4HYZA

Crystal structure of a duf3887 family protein (rumgna_01855) from ruminococcus gnavus atcc 29149 at 2.25 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
GEILKELPEGFDKETVRKQAMEDIEIAQSKDYESWKSRFTKDLQSSLTEESYDSYLKILEKQGEFKEFGKCTYLGQIKDNKKYGGVIIVVKYEEGNVNYSLAYDEDMNLVSFTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (RUMGNA_01855) from Ruminococcus gnavus ATCC 29149 at 2.25 A resolution
rcsb
source organism Ruminococcus gnavus
total genus 33
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13026 DUF3887 Protein of unknown function (DUF3887)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.590 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hyzA00
4HYZA 2MC8A
chains in the Genus database with same CATH superfamily
4BIRA 3A5EA 3MG2A 4NREA 1BOXA 2Q07A 1R4CA 3FCSB 1YVBI 3G8ZA 2WGQA 1ZX2A 1I3IA 1JRQA 1FGMA 2RCDA 2BO9B 1M904 1LOWA 3GSPA 1ULJB 5IG0A 3WMDA 4H61A 1M1XB 1PY3A 4XBYA 1BGSA 2P38A 4Q53A 1DMMA 1SQWA 4RNZA 3VGNA 5I97A 4EV2A 3CMA3 3ALAA 3LTDA 1RJOA 1B3SA 1TTOA 2XGNA 2BIRA 8RNTA 2JDIH 4EV5A 2PZVA 1JBSA 3NBJA 4HM5B 1GSPA 2CK3H 1W7CA 4KT3B 4MMYB 5M18A 1AV4A 3OV4A 2W56B 7STDA 1EUIC 1US1A 1D6YA 3KE7A 2XGLA 1RNBA 3RGRA 3NX0A 2GBXB 1IVWA 1VQ43 2GEXA 2RSXA 2FNQA 5AEUB 1UUGB 3ROBA 5BVBA 3FG3A 3ZG5A 2KF6A 4HM3B 1YJ93 3D9RA 4HVNA 1OHOA 1WNHA 4HOHA 4R9LA 3HK4A 4O02B 5CK6A 1DYUA 1JB4A 4N6UA 4XBXA 2H0IA 5AIIA 2IA7A 3H3HA 4LZIA 2P09A 1SIHA 1L5GB 1N9JA 1JNQA 1TFOA 3MG3A 1RGKA 3MHEA 6RNTA 1PYLA 1YIJ3 3HX8A 3LXUX 2OQEA 2RFRA 1N9EA 3K7CA 4HM8B 2W9PA 1BSAA 3VSYA 2F99A 2SARA 1CYVA 3EB8A 1RRLA 1W6CA 1YGWA 3PXMA 1I3FA 1LNHA 2QIYA 3JVCA 3WHOA 1ISKA 3FZWA 3LTCA 3CD63 3T8NA 3K63A 3CCR3 1OUNA 3NXJA 4IIAA 2XFSA 2OCTA 3X3ZA 1RN7A 1AVKA 