 2XSOB 3FZWA 3JUMA 4WP5A 5IF6A 5IG5A 1ULIB 1GY7A 1OHSA 4HZ9B 1OF5A 4HM1B 5AI1A 2HMMB 3OX9A 3JUNA 4HJLB 4HKVB 3EN1B 4GB5A 4K1VA 1DMNA 3JUPA 4XB5A 1HKXA 5G2GA 3SEDA 2HMKB 4LMIA 5D83A 4OUQA 3CU3A 3EHCA 5TGNA 2GBXB 3CPOA 5AIFA 1BUQA 1DMQA 1GY5A 1E3RA 1QJGA 2CHCA 4WWUC 4I4KA 3K7CA 3UJMA 1U5OA 4LEHA 3EBTA 4MJDA 5BVBA 5CF1A 1O7WB 1OGXA 1SJWA 2F99A 1VZZA 3G0KA 3KSPA 5STDA 3SOAA 2BMOB 1JN5A 3NUVA 3EN8A 1OHPA 4K1UA 4LGQA 1ULJB 1UUVB 4XBTA 3EJVA 3OV4A 4HM6B 1CQSA 3MG3A 4U13A 3OWYA 2YFJB 2GBWB 3F14A 3FF0A 1JB4A 2RGQA 2HMLB 1ISKA 1O7MB 3F8XA 3H51A 1QMAA 3GZYB 4HM7B 4HM5B 3MSOA 4OVMA 4XDVA 2RCDA 5FW5A 4H3UA 1Q40A 1ZX2A 3F8HA 3OWUA 3H3HA 4HM3B 5IENA 3RGRA 3B4PA 3CNXA 3CNMA 1OPYA 1ZO2A 3GRDA 6STDA 3FH1A 2STDA 2PZVA 5KP3A 3MHEA 4ORLA 2W2CA 2QIYA 3G16A 4FCMA 1JN5B 4X2OA 5IG4A 5JPUA 3KE7A 5AEWB 4HM2B 2HMNB 1A2KA 1GYBA 3F40A 1O7HB 4IIAA 3WMDA 2YFLB 3KKGA 2RFRA 5AIIA 4R9LA 3DM8A 1GY6A 3EX9A 4R9KA 3UNLA 1ASKA 3VGNA 3EQQB 2INXA 5CXOA 3T8NA 3FKAA 1W00A 4XBYA 3VSYA 5KP4A 2IMJA 3GZXB 4J9AA 1AR0A 2XRXB 3F7XA 3HX8A 3HZPA 1O7PB 4RZMA 1OCVA 2Z76A 3M8CA 3DMCA 3K0ZA 2QGUA 1NDOB 3MYTA 2HMOB 2Z77A 2OWPA 1GS3A 4R1KA 5CK6A 1O7GB 5AIHA 1DMMA 1K41A 1W6YA 1JKGA 1E3VA 1OH0A 3S5CA 4PEJA 5JPPA 3MG1A 4HVNA 3NV0B 3GZBA 3GWRA 5D81A 2Z7AA 3B8LA 3BLZA 3NBRA 4X2HA 1C7HA 4Q53A 3F7SA 5DRVA 2BNGA 5AIGA 1TP6A 5IERA 1IDPA 3D9RA 1UUWB 3E99A 3ECFA 4HZBB 3B4OA 5KP1A 1Z1SA 3NM2A 3IPTA 5IG3A 3FGYA 5D82A 4HM8B 3GZRA 8CHOA 1S5AA 5CF2A 2GEYA 4XBXA 4KVHA 3ER7A 1W01A 1Q40B 2XSHB 1E97A 4J8TA 3NHXA 3SOYA 3JUOA 2GXFA 4STDA 3FSDA 3NXJA 2R4IA 1STDA 3DUKA 2K54A 4L8OA 5CLKA 3FF2A 5BXQA 4XDWA 7STDA 3RGAA 2B24B 3EBYA 1JB5A 5EVHA 3KZTA 2CKFB 1TUHA
chains in the Genus database with same CATH superfamily
2F86B 3Q90A 3DXOA 3V99A 3WHOA 1EQKA 3F9SA 3ZFZA 2W9QA 3I0YA 1BRSA 1Q42A 3NM7A 4FR9A 2QA43 3A76A 2KXGA 3KSED 4I5QA 3T8NA 3U97A 2GEXA 4L7KA 1UW1A 1G96A 1MGWA 4MMYB 4BL3A 4WYKB 7RNTA 1LQMB 2XFSA 1RN1A 1IU7A 1V57A 2E2TA 4WYKA 3S67A 2HOHA 4CJNA 1EA2A 1GMPA 2WO0A 3LZAA 1NU3A 6STDA 1OACA 1VQ93 1NWWA 1UDII 1OUNA 4JF8A 1BSDA 3DGLA 5EEOA 1OGZA 1DETA 1OF5B 2XSOB 1NO3A 2M7OA 3NV0A 3DGYA 2J8XB 4R4KA 3MWZA 3N8BA 1OHSA 4HYZA 3SYUA 1OF5A 1RGKA 2C4BA 4N6TA 1A67A 3OX9A 3EN1B 5G2GA 1DMNA 1Q7HA 3JUPA 3UL6A 1TRQA 5D83A 3URPA 4IT7A 3EHCA 2SARA 1DE3A 1MWSA 1DMQA 1I3IA 1QJGA 2P38A 3CCJ3 3FG3A 3EBTA 1T2HA 2Z6BA 2D1WA 4OK0A 3STDA 1C54A 3ALAA 3ZG0A 5STDA 2BMOB 3CME3 1DYUA 1I70A 1OHPA 1ULJB 1UUVB 2AADA 3DGOA 3LT9A 4K1UA 4U13A 3CPW2 3OWYA 3I553 1FUWA 8RNTA 1JB4A 2P09A 2ZHXB 1JJ22 3WR2A 1ISKA 1TJDA 1W4NA 4FMAA 3H51A 1RHLA 3F8XA 1BSEA 1W2B2 1HZ1A 3X3XA 1UCIA 2W0QA 1K734 4LZIA 3BU4A 1IVVA 1TIJA 1Q824 1ZX2A 3OWUA 4HM3B 5IENA 3CXC2 3LTAA 3WOFB 1V74A 1DVCA 1BRHA 1YGEA 2STDA 1AY7A 3G16A 1RKYA 1QVF2 4LYLB 3DH2A 5JPUA 4NREA 5AEWB 1BSCA 1WNHA 5ELUA 3F40A 1GYBA 3DY5A 4ILFA 1CYVA 3KKGA 1US1A 5AIIA 3V98A 1YJ93 1A90A 3EX9A 1PYLA 3VGNA 2F5WA 1B27A 2INXA 3K9MC 3X41A 4EYCA 2KF6A 1FYSA 1ZS7A 5AYSC 3CMA3 2XRXB 2E2VA 1O7PB 1R4YA 2MC8A 1MWUA 1IK3A 1BRGA 1BGSA 6GSPA 3DMCA 3S29A 2CFLA 1M1K4 2L1SA 1EUIC 1NDOB 3MYTA 2BO9B 4N6MA 1RLSA 2CH9A 2OWPA 3GAXA 4KFEA 4O02B 1K41A 1W6YA 1JKGA 2XGLA 4PEJA 1WMNA 1VQK3 2IY2A 1I0XA 1IQXA 4X2HA 1NB3I 1JNQA 3F7SA 1M9GA 1GMQA 3AMOA 1U8CB 1MNLA 3D9RA 5M19A 1Z1SA 2CG1A 3S27A 5IG3A 3FGYA 4HM8B 3OW22 1LXEA 1BANA 1B2ZA 4XBXA 5M1AA 3O8YA 1FUTA 1I0VA 3ER7A 9RNTA 2H0GA 4HOHA 4N6V0 1Q40B 1FGQA 1B2SA 1VQ73 3NHXA 5GSPA 1BNIA 2KRTA 1BRKA 1KC84 1FGRA 3N9HA 4RNZA 1STDA 5ELJA 3SVAA 5CLKA 1J2BA 3FF2A 4XDWA 1B2XA 1AVKA 1VQP3 1B21A 3EBYA 1WMPA 3KZTA 3RGAA 1UI7A 1Q7Y4 1TUHA 1JV2B 1N8QA 1Y4KA 4BTWA 3ROBA 4XM4A 3T0UA 1IT8A 4BU4A 1VQL3 1VQM3 5AEUB 4NPBA 5A0OB 1KD14 1SARA 2CX0A 1EG9B 4HM4B 3OWSA 5DREA 3OXAA 1N5HA 5HGRA 1OHOA 2A15A 2UX0A 1YI23 7GSPA 1EEJA 1GOYA 5IEPA 3X40A 4RNYA 5AYRB 1LOXA 4L8PA 4N6UA 3FG1A 1BNJA 1BU4A 1WQLB 3MG2A 3MKIA 1KQS2 3UL5A 4MMZB 3RNTA 4AEQA 4WP5A 1BIRA 1FGTA 2R41A 4HZ9B 1BNRA 4HM1B 1KWIA 3L0RA 4TX4A 5AI1A 1K28A 2CFWA 1LRAA 3SEDA 1TTOA 1RRHA 3BNDA 2OTL3 1A2PA 4OUQA 3CU3A 5TGNA 2XF3A 2GBXB 1BNGA 3DGMA 5AIFA 2UGIA 2IUJA 3N54B 2O3OA 1BUQA 1E3RA 5BVBA 4I4KA 3K7CA 1LNHA 1U5OA 4LEHA 2KF5A 1OGXA 