1OHSA

Crystal structure of 5-3-ketosteroid isomerase mutant y14f/d38n from pseudomonas testosteroni complexed with androstanedione
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRFVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Crystal Structure of 5-3-Ketosteroid Isomerase Mutant Y14F/D38N from Pseudomonas Testosteroni Complexed with Androstanedione
rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
total genus 33
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ohsA00
1ZO2A 2K54A 3EN8A 4XDVA 3SEDA 1JN5B 3NUVA 4XDWA 1ASKA 2GEXA 4HM0B 4STDA 3F14A 5KP1A 3DMCA 3EHCA 1OHSA 5FW5A 4CDLA 2Z7AA 4HM2B 3T8UA 2HMJB 2GBXB 5AIHA 4XM4A 3K0ZA 4OUQA 3F9SA 4K1UA 2F98A 1OCVA 4I4KA 3STDA 1EA2A 3FKAA 4H3UA 5IF6A 5TGNA 4HM7B 5EVHA 3NXJA 4KVHA 4RZMA 2BMQB 3RGAA 8CHOA 3K7CA 3HZPA 1OUNA 4XB5A 3EN1B 4WYKB 1OGXA 3EQQB 4L8OA 1O7MB 3G8ZA 2Z77A 1GY6A 5AEWB 3JUMA 4HM8B 1O7PB 3NV0B 1A2KA 2F99A 4WWUC 1JB5A 4HVNA 1OGZA 4XBXA 1DMQA 1OHOA 1ZX2A 3IPTA 3OWSA 3F8XA 2GBWB 4HZ9B 1QMAA 3H3HA 2HMLB 1VZZA 1TUHA 1E97A 4R9KA 3NM2A 3FGYA 1GYBA 2STDA 5IENA 4PEJA 5AEUB 3OXAA 1IDPA 4HM3B 2I9WA 1CQSA 3FSDA 1W00A 5JPUA 3SOAA 5CF1A 3OV4A 2BMRB 3A76A 3ER7A 5DREA 5CLKA 1TP6A 3H51A 3EF8A 3ECFA 3GWRA 3UNLA 1NU3A 5IG0A 4R1KA 3CPOA 3E99A 1OH0A 2BNGA 2QIYA 4GB5A 1HKXA 1U5OA 2YFLB 2RFRA 3D9RA 3NV0A 5KP4A 2OWPA 2HMMB 5G2GA 5CXOA 5HGRA 1O7HB 3JUNA 4Q53A 4J8TA 4MJDA 5IEPA 3FF0A 3GZBA 5IEOA 3M8CA 4FCMA 5CK6A 1O7GB 3F40A 2HMNB 3B4OA 5D81A 2HMOB 3OWUA 1Q42A 3MSOA 5D83A 1GY5A 1GY7A 3WMDA 1OF5A 2W2CA 2INXA 1WQLB 5IG3A 2CKFB 3OX9A 3RGRA 1NWWA 3MG2A 1Z1SA 1O7WB 5IG4A 4HM5B 2F86B 3Q90A 4K1VA 3EBTA 3UJMA 5STDA 3MG3A 2JQ5A 4U13A 1OHPA 1AR0A 5AIFA 1STDA 3G16A 3EC9A 7STDA 2B1XB 3VSYA 1BUQA 3G0KA 1Q40A 1ISKA 1K41A 2R4IA 2Z76A 3CU3A 3MG1A 6STDA 3KZTA 1OPYA 1OF5B 2XRXB 3GZRA 3DM8A 3OWYA 4WP5A 4LMIA 3MYTA 1DMNA 3CNXA 3FF2A 3EJVA 3CNMA 3KE7A 3T8NA 3LZAA 3I0YA 5IG5A 2PZVA 4L7KA 3FH1A 5IERA 4R9LA 5BXQA 2BMOB 1W6YA 3F7SA 4L8PA 5CF2A 1ULJB 3F8HA 4HZBB 1E3RA 3GZXB 2XR8B 4ORLA 5AI1A 3GZYB 2QGUA 3F7XA 3EBYA 1Q40B 2A15A 1EG9B 2GEYA 1JB2A 3JUOA 5D82A 3ROBA 3MHEA 3B4PA 4OVMA 1JKGA 2CHCA 2B24B 3DXOA 5AIGA 1S5AA 1UUWB 4HM6B 3VGNA 1W01A 3FZWA 2IMJA 2YFIB 1GS3A 1SJWA 2XSOB 3DUKA 4N3VA 4XBTA 2UX0A 1ULIB 5AIIA 4HM4B 1JB4A 4X2OA 3FLJA 3LYGA 2XSHB 3SOYA 1UUVB 3NBRA 3EX9A 5JPPA 4LEHA 1QJGA 4HJLB 3BB9A 4IIAA 3DZLA 1E3VA 1O7NB 3S5CA 1JN5A 4HM1B 3JUPA 3JUQA 4HKVB 1NDOB 2HMKB 3BLZA 3HK4A 3HX8A 1JKGB 2RGQA 3GRDA 1W02A 4LGQA 4FCJA 5BVBA 3NHXA 3KSPA 2RCDA 2YFJB 2GXFA 5DRVA 1DMMA 4XBYA 4X2HA 3KKGA 4J9AA 5KP3A 1C7HA 3MKIA 3B8LA 4WYKA 3B7CA
chains in the Genus database with same CATH superfamily
1LOXA 2W56A 1Q864 1M1K4 1ZO2A 1X1YA 2BT3A 4BL2A 2RBIA 2K54A 3CCJ3 3EN8A 4XDVA 4CPKA 3SEDA 1JN5B 3KCHA 3NUVA 4XDWA 1JJ22 2CFDA 1ASKA 1TRPA 2GEXA 2AADA 3D5GA 4HM0B 3F14A 4STDA 1PFPA 5KP1A 3DMCA 3EHCA 1OHSA 5FW5A 1BNSA 5RNTA 1BNIA 4CDLA 1RHLA 2Z7AA 4KT3B 1GSPA 3S29A 1KC84 3KFQC 1BNGA 5GSPA 1RRLA 4HM2B 1MWSA 2BU4A 1TRQA 3T8UA 2C4BA 2HMJB 1SPUA 2GBXB 5AIHA 4XM4A 1LXEA 1RGLA 3K0ZA 2P38A 4OUQA 1MGWA 3F9SA 3NM7A 4K1UA 2F98A 1B2XA 1BNEA 1BSEA 2O9UX 4OK0A 1OCVA 4I4KA 3CCU3 1MOLA 1N9EA 3STDA 1EA2A 2KRTA 2OCTA 2CFWA 5HOHA 1IK3A 3FKAA 4H3UA 1EQKA 3DH2A 1HU9A 5IF6A 4KFDA 5TGNA 3CCQ3 3O8YA 4HM7B 3NXJA 5EVHA 1L5GB 1D6ZA 3BNDA 1BRGA 4KVHA 1BGSA 4NREA 4FMBA 4RZMA 2ZA4A 1KSIA 5M18A 5AYRB 1T2HA 2BMQB 2P05A 3RGAA 2K0MA 3WODG 8CHOA 3K7CA 3HZPA 3UL6A 1B2MA 1C54A 1FGQA 1OUNA 7RNTA 4XB5A 3EN1B 3SYUA 3PCRA 2CWVA 3N8BA 3BU4A 4WYKB 4QWTA 4BTYA 1OGXA 1RGAA 2GSPA 2GU1A 2W56B 1W2B2 4JRFA 4IT7A 3PYJA 3EQQB 4BTXA 3WA3A 4CCVA 3DGYA 4L8OA 1O7MB 3G8ZA 4K90B 2Z77A 2CWTA 2C11A 2KF3A 4O3VA 4NHFA 4RNTA 1GY6A 1V74A 6GSPA 5AEWB 3JUMA 2P09A 1GD3A 3CCE3 1A2PA 2XF3A 3G713 4HM8B 1O7PB 3NV0B 1CYUA 1BRJA 3U1WA 1BAOA 1A2KA 2F99A 2KF5A 4RNZA 4WWUC 3QK9A 3X41A 2OOVA 1M9GA 2UGIA 3EE1A 1CYVA 1JZOA 1VQO3 2LQVA 1RKYA 1JB5A 1GOUA 3IMAB 2WGOA 1FW7A 3LT8A 4HVNA 2M7OA 1OGZA 1N5PA 3PCSA 1WMNA 1DETA 4XBXA 1RGCA 1PU4A 3I553 2QEX3 1VQQA 3X3ZA 5G1KA 1G02A 1RGKA 3D79A 1DMQA 1OHOA 3OW22 5BIRA 1GMQA 1RMSA 1ZX2A 3IPTA 3OWSA 1J2BA 2CK3H 4N6NB 1UUGB 3F8XA 1I3FA 2GBWB 4HZ9B 1I70A 4R80A 1QMAA 3H3HA 2YX9A 2HMLB 1YVSA 2OOVC 3FG4A 3X42A 1VZZA 1G96A 3FG1A 1TUHA 1E97A 3FCSB 