3G16A 1IYYA 2CWVA 3GZXB 1RKYA 3F8XA 2KF5A 2OOVC 3JUMA 3E99A 2GBWB 1BNJA 2W9QA 1KQS2 4GL6A 4AKZA 1TRQA 4HYZA 5EVHA 3K9MC 4X2HA 5G2GA 1FUWA 2GSPA 2IY2A 2Z76A 2BMRB 1I2GA 1LQMB 1MNLA 2HMMB 3B8LA 3BNCA 3URPA 1MGWA 4ORLA 1IVUA 3RNTA 1TU5A 1IT8A 4J8TA 2KF3A 2CC3A 5CF1A 3MSOA 8CHOA 1YHQ3 3JUPA 4EXRA 1G0TA 1I0VA 1LXEA 3LYGA 5A0OB 1I70A 3Q3FA 2F98A 1GD4A 3U1WA 1RSNA 3HOHA 1HZ1A 1ROAA 3F14A 3MPHA 1QJGA 2K54A 1KWIA 1N5PA 2XEPA 1IV9A 1NU3A 3HIGA 3KFQC 2XFTA 1N8QA 3NM2A 4MEIA 4R4KA 3JUOA 1RCKA 3ZFZA 1BNRA 1OHPA 3T8UA 1MWRA 3MG1A 1NB5I 3U97A 2B1XB 1EQKA 1D6ZA 1GMPA 1NJI4 3GZBA 3Q2PA 1UCKA 1MWUA 2Y73A 1JB5A 4HM2B 1CYUA 2H0GA 3CCU3 5AIHA 1BNSA 1BNIA 3FG1A 4JRFA 4HZ9B 5CXOA 3LTBA 3EBYA 2XSOB 1WMNA 1RGFA 3UB1A 2XR8B 1DVDA 1C7HA 4L7KA 3OW22 3LZAA 1ROVA 2A15A 1DMNA 3CU3A 4FMDA 2HMOB 3CNXA 1JKGA 4QWTA 2W6JH 1B2SA 2O3OA 3BLZA 2PNCA 4KVHA 1UCLA 4GB5A 2ZL8A 2AADA 1TJDA 3QK9A 3CPOA 4HM0B 3CCE3 1OHSA 3X42A 4OUQA 4N6NB 1W2ZA 1T2IA 1BSDA 1JB2A 1X1XA 1AQZA 2RBIA 2Z77A 3FG4A 4I5QA 1YIT3 1S5AA 3DXOA 3SYUA 1VZZA 1ZO2A 4LMIA 1SJWA 3DZLA 3CC73 1K41A 1K8A4 2F56A 2M7OA 4LEHA 3HIIA 1BRJA 4IPBA 6GSPA 5HGRA 1WMOA 3CNMA 3LT8A 4BTXA 3PZWA 1QVF2 3DGOA 5G1KA 3UNLA 1NWWA 3OX9A 4GHOA 4IT7A 4MMZB 1O7HB 1B27A 1IDPA 1W4NA 2F5MA 1RLSA 9RNTA 4O3VA 1LOVA 3AGOA 1K28A 1IU7A 3X3YA 4ZM8A 2V1LA 1SARA 5IEOA 1RGAA 5IF6A 3S27A 1VQ63 4RZMA 4WP5A 5BXQA 3DMCA 3SVAA 1HKXA 3SXXA 1GMRA 2GEYA 1RTUA 1YI23 1B2MA 5D83A 2XH9A 1ASKA 3X3XA 1VQ83 2D1WA 1JKGB 3PGBA 3CCL3 3FLJA 1X1UA 2RNTA 3G713 1IVVA 3WODG 5JPUA 1EKMA 3JUQA 2CX0A 2W04A 5TGNA 1JZDA 1V57A 3KKGA 1EG9B 1MGRA 1A67A 3SX1A 1IQYA 2IUKA 2SBLA 1J2BA 5IEPA 2OOVA 1PFPA 1BSCA 3I0YA 1LNIA 3N54B 3CCM3 3CCQ3 1RGGA 1ZGXA 1B2ZA 2Z7AA 2ZHXB 4CDLA 2GU1A 3MKIA 