1B3SA 1VZZA 1W2ZA 3KSPA 4LGQA 3NQYA 1JZOA 1M1XB 4HM6B 1TU5A 1PU4A 1M904 3D79A 5JBSA 3F14A 2HMLB 1KSIA 2W56A 2CWUA 1O7MB 2KF4A 3BIRA 2RCDA 5FW5A 2IUKA 2OTJ3 1D6ZA 1GOUA 2CFDA 3LTDA 1Q40A 4FMBA 1N8R4 1RJOA 1WMOA 3B4PA 1YIT3 3FH1A 1UCLA 3MHEA 2YX9A 5EQLA 3FCSB 1JN5B 3LMLA 1QAFA 4GHOA 2HMNB 1A2KA 2IA7A 1UGIA 3WMDA 4EBGA 3Q3FA 4O2HA 1UCJA 2L4VA 3CCR3 2Y74A 1V58A 1LOWA 1ASKA 2F4YA 1JBSA 3EQQB 2RSXA 3D5IA 3FKAA 1N5PA 3CCL3 3AGOA 3WOEB 1I2GA 4XB5A 1IQ8A 2UUGC 2XFTA 3HX8A 3HZPA 4RZMA 1BUJA 4EXRA 1T2IA 1BNFA 4K61A 1YIJ3 1UUGB 5AIHA 1O7GB 1X1WA 4J5KA 1I3FA 3IJEB 2KCDA 1T3BA 3BLZA 1C7HA 5IERA 2BNGA 5M18A 1IDPA 1W7CA 1MGRA 3E99A 3ECFA 1RGFA 3IPTA 8CHOA 1JRQA 1LQGC 2JDIH 1B2UA 3NX0A 4GSPA 2GEYA 4GL6A 1FGOA 3SX1A 3A5EA 1W01A 1VQN3 3V92A 4J8TA 2P0MA 4R80A 3SOYA 3JUOA 3G713 2ZL8A 3FSDA 3KN4A 5LC7A 3DUKA 3TDGA 1G02A 4NHFA 7STDA 2B24B 1X1UA 3MPHA 5EVHA 1IVUA 1G0TA 1E97A 4K90B 4EW5A 5IG0A 3EF8A 3UNLA 1FUSA 1I2FA 1PFPA 3T8UA 4G1MB 2XH9A 1HYFA 2CWVA 4KFFA 5RNTA 2YFIB 3DZLA 1SIIA 1W02A 5IG5A 2XR8B 1GD4A 2F5MA 3AHWA 2JQ5A 4WHAA 3BB9A 3JUQA 2P0XA 1S723 3NQZA 1SQWA 1BNSA 3X3YA 1RGGA 4MEIA 1IVWA 1RTUA 3FLJA 1NNVA 4FCJA 3K5TA 1AV4A 1W6GA 3PCRA 1F8NA 3FZWA 1GOVA 3LTCA 1RGLA 5BIRA 4O8SA 3JUNA 3KIIA 4HKVB 4GB5A 2WOHA 1HKXA 4N6LA 2CFKA 2KAAA 1Q864 1HU9A 3CPOA 3LT8A 1GY5A 3CD63 1RGEA 3D4AA 3UJMA 3CCS3 5CF1A 1O7WB 1QALA 2F99A 1K8A4 2OOVA 3LTBA 3NUVA 4BTXA 3EJVA 3MG3A 2W9PA 2GBWB 1ZGXA 2RGQA 4JRFA 1BOXA 1RDSA 5FGOA 3CCQ3 2CFGA 1R4CA 3U1WA 3GZYB 3BNCA 4XDVA 1BNEA 3MSOA 4OVMA 3CC43 1NB5I 1RCKA 1IVXA 1TFKA 2ML5A 2K0MA 4EC6A 4MMXB 3F8HA 2C10A 1YJW3 3D3LA 3HIIA 3CNXA 3S28A 3CNMA 1OPYA 1BSAA 1ZO2A 3GRDA 3RDEA 1JBRA 2PZVA 2W2CA 2QIYA 1YVSA 4FCMA 4BL2A 1D6YA 3HOHA 3KE7A 2KF3A 3X42A 4HM2B 4AKYA 3VF1A 3CCV3 2RFRA 4AKZA 4R9LA 3DM8A 3PXMA 1BVIA 3CCE3 4RBNA 2CW9A 3J7Yd 4XBYA 4RNTA 3VSYA 2IMJA 3GZXB 1ROVA 3F7XA 2C11A 1A2VA 1OCVA 2Z76A 4BTYA 3K63A 1D6UA 3K0ZA 2OCTA 2HMOB 5CK6A 3Q1CA 5G1KA 1DMMA 4BIRA 1E3VA 1GSPA 4EV2A 1VQQA 3MG1A 1Q9EA 2WGQA 3GZBA 5D81A 5DRVA 2Z7AA 1CH0A 1SIHA 1IV7A 2LQVA 3NBRA 1CYUA 2W04A 1JZDA 1FA3A 1UUWB 4HZBB 3B4OA 3JVCA 4H61A 2OQEA 3HI7A 3PGBA 1S5AA 2BIRA 1RGHA 4N6OB 1IQYA 4KVHA 1BRJA 1N9EA 4KFDA 1RGAA 4CPKA 3CCU3 4STDA 2GXFA 3D5GA 4KZ1A 1N9JA 3NXJA 2K54A 2WOFA 2ZA4A 4N6NB 4FMCA 4ZM8A 1BAOA 2IYJA 2Y73A 3CCM3 3AHSA 3FG4A 1B2MA 4HM0B 1JB2A 1RSNA 4N3VA 4QWTA 1RNTA 1SPUA 1WTHA 2BMQB 2D42A 3HK4A 3EB8A 3KCHA 3PCSA 3AMOB 1YJN3 2V1LA 2ZDJA 2GU3A 3GSPA 2O9UX 2HMJB 6RNTA 1GD3A 2F98A 1O7NB 3G8ZA 1T5YA 3LYGA 3WA2X 3PYJA 3LOYA 4CDLA 5KP1A 2XGNA 3G6E3 3IMAB 3CC73 1I8VA 1RN4A 2I9WA 1LOYA 1TFOA 3B7CA 4HAAA 1VQ43 2BMRB 5HOHA 1I2EA 1GMRA 2B1XB 3EC9A 1VQ83 2F56A 1JKGB 1X1YA 3JUMA 3I563 1K9M4 2Q07A 1ULIB 1GY7A 2FGTA 2HMMB 2K3DA 3HIGA 4HJLB 4K1VA 3NBBA 2FXTA 5IEOA 2XEPA 5IW9A 1RN7A 2P05A 3KFQC 2HMKB 1BRIA 3AGNA 3BNEA 2RNTA 4LMIA 3G4S3 2QEX3 3WA3A 2FNQA 2CC3A 1AQZA 2CHCA 2E2UA 1LNIA 4WWUC 2CWTA 4MJDA 1FGMA 1SJWA 2W03A 3G0KA 3SOAA 1JN5A 5G1LA 1RGCA 2AAEA 3EN8A 4XBTA 5I97A 3OV4A 1CQSA 3UB1A 2YFJB 2W56B 3FF0A 1YNVX 1DVDA 1QMAA 4HM7B 1FZUA 4HM5B 2H0IA 2CK3H 1YGWA 3QRDA 4H3UA 1B20A 3CC23 1LOVA 2H0HA 1EKMA 2OOVC 4KT3B 1YHQ3 3H3HA 5BU4A 1UI8A 3RGRA 3BNBA 4IPBA 2BT3A 1CEWI 1MWTA 3WODG 1IYYA 5KP3A 3NBJA 1IV9A 4ORLA 3SLUA 2SBLA 1RMSA 1W6CA 4FMDA 1RNBA 4X2OA 1RRLA 5IG4A 1STFI 5LC6A 1VQ53 1QAKA 1O7HB 3PZWA 4IIAA 2YFLB 2WGOA 1NJI4 2MF7A 2PNCA 1GY6A 4R9KA 4WFOA 2CX1A 1X1XA 4EV5A 5CXOA 3ZG5A 1UCKA 2CIUA 4LSOA 1W00A 5KP4A 3PS8A 4J9AA 1AR0A 1FW7A 3M8CA 1ROAA 1BSBA 2QGUA 1IT7A 2GSPA 1MWRA 2RBIA 1GS3A 2Z77A 2W6JH 3DGNA 4R1KA 3Q2PA 5JPPA 1VQO3 1OH0A 3S5CA 1TRPA 1L5GB 4HVNA 1VQ63 2LYXA 3NV0B 3GWRA 1UGHI 3B8LA 4DKIA 1MOLA 4Q53A 5AIGA 1TP6A 4J5GA 1Q814 1YVBI 1AVLA 1W5ZA 3NM2A 1JBTA 5D82A 3GZRA 5CF2A 3QK9A 1BRNL 2XSHB 3SXXA 3X3ZA 1QVG2 3LXUX 1PY3A 4HBRA 2ML6A 1LVNA 2CG0A 2R4IA 3EE1A 2BHMA 4L8OA 4CCVA 5BXQA 4FCZA 3LH4A 3WDGB 4O3VA 1JB5A 2GU1A 2BU4A 1RCLA 2CKFB 5IF6A 2OQEC
chains in the Genus database with same CATH topology