4R9KA 1GMRA 3NM2A 3FGYA 1GYBA 2STDA 5IENA 4EV5A 2CX1A 4O2HA 4PEJA 5AEUB 1BRSA 3Q1CA 1VQ73 2W04A 4EYCA 1VQ63 2FNQA 3OXAA 1IDPA 4HM3B 2I9WA 3ZFZA 1CQSA 3FSDA 3ALAA 2BIRA 4GSPA 1W00A 4I5QA 4EW5A 1MWTA 5JPUA 2WOHA 3SOAA 5CF1A 1VQ43 1I0XA 1N5HA 1IYYA 4N6MA 3TDGA 1K8A4 1CEWI 3LTAA 1WTHA 2RNTA 3OV4A 2BMRB 2KAAA 3A76A 3ER7A 2RSXA 3A5EA 3SXXA 1IQ8A 2E2UA 5CLKA 5DREA 1IV7A 1TP6A 2V1LA 2K3DA 3H51A 4WFOA 3EF8A 2CC3A 2P0XA 1B2ZA 1IVUA 3ECFA 1NNVA 3GWRA 3IJEB 3LTBA 4HOHA 1RDSA 2OQEA 3WR2A 3UNLA 1BVIA 2CH9A 2LYXA 1V58A 2ZL8A 1NU3A 2Y74A 3SX1A 5IG0A 4R1KA 3CPOA 3E99A 5EEOA 4AEQA 1OH0A 4KZ1A 2BNGA 2QIYA 4GB5A 1DE3A 2J8XB 3GSPA 3DGLA 1RNTA 1FUTA 1HKXA 1U5OA 1RN4A 2RFRA 2YFLB 2Z6BA 3D3LA 3D9RA 1NB3I 3NV0A 4LYLB 2OWPA 5KP4A 3KIIA 4HBRA 4MMYB 2L1SA 1LOYA 1BSDA 2F5WA 4DKIA 1BUJA 3MPHA 1LVNA 1W6GA 1Y4KA 4GHOA 1IT8A 4O02B 5ELUA 3G4S3 2HMMB 5G2GA 1UCJA 3NQZA 5CXOA 3EB8A 1CH0A 2CWUA 4N6OB 1K9M4 1ZS7A 5HGRA 1FA3A 1O7HB 1FUWA 3JUNA 4Q53A 3Q3FA 4J8TA 1UW1A 4MJDA 4AKZA 5IEPA 7GSPA 3CME3 2D1WA 3FF0A 1RN1A 2SBLA 2Y73A 3GZBA 1PYLA 1VQN3 2JDIH 1RJOA 1JNQA 1WMOA 3M8CA 4FCMA 5IEOA 3WHOA 1UCKA 1KQS2 1A67A 1BSBA 1FGRA 1W7CA 5CK6A 1BRKA 3KSED 1MGRA 1O7GB 3AMOA 3F40A 4ILFA 1YJ93 2HMNB 2GU3A 3B4OA 3CC23 1DYUA 2HMOB 5D81A 1S723 3OWUA 1Q42A 3MSOA 3CCV3 1VQ93 2AAEA 4BL3A 3URPA 5D83A 5LC6A 3HI7A 5LC7A 1YIT3 1GY5A 1GY7A 3LH4A 3WMDA 1SIIA 1RRHA 1N9JA 1R4CA 3CCS3 1OF5A 1LOVA 2W2CA 4JF8A 2INXA 4FMCA 1WQLB 5IG3A 2CKFB 3OX9A 2OTL3 3RGRA 1NWWA 3MG2A 1VQP3 3BNEA 3LMLA 3S28A 3L0RA 1W4NA 3PZWA 1FUSA 1Z1SA 1SARA 1X1XA 2W03A 2XGLA 1O7WB 3S67A 2XFSA 2FGTA 5IG4A 1LOWA 1B20A 4KFFA 3HOHA 4R4KA 4HM5B 1F8NA 2F86B 3NBBA 1TJDA 3Q90A 1KD14 1BSCA 3DGOA 1ROAA 4K1VA 1YJW3 1US1A 3EBTA 3UJMA 1YIJ3 4LZIA 5STDA 3MG3A 2ZHXB 2H0GA 2JQ5A 4FCZA 4U13A 3DGMA 1MNLA 2IUKA 1TIJA 3WOEB 3AHSA 1TFKA 2BO9B 3CMA3 1FGOA 1OHPA 1AR0A 1MWRA 1IT7A 3JVCA 5AIFA 1AVLA 1STDA 1A2VA 3MWZA 1AQZA 2F56A 2XH9A 2CW9A 3G16A 1V57A 1AVKA 3EC9A 2KF4A 4MEIA 7STDA 2B1XB 3DY5A 3VSYA 1BUQA 1M904 3AMOB 3G0KA 1EKMA 3PXMA 1Q40A 1ISKA 1K41A 3CD63 2R4IA 1OACA 1Q7Y4 2Z76A 1IVVA 2KF6A 3CU3A 3D4AA 1I2GA 3MG1A 3V92A 6STDA 3KZTA 3DGNA 1Q9EA 4N6LA 1OPYA 2W9QA 2CG1A 3X3XA 1OF5B 2D42A 2XRXB 1FYSA 2FXTA 3D5IA 3GZRA 2MF7A 1FGTA 2H0HA 3DM8A 4NPBA 3SLUA 3OWYA 5IW9A 4K61A 1GOVA 3CC43 2C10A 4WP5A 1A90A 4FR9A 3AHWA 4LMIA 3N54B 3V98A 3MYTA 1TFOA 2KXGA 1DMNA 1WNHA 4AKYA 1UDII 3GAXA 1W6CA 3CNXA 3FF2A 3HIIA 2BHMA 3ZG5A 1B2SA 3EJVA 1SQWA 1B21A 3CNMA 1T3BA 1QVF2 3CXC2 5BU4A 3KE7A 1YHQ3 3RDEA 1PY3A 1W2ZA 3N9HA 3T8NA 5M19A 1ZGXA 3LZAA 2CFKA 2R41A 1RGGA 3I0YA 5IG5A 1JBSA 2PZVA 4L7KA 3FH1A 5IERA 2CFLA 4R9LA 3CPW2 5BXQA 2BMOB 4EC6A 1W6YA 4J5KA 3V99A 1EUIC 3F7SA 3CCL3 3U97A 1R4YA 1B27A 1LQMB 4L8PA 1VQL3 1UI7A 5CF2A 1ULJB 3F8HA 1RCKA 4HZBB 2QA43 1NB5I 1FGMA 3QRDA 1UI8A 3X3YA 1NJI4 1E3RA 3GZXB 1LRAA 1UCIA 2CFGA 2XR8B 4ORLA 2IA7A 5AI1A 1K28A 1GD4A 1TTOA 3GZYB 1DVDA 1STFI 1X1WA 2QGUA 2OQEC 3F7XA 1LQGC 1MWUA 1W5ZA 2MC8A 2KCDA 3EBYA 4HAAA 1IU7A 1Q40B 2A15A 1EG9B 2GEYA 1JB2A 2CX0A 3JUOA 5D82A 4O8SA 2CG0A 2W9PA 3VF1A 1TU5A 1Q7HA 1RGFA 2PNCA 3ROBA 3MHEA 3B4PA 4OVMA 4EXRA 1JZDA 4KFEA 1JKGA 2CHCA 2W6JH 9RNTA 1SIHA 2B24B 1IVWA 3BIRA 1UCLA 3DXOA 5AIGA 1YNVX 1D6UA 3LTDA 1IQYA 1S5AA 6RNTA 1I2FA 3LXUX 1LNIA 3K5TA 1N8QA 1UUWB 2P0MA 2WGQA 1RCLA 4HM6B 1JV2B 1AY7A 2SARA 2UUGC 3LOYA 1W01A 3Q2PA 3VGNA 5ELJA 1IQXA 3FZWA 2ZDJA 2IMJA 2W0QA 2WO0A 1GS3A 2YFIB 4IPBA 3J7Yd 1SJWA 2XSOB 3DUKA 1AV4A 1GOYA 3PGBA 4N3VA 4XBTA 2HOHA 3SVAA 3CCR3 8RNTA 2UX0A 1Q814 3FG3A 1I3IA 2XFTA 3NBJA 4RBNA 3WOFB 1BOXA 1ULIB 1IV9A 1BNRA 1T5YA 5AIIA 1T2IA 1YGWA 4HM4B 5A0OB 1JB4A 1JBRA 4LSOA 1BNJA 5FGOA 4MMXB 4X2OA 3LTCA 1BRNL 3FLJA 3X40A 3I563 4FMDA 1RN7A 3LYGA 2XSHB 1VQK3 5JBSA 3SOYA 4H61A 1HZ1A 4MMZB 1UUVB 3LT9A 3NBRA 3RNTA 3K63A 1YVBI 3EX9A 5JPPA 4ZM8A 4LEHA 1QJGA 4N6UA 1ROVA 2F5MA 4HJLB 1VQ53 1RTUA 3BB9A 4IIAA 1VQ83 3DZLA 1E3VA 1O7NB 3BNCA 4RNYA 3S5CA 1JN5A 4HM1B 3JUPA 3CCM3 4N6TA 1JBTA 3JUQA 1IVXA 4N6V0 5EQLA 4EV2A 1FZUA 1BU4A 1NDOB 2WOFA 4HKVB 1UGIA 1B3SA 1UGHI 2HMKB 2F4YA 2IUJA 1Q824 1RGEA 3BLZA 3AGOA 3HK4A 1BNFA 3HX8A 2CIUA 1JKGB 1M1XB 3UL5A 3PS8A 1BANA 1KWIA 2E2TA 2RGQA 4BIRA 1QAFA 2ML5A 2L4VA 2IYJA 3GRDA 5G1LA 1W02A 3AGNA 2ML6A 4LGQA 3S27A 1BRHA 4EBGA 4FCJA 5BVBA 1QAKA 1QALA 3WDGB 2Q07A 4WHAA 2OTJ3 3NHXA 3UB1A 2H0IA 1NO3A 2XEPA 1X1UA 3KSPA 4BU4A 2RCDA 1G0TA 3WA2X 1JRQA 5M1AA 2YFJB 5I97A 1VQM3 1I0VA 3T0UA 1RGHA 3NQYA 3ZG0A 1BRIA 1D6YA 2GXFA 3K9MC 2IY2A 3NX0A 1I8VA 5DRVA 1U8CB 1YI23 1DVCA 4J5GA 1BSAA 1LNHA 1WMPA 1DMMA 1EEJA 4HYZA 3HIGA 4XBYA 4G1MB 4TX4A 1B2UA 5AYSC 3BNBA 1QVG2 4GL6A 4CJNA 1I2EA 3KN4A 3KKGA 4X2HA 4BTWA 4J9AA 5KP3A 1YGEA 1C7HA 1RSNA 1K734 2O3OA 2E2VA 1YJN3 1GMPA 1RLSA 4FMAA 3MKIA 1HYFA 3G6E3 1N8R4 3CC73 1BIRA 3B8LA 4WYKA 3B7CA 2XGNA 1RNBA