3Q1CA 1GD3A 3BB9A 1RN4A 5KP1A 3BNBA 2CG1A 1LVNA 1Y4KA 3CPW2 1OPYA 1GY5A 4H3UA 4O8SA 1VQL3 1YNVX 3O8YA 1QAFA 1GY6A 1UDII 1B2XA 4N6OB 1W6YA 5M1AA 3FKAA 3CCV3 1K9M4 1Q42A 3F7XA 4MMXB 5JPPA 2W2CA 2Z6BA 3F7SA 1TFKA 2CFWA 1WTHA 4XBTA 2IYJA 1DETA 5DREA 3LMLA 4CPKA 1G96A 1RMSA 4XM4A 5AIFA 2K3DA 4N6TA 4BL2A 4JF8A 2INXA 1I2FA 1D6UA 1BRKA 1BUQA 2STDA 1W6GA 4HM4B 2JQ5A 1RGCA 2BT3A 3PCRA 4DKIA 3GZRA 3NV0B 3WR2A 1IV7A 1M1K4 1FA3A 3LOYA 4NPBA 3AMOA 1Q40A 1I0XA 5ELJA 1Q7Y4 4EW5A 3WDGB 2D42A 2O9UX 1FYSA 1CQSA 1BNEA 3IMAB 4TX4A 1B20A 1JV2B 3WA2X 5AIGA 1VQO3 3S28A 1A90A 2K0MA 1UUVB 1WQLB 1B21A 1TP6A 2E2VA 1OF5A 2ZA4A 2GXFA 1KSIA 4K61A 2CFLA 1A2KA 1DMQA 2CFGA 3NQZA 3RGAA 3FF2A 5AEWB 3KSPA 3SOAA 6STDA 2F5WA 1WMPA 5LC6A 4GSPA 4RNYA 1GOUA 3HI7A 2BMOB 3PS8A 3OWUA 3T0UA 1V58A 1BANA 2KCDA 1OGXA 2F86B 1GYBA 2L1SA 2Y74A 4K1UA 5BIRA 1U8CB 3AHSA 1MOLA 1UI7A 1FGRA 2CWUA 2C4BA 2XF3A 3ECFA 5AI1A 5KP3A 5M19A 4OVMA 3CCS3 3X40A 2I9WA 3KCHA 4XDVA 5IW9A 4WHAA 2WOFA 1HYFA 1W00A 1BRIA 2KF4A 5D81A 5IERA 1RRHA 2P0MA 4BTWA 1AY7A 2WGOA 1JJ22 3CME3 1UCJA 1JBTA 3DGYA 3ZG0A 2W0QA 4OK0A 3D3LA 2QA43 5HOHA 3GRDA 1VQK3 4KFDA 3CXC2 1G02A 3D5IA 2YFLB 3AMOB 1Q40B 3I563 1Q814 3STDA 1IQXA 5IG3A 1F8NA 1BU4A 3UL6A 3NQYA 3GWRA 4U13A 3KN4A 4BTYA 1VQM3 1R4YA 2IMJA 2XSHB 4RNTA 4HM1B 5G1LA 4WWUC 4HBRA 5EEOA 4N6V0 1DVCA 3FH1A 3EN8A 2QGUA 1I2EA 1OF5B 2CG0A 3DUKA 3WOEB 2L4VA 4KFEA 3H51A 5IG4A 5GSPA 3WOFB 1N8R4 1VQ73 1E97A 3F9SA 1W2B2 2KXGA 3V92A 2IUJA 3F40A 2P05A 2CFKA 4G1MB 3B7CA 3D4AA 1QVG2 2KRTA 1FUSA 1A2VA 1NDOB 4FCZA 1STFI 1Z1SA 4XB5A 3L0RA 3RDEA 1RCLA 1W01A 4FMAA 5FW5A 2BMQB 1KC84 5ELUA 3EF8A 3BIRA 1HU9A 1BNFA 1O7WB 1RGLA 2FGTA 1FW7A 2GU3A 1BSEA 3NV0A 3EC9A 4HM7B 3TDGA 4HZBB 4X2OA 3OWSA 1FGTA 4CJNA 