2F86B 3Q90A 3DXOA 3V99A 3F9SA 2W9QA 3I0YA 3NM7A 1Q42A 4FR9A 2QA43 3A76A 2KXGA 3KSED 3T8NA 3U97A 2GEXA 4L7KA 1UW1A 1G96A 4MMYB 4WYKB 2XFSA 2E2TA 1IU7A 4WYKA 3S67A 6STDA 1EA2A 1EQKA 2WO0A 3LZAA 1NU3A 1OACA 1VQ93 1NWWA 1OUNA 4JF8A 3DGLA 5EEOA 1OGZA 3NV0A 1OF5B 2XSOB 1NO3A 2M7OA 4R4KA 1A67A 3MWZA 3N8BA 1OHSA 4HYZA 1OF5A 4N6TA 3OX9A 3EN1B 5G2GA 1DMNA 3JUPA 3UL6A 5D83A 4IT7A 3EHCA 1DMQA 1QJGA 2P38A 3CCJ3 3FG3A 3EBTA 4OK0A 2Z6BA 2D1WA 3STDA 3ALAA 5STDA 2BMOB 3CME3 1DYUA 1OHPA 3DGOA 1ULJB 1UUVB 3LT9A 4K1UA 4U13A 3CPW2 3OWYA 3I553 1FUWA 1JB4A 2P09A 1JJ22 1ISKA 1W4NA 4FMAA 3H51A 3F8XA 1W2B2 3X3XA 1K734 2W0QA 4LZIA 1Q824 1IVVA 1TIJA 1ZX2A 3OWUA 4HM3B 5IENA 3CXC2 3LTAA 3WOFB 1V74A 1DVCA 1YGEA 2STDA 3G16A 1RKYA 1QVF2 5JPUA 4NREA 5AEWB 5ELUA 1WNHA 3F40A 1GYBA 3DY5A 1A90A 1CYVA 3KKGA 1US1A 5AIIA 3V98A 1YJ93 3EX9A 3VGNA 3K9MC 2INXA 3X41A 4EYCA 5AYSC 3CMA3 2XRXB 2E2VA 1O7PB 2MC8A 1IK3A 3DMCA 3S29A 2CFLA 1M1K4 1NDOB 3MYTA 2BO9B 4N6MA 2OWPA 2CH9A 3GAXA 4KFEA 4O02B 1K41A 1W6YA 1JKGA 2XGLA 4PEJA 1WMNA 1VQK3 1IQXA 4X2HA 1NB3I 1JNQA 3F7SA 1M9GA 3D9RA 1U8CB 1MNLA 3AMOA 1Z1SA 2CG1A 3S27A 5IG3A 3FGYA 4HM8B 3OW22 1LXEA 4XBXA 3O8YA 3ER7A 4N6V0 1Q40B 1FGQA 1VQ73 3NHXA 2KRTA 1KC84 1FGRA 3N9HA 4RNZA 1STDA 5ELJA 3SVAA 5CLKA 1J2BA 3FF2A 4XDWA 1AVKA 1VQP3 3EBYA 1WMPA 3KZTA 3RGAA 1UI7A 1Q7Y4 1TUHA 1JV2B 1N8QA 1Y4KA 4BTWA 3ROBA 4XM4A 3T0UA 1IT8A 1VQL3 1VQM3 5AEUB 5A0OB 1KD14 5DREA 1EG9B 4HM4B 3OWSA 3OXAA 1N5HA 5HGRA 1OHOA 2A15A 2UX0A 1YI23 5IEPA 3X40A 4RNYA 5AYRB 1LOXA 4L8PA 4N6UA 3FG1A 1WQLB 1KQS2 3MG2A 3MKIA 3UL5A 4MMZB 4AEQA 4WP5A 1FGTA 4HZ9B 4HM1B 1KWIA 3L0RA 4TX4A 5AI1A 1K28A 2CFWA 3SEDA 1RRHA 3BNDA 2OTL3 4OUQA 3CU3A 5TGNA 2XF3A 2GBXB 3DGMA 5AIFA 1BUQA 2IUJA 3N54B 2O3OA 1E3RA 5BVBA 4I4KA 3K7CA 1LNHA 1U5OA 4LEHA 1OGXA 1VZZA 3KSPA 1W2ZA 4LGQA 3NQYA 1TU5A 1M1XB 4HM6B 1PU4A 1M904 5JBSA 3F14A 2HMLB 1KSIA 2W56A 2CWUA 1O7MB 2RCDA 5FW5A 2IUKA 2OTJ3 1D6ZA 3LTDA 2CFDA 1Q40A 4FMBA 1N8R4 1RJOA 1WMOA 3B4PA 1YIT3 3FH1A 3MHEA 2YX9A 5EQLA 3FCSB 1JN5B 3LMLA 1QAFA 2HMNB 1A2KA 2IA7A 3WMDA 4EBGA 4O2HA 2L4VA 3CCR3 2Y74A 1ASKA 3EQQB 2RSXA 3FKAA 1N5PA 3CCL3 3WOEB 4XB5A 1IQ8A 2XFTA 3HX8A 3HZPA 4RZMA 4EXRA 4K61A 1YIJ3 5AIHA 1O7GB 3IJEB 2KCDA 3BLZA 1C7HA 5IERA 2BNGA 1IDPA 1W7CA 3E99A 3ECFA 3IPTA 8CHOA 1JRQA 2JDIH 3NX0A 2GEYA 4GL6A 1FGOA 3SX1A 1W01A 1VQN3 3V92A 4J8TA 2P0MA 4R80A 3SOYA 3JUOA 3G713 2ZL8A 3FSDA 3KN4A 5LC7A 3DUKA 3TDGA 4NHFA 7STDA 2B24B 3MPHA 5EVHA 1IVUA 1E97A 4K90B 5IG0A 3EF8A 3UNLA 1PFPA 3T8UA 4G1MB 2XH9A 2CWVA 4KFFA 2YFIB 3DZLA 1SIIA 1W02A 5IG5A 2XR8B 1GD4A 4WHAA 2JQ5A 3BB9A 3JUQA 2P0XA 1S723 3NQZA 1SQWA 3X3YA 4MEIA 1IVWA 3FLJA 4FCJA 3K5TA 1AV4A 1W6GA 3PCRA 1F8NA 3FZWA 3LTCA 4O8SA 3JUNA 3KIIA 4HKVB 4GB5A 2WOHA 1HKXA 4N6LA 2CFKA 1Q864 1HU9A 3CPOA 3LT8A 1GY5A 3CD63 3UJMA 3CCS3 5CF1A 1O7WB 1QALA 2F99A 1K8A4 2OOVA 3LTBA 3NUVA 4BTXA 3EJVA 3MG3A 2W9PA 2GBWB 2RGQA 4JRFA 5FGOA 3CCQ3 2CFGA 1R4CA 3U1WA 3GZYB 3BNCA 4XDVA 3MSOA 4OVMA 3CC43 1NB5I 1IVXA 1TFKA 2ML5A 2K0MA 4EC6A 4MMXB 3F8HA 2C10A 1YJW3 3D3LA 3HIIA 3CNXA 3S28A 3CNMA 1OPYA 1ZO2A 3GRDA 3RDEA 2PZVA 2W2CA 2QIYA 4FCMA 1D6YA 3KE7A 3X42A 4HM2B 4AKYA 3VF1A 3CCV3 2RFRA 4AKZA 4R9LA 3DM8A 3PXMA 3CCE3 4RBNA 2CW9A 3J7Yd 4XBYA 3VSYA 2IMJA 3GZXB 1ROVA 3F7XA 2C11A 1A2VA 1OCVA 2Z76A 4BTYA 3K63A 1D6UA 3K0ZA 2OCTA 2HMOB 5CK6A 3Q1CA 1DMMA 1E3VA 4EV2A 3MG1A 2WGQA 3GZBA 5D81A 5DRVA 2Z7AA 1SIHA 1IV7A 2LQVA 3NBRA 1CYUA 2W04A 1FA3A 1UUWB 4HZBB 3B4OA 3JVCA 4H61A 2OQEA 3HI7A 3PGBA 1S5AA 4N6OB 1IQYA 4KVHA 1N9EA 4KFDA 3CCU3 4STDA 2GXFA 4KZ1A 1N9JA 3NXJA 2K54A 2WOFA 4N6NB 4FMCA 4ZM8A 2Y73A 3CCM3 3FG4A 4HM0B 1JB2A 4N3VA 4QWTA 1WTHA 1SPUA 2D42A 2BMQB 3HK4A 3PCSA 3EB8A 1YJN3 3AMOB 2V1LA 2ZDJA 2GU3A 2O9UX 2HMJB 1GD3A 2F98A 1O7NB 3G8ZA 1T5YA 3LYGA 3WA2X 3PYJA 3LOYA 4CDLA 5KP1A 2XGNA 3G6E3 3IMAB 3CC73 2I9WA 1TFOA 3B7CA 1VQ43 2BMRB 3EC9A 2B1XB 1VQ83 1JKGB 3JUMA 3I563 1K9M4 2Q07A 1ULIB 1GY7A 2FGTA 2HMMB 3HIGA 4HJLB 4K1VA 5IEOA 3NBBA 2FXTA 2XEPA 5IW9A 1RN7A 2P05A 3KFQC 2HMKB 3BNEA 4LMIA 2QEX3 3G4S3 3WA3A 2FNQA 2CC3A 2CHCA 2E2UA 4WWUC 2CWTA 4MJDA 1FGMA 1SJWA 2W03A 3G0KA 3SOAA 1JN5A 3EN8A 4XBTA 5I97A 3OV4A 1CQSA 3UB1A 2YFJB 2W56B 3FF0A 1DVDA 1QMAA 4HM7B 4HM5B 2CK3H 3QRDA 4H3UA 3CC23 1EKMA 2OOVC 1YHQ3 3H3HA 1UI8A 3RGRA 3BNBA 4IPBA 2BT3A 1CEWI 3WODG 5KP3A 3NBJA 1IV9A 4ORLA 