chains in the Genus database with same CATH topology
1LOXA 2W56A 1Q864 1M1K4 1ZO2A 2BT3A 2K54A 3CCJ3 3EN8A 4XDVA 3SEDA 1JN5B 3NUVA 4XDWA 1JJ22 2CFDA 1ASKA 2GEXA 4HM0B 4STDA 3F14A 1PFPA 5KP1A 3DMCA 3EHCA 1OHSA 5FW5A 4CDLA 2Z7AA 1KC84 3S29A 3KFQC 1RRLA 4HM2B 3T8UA 2HMJB 1SPUA 2GBXB 5AIHA 4XM4A 1LXEA 3K0ZA 2P38A 4OUQA 3F9SA 3NM7A 4K1UA 2F98A 2O9UX 4OK0A 3CCU3 1OCVA 4I4KA 1MOLA 1N9EA 3STDA 1EA2A 2KRTA 2OCTA 2CFWA 1IK3A 3FKAA 4H3UA 1EQKA 1HU9A 5IF6A 4KFDA 5TGNA 3CCQ3 3O8YA 4HM7B 3NXJA 5EVHA 1L5GB 1D6ZA 3BNDA 4KVHA 4NREA 4FMBA 4RZMA 1KSIA 5AYRB 2BMQB 2P05A 3RGAA 2K0MA 3WODG 8CHOA 3K7CA 3HZPA 3UL6A 1FGQA 1OUNA 4XB5A 3EN1B 3PCRA 2CWVA 3N8BA 4WYKB 4BTYA 4QWTA 1OGXA 2GU1A 1W2B2 2W56B 4JRFA 4IT7A 3PYJA 3EQQB 4BTXA 3WA3A 4CCVA 4L8OA 1O7MB 3G8ZA 4K90B 2Z77A 2CWTA 2C11A 4O3VA 4NHFA 1GY6A 1V74A 5AEWB 3JUMA 2P09A 1GD3A 3CCE3 2XF3A 3G713 4HM8B 1O7PB 3NV0B 1CYUA 3U1WA 1A2KA 2F99A 4RNZA 4WWUC 3X41A 3QK9A 2OOVA 1M9GA 3EE1A 1CYVA 1VQO3 2LQVA 1RKYA 1JB5A 3IMAB 2WGOA 3LT8A 4HVNA 2M7OA 1OGZA 1N5PA 3PCSA 1WMNA 4XBXA 1PU4A 3I553 2QEX3 3X3ZA 1DMQA 1OHOA 3OW22 1ZX2A 3IPTA 3OWSA 1J2BA 2CK3H 4N6NB 3F8XA 2GBWB 4HZ9B 4R80A 1QMAA 3H3HA 2YX9A 2HMLB 2OOVC 3FG4A 3X42A 1VZZA 1G96A 3FG1A 1TUHA 1E97A 3FCSB 4R9KA 3NM2A 3FGYA 1GYBA 2STDA 5IENA 4EV5A 4O2HA 4PEJA 5AEUB 3Q1CA 1VQ73 2W04A 4EYCA 1VQ63 2FNQA 3OXAA 1IDPA 4HM3B 2I9WA 1CQSA 3FSDA 3ALAA 1W00A 5JPUA 2WOHA 3SOAA 5CF1A 1VQ43 1N5HA 1FA3A 4N6MA 3TDGA 1K8A4 1CEWI 3LTAA 1WTHA 3OV4A 2BMRB 3A76A 3ER7A 2RSXA 3SXXA 1IQ8A 2E2UA 5CLKA 5DREA 1IV7A 1TP6A 2V1LA 3H51A 4WFOA 3EF8A 2CC3A 2P0XA 1IVUA 3ECFA 3IJEB 3GWRA 3LTBA 2OQEA 2CH9A 2LYXA 3UNLA 2ZL8A 1NU3A 2Y74A 3SX1A 5IG0A 4R1KA 3CPOA 3E99A 5EEOA 4AEQA 1OH0A 4KZ1A 2BNGA 2QIYA 4GB5A 3DGLA 1HKXA 1U5OA 2YFLB 2RFRA 2Z6BA 3D3LA 3D9RA 1NB3I 3NV0A 5KP4A 2OWPA 3KIIA 4HBRA 4MMYB 3MPHA 1LVNA 1W6GA 1Y4KA 4O02B 1IT8A 5ELUA 3G4S3 2HMMB 5G2GA 3NQZA 5CXOA 3EB8A 2CWUA 4N6OB 1K9M4 5HGRA 1O7HB 1FUWA 3JUNA 4Q53A 4J8TA 1UW1A 4MJDA 4AKZA 5IEPA 3CME3 1VQN3 2D1WA 3FF0A 2SBLA 2Y73A 3GZBA 2JDIH 1RJOA 1JNQA 1WMOA 3M8CA 4FCMA 5IEOA 1KQS2 1A67A 1FGRA 1W7CA 5CK6A 3KSED 1O7GB 3AMOA 3F40A 1YJ93 2HMNB 2GU3A 3B4OA 3CC23 1DYUA 2HMOB 5D81A 1S723 3OWUA 1Q42A 3MSOA 3CCV3 1VQ93 5D83A 5LC6A 3HI7A 5LC7A 1YIT3 1GY5A 1GY7A 3LH4A 3WMDA 1N9JA 1SIIA 1RRHA 1R4CA 3CCS3 1OF5A 2W2CA 4JF8A 2INXA 4FMCA 1WQLB 5IG3A 2CKFB 3OX9A 2OTL3 3RGRA 1NWWA 3MG2A 1VQP3 3BNEA 3LMLA 3S28A 3L0RA 1W4NA 3PZWA 1Z1SA 2W03A 2XGLA 1O7WB 3S67A 2XFSA 2FGTA 5IG4A 4KFFA 4R4KA 4HM5B 2F86B 1F8NA 3NBBA 3Q90A 1KD14 3DGOA 1ROAA 4K1VA 1YJW3 1US1A 3EBTA 3UJMA 1YIJ3 4LZIA 5STDA 3MG3A 2JQ5A 4FCZA 4U13A 3DGMA 1MNLA 2IUKA 1TIJA 3WOEB 1TFKA 2BO9B 3CMA3 1FGOA 1OHPA 1AR0A 1IT7A 3JVCA 5AIFA 1AVLA 1STDA 1A2VA 3MWZA 2XH9A 2CW9A 3G16A 1AVKA 3EC9A 4MEIA 7STDA 2B1XB 3DY5A 3VSYA 1BUQA 1M904 3AMOB 3G0KA 1EKMA 3PXMA 1Q40A 1ISKA 1K41A 3CD63 2R4IA 1OACA 1Q7Y4 2Z76A 1IVVA 3CU3A 3MG1A 3V92A 6STDA 3KZTA 3DGNA 4N6LA 1OPYA 2W9QA 2CG1A 3X3XA 1OF5B 2D42A 2XRXB 3NQYA 2FXTA 3GZRA 2MF7A 1FGTA 3DM8A 3SLUA 5IW9A 3CC43 3OWYA 4K61A 2C10A 4WP5A 1A90A 4FR9A 4LMIA 3N54B 3V98A 3MYTA 1TFOA 2KXGA 1DMNA 1WNHA 4AKYA 3GAXA 1W6CA 3CNXA 3FF2A 3HIIA 2BHMA 3EJVA 1SQWA 3CNMA 1QVF2 3CXC2 3KE7A 1YHQ3 3RDEA 1W2ZA 3N9HA 3T8NA 3LZAA 2CFKA 3I0YA 5IG5A 2PZVA 4L7KA 3FH1A 5IERA 2CFLA 4R9LA 3CPW2 5BXQA 2BMOB 4EC6A 1W6YA 3V99A 3F7SA 3CCL3 3U97A 4L8PA 1VQL3 1UI7A 5CF2A 1ULJB 3F8HA 2QA43 4HZBB 1NB5I 1FGMA 3QRDA 1UI8A 3X3YA 1NJI4 1E3RA 3GZXB 2CFGA 2XR8B 4ORLA 2IA7A 5AI1A 1K28A 1GD4A 3GZYB 1DVDA 1STFI 2QGUA 2OQEC 3F7XA 1W5ZA 2MC8A 2KCDA 3EBYA 1IU7A 1Q40B 2A15A 1EG9B 2GEYA 1JB2A 3JUOA 3VF1A 5D82A 4O8SA 2CG0A 2W9PA 1TU5A 2PNCA 3ROBA 3MHEA 3B4PA 4OVMA 4EXRA 4KFEA 1JKGA 2CHCA 2W6JH 1SIHA 2B24B 1IVWA 3DXOA 5AIGA 1D6UA 3LTDA 1IQYA 1S5AA 