3N9HA 2R41A 4HM6B 5CLKA 2E2UA 1Q824 3OWYA 1I8VA 4KFFA 3PYJA 2UGIA 1BRHA 3EQQB 3NBBA 3DGMA 2HMLB 3SOYA 1Q9EA 4K1VA 3I553 1UGHI 3DH2A 4FMBA 2BU4A 4WYKA 1BUJA 1IVXA 1MWTA 1RGEA 1QALA 1E3VA 1YJN3 2B24B 4N6LA 3S29A 1UI8A 3MYTA 1RDSA 3M8CA 1YJW3 1O7PB 3LT9A 1UCIA 5AYRB 1GOVA 4J5GA 1TIJA 2HMNB 1OGZA 1BVIA 2CKFB 3K5TA 1AVLA 5EQLA 1C54A 1S723 1GS3A 4XDWA 3J7Yd 4HKVB 1BRNL 2C11A 3NBRA 1O7MB 1OACA 4RBNA 1QMAA 1LQGC 1T3BA 2MF7A 1BSBA 1RN1A 2LYXA 2YX9A 3S5CA 3Q90A 2MC8A 4AKYA 2ML6A 1EA2A 2HMKB 3EJVA 3F8HA 4HAAA 4HJLB 1RGHA 1BNGA 1STDA 1N5HA 3JUNA 3SEDA 3K0ZA 1GMQA 2H0HA 3BNDA 3DY5A 2LQVA 1SPUA 1X1YA 5BU4A 4J9AA 1JN5A 4LSOA 1PU4A 4KZ1A 5RNTA 1CEWI 1LOXA 1NO3A 4N6MA 1OH0A 2WO0A 3FSDA 5D82A 5AYSC 1NNVA 3S67A 1DE3A 3EHCA 5KP4A 3ER7A 7RNTA 1OCVA 2CWTA 3EN1B 3X41A 1O7GB 4O2HA 2CH9A 2HMJB 1M9GA 1SIIA 4LYLB 4STDA 4EBGA 3FGYA 1GOYA 1O7NB 4WFOA 2CHCA 2KAAA 2WOHA 2YFIB 3D79A 3KSED 1FUTA 4ILFA 3DGLA 2E2TA 3B4PA 3EE1A 5FGOA 4FCMA 2UX0A 3UL5A 4WYKB 1B2UA 2BHMA 3VF1A 3G6E3 1IQ8A 2OQEC 3EX9A 1VQN3 1T5YA 1EEJA 4EC6A 1JZOA 2ZDJA 4AEQA 2ML5A 3EBTA 1FGQA 3GZYB 2J8XB 3QRDA 4N3VA 1T2HA 2C10A 2FXTA 3AGNA 5LC7A 3IJEB 1GY7A 1W02A 2CW9A 2R4IA 2QEX3 1BIRA 1V74A 3NM7A 1IT7A 3NUVA 4R80A 3V98A 4CCVA 1RHLA 5DRVA 3PCSA 1ULIB 1X1WA 1W5ZA 1UW1A 2CIUA 4FR9A 1RNTA 3G0KA 3SLUA 3D5GA 2AAEA 3MWZA 2F4YA 3V99A 3NHXA 3OXAA 1NB3I 1BAOA 1FZUA 2OWPA 4K90B 1U5OA 1BRSA 2P0XA 4R1KA 4BU4A 1JN5B 1TUHA 1VQQA 3BNEA 1Q7HA 5CF2A 3A76A 1VQP3 1VQ53 1AR0A 4FMCA 4BL3A 2YFJB 3UJMA 1JBRA 5IG5A 1YVSA 3WA3A 2CX1A 4FCJA 1UGIA 2CFDA 1K734 2BNGA 4PEJA 5JBSA 1BRGA 4LGQA 1LRAA 1KD14 1Q864 2OTJ3 3KIIA 1MWSA 3G4S3 1ZS7A 4J5KA 3LTAA 3FF0A 3GAXA 3CCJ3 1VQ93 2W56A 3DGNA 3AHWA 2HOHA 3KZTA 4L8OA 3IPTA 1YGEA 2W03A 3HZPA 4NHFA 2OTL3 1CH0A 4EYCA 5STDA 2UUGC 3CC43 3CC23 1A2PA 1E3RA 4I4KA 2RGQA 3BU4A 3DM8A 4L8PA 1IK3A 1FGOA 1QAKA 3LH4A 4MJDA 1UUWB 4R9KA 2XRXB 1LOYA 3N8BA 5IENA 1TRPA 7GSPA 3B4OA