3SLUA 2SBLA 1W6CA 4FMDA 4X2OA 1RRLA 5IG4A 1STFI 5LC6A 1VQ53 1QAKA 1O7HB 3PZWA 4IIAA 2YFLB 2WGOA 1NJI4 2MF7A 2PNCA 1GY6A 4R9KA 4WFOA 4EV5A 5CXOA 2CIUA 4LSOA 1W00A 5KP4A 3PS8A 4J9AA 1AR0A 3M8CA 1ROAA 2QGUA 1IT7A 2Z77A 4R1KA 1GS3A 3DGNA 2W6JH 3Q2PA 5JPPA 1VQO3 1OH0A 3S5CA 1L5GB 4HVNA 1VQ63 2LYXA 3NV0B 3GWRA 3B8LA 1MOLA 4Q53A 5AIGA 1TP6A 1Q814 1YVBI 1AVLA 1W5ZA 3NM2A 5D82A 3GZRA 5CF2A 3QK9A 2XSHB 3SXXA 3X3ZA 1QVG2 3LXUX 4HBRA 2ML6A 1LVNA 2CG0A 2R4IA 3EE1A 2BHMA 4L8OA 4CCVA 5BXQA 4FCZA 3LH4A 3WDGB 4O3VA 1JB5A 2GU1A 2CKFB 5IF6A 2OQEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F86 B;  4HM0 B;  1JB2 A;  4N3V A;  3EF8 A;  3DXO A;  3Q90 A;  3HK4 A;  5IG0 A;  3ROB A;  2BMQ B;  3T8U A;  3F9S A;  4XM4 A;  3I0Y A;  5AEU B;  1Q42 A;  2YFI B;  5IEO A;  3DZL A;  5DRE A;  1EG9 B;  2HMJ B;  1W02 A;  3OWS A;  3A76 A;  4HM4 B;  2XR8 B;  3STD A;  3OXA A;  2F98 A;  1O7N B;  2JQ5 A;  2GEX A;  1OHO A;  3BB9 A;  2A15 A;  2UX0 A;  3G8Z A;  3JUQ A;  3LYG A;  4L7K A;  4CDL A;  4WYK B;  5IEP A;  2I9W A;  4L8P A;  5HGR A;  3B7C A;  2BMR B;  4WYK A;  3EC9 A;  1WQL B;  2B1X B;  1EA2 A;  3FLJ A;  3LZA A;  3MG2 A;  1NU3 A;  3MKI A;  1JKG B;  4FCJ A;  1NWW A;  1OUN A;  1OGZ A;  3NV0 A;  1OF5 B;  2XSO B;  3FZW A;  3JUM A;  4WP5 A;  5IF6 A;  5IG5 A;  1ULI B;  1GY7 A;  1OHS A;  4HZ9 B;  1OF5 A;  4HM1 B;  5AI1 A;  2HMM B;  3OX9 A;  3JUN A;  4HJL B;  4HKV B;  3EN1 B;  4GB5 A;  4K1V A;  1DMN A;  3JUP A;  4XB5 A;  1HKX A;  5G2G A;  3SED A;  2HMK B;  4LMI A;  5D83 A;  4OUQ A;  3CU3 A;  3EHC A;  5TGN A;  2GBX B;  3CPO A;  5AIF A;  1BUQ A;  1DMQ A;  1GY5 A;  1E3R A;  1QJG A;  2CHC A;  4WWU C;  4I4K A;  3K7C A;  3UJM A;  1U5O A;  4LEH A;  3EBT A;  4MJD A;  5BVB A;  5CF1 A;  1O7W B;  1OGX A;  1SJW A;  2F99 A;  1VZZ A;  3G0K A;  3KSP A;  5STD A;  3SOA A;  2BMO B;  1JN5 A;  3NUV A;  3EN8 A;  1OHP A;  4K1U A;  4LGQ A;  1ULJ B;  1UUV B;  4XBT A;  3EJV A;  3OV4 A;  4HM6 B;  1CQS A;  3MG3 A;  4U13 A;  3OWY A;  2YFJ B;  2GBW B;  3F14 A;  3FF0 A;  1JB4 A;  2RGQ A;  2HML B;  1ISK A;  1O7M B;  3F8X A;  3H51 A;  1QMA A;  3GZY B;  4HM7 B;  4HM5 B;  3MSO A;  4OVM A;  4XDV A;  2RCD A;  5FW5 A;  4H3U A;  1Q40 A;  1ZX2 A;  3F8H A;  3OWU A;  3H3H A;  4HM3 B;  5IEN A;  3RGR A;  3B4P A;  3CNX A;  3CNM A;  1OPY A;  1ZO2 A;  3GRD A;  6STD A;  3FH1 A;  2STD A;  2PZV A;  5KP3 A;  3MHE A;  4ORL A;  2W2C A;  2QIY A;  3G16 A;  4FCM A;  1JN5 B;  4X2O A;  5IG4 A;  5JPU A;  3KE7 A;  5AEW B;  4HM2 B;  2HMN B;  1A2K A;  1GYB A;  3F40 A;  1O7H B;  4IIA A;  3WMD A;  2YFL B;  3KKG A;  2RFR A;  5AII A;  4R9L A;  3DM8 A;  1GY6 A;  3EX9 A;  4R9K A;  3UNL A;  1ASK A;  3VGN A;  3EQQ B;  2INX A;  5CXO A;  3T8N A;  3FKA A;  1W00 A;  4XBY A;  3VSY A;  5KP4 A;  2IMJ A;  3GZX B;  4J9A A;  1AR0 A;  2XRX B;  3F7X A;  3HX8 A;  3HZP A;  1O7P B;  4RZM A;  1OCV A;  2Z76 A;  3M8C A;  3DMC A;  3K0Z A;  2QGU A;  1NDO B;  3MYT A;  2HMO B;  2Z77 A;  2OWP A;  1GS3 A;  4R1K A;  5CK6 A;  1O7G B;  5AIH A;  1DMM A;  1K41 A;  1W6Y A;  1JKG A;  1E3V A;  1OH0 A;  3S5C A;  4PEJ A;  5JPP A;  3MG1 A;  4HVN A;  3NV0 B;  3GZB A;  3GWR A;  5D81 A;  2Z7A A;  3B8L A;  3BLZ A;  3NBR A;  4X2H A;  1C7H A;  4Q53 A;  3F7S A;  5DRV A;  2BNG A;  5AIG A;  1TP6 A;  5IER A;  1IDP A;  3D9R A;  1UUW B;  3E99 A;  3ECF A;  4HZB B;  3B4O A;  5KP1 A;  1Z1S A;  3NM2 A;  3IPT A;  5IG3 A;  3FGY A;  5D82 A;  4HM8 B;  3GZR A;  8CHO A;  1S5A A;  5CF2 A;  2GEY A;  4XBX A;  4KVH A;  3ER7 A;  1W01 A;  1Q40 B;  2XSH B;  1E97 A;  4J8T A;  3NHX A;  3SOY A;  3JUO A;  2GXF A;  4STD A;  3FSD A;  3NXJ A;  2R4I A;  1STD A;  3DUK A;  2K54 A;  4L8O A;  5CLK A;  3FF2 A;  5BXQ A;  4XDW A;  7STD A;  3RGA A;  2B24 B;  3EBY A;  1JB5 A;  5EVH A;  3KZT A;  2CKF B;  1TUH A; 
#chains in the Genus database with same CATH topology