3LXUX 3K5TA 1N8QA 1UUWB 2P0MA 2WGQA 4HM6B 1JV2B 3LOYA 3VGNA 1W01A 3Q2PA 5ELJA 1IQXA 3FZWA 2ZDJA 2IMJA 2W0QA 2WO0A 1GS3A 2YFIB 4IPBA 3J7Yd 1SJWA 2XSOB 3DUKA 1AV4A 3PGBA 4N3VA 4XBTA 3SVAA 3CCR3 1Q814 2UX0A 3FG3A 2XFTA 3NBJA 4RBNA 3WOFB 1ULIB 1IV9A 1T5YA 5AIIA 4HM4B 5A0OB 1JB4A 4LSOA 5FGOA 4MMXB 4X2OA 3LTCA 3FLJA 3X40A 3I563 4FMDA 1RN7A 3LYGA 2XSHB 1VQK3 5JBSA 3SOYA 4H61A 4MMZB 1UUVB 3LT9A 3NBRA 3K63A 1YVBI 3EX9A 5JPPA 4ZM8A 4LEHA 1QJGA 4N6UA 1ROVA 4HJLB 1VQ53 3BB9A 4IIAA 1VQ83 3DZLA 1E3VA 1O7NB 3BNCA 4RNYA 3S5CA 1JN5A 4HM1B 3JUPA 3CCM3 4N6TA 3JUQA 1IVXA 4N6V0 5EQLA 4EV2A 2WOFA 4HKVB 1NDOB 2HMKB 2IUJA 1Q824 3BLZA 3HK4A 3HX8A 2CIUA 1JKGB 1M1XB 3UL5A 3PS8A 1KWIA 2E2TA 2RGQA 1QAFA 2ML5A 2L4VA 3GRDA 1W02A 3S27A 2ML6A 4LGQA 4EBGA 4FCJA 5BVBA 1QAKA 1QALA 3WDGB 2Q07A 4WHAA 2OTJ3 3NHXA 3UB1A 2XEPA 1NO3A 3KSPA 2RCDA 3WA2X 1JRQA 1VQM3 2YFJB 5I97A 3T0UA 1D6YA 2GXFA 3K9MC 3NX0A 5DRVA 1U8CB 1YI23 1DVCA 1LNHA 1WMPA 1DMMA 4HYZA 4XBYA 3HIGA 4G1MB 4TX4A 5AYSC 3BNBA 1QVG2 4GL6A 4X2HA 3KN4A 3KKGA 4BTWA 4J9AA 5KP3A 1YGEA 1C7HA 1K734 2O3OA 2E2VA 1YJN3 4FMAA 3MKIA 1N8R4 3G6E3 3CC73 3B8LA 4WYKA 3B7CA 2XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZO2 A;  2K54 A;  3EN8 A;  4XDV A;  3SED A;  1JN5 B;  3NUV A;  4XDW A;  1ASK A;  2GEX A;  4HM0 B;  4STD A;  3F14 A;  5KP1 A;  3DMC A;  3EHC A;  1OHS A;  5FW5 A;  4CDL A;  2Z7A A;  4HM2 B;  3T8U A;  2HMJ B;  2GBX B;  5AIH A;  4XM4 A;  3K0Z A;  4OUQ A;  3F9S A;  4K1U A;  2F98 A;  1OCV A;  4I4K A;  3STD A;  1EA2 A;  3FKA A;  4H3U A;  5IF6 A;  5TGN A;  4HM7 B;  5EVH A;  3NXJ A;  4KVH A;  4RZM A;  2BMQ B;  3RGA A;  8CHO A;  3K7C A;  3HZP A;  1OUN A;  4XB5 A;  3EN1 B;  4WYK B;  1OGX A;  3EQQ B;  4L8O A;  1O7M B;  3G8Z A;  2Z77 A;  1GY6 A;  5AEW B;  3JUM A;  4HM8 B;  1O7P B;  3NV0 B;  1A2K A;  2F99 A;  4WWU C;  1JB5 A;  4HVN A;  1OGZ A;  4XBX A;  1DMQ A;  1OHO A;  1ZX2 A;  3IPT A;  3OWS A;  3F8X A;  2GBW B;  4HZ9 B;  1QMA A;  3H3H A;  2HML B;  1VZZ A;  1TUH A;  1E97 A;  4R9K A;  3NM2 A;  3FGY A;  1GYB A;  2STD A;  5IEN A;  4PEJ A;  5AEU B;  3OXA A;  1IDP A;  4HM3 B;  2I9W A;  1CQS A;  3FSD A;  1W00 A;  5JPU A;  3SOA A;  5CF1 A;  3OV4 A;  2BMR B;  3A76 A;  3ER7 A;  5DRE A;  5CLK A;  1TP6 A;  3H51 A;  3EF8 A;  3ECF A;  3GWR A;  3UNL A;  1NU3 A;  5IG0 A;  4R1K A;  3CPO A;  3E99 A;  1OH0 A;  2BNG A;  2QIY A;  4GB5 A;  1HKX A;  1U5O A;  2YFL B;  2RFR A;  3D9R A;  3NV0 A;  5KP4 A;  2OWP A;  2HMM B;  5G2G A;  5CXO A;  5HGR A;  1O7H B;  3JUN A;  4Q53 A;  4J8T A;  4MJD A;  5IEP A;  3FF0 A;  3GZB A;  5IEO A;  3M8C A;  4FCM A;  5CK6 A;  1O7G B;  3F40 A;  2HMN B;  3B4O A;  5D81 A;  2HMO B;  3OWU A;  1Q42 A;  3MSO A;  5D83 A;  1GY5 A;  1GY7 A;  3WMD A;  1OF5 A;  2W2C A;  2INX A;  1WQL B;  5IG3 A;  2CKF B;  3OX9 A;  3RGR A;  1NWW A;  3MG2 A;  1Z1S A;  1O7W B;  5IG4 A;  4HM5 B;  2F86 B;  3Q90 A;  4K1V A;  3EBT A;  3UJM A;  5STD A;  3MG3 A;  2JQ5 A;  4U13 A;  1OHP A;  1AR0 A;  5AIF A;  1STD A;  3G16 A;  3EC9 A;  7STD A;  2B1X B;  3VSY A;  1BUQ A;  3G0K A;  1Q40 A;  1ISK A;  1K41 A;  2R4I A;  2Z76 A;  3CU3 A;  3MG1 A;  6STD A;  3KZT A;  1OPY A;  1OF5 B;  2XRX B;  3GZR A;  3DM8 A;  3OWY A;  4WP5 A;  4LMI A;  3MYT A;  1DMN A;  3CNX A;  3FF2 A;  3EJV A;  3CNM A;  3KE7 A;  3T8N A;  3LZA A;  3I0Y A;  5IG5 A;  2PZV A;  4L7K A;  3FH1 A;  5IER A;  4R9L A;  5BXQ A;  2BMO B;  1W6Y A;  3F7S A;  4L8P A;  5CF2 A;  1ULJ B;  3F8H A;  4HZB B;  1E3R A;  3GZX B;  2XR8 B;  4ORL A;  5AI1 A;  3GZY B;  2QGU A;  3F7X A;  3EBY A;  1Q40 B;  2A15 A;  1EG9 B;  2GEY A;  1JB2 A;  3JUO A;  5D82 A;  3ROB A;  3MHE A;  3B4P A;  4OVM A;  1JKG A;  2CHC A;  2B24 B;  3DXO A;  5AIG A;  1S5A A;  1UUW B;  4HM6 B;  3VGN A;  1W01 A;  3FZW A;  2IMJ A;  2YFI B;  1GS3 A;  1SJW A;  2XSO B;  3DUK A;  4N3V A;  4XBT A;  2UX0 A;  1ULI B;  5AII A;  4HM4 B;  1JB4 A;  4X2O A;  3FLJ A;  3LYG A;  2XSH B;  3SOY A;  1UUV B;  3NBR A;  3EX9 A;  5JPP A;  4LEH A;  1QJG A;  4HJL B;  3BB9 A;  4IIA A;  3DZL A;  1E3V A;  1O7N B;  3S5C A;  1JN5 A;  4HM1 B;  3JUP A;  3JUQ A;  4HKV B;  1NDO B;  2HMK B;  3BLZ A;  3HK4 A;  3HX8 A;  1JKG B;  2RGQ A;  3GRD A;  1W02 A;  4LGQ A;  4FCJ A;  5BVB A;  3NHX A;  3KSP A;  2RCD A;  2YFJ B;  2GXF A;  5DRV A;  1DMM A;  4XBY A;  4X2H A;  3KKG A;  4J9A A;  5KP3 A;  1C7H A;  3MKI A;  3B8L A;  4WYK A;  3B7C A; 