chains in the Genus database with same CATH topology
3MG2A 4NREA 2Q07A 1R4CA 3FCSB 1YVBI 3G8ZA 2WGQA 1ZX2A 1JRQA 1FGMA 2RCDA 2BO9B 1M904 5IG0A 1ULJB 3WMDA 4H61A 1M1XB 4XBYA 2P38A 4Q53A 1DMMA 1SQWA 4RNZA 3VGNA 5I97A 4EV2A 3CMA3 3ALAA 3LTDA 1RJOA 2XGNA 2JDIH 4EV5A 2PZVA 3NBJA 4HM5B 2CK3H 1W7CA 4MMYB 1AV4A 3OV4A 2W56B 7STDA 1US1A 1D6YA 3KE7A 2XGLA 3RGRA 3NX0A 2GBXB 1IVWA 1VQ43 2GEXA 2RSXA 2FNQA 5AEUB 3ROBA 5BVBA 3FG3A 4HM3B 1YJ93 3D9RA 4HVNA 1OHOA 1WNHA 5CK6A 4R9LA 3HK4A 4O02B 1DYUA 1JB4A 4N6UA 4XBXA 5AIIA 2IA7A 3H3HA 4LZIA 2P09A 1SIHA 1L5GB 1N9JA 1JNQA 1TFOA 3MG3A 3MHEA 1YIJ3 3HX8A 3LXUX 2OQEA 2RFRA 1N9EA 3K7CA 4HM8B 2W9PA 3VSYA 2F99A 1CYVA 3EB8A 1RRLA 1W6CA 3PXMA 1ISKA 3JVCA 1LNHA 2QIYA 3FZWA 3LTCA 3CD63 3T8NA 3K63A 3CCR3 1OUNA 3NXJA 4IIAA 2XFSA 2OCTA 3X3ZA 1RN7A 1AVKA 3G16A 2CWVA 3GZXB 1RKYA 3F8XA 2OOVC 3JUMA 3E99A 2GBWB 2W9QA 1KQS2 4GL6A 4AKZA 4HYZA 5EVHA 3K9MC 4X2HA 5G2GA 1FUWA 3CCJ3 2Z76A 2BMRB 1MNLA 2HMMB 3B8LA 3BNCA 4ORLA 1IVUA 1TU5A 1IT8A 4J8TA 2CC3A 5CF1A 3MSOA 8CHOA 3JUPA 4EXRA 1LXEA 3LYGA 5A0OB 2F98A 1GD4A 3U1WA 1ROAA 3F14A 3MPHA 1QJGA 2K54A 1KWIA 1N5PA 2XEPA 1IV9A 1NU3A 3HIGA 3KFQC 2XFTA 1N8QA 3NM2A 4MEIA 4R4KA 3JUOA 1OHPA 3T8UA 3MG1A 1NB5I 3U97A 2B1XB 1EQKA 1D6ZA 1NJI4 3GZBA 3Q2PA 4HM2B 2Y73A 1JB5A 1CYUA 3CCU3 5AIHA 4JRFA 3FG1A 5CXOA 4HZ9B 3LTBA 3EBYA 2XSOB 1WMNA 3UB1A 2XR8B 1DVDA 1C7HA 4L7KA 3OW22 3LZAA 1ROVA 2A15A 1DMNA 3CU3A 4FMDA 2HMOB 3CNXA 1JKGA 4QWTA 2W6JH 2O3OA 3BLZA 2PNCA 4GB5A 2ZL8A 3QK9A 4HM0B 3CPOA 3CCE3 1OHSA 3X42A 4OUQA 4N6NB 1W2ZA 1JB2A 