 2F86 B;  3Q90 A;  3DXO A;  3V99 A;  3WHO A;  1EQK A;  3F9S A;  3ZFZ A;  2W9Q A;  3I0Y A;  1BRS A;  1Q42 A;  3NM7 A;  4FR9 A;  2QA4 3;  3A76 A;  2KXG A;  3KSE D;  4I5Q A;  3T8N A;  3U97 A;  2GEX A;  4L7K A;  1UW1 A;  1G96 A;  1MGW A;  4MMY B;  4BL3 A;  4WYK B;  7RNT A;  1LQM B;  2XFS A;  1RN1 A;  1IU7 A;  1V57 A;  2E2T A;  4WYK A;  3S67 A;  2HOH A;  4CJN A;  1EA2 A;  1GMP A;  2WO0 A;  3LZA A;  1NU3 A;  6STD A;  1OAC A;  1VQ9 3;  1NWW A;  1UDI I;  1OUN A;  4JF8 A;  1BSD A;  3DGL A;  5EEO A;  1OGZ A;  1DET A;  1OF5 B;  2XSO B;  1NO3 A;  2M7O A;  3NV0 A;  3DGY A;  2J8X B;  4R4K A;  3MWZ A;  3N8B A;  1OHS A;  4HYZ A;  3SYU A;  1OF5 A;  1RGK A;  2C4B A;  4N6T A;  1A67 A;  3OX9 A;  3EN1 B;  5G2G A;  1DMN A;  1Q7H A;  3JUP A;  3UL6 A;  1TRQ A;  5D83 A;  3URP A;  4IT7 A;  3EHC A;  2SAR A;  1DE3 A;  1MWS A;  1DMQ A;  1I3I A;  1QJG A;  2P38 A;  3CCJ 3;  3FG3 A;  3EBT A;  1T2H A;  2Z6B A;  2D1W A;  4OK0 A;  3STD A;  1C54 A;  3ALA A;  3ZG0 A;  5STD A;  2BMO B;  3CME 3;  1DYU A;  1I70 A;  1OHP A;  1ULJ B;  1UUV B;  2AAD A;  3DGO A;  3LT9 A;  4K1U A;  4U13 A;  3CPW 2;  3OWY A;  3I55 3;  1FUW A;  8RNT A;  1JB4 A;  2P09 A;  2ZHX B;  1JJ2 2;  3WR2 A;  1ISK A;  1TJD A;  1W4N A;  4FMA A;  3H51 A;  1RHL A;  3F8X A;  1BSE A;  1W2B 2;  1HZ1 A;  3X3X A;  1UCI A;  2W0Q A;  1K73 4;  4LZI A;  3BU4 A;  1IVV A;  1TIJ A;  1Q82 4;  1ZX2 A;  3OWU A;  4HM3 B;  5IEN A;  3CXC 2;  3LTA A;  3WOF B;  1V74 A;  1DVC A;  1BRH A;  1YGE A;  2STD A;  1AY7 A;  3G16 A;  1RKY A;  1QVF 2;  4LYL B;  3DH2 A;  5JPU A;  4NRE A;  5AEW B;  1BSC A;  1WNH A;  5ELU A;  3F40 A;  1GYB A;  3DY5 A;  4ILF A;  1CYV A;  3KKG A;  1US1 A;  5AII A;  3V98 A;  1YJ9 3;  1A90 A;  3EX9 A;  1PYL A;  3VGN A;  2F5W A;  1B27 A;  2INX A;  3K9M C;  3X41 A;  4EYC A;  2KF6 A;  1FYS A;  1ZS7 A;  5AYS C;  3CMA 3;  2XRX B;  2E2V A;  1O7P B;  1R4Y A;  2MC8 A;  1MWU A;  1IK3 A;  1BRG A;  1BGS A;  6GSP A;  3DMC A;  3S29 A;  2CFL A;  1M1K 4;  2L1S A;  1EUI C;  1NDO B;  3MYT A;  2BO9 B;  4N6M A;  1RLS A;  2CH9 A;  2OWP A;  3GAX A;  4KFE A;  4O02 B;  1K41 A;  1W6Y A;  1JKG A;  2XGL A;  4PEJ A;  1WMN A;  1VQK 3;  2IY2 A;  1I0X A;  1IQX A;  4X2H A;  1NB3 I;  1JNQ A;  3F7S A;  1M9G A;  1GMQ A;  3AMO A;  1U8C B;  1MNL A;  3D9R A;  5M19 A;  1Z1S A;  2CG1 A;  3S27 A;  5IG3 A;  3FGY A;  4HM8 B;  3OW2 2;  1LXE A;  1BAN A;  1B2Z A;  4XBX A;  5M1A A;  3O8Y A;  1FUT A;  1I0V A;  3ER7 A;  9RNT A;  2H0G A;  4HOH A;  4N6V 0;  1Q40 B;  1FGQ A;  1B2S A;  1VQ7 3;  3NHX A;  5GSP A;  1BNI A;  2KRT A;  1BRK A;  1KC8 4;  1FGR A;  3N9H A;  4RNZ A;  1STD A;  5ELJ A;  3SVA A;  5CLK A;  1J2B A;  3FF2 A;  4XDW A;  1B2X A;  1AVK A;  1VQP 3;  1B21 A;  3EBY A;  1WMP A;  3KZT A;  3RGA A;  1UI7 A;  1Q7Y 4;  1TUH A;  1JV2 B;  1N8Q A;  1Y4K A;  4BTW A;  3ROB A;  4XM4 A;  3T0U A;  1IT8 A;  4BU4 A;  1VQL 3;  1VQM 3;  5AEU B;  4NPB A;  5A0O B;  1KD1 4;  1SAR A;  2CX0 A;  1EG9 B;  4HM4 B;  3OWS A;  5DRE A;  3OXA A;  1N5H A;  5HGR A;  1OHO A;  2A15 A;  2UX0 A;  1YI2 3;  7GSP A;  1EEJ A;  1GOY A;  5IEP A;  3X40 A;  4RNY A;  5AYR B;  1LOX A;  4L8P A;  4N6U A;  3FG1 A;  1BNJ A;  1BU4 A;  1WQL B;  3MG2 A;  3MKI A;  1KQS 2;  3UL5 A;  4MMZ B;  3RNT A;  4AEQ A;  4WP5 A;  1BIR A;  1FGT A;  2R41 A;  4HZ9 B;  1BNR A;  4HM1 B;  1KWI A;  3L0R A;  4TX4 A;  5AI1 A;  1K28 A;  2CFW A;  1LRA A;  3SED A;  1TTO A;  1RRH A;  3BND A;  2OTL 3;  1A2P A;  4OUQ A;  3CU3 A;  5TGN A;  2XF3 A;  2GBX B;  1BNG A;  3DGM A;  5AIF A;  2UGI A;  2IUJ A;  3N54 B;  2O3O A;  1BUQ A;  1E3R A;  5BVB A;  4I4K A;  3K7C A;  1LNH A;  1U5O A;  4LEH A;  2KF5 A;  1OGX A;  1B3S A;  1VZZ A;  1W2Z A;  3KSP A;  4LGQ A;  3NQY A;  1JZO A;  1M1X B;  4HM6 B;  1TU5 A;  1PU4 A;  1M90 4;  3D79 A;  5JBS A;  3F14 A;  2HML B;  1KSI A;  2W56 A;  2CWU A;  1O7M B;  2KF4 A;  3BIR A;  2RCD A;  5FW5 A;  2IUK A;  2OTJ 3;  1D6Z A;  1GOU A;  2CFD A;  3LTD A;  1Q40 A;  4FMB A;  1N8R 4;  1RJO A;  1WMO A;  3B4P A;  1YIT 3;  3FH1 A;  1UCL A;  3MHE A;  2YX9 A;  5EQL A;  3FCS B;  1JN5 B;  3LML A;  1QAF A;  4GHO A;  2HMN B;  1A2K A;  2IA7 A;  1UGI A;  3WMD A;  4EBG A;  3Q3F A;  4O2H A;  1UCJ A;  2L4V A;  3CCR 3;  2Y74 A;  1V58 A;  1LOW A;  1ASK A;  2F4Y A;  1JBS A;  3EQQ B;  2RSX A;  3D5I A;  3FKA A;  1N5P A;  3CCL 3;  3AGO A;  3WOE B;  1I2G A;  4XB5 A;  1IQ8 A;  2UUG C;  2XFT A;  3HX8 A;  3HZP A;  4RZM A;  1BUJ A;  4EXR A;  1T2I A;  1BNF A;  4K61 A;  1YIJ 3;  1UUG B;  5AIH A;  1O7G B;  1X1W A;  4J5K A;  1I3F A;  