#chains in the Genus database with same CATH topology
 1LOX A;  2W56 A;  1Q86 4;  1M1K 4;  1ZO2 A;  1X1Y A;  2BT3 A;  4BL2 A;  2RBI A;  2K54 A;  3CCJ 3;  3EN8 A;  4XDV A;  4CPK A;  3SED A;  1JN5 B;  3KCH A;  3NUV A;  4XDW A;  1JJ2 2;  2CFD A;  1ASK A;  1TRP A;  2GEX A;  2AAD A;  3D5G A;  4HM0 B;  3F14 A;  4STD A;  1PFP A;  5KP1 A;  3DMC A;  3EHC A;  1OHS A;  5FW5 A;  1BNS A;  5RNT A;  1BNI A;  4CDL A;  1RHL A;  2Z7A A;  4KT3 B;  1GSP A;  3S29 A;  1KC8 4;  3KFQ C;  1BNG A;  5GSP A;  1RRL A;  4HM2 B;  1MWS A;  2BU4 A;  1TRQ A;  3T8U A;  2C4B A;  2HMJ B;  1SPU A;  2GBX B;  5AIH A;  4XM4 A;  1LXE A;  1RGL A;  3K0Z A;  2P38 A;  4OUQ A;  1MGW A;  3F9S A;  3NM7 A;  4K1U A;  2F98 A;  1B2X A;  1BNE A;  1BSE A;  2O9U X;  4OK0 A;  1OCV A;  4I4K A;  3CCU 3;  1MOL A;  1N9E A;  3STD A;  1EA2 A;  2KRT A;  2OCT A;  2CFW A;  5HOH A;  1IK3 A;  3FKA A;  4H3U A;  1EQK A;  3DH2 A;  1HU9 A;  5IF6 A;  4KFD A;  5TGN A;  3CCQ 3;  3O8Y A;  4HM7 B;  3NXJ A;  5EVH A;  1L5G B;  1D6Z A;  3BND A;  1BRG A;  4KVH A;  1BGS A;  4NRE A;  4FMB A;  4RZM A;  2ZA4 A;  1KSI A;  5M18 A;  5AYR B;  1T2H A;  2BMQ B;  2P05 A;  3RGA A;  2K0M A;  3WOD G;  8CHO A;  3K7C A;  3HZP A;  3UL6 A;  1B2M A;  1C54 A;  1FGQ A;  1OUN A;  7RNT A;  4XB5 A;  3EN1 B;  3SYU A;  3PCR A;  2CWV A;  3N8B A;  3BU4 A;  4WYK B;  4QWT A;  4BTY A;  1OGX A;  1RGA A;  2GSP A;  2GU1 A;  2W56 B;  1W2B 2;  4JRF A;  4IT7 A;  3PYJ A;  3EQQ B;  4BTX A;  3WA3 A;  4CCV A;  3DGY A;  4L8O A;  1O7M B;  3G8Z A;  4K90 B;  2Z77 A;  2CWT A;  2C11 A;  2KF3 A;  4O3V A;  4NHF A;  4RNT A;  1GY6 A;  1V74 A;  6GSP A;  5AEW B;  3JUM A;  2P09 A;  1GD3 A;  3CCE 3;  1A2P A;  2XF3 A;  3G71 3;  4HM8 B;  1O7P B;  3NV0 B;  1CYU A;  1BRJ A;  3U1W A;  1BAO A;  1A2K A;  2F99 A;  2KF5 A;  4RNZ A;  4WWU C;  3QK9 A;  3X41 A;  2OOV A;  1M9G A;  2UGI A;  3EE1 A;  1CYV A;  1JZO A;  1VQO 3;  2LQV A;  1RKY A;  1JB5 A;  1GOU A;  3IMA B;  2WGO A;  1FW7 A;  3LT8 A;  4HVN A;  2M7O A;  1OGZ A;  1N5P A;  3PCS A;  1WMN A;  1DET A;  4XBX A;  1RGC A;  1PU4 A;  3I55 3;  2QEX 3;  1VQQ A;  3X3Z A;  5G1K A;  1G02 A;  1RGK A;  3D79 A;  1DMQ A;  1OHO A;  3OW2 2;  5BIR A;  1GMQ A;  1RMS A;  1ZX2 A;  3IPT A;  3OWS A;  1J2B A;  2CK3 H;  4N6N B;  1UUG B;  3F8X A;  1I3F A;  2GBW B;  4HZ9 B;  1I70 A;  4R80 A;  1QMA A;  3H3H A;  2YX9 A;  2HML B;  1YVS A;  2OOV C;  3FG4 A;  3X42 A;  1VZZ A;  1G96 A;  3FG1 A;  1TUH A;  1E97 A;  3FCS B;  4R9K A;  1GMR A;  3NM2 A;  3FGY A;  1GYB A;  2STD A;  5IEN A;  4EV5 A;  2CX1 A;  4O2H A;  4PEJ A;  5AEU B;  1BRS A;  3Q1C A;  1VQ7 3;  2W04 A;  4EYC A;  1VQ6 3;  2FNQ A;  3OXA A;  1IDP A;  4HM3 B;  2I9W A;  3ZFZ A;  1CQS A;  3FSD A;  3ALA A;  2BIR A;  4GSP A;  1W00 A;  4I5Q A;  4EW5 A;  1MWT A;  5JPU A;  2WOH A;  3SOA A;  5CF1 A;  1VQ4 3;  1I0X A;  1N5H A;  1IYY A;  4N6M A;  3TDG A;  1K8A 4;  1CEW I;  3LTA A;  1WTH A;  2RNT A;  3OV4 A;  2BMR B;  2KAA A;  3A76 A;  3ER7 A;  2RSX A;  3A5E A;  3SXX A;  1IQ8 A;  2E2U A;  5CLK A;  5DRE A;  1IV7 A;  1TP6 A;  2V1L A;  2K3D A;  3H51 A;  4WFO A;  3EF8 A;  2CC3 A;  2P0X A;  1B2Z A;  1IVU A;  3ECF A;  1NNV A;  3GWR A;  3IJE B;  3LTB A;  4HOH A;  1RDS A;  2OQE A;  3WR2 A;  3UNL A;  1BVI A;  2CH9 A;  2LYX A;  1V58 A;  2ZL8 A;  1NU3 A;  2Y74 A;  3SX1 A;  5IG0 A;  4R1K A;  3CPO A;  3E99 A;  5EEO A;  4AEQ A;  1OH0 A;  4KZ1 A;  2BNG A;  2QIY A;  4GB5 A;  1DE3 A;  2J8X B;  3GSP A;  3DGL A;  1RNT A;  1FUT A;  1HKX A;  1U5O A;  1RN4 A;  2RFR A;  2YFL B;  2Z6B A;  3D3L A;  3D9R A;  1NB3 I;  3NV0 A;  4LYL B;  2OWP A;  5KP4 A;  3KII A;  4HBR A;  4MMY B;  2L1S A;  1LOY A;  1BSD A;  2F5W A;  4DKI A;  1BUJ A;  3MPH A;  1LVN A;  1W6G A;  1Y4K A;  4GHO A;  1IT8 A;  4O02 B;  5ELU A;  3G4S 3;  2HMM B;  5G2G A;  1UCJ A;  3NQZ A;  5CXO A;  3EB8 A;  1CH0 A;  2CWU A;  4N6O B;  1K9M 4;  1ZS7 A;  5HGR A;  1FA3 A;  1O7H B;  1FUW A;  3JUN A;  4Q53 A;  3Q3F A;  4J8T A;  1UW1 A;  4MJD A;  4AKZ A;  5IEP A;  7GSP A;  3CME 3;  2D1W A;  3FF0 A;  1RN1 A;  2SBL A;  2Y73 A;  3GZB A;  1PYL A;  1VQN 3;  2JDI H;  1RJO A;  1JNQ A;  1WMO A;  3M8C A;  4FCM A;  5IEO A;  3WHO A;  1UCK A;  1KQS 2;  1A67 A;  1BSB A;  1FGR A;  1W7C A;  5CK6 A;  1BRK