3IJE B;  2KCD A;  1T3B A;  3BLZ A;  1C7H A;  5IER A;  2BNG A;  5M18 A;  1IDP A;  1W7C A;  1MGR A;  3E99 A;  3ECF A;  1RGF A;  3IPT A;  8CHO A;  1JRQ A;  1LQG C;  2JDI H;  1B2U A;  3NX0 A;  4GSP A;  2GEY A;  4GL6 A;  1FGO A;  3SX1 A;  3A5E A;  1W01 A;  1VQN 3;  3V92 A;  4J8T A;  2P0M A;  4R80 A;  3SOY A;  3JUO A;  3G71 3;  2ZL8 A;  3FSD A;  3KN4 A;  5LC7 A;  3DUK A;  3TDG A;  1G02 A;  4NHF A;  7STD A;  2B24 B;  1X1U A;  3MPH A;  5EVH A;  1IVU A;  1G0T A;  1E97 A;  4K90 B;  4EW5 A;  5IG0 A;  3EF8 A;  3UNL A;  1FUS A;  1I2F A;  1PFP A;  3T8U A;  4G1M B;  2XH9 A;  1HYF A;  2CWV A;  4KFF A;  5RNT A;  2YFI B;  3DZL A;  1SII A;  1W02 A;  5IG5 A;  2XR8 B;  1GD4 A;  2F5M A;  3AHW A;  2JQ5 A;  4WHA A;  3BB9 A;  3JUQ A;  2P0X A;  1S72 3;  3NQZ A;  1SQW A;  1BNS A;  3X3Y A;  1RGG A;  4MEI A;  1IVW A;  1RTU A;  3FLJ A;  1NNV A;  4FCJ A;  3K5T A;  1AV4 A;  1W6G A;  3PCR A;  1F8N A;  3FZW A;  1GOV A;  3LTC A;  1RGL A;  5BIR A;  4O8S A;  3JUN A;  3KII A;  4HKV B;  4GB5 A;  2WOH A;  1HKX A;  4N6L A;  2CFK A;  2KAA A;  1Q86 4;  1HU9 A;  3CPO A;  3LT8 A;  1GY5 A;  3CD6 3;  1RGE A;  3D4A A;  3UJM A;  3CCS 3;  5CF1 A;  1O7W B;  1QAL A;  2F99 A;  1K8A 4;  2OOV A;  3LTB A;  3NUV A;  4BTX A;  3EJV A;  3MG3 A;  2W9P A;  2GBW B;  1ZGX A;  2RGQ A;  4JRF A;  1BOX A;  1RDS A;  5FGO A;  3CCQ 3;  2CFG A;  1R4C A;  3U1W A;  3GZY B;  3BNC A;  4XDV A;  1BNE A;  3MSO A;  4OVM A;  3CC4 3;  1NB5 I;  1RCK A;  1IVX A;  1TFK A;  2ML5 A;  2K0M A;  4EC6 A;  4MMX B;  3F8H A;  2C10 A;  1YJW 3;  3D3L A;  3HII A;  3CNX A;  3S28 A;  3CNM A;  1OPY A;  1BSA A;  1ZO2 A;  3GRD A;  3RDE A;  1JBR A;  2PZV A;  2W2C A;  2QIY A;  1YVS A;  4FCM A;  4BL2 A;  1D6Y A;  3HOH A;  3KE7 A;  2KF3 A;  3X42 A;  4HM2 B;  4AKY A;  3VF1 A;  3CCV 3;  2RFR A;  4AKZ A;  4R9L A;  3DM8 A;  3PXM A;  1BVI A;  3CCE 3;  4RBN A;  2CW9 A;  3J7Y d;  4XBY A;  4RNT A;  3VSY A;  2IMJ A;  3GZX B;  1ROV A;  3F7X A;  2C11 A;  1A2V A;  1OCV A;  2Z76 A;  4BTY A;  3K63 A;  1D6U A;  3K0Z A;  2OCT A;  2HMO B;  5CK6 A;  3Q1C A;  5G1K A;  1DMM A;  4BIR A;  1E3V A;  1GSP A;  4EV2 A;  1VQQ A;  3MG1 A;  1Q9E A;  2WGQ A;  3GZB A;  5D81 A;  5DRV A;  2Z7A A;  1CH0 A;  1SIH A;  1IV7 A;  2LQV A;  3NBR A;  1CYU A;  2W04 A;  1JZD A;  1FA3 A;  1UUW B;  4HZB B;  3B4O A;  3JVC A;  4H61 A;  2OQE A;  3HI7 A;  3PGB A;  1S5A A;  2BIR A;  1RGH A;  4N6O B;  1IQY A;  4KVH A;  1BRJ A;  1N9E A;  4KFD A;  1RGA A;  4CPK A;  3CCU 3;  4STD A;  2GXF A;  3D5G A;  4KZ1 A;  1N9J A;  3NXJ A;  2K54 A;  2WOF A;  2ZA4 A;  4N6N B;  4FMC A;  4ZM8 A;  1BAO A;  2IYJ A;  2Y73 A;  3CCM 3;  3AHS A;  3FG4 A;  1B2M A;  4HM0 B;  1JB2 A;  1RSN A;  4N3V A;  4QWT A;  1RNT A;  1SPU A;  1WTH A;  2BMQ B;  2D42 A;  3HK4 A;  3EB8 A;  3KCH A;  3PCS A;  3AMO B;  1YJN 3;  2V1L A;  2ZDJ A;  2GU3 A;  3GSP A;  2O9U X;  2HMJ B;  6RNT A;  1GD3 A;  2F98 A;  1O7N B;  3G8Z A;  1T5Y A;  3LYG A;  3WA2 X;  3PYJ A;  3LOY A;  4CDL A;  5KP1 A;  2XGN A;  3G6E 3;  3IMA B;  3CC7 3;  1I8V A;  1RN4 A;  2I9W A;  1LOY A;  1TFO A;  3B7C A;  4HAA A;  1VQ4 3;  2BMR B;  5HOH A;  1I2E A;  1GMR A;  2B1X B;  3EC9 A;  1VQ8 3;  2F56 A;  1JKG B;  1X1Y A;  3JUM A;  3I56 3;  1K9M 4;  2Q07 A;  1ULI B;  1GY7 A;  2FGT A;  2HMM B;  2K3D A;  3HIG A;  4HJL B;  4K1V A;  3NBB A;  2FXT A;  5IEO A;  2XEP A;  5IW9 A;  1RN7 A;  2P05 A;  3KFQ C;  2HMK B;  1BRI A;  3AGN A;  3BNE A;  2RNT A;  4LMI A;  3G4S 3;  2QEX 3;  3WA3 A;  2FNQ A;  2CC3 A;  1AQZ A;  2CHC A;  2E2U A;  1LNI A;  4WWU C;  2CWT A;  4MJD A;  1FGM A;  1SJW A;  2W03 A;  3G0K A;  3SOA A;  1JN5 A;  5G1L A;  1RGC A;  2AAE A;  3EN8 A;  4XBT A;  5I97 A;  3OV4 A;  1CQS A;  3UB1 A;  2YFJ B;  2W56 B;  3FF0 A;  1YNV X;  1DVD A;  1QMA A;  4HM7 B;  1FZU A;  4HM5 B;  2H0I A;  2CK3 H;  1YGW A;  3QRD A;  4H3U A;  1B20 A;  3CC2 3;  1LOV A;  2H0H A;  1EKM A;  2OOV C;  4KT3 B;  1YHQ 3;  3H3H A;  5BU4 A;  1UI8 A;  3RGR A;  3BNB A;  4IPB A;  2BT3 A;  1CEW I;  1MWT A;  3WOD G;  1IYY A;  5KP3 A;  3NBJ A;  1IV9 A;  4ORL A;  3SLU A;  2SBL A;  1RMS A;  1W6C A;  4FMD A;  1RNB A;  4X2O A;  1RRL A;  5IG4 A;  1STF I;  5LC6 A;  1VQ5 3;  1QAK A;  1O7H B;  