A;  3KSE D;  1MGR A;  1O7G B;  3AMO A;  3F40 A;  4ILF A;  1YJ9 3;  2HMN B;  2GU3 A;  3B4O A;  3CC2 3;  1DYU A;  2HMO B;  5D81 A;  1S72 3;  3OWU A;  1Q42 A;  3MSO A;  3CCV 3;  1VQ9 3;  2AAE A;  4BL3 A;  3URP A;  5D83 A;  5LC6 A;  3HI7 A;  5LC7 A;  1YIT 3;  1GY5 A;  1GY7 A;  3LH4 A;  3WMD A;  1SII A;  1RRH A;  1N9J A;  1R4C A;  3CCS 3;  1OF5 A;  1LOV A;  2W2C A;  4JF8 A;  2INX A;  4FMC A;  1WQL B;  5IG3 A;  2CKF B;  3OX9 A;  2OTL 3;  3RGR A;  1NWW A;  3MG2 A;  1VQP 3;  3BNE A;  3LML A;  3S28 A;  3L0R A;  1W4N A;  3PZW A;  1FUS A;  1Z1S A;  1SAR A;  1X1X A;  2W03 A;  2XGL A;  1O7W B;  3S67 A;  2XFS A;  2FGT A;  5IG4 A;  1LOW A;  1B20 A;  4KFF A;  3HOH A;  4R4K A;  4HM5 B;  1F8N A;  2F86 B;  3NBB A;  1TJD A;  3Q90 A;  1KD1 4;  1BSC A;  3DGO A;  1ROA A;  4K1V A;  1YJW 3;  1US1 A;  3EBT A;  3UJM A;  1YIJ 3;  4LZI A;  5STD A;  3MG3 A;  2ZHX B;  2H0G A;  2JQ5 A;  4FCZ A;  4U13 A;  3DGM A;  1MNL A;  2IUK A;  1TIJ A;  3WOE B;  3AHS A;  1TFK A;  2BO9 B;  3CMA 3;  1FGO A;  1OHP A;  1AR0 A;  1MWR A;  1IT7 A;  3JVC A;  5AIF A;  1AVL A;  1STD A;  1A2V A;  3MWZ A;  1AQZ A;  2F56 A;  2XH9 A;  2CW9 A;  3G16 A;  1V57 A;  1AVK A;  3EC9 A;  2KF4 A;  4MEI A;  7STD A;  2B1X B;  3DY5 A;  3VSY A;  1BUQ A;  1M90 4;  3AMO B;  3G0K A;  1EKM A;  3PXM A;  1Q40 A;  1ISK A;  1K41 A;  3CD6 3;  2R4I A;  1OAC A;  1Q7Y 4;  2Z76 A;  1IVV A;  2KF6 A;  3CU3 A;  3D4A A;  1I2G A;  3MG1 A;  3V92 A;  6STD A;  3KZT A;  3DGN A;  1Q9E A;  4N6L A;  1OPY A;  2W9Q A;  2CG1 A;  3X3X A;  1OF5 B;  2D42 A;  2XRX B;  1FYS A;  2FXT A;  3D5I A;  3GZR A;  2MF7 A;  1FGT A;  2H0H A;  3DM8 A;  4NPB A;  3SLU A;  3OWY A;  5IW9 A;  4K61 A;  1GOV A;  3CC4 3;  2C10 A;  4WP5 A;  1A90 A;  4FR9 A;  3AHW A;  4LMI A;  3N54 B;  3V98 A;  3MYT A;  1TFO A;  2KXG A;  1DMN A;  1WNH A;  4AKY A;  1UDI I;  3GAX A;  1W6C A;  3CNX A;  3FF2 A;  3HII A;  2BHM A;  3ZG5 A;  1B2S A;  3EJV A;  1SQW A;  1B21 A;  3CNM A;  1T3B A;  1QVF 2;  3CXC 2;  5BU4 A;  3KE7 A;  1YHQ 3;  3RDE A;  1PY3 A;  1W2Z A;  3N9H A;  3T8N A;  5M19 A;  1ZGX A;  3LZA A;  2CFK A;  2R41 A;  1RGG A;  3I0Y A;  5IG5 A;  1JBS A;  2PZV A;  4L7K A;  3FH1 A;  5IER A;  2CFL A;  4R9L A;  3CPW 2;  5BXQ A;  2BMO B;  4EC6 A;  1W6Y A;  4J5K A;  3V99 A;  1EUI C;  3F7S A;  3CCL 3;  3U97 A;  1R4Y A;  1B27 A;  1LQM B;  4L8P A;  1VQL 3;  1UI7 A;  5CF2 A;  1ULJ B;  3F8H A;  1RCK A;  4HZB B;  2QA4 3;  1NB5 I;  1FGM A;  3QRD A;  1UI8 A;  3X3Y A;  1NJI 4;  1E3R A;  3GZX B;  1LRA A;  1UCI A;  2CFG A;  2XR8 B;  4ORL A;  2IA7 A;  5AI1 A;  1K28 A;  1GD4 A;  1TTO A;  3GZY B;  1DVD A;  1STF I;  1X1W A;  2QGU A;  2OQE C;  3F7X A;  1LQG C;  1MWU A;  1W5Z A;  2MC8 A;  2KCD A;  3EBY A;  4HAA A;  1IU7 A;  1Q40 B;  2A15 A;  1EG9 B;  2GEY A;  1JB2 A;  2CX0 A;  3JUO A;  5D82 A;  4O8S A;  2CG0 A;  2W9P A;  3VF1 A;  1TU5 A;  1Q7H A;  1RGF A;  2PNC A;  3ROB A;  3MHE A;  3B4P A;  4OVM A;  4EXR A;  1JZD A;  4KFE A;  1JKG A;  2CHC A;  2W6J H;  9RNT A;  1SIH A;  2B24 B;  1IVW A;  3BIR A;  1UCL A;  3DXO A;  5AIG A;  1YNV X;  1D6U A;  3LTD A;  1IQY A;  1S5A A;  6RNT A;  1I2F A;  3LXU X;  1LNI A;  3K5T A;  1N8Q A;  1UUW B;  2P0M A;  2WGQ A;  1RCL A;  4HM6 B;  1JV2 B;  1AY7 A;  2SAR A;  2UUG C;  3LOY A;  1W01 A;  3Q2P A;  3VGN A;  5ELJ A;  1IQX A;  3FZW A;  2ZDJ A;  2IMJ A;  2W0Q A;  2WO0 A;  1GS3 A;  2YFI B;  4IPB A;  3J7Y d;  1SJW A;  2XSO B;  3DUK A;  1AV4 A;  1GOY A;  3PGB A;  4N3V A;  4XBT A;  2HOH A;  3SVA A;  3CCR 3;  8RNT A;  2UX0 A;  1Q81 4;  3FG3 A;  1I3I A;  2XFT A;  3NBJ A;  4RBN A;  3WOF B;  1BOX A;  1ULI B;  1IV9 A;  1BNR A;  1T5Y A;  5AII A;  1T2I A;  1YGW A;  4HM4 B;  5A0O B;  1JB4 A;  1JBR A;  4LSO A;  1BNJ A;  5FGO A;  4MMX B;  4X2O A;  3LTC A;  1BRN L;  3FLJ A;  3X40 A;  3I56 3;  4FMD A;  1RN7 A;  3LYG A;  2XSH B;  1VQK 3;  5JBS A;  3SOY A;  4H61 A;  1HZ1 A;  4MMZ B;  1UUV B;  3LT9 A;  3NBR A;  3RNT A;  3K63 A;  1YVB I;  3EX9 A;  5JPP A;  4ZM8 A;  4LEH A;  1QJG A;  4N6U A;  1ROV A;  2F5M A;  4HJL B;  1VQ5 3;  1RTU A;  3BB9 A;  4IIA A;  1VQ8 3;  3DZL A;  1E3V A;  1O7N B;  3BNC A;  4RNY A;  3S5C A;  1JN5 A;  4HM1 B;  3JUP A;  3CCM 3;  4N6T A;  1JBT A;  3JUQ A;  1IVX A;  4N6V 0;  5EQL A;  4EV2 A;  1FZU A;  1BU4 A;  1NDO B;  2WOF A;  4HKV B;  1UGI A;  1B3S A;  1UGH I;  2HMK B;  2F4Y A;  2IUJ A;  1Q82 4;  1RGE A;  3BLZ A;  3AGO A;  3HK4 A;  1BNF A;  3HX8 A;  2CIU A;  1JKG B;  1M1X B;  3UL5 A;  3PS8 A;  1BAN A;  1KWI A;  2E2T A;  2RGQ A;  4BIR A;  1QAF A;  2ML5 A;  2L4V A;  2IYJ A;  3GRD A;  5G1L A;  1W02 A;  3AGN A;  2ML6 A;  4LGQ A;  3S27 A;  1BRH A;  4EBG A;  4FCJ A;  5BVB A;  1QAK A;  1QAL A;  3WDG B;  2Q07 A;  4WHA A;  2OTJ 3;  3NHX A;  3UB1 A;  2H0I A;  1NO3 A;  2XEP A;  1X1U A;  3KSP A;  4BU4 A;  2RCD A;  1G0T A;  3WA2 X;  1JRQ A;  5M1A A;  2YFJ B;  5I97 A;  1VQM 3;  1I0V A;  3T0U A;  1RGH A;  3NQY A;  3ZG0 A;  1BRI A;  1D6Y A;  2GXF A;  3K9M C;  2IY2 A;  3NX0 A;  1I8V A;  5DRV A;  1U8C B;  1YI2 3;  1DVC A;  4J5G A;  1BSA A;  1LNH A;  1WMP A;  1DMM A;  1EEJ A;  4HYZ A;  3HIG A;  4XBY A;  4G1M B;  4TX4 A;  1B2U A;  5AYS C;  3BNB A;  1QVG 2;  4GL6 A;  4CJN A;  1I2E A;  3KN4 A;  3KKG A;  4X2H A;  4BTW A;  4J9A A;  5KP3 A;  1YGE A;  1C7H A;  1RSN A;  1K73 4;  2O3O A;  2E2V A;  1YJN 3;  1GMP A;  1RLS A;  4FMA A;  3MKI A;  1HYF A;  3G6E 3;  1N8R 4;  3CC7 3;  1BIR A;  3B8L A;  4WYK A;  3B7C A;  2XGN A;  1RNB A; 
#chains in the Genus database with same CATH homology
 1LOX A;  2W56 A;  1Q86 4;  1M1K 4;  1ZO2 A;  2BT3 A;  2K54 A;  3CCJ 3;  3EN8 A;  4XDV A;  3SED A;  1JN5 B;  3NUV A;  4XDW A;  1JJ2 2;  2CFD A;  1ASK A;  2GEX A;  4HM0 B;  4STD A;  3F14 A;  1PFP A;  5KP1 A;  3DMC A;  3EHC A;  1OHS A;  5FW5 A;  4CDL A;  2Z7A A;  1KC8 4;  3S29 A;  3KFQ C;  1RRL A;  4HM2 B;  3T8U A;  2HMJ B;  1SPU A;  2GBX B;  5AIH A;  4XM4 A;  1LXE A;  3K0Z A;  2P38 A;  4OUQ A;  3F9S A;  3NM7 A;  4K1U A;  2F98 A;  2O9U X;  4OK0 A;  3CCU 3;  1OCV A;  4I4K A;  1MOL A;  1N9E A;  3STD A;  1EA2 A;  2KRT A;  2OCT A;  2CFW A;  1IK3 A;  3FKA A;  4H3U A;  1EQK A;  1HU9 A;  5IF6 A;  4KFD A;  5TGN A;  3CCQ 3;  3O8Y A;  4HM7 B;  3NXJ A;  5EVH A;  1L5G B;  1D6Z A;  3BND A;  4KVH A;  4NRE A;  4FMB A;  4RZM A;  1KSI A;  5AYR B;  2BMQ B;  2P05 A;  3RGA A;  2K0M A;  3WOD G;  8CHO A;  3K7C A;  3HZP A;  3UL6 A;  1FGQ A;  1OUN A;  4XB5 A;  3EN1 B;  3PCR A;  2CWV A;  3N8B A;  4WYK B;  4BTY A;  4QWT A;  1OGX A;  2GU1 A;  1W2B 2;  2W56 B;  4JRF A;  4IT7 A;  3PYJ A;  3EQQ B;  4BTX A;  3WA3 A;  4CCV A;  4L8O A;  1O7M B;  3G8Z A;  4K90 B;  2Z77 A;  2CWT A;  2C11 A;  4O3V A;  4NHF A;  1GY6 A;  1V74 A;  5AEW B;  3JUM A;  2P09 A;  1GD3 A;  3CCE 3;  2XF3 A;  3G71 3;  4HM8 B;  1O7P B;  3NV0 B;  1CYU A;  3U1W A;  1A2K A;  2F99 A;  4RNZ A;  4WWU C;  3X41 A;  3QK9 A;  2OOV A;  1M9G A;  3EE1 A;  1CYV A;  1VQO 3;  2LQV A;  1RKY A;  1JB5 A;  3IMA B;  2WGO A;  3LT8 A;  4HVN A;  2M7O A;  1OGZ A;  1N5P A;  3PCS A;  1WMN A;  4XBX A;  1PU4 A;  3I55 3;  2QEX 3;  3X3Z A;  1DMQ A;  1OHO A;  3OW2 2;  1ZX2 A;  3IPT A;  3OWS A;  1J2B A;  2CK3 H;  4N6N B;  3F8X A;  2GBW B;  4HZ9 B;  4R80 A;  1QMA A;  3H3H A;  2YX9 A;  2HML B;  2OOV C;  3FG4 A;  3X42 A;  1VZZ A;  1G96 A;  3FG1 A;  1TUH A;  1E97 A;  3FCS B;  4R9K A;  3NM2 A;  3FGY A;  1GYB A;  2STD A;  5IEN A;  4EV5 A;  4O2H A;  4PEJ A;  5AEU B;  3Q1C A;  1VQ7 3;  2W04 A;  4EYC A;  1VQ6 3;  2FNQ A;  3OXA A;  1IDP A;  4HM3 B;  2I9W A;  1CQS A;  3FSD A;  3ALA A;  1W00 A;  5JPU A;  2WOH A;  3SOA A;  5CF1 A;  1VQ4 3;  1N5H A;  1FA3 A;  4N6M A;  3TDG A;  1K8A 4;  1CEW I;  3LTA A;  1WTH A;  3OV4 A;  2BMR B;  3A76 A;  3ER7 A;  2RSX A;  3SXX A;  1IQ8 A;  2E2U A;  5CLK A;  5DRE A;  1IV7 A;  1TP6 A;  2V1L A;  3H51 A;  4WFO A;  3EF8 A;  2CC3 A;  2P0X A;  1IVU A;  3ECF A;  3IJE B;  3GWR A;  3LTB A;  2OQE A;  2CH9 A;  2LYX A;  3UNL A;  2ZL8 A;  1NU3 A;  2Y74 A;  3SX1 A;  5IG0 A;  4R1K A;  3CPO A;  3E99 A;  5EEO A;  4AEQ A;  1OH0 A;  4KZ1 A;  2BNG A;  2QIY A;  4GB5 A;  3DGL A;  1HKX A;  1U5O A;  2YFL B;  2RFR A;  2Z6B A;  3D3L A;  3D9R A;  1NB3 I;  3NV0 A;  5KP4 A;  2OWP A;  3KII A;  4HBR A;  4MMY B;  3MPH A;  1LVN A;  1W6G A;  1Y4K A;  4O02 B;  1IT8 A;  5ELU A;  3G4S 3;  2HMM B;  5G2G A;  3NQZ A;  5CXO A;  3EB8 A;  2CWU A;  4N6O B;  1K9M 4;  5HGR A;  1O7H B;  1FUW A;  3JUN A;  4Q53 A;  4J8T A;  1UW1 A;  4MJD A;  4AKZ A;  5IEP A;  3CME 3;  1VQN 3;  2D1W A;  3FF0 A;  2SBL A;  2Y73 A;  3GZB A;  2JDI H;  1RJO A;  1JNQ A;  1WMO A;  3M8C A;  4FCM A;  5IEO A;  1KQS 2;  1A67 A;  1FGR A;  1W7C A;  