3PZW A;  4IIA A;  2YFL B;  2WGO A;  1NJI 4;  2MF7 A;  2PNC A;  1GY6 A;  4R9K A;  4WFO A;  2CX1 A;  1X1X A;  4EV5 A;  5CXO A;  3ZG5 A;  1UCK A;  2CIU A;  4LSO A;  1W00 A;  5KP4 A;  3PS8 A;  4J9A A;  1AR0 A;  1FW7 A;  3M8C A;  1ROA A;  1BSB A;  2QGU A;  1IT7 A;  2GSP A;  1MWR A;  2RBI A;  1GS3 A;  2Z77 A;  2W6J H;  3DGN A;  4R1K A;  3Q2P A;  5JPP A;  1VQO 3;  1OH0 A;  3S5C A;  1TRP A;  1L5G B;  4HVN A;  1VQ6 3;  2LYX A;  3NV0 B;  3GWR A;  1UGH I;  3B8L A;  4DKI A;  1MOL A;  4Q53 A;  5AIG A;  1TP6 A;  4J5G A;  1Q81 4;  1YVB I;  1AVL A;  1W5Z A;  3NM2 A;  1JBT A;  5D82 A;  3GZR A;  5CF2 A;  3QK9 A;  1BRN L;  2XSH B;  3SXX A;  3X3Z A;  1QVG 2;  3LXU X;  1PY3 A;  4HBR A;  2ML6 A;  1LVN A;  2CG0 A;  2R4I A;  3EE1 A;  2BHM A;  4L8O A;  4CCV A;  5BXQ A;  4FCZ A;  3LH4 A;  3WDG B;  4O3V A;  1JB5 A;  2GU1 A;  2BU4 A;  1RCL A;  2CKF B;  5IF6 A;  2OQE C; 
#chains in the Genus database with same CATH homology
 2F86 B;  3Q90 A;  3DXO A;  3V99 A;  3F9S A;  2W9Q A;  3I0Y A;  3NM7 A;  1Q42 A;  4FR9 A;  2QA4 3;  3A76 A;  2KXG A;  3KSE D;  3T8N A;  3U97 A;  2GEX A;  4L7K A;  1UW1 A;  1G96 A;  4MMY B;  4WYK B;  2XFS A;  2E2T A;  1IU7 A;  4WYK A;  3S67 A;  6STD A;  1EA2 A;  1EQK A;  2WO0 A;  3LZA A;  1NU3 A;  1OAC A;  1VQ9 3;  1NWW A;  1OUN A;  4JF8 A;  3DGL A;  5EEO A;  1OGZ A;  3NV0 A;  1OF5 B;  2XSO B;  1NO3 A;  2M7O A;  4R4K A;  1A67 A;  3MWZ A;  3N8B A;  1OHS A;  4HYZ A;  1OF5 A;  4N6T A;  3OX9 A;  3EN1 B;  5G2G A;  1DMN A;  3JUP A;  3UL6 A;  5D83 A;  4IT7 A;  3EHC A;  1DMQ A;  1QJG A;  2P38 A;  3CCJ 3;  3FG3 A;  3EBT A;  4OK0 A;  2Z6B A;  2D1W A;  3STD A;  3ALA A;  5STD A;  2BMO B;  3CME 3;  1DYU A;  1OHP A;  3DGO A;  1ULJ B;  1UUV B;  3LT9 A;  4K1U A;  4U13 A;  3CPW 2;  3OWY A;  3I55 3;  1FUW A;  1JB4 A;  2P09 A;  1JJ2 2;  1ISK A;  1W4N A;  4FMA A;  3H51 A;  3F8X A;  1W2B 2;  3X3X A;  1K73 4;  2W0Q A;  4LZI A;  1Q82 4;  1IVV A;  1TIJ A;  1ZX2 A;  3OWU A;  4HM3 B;  5IEN A;  3CXC 2;  3LTA A;  3WOF B;  1V74 A;  1DVC A;  1YGE A;  2STD A;  3G16 A;  1RKY A;  1QVF 2;  5JPU A;  4NRE A;  5AEW B;  5ELU A;  1WNH A;  3F40 A;  1GYB A;  3DY5 A;  1A90 A;  1CYV A;  3KKG A;  1US1 A;  5AII A;  3V98 A;  1YJ9 3;  3EX9 A;  3VGN A;  3K9M C;  2INX A;  3X41 A;  4EYC A;  5AYS C;  3CMA 3;  2XRX B;  2E2V A;  1O7P B;  2MC8 A;  1IK3 A;  3DMC A;  3S29 A;  2CFL A;  1M1K 4;  1NDO B;  3MYT A;  2BO9 B;  4N6M A;  2OWP A;  2CH9 A;  3GAX A;  4KFE A;  4O02 B;  1K41 A;  1W6Y A;  1JKG A;  2XGL A;  4PEJ A;  1WMN A;  1VQK 3;  1IQX A;  4X2H A;  1NB3 I;  1JNQ A;  3F7S A;  1M9G A;  3D9R A;  1U8C B;  1MNL A;  3AMO A;  1Z1S A;  2CG1 A;  3S27 A;  5IG3 A;  3FGY A;  4HM8 B;  3OW2 2;  1LXE A;  4XBX A;  3O8Y A;  3ER7 A;  4N6V 0;  1Q40 B;  1FGQ A;  1VQ7 3;  3NHX A;  2KRT A;  1KC8 4;  1FGR A;  3N9H A;  4RNZ A;  1STD A;  5ELJ A;  3SVA A;  5CLK A;  1J2B A;  3FF2 A;  4XDW A;  1AVK A;  1VQP 3;  3EBY A;  1WMP A;  3KZT A;  3RGA A;  1UI7 A;  1Q7Y 4;  1TUH A;  1JV2 B;  1N8Q A;  1Y4K A;  4BTW A;  3ROB A;  4XM4 A;  3T0U A;  1IT8 A;  1VQL 3;  1VQM 3;  5AEU B;  5A0O B;  1KD1 4;  5DRE A;  1EG9 B;  4HM4 B;  3OWS A;  3OXA A;  1N5H A;  5HGR A;  1OHO A;  2A15 A;  2UX0 A;  1YI2 3;  5IEP A;  3X40 A;  4RNY A;  5AYR B;  1LOX A;  4L8P A;  4N6U A;  3FG1 A;  1WQL B;  1KQS 2;  3MG2 A;  3MKI A;  3UL5 A;  4MMZ B;  4AEQ A;  4WP5 A;  1FGT A;  4HZ9 B;  4HM1 B;  1KWI A;  3L0R A;  4TX4 A;  5AI1 A;  1K28 A;  2CFW A;  3SED A;  1RRH A;  3BND A;  2OTL 3;  4OUQ A;  3CU3 A;  5TGN A;  2XF3 A;  2GBX B;  3DGM A;  5AIF A;  1BUQ A;  2IUJ A;  3N54 B;  2O3O A;  1E3R A;  5BVB A;  4I4K A;  3K7C A;  1LNH A;  1U5O A;  4LEH A;  1OGX A;  1VZZ A;  3KSP A;  1W2Z A;  4LGQ A;  3NQY A;  1TU5 A;  1M1X B;  4HM6 B;  1PU4 A;  1M90 4;  5JBS A;  3F14 A;  2HML B;  1KSI A;  2W56 A;  2CWU A;  1O7M B;  2RCD A;  5FW5 A;  2IUK A;  2OTJ 3;  1D6Z A;  3LTD A;  2CFD A;  1Q40 A;  4FMB A;  1N8R 4;  1RJO A;  1WMO A;  3B4P A;  1YIT 3;  3FH1 A;  3MHE A;  2YX9 A;  5EQL A;  3FCS B;  1JN5 B;  3LML A;  1QAF A;  2HMN B;  1A2K A;  2IA7 A;  3WMD A;  4EBG A;  4O2H A;  2L4V A;  3CCR 3;  2Y74 A;  1ASK A;  3EQQ B;  2RSX A;  3FKA A;  1N5P A;  3CCL 