5CK6 A;  3KSE D;  1O7G B;  3AMO A;  3F40 A;  1YJ9 3;  2HMN B;  2GU3 A;  3B4O A;  3CC2 3;  1DYU A;  2HMO B;  5D81 A;  1S72 3;  3OWU A;  1Q42 A;  3MSO A;  3CCV 3;  1VQ9 3;  5D83 A;  5LC6 A;  3HI7 A;  5LC7 A;  1YIT 3;  1GY5 A;  1GY7 A;  3LH4 A;  3WMD A;  1N9J A;  1SII A;  1RRH A;  1R4C A;  3CCS 3;  1OF5 A;  2W2C A;  4JF8 A;  2INX A;  4FMC A;  1WQL B;  5IG3 A;  2CKF B;  3OX9 A;  2OTL 3;  3RGR A;  1NWW A;  3MG2 A;  1VQP 3;  3BNE A;  3LML A;  3S28 A;  3L0R A;  1W4N A;  3PZW A;  1Z1S A;  2W03 A;  2XGL A;  1O7W B;  3S67 A;  2XFS A;  2FGT A;  5IG4 A;  4KFF A;  4R4K A;  4HM5 B;  2F86 B;  1F8N A;  3NBB A;  3Q90 A;  1KD1 4;  3DGO A;  1ROA A;  4K1V A;  1YJW 3;  1US1 A;  3EBT A;  3UJM A;  1YIJ 3;  4LZI A;  5STD A;  3MG3 A;  2JQ5 A;  4FCZ A;  4U13 A;  3DGM A;  1MNL A;  2IUK A;  1TIJ A;  3WOE B;  1TFK A;  2BO9 B;  3CMA 3;  1FGO A;  1OHP A;  1AR0 A;  1IT7 A;  3JVC A;  5AIF A;  1AVL A;  1STD A;  1A2V A;  3MWZ A;  2XH9 A;  2CW9 A;  3G16 A;  1AVK A;  3EC9 A;  4MEI A;  7STD A;  2B1X B;  3DY5 A;  3VSY A;  1BUQ A;  1M90 4;  3AMO B;  3G0K A;  1EKM A;  3PXM A;  1Q40 A;  1ISK A;  1K41 A;  3CD6 3;  2R4I A;  1OAC A;  1Q7Y 4;  2Z76 A;  1IVV A;  3CU3 A;  3MG1 A;  3V92 A;  6STD A;  3KZT A;  3DGN A;  4N6L A;  1OPY A;  2W9Q A;  2CG1 A;  3X3X A;  1OF5 B;  2D42 A;  2XRX B;  3NQY A;  2FXT A;  3GZR A;  2MF7 A;  1FGT A;  3DM8 A;  3SLU A;  5IW9 A;  3CC4 3;  3OWY A;  4K61 A;  2C10 A;  4WP5 A;  1A90 A;  4FR9 A;  4LMI A;  3N54 B;  3V98 A;  3MYT A;  1TFO A;  2KXG A;  1DMN A;  1WNH A;  4AKY A;  3GAX A;  1W6C A;  3CNX A;  3FF2 A;  3HII A;  2BHM A;  3EJV A;  1SQW A;  3CNM A;  1QVF 2;  3CXC 2;  3KE7 A;  1YHQ 3;  3RDE A;  1W2Z A;  3N9H A;  3T8N A;  3LZA A;  2CFK A;  3I0Y A;  5IG5 A;  2PZV A;  4L7K A;  3FH1 A;  5IER A;  2CFL A;  4R9L A;  3CPW 2;  5BXQ A;  2BMO B;  4EC6 A;  1W6Y A;  3V99 A;  3F7S A;  3CCL 3;  3U97 A;  4L8P A;  1VQL 3;  1UI7 A;  5CF2 A;  1ULJ B;  3F8H A;  2QA4 3;  4HZB B;  1NB5 I;  1FGM A;  3QRD A;  1UI8 A;  3X3Y A;  1NJI 4;  1E3R A;  3GZX B;  2CFG A;  2XR8 B;  4ORL A;  2IA7 A;  5AI1 A;  1K28 A;  1GD4 A;  3GZY B;  1DVD A;  1STF I;  2QGU A;  2OQE C;  3F7X A;  1W5Z A;  2MC8 A;  2KCD A;  3EBY A;  1IU7 A;  1Q40 B;  2A15 A;  1EG9 B;  2GEY A;  1JB2 A;  3JUO A;  3VF1 A;  5D82 A;  4O8S A;  2CG0 A;  2W9P A;  1TU5 A;  2PNC A;  3ROB A;  3MHE A;  3B4P A;  4OVM A;  4EXR A;  4KFE A;  1JKG A;  2CHC A;  2W6J H;  1SIH A;  2B24 B;  1IVW A;  3DXO A;  5AIG A;  1D6U A;  3LTD A;  1IQY A;  1S5A A;  3LXU X;  3K5T A;  1N8Q A;  1UUW B;  2P0M A;  2WGQ A;  4HM6 B;  1JV2 B;  3LOY A;  3VGN A;  1W01 A;  3Q2P A;  5ELJ A;  1IQX A;  3FZW A;  2ZDJ A;  2IMJ A;  2W0Q A;  2WO0 A;  1GS3 A;  2YFI B;  4IPB A;  3J7Y d;  1SJW A;  2XSO B;  3DUK A;  1AV4 A;  3PGB A;  4N3V A;  4XBT A;  3SVA A;  3CCR 3;  1Q81 4;  2UX0 A;  3FG3 A;  2XFT A;  3NBJ A;  4RBN A;  3WOF B;  1ULI B;  1IV9 A;  1T5Y A;  5AII A;  4HM4 B;  5A0O B;  1JB4 A;  4LSO A;  5FGO A;  4MMX B;  4X2O A;  3LTC A;  3FLJ A;  3X40 A;  3I56 3;  4FMD A;  1RN7 A;  3LYG A;  2XSH B;  1VQK 3;  5JBS A;  3SOY A;  4H61 A;  4MMZ B;  1UUV B;  3LT9 A;  3NBR A;  3K63 A;  1YVB I;  3EX9 A;  5JPP A;  4ZM8 A;  4LEH A;  1QJG A;  4N6U A;  1ROV A;  4HJL B;  1VQ5 3;  3BB9 A;  4IIA A;  1VQ8 3;  3DZL A;  1E3V A;  1O7N B;  3BNC A;  4RNY A;  3S5C A;  1JN5 A;  4HM1 B;  3JUP A;  3CCM 3;  4N6T A;  3JUQ A;  1IVX A;  4N6V 0;  5EQL A;  4EV2 A;  2WOF A;  4HKV B;  1NDO B;  2HMK B;  2IUJ A;  1Q82 4;  3BLZ A;  3HK4 A;  3HX8 A;  2CIU A;  1JKG B;  1M1X B;  3UL5 A;  3PS8 A;  1KWI A;  2E2T A;  2RGQ A;  1QAF A;  2ML5 A;  2L4V A;  3GRD A;  1W02 A;  3S27 A;  2ML6 A;  4LGQ A;  4EBG A;  4FCJ A;  5BVB A;  1QAK A;  1QAL A;  3WDG B;  2Q07 A;  4WHA A;  2OTJ 3;  3NHX A;  3UB1 A;  2XEP A;  1NO3 A;  3KSP A;  2RCD A;  3WA2 X;  1JRQ A;  1VQM 3;  2YFJ B;  5I97 A;  3T0U A;  1D6Y A;  2GXF A;  3K9M C;  3NX0 A;  5DRV A;  1U8C B;  1YI2 3;  1DVC A;  1LNH A;  1WMP A;  1DMM A;  4HYZ A;  4XBY A;  3HIG A;  4G1M B;  4TX4 A;  5AYS C;  3BNB A;  1QVG 2;  4GL6 A;  4X2H A;  3KN4 A;  3KKG A;  4BTW A;  4J9A A;  5KP3 A;  1YGE A;  1C7H A;  1K73 4;  2O3O A;  2E2V A;  1YJN 3;  4FMA A;  3MKI A;  1N8R 4;  3G6E 3;  3CC7 3;  3B8L A;  4WYK A;  3B7C A;  2XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...