3;  3WOE B;  4XB5 A;  1IQ8 A;  2XFT A;  3HX8 A;  3HZP A;  4RZM A;  4EXR A;  4K61 A;  1YIJ 3;  5AIH A;  1O7G B;  3IJE B;  2KCD A;  3BLZ A;  1C7H A;  5IER A;  2BNG A;  1IDP A;  1W7C A;  3E99 A;  3ECF A;  3IPT A;  8CHO A;  1JRQ A;  2JDI H;  3NX0 A;  2GEY A;  4GL6 A;  1FGO A;  3SX1 A;  1W01 A;  1VQN 3;  3V92 A;  4J8T A;  2P0M A;  4R80 A;  3SOY A;  3JUO A;  3G71 3;  2ZL8 A;  3FSD A;  3KN4 A;  5LC7 A;  3DUK A;  3TDG A;  4NHF A;  7STD A;  2B24 B;  3MPH A;  5EVH A;  1IVU A;  1E97 A;  4K90 B;  5IG0 A;  3EF8 A;  3UNL A;  1PFP A;  3T8U A;  4G1M B;  2XH9 A;  2CWV A;  4KFF A;  2YFI B;  3DZL A;  1SII A;  1W02 A;  5IG5 A;  2XR8 B;  1GD4 A;  4WHA A;  2JQ5 A;  3BB9 A;  3JUQ A;  2P0X A;  1S72 3;  3NQZ A;  1SQW A;  3X3Y A;  4MEI A;  1IVW A;  3FLJ A;  4FCJ A;  3K5T A;  1AV4 A;  1W6G A;  3PCR A;  1F8N A;  3FZW A;  3LTC A;  4O8S A;  3JUN A;  3KII A;  4HKV B;  4GB5 A;  2WOH A;  1HKX A;  4N6L A;  2CFK A;  1Q86 4;  1HU9 A;  3CPO A;  3LT8 A;  1GY5 A;  3CD6 3;  3UJM A;  3CCS 3;  5CF1 A;  1O7W B;  1QAL A;  2F99 A;  1K8A 4;  2OOV A;  3LTB A;  3NUV A;  4BTX A;  3EJV A;  3MG3 A;  2W9P A;  2GBW B;  2RGQ A;  4JRF A;  5FGO A;  3CCQ 3;  2CFG A;  1R4C A;  3U1W A;  3GZY B;  3BNC A;  4XDV A;  3MSO A;  4OVM A;  3CC4 3;  1NB5 I;  1IVX A;  1TFK A;  2ML5 A;  2K0M A;  4EC6 A;  4MMX B;  3F8H A;  2C10 A;  1YJW 3;  3D3L A;  3HII A;  3CNX A;  3S28 A;  3CNM A;  1OPY A;  1ZO2 A;  3GRD A;  3RDE A;  2PZV A;  2W2C A;  2QIY A;  4FCM A;  1D6Y A;  3KE7 A;  3X42 A;  4HM2 B;  4AKY A;  3VF1 A;  3CCV 3;  2RFR A;  4AKZ A;  4R9L A;  3DM8 A;  3PXM A;  3CCE 3;  4RBN A;  2CW9 A;  3J7Y d;  4XBY A;  3VSY A;  2IMJ A;  3GZX B;  1ROV A;  3F7X A;  2C11 A;  1A2V A;  1OCV A;  2Z76 A;  4BTY A;  3K63 A;  1D6U A;  3K0Z A;  2OCT A;  2HMO B;  5CK6 A;  3Q1C A;  1DMM A;  1E3V A;  4EV2 A;  3MG1 A;  2WGQ A;  3GZB A;  5D81 A;  5DRV A;  2Z7A A;  1SIH A;  1IV7 A;  2LQV A;  3NBR A;  1CYU A;  2W04 A;  1FA3 A;  1UUW B;  4HZB B;  3B4O A;  3JVC A;  4H61 A;  2OQE A;  3HI7 A;  3PGB A;  1S5A A;  4N6O B;  1IQY A;  4KVH A;  1N9E A;  4KFD A;  3CCU 3;  4STD A;  2GXF A;  4KZ1 A;  1N9J A;  3NXJ A;  2K54 A;  2WOF A;  4N6N B;  4FMC A;  4ZM8 A;  2Y73 A;  3CCM 3;  3FG4 A;  4HM0 B;  1JB2 A;  4N3V A;  4QWT A;  1WTH A;  1SPU A;  2D42 A;  2BMQ B;  3HK4 A;  3PCS A;  3EB8 A;  1YJN 3;  3AMO B;  2V1L A;  2ZDJ A;  2GU3 A;  2O9U X;  2HMJ B;  1GD3 A;  2F98 A;  1O7N B;  3G8Z A;  1T5Y A;  3LYG A;  3WA2 X;  3PYJ A;  3LOY A;  4CDL A;  5KP1 A;  2XGN A;  3G6E 3;  3IMA B;  3CC7 3;  2I9W A;  1TFO A;  3B7C A;  1VQ4 3;  2BMR B;  3EC9 A;  2B1X B;  1VQ8 3;  1JKG B;  3JUM A;  3I56 3;  1K9M 4;  2Q07 A;  1ULI B;  1GY7 A;  2FGT A;  2HMM B;  3HIG A;  4HJL B;  4K1V A;  5IEO A;  3NBB A;  2FXT A;  2XEP A;  5IW9 A;  1RN7 A;  2P05 A;  3KFQ C;  2HMK B;  3BNE A;  4LMI A;  2QEX 3;  3G4S 3;  3WA3 A;  2FNQ A;  2CC3 A;  2CHC A;  2E2U A;  4WWU C;  2CWT A;  4MJD A;  1FGM A;  1SJW A;  2W03 A;  3G0K A;  3SOA A;  1JN5 A;  3EN8 A;  4XBT A;  5I97 A;  3OV4 A;  1CQS A;  3UB1 A;  2YFJ B;  2W56 B;  3FF0 A;  1DVD A;  1QMA A;  4HM7 B;  4HM5 B;  2CK3 H;  3QRD A;  4H3U A;  3CC2 3;  1EKM A;  2OOV C;  1YHQ 3;  3H3H A;  1UI8 A;  3RGR A;  3BNB A;  4IPB A;  2BT3 A;  1CEW I;  3WOD G;  5KP3 A;  3NBJ A;  1IV9 A;  4ORL A;  3SLU A;  2SBL A;  1W6C A;  4FMD A;  4X2O A;  1RRL A;  5IG4 A;  1STF I;  5LC6 A;  1VQ5 3;  1QAK A;  1O7H B;  3PZW A;  4IIA A;  2YFL B;  2WGO A;  1NJI 4;  2MF7 A;  2PNC A;  1GY6 A;  4R9K A;  4WFO A;  4EV5 A;  5CXO A;  2CIU A;  4LSO A;  1W00 A;  5KP4 A;  3PS8 A;  4J9A A;  1AR0 A;  3M8C A;  1ROA A;  2QGU A;  1IT7 A;  2Z77 A;  4R1K A;  1GS3 A;  3DGN A;  2W6J H;  3Q2P A;  5JPP A;  1VQO 3;  1OH0 A;  3S5C A;  1L5G B;  4HVN A;  1VQ6 3;  2LYX A;  3NV0 B;  3GWR A;  3B8L A;  1MOL A;  4Q53 A;  5AIG A;  1TP6 A;  1Q81 4;  1YVB I;  1AVL A;  1W5Z A;  3NM2 A;  5D82 A;  3GZR A;  5CF2 A;  3QK9 A;  2XSH B;  3SXX A;  3X3Z A;  1QVG 2;  3LXU X;  4HBR A;  2ML6 A;  1LVN A;  2CG0 A;  2R4I A;  3EE1 A;  2BHM A;  4L8O A;  4CCV A;  5BXQ A;  4FCZ A;  3LH4 A;  3WDG B;  4O3V A;  1JB5 A;  2GU1 A;  2CKF B;  5IF6 A;  2OQE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...