2Z77A 3FG4A 1YIT3 1S5AA 3DXOA 1VZZA 1ZO2A 4LMIA 1SJWA 3DZLA 3CC73 1K41A 1K8A4 2M7OA 4LEHA 3HIIA 4IPBA 5HGRA 1WMOA 3CNMA 3LT8A 4BTXA 3PZWA 1QVF2 3DGOA 3UNLA 1NWWA 3OX9A 4IT7A 4MMZB 1O7HB 1IDPA 1W4NA 4O3VA 1K28A 1IU7A 3X3YA 4ZM8A 2V1LA 5IEOA 5IF6A 3S27A 1VQ63 4RZMA 4WP5A 5BXQA 3DMCA 3SVAA 1HKXA 3SXXA 2GEYA 1YI23 5D83A 2XH9A 1ASKA 3X3XA 1VQ83 2D1WA 1JKGB 3PGBA 3CCL3 3FLJA 3G713 1IVVA 3WODG 5JPUA 1EKMA 3JUQA 5TGNA 2W04A 3KKGA 1EG9B 1A67A 3SX1A 1IQYA 2IUKA 2SBLA 1J2BA 5IEPA 2OOVA 1PFPA 3I0YA 3CCM3 3N54B 3CCQ3 2Z7AA 4CDLA 2GU1A 3MKIA 3Q1CA 1GD3A 3BB9A 5KP1A 3BNBA 2CG1A 1LVNA 1Y4KA 3CPW2 1OPYA 1GY5A 4H3UA 4O8SA 1VQL3 3O8YA 1QAFA 1GY6A 4N6OB 1W6YA 3CCV3 3FKAA 1K9M4 1Q42A 3F7XA 4MMXB 5JPPA 2W2CA 2Z6BA 3F7SA 1TFKA 2CFWA 1WTHA 4XBTA 5DREA 3LMLA 1G96A 4XM4A 5AIFA 4N6TA 4JF8A 2INXA 1D6UA 1BUQA 2STDA 1W6GA 4HM4B 2JQ5A 2BT3A 3PCRA 3GZRA 3NV0B 1M1K4 1IV7A 1FA3A 3LOYA 3AMOA 1Q40A 5ELJA 1Q7Y4 3WDGB 2D42A 2O9UX 1CQSA 3IMAB 4TX4A 3WA2X 1JV2B 5AIGA 1VQO3 3S28A 1A90A 2K0MA 1UUVB 1WQLB 1TP6A 2E2VA 1OF5A 2GXFA 1KSIA 4K61A 2CFLA 1A2KA 1DMQA 2CFGA 3NQZA 3RGAA 3FF2A 5AEWB 3KSPA 3SOAA 6STDA 1WMPA 5LC6A 4RNYA 3HI7A 2BMOB 3PS8A 3OWUA 3T0UA 2KCDA 1OGXA 2F86B 1GYBA 2Y74A 4K1UA 1U8CB 1MOLA 1UI7A 1FGRA 2CWUA 2XF3A 3ECFA 5AI1A 5KP3A 4OVMA 3CCS3 3X40A 2I9WA 4XDVA 5IW9A 4WHAA 2WOFA 1W00A 5D81A 5IERA 1RRHA 2P0MA 4BTWA 2WGOA 1JJ22 3CME3 2W0QA 4OK0A 3D3LA 2QA43 3GRDA 1VQK3 4KFDA 3CXC2 2YFLB 3AMOB 1Q40B 3I563 1Q814 3STDA 1IQXA 5IG3A 1F8NA 3UL6A 3NQYA 3GWRA 4U13A 3KN4A 4BTYA 1VQM3 2IMJA 2XSHB 4HM1B 4WWUC 4HBRA 5EEOA 4N6V0 1DVCA 3FH1A 3EN8A 2QGUA 1OF5B 2CG0A 3DUKA 3WOEB 2L4VA 4KFEA 3H51A 5IG4A 1N8R4 3WOFB 1VQ73 1E97A 3F9SA 1W2B2 2KXGA 3V92A 2IUJA 3F40A 2P05A 2CFKA 4G1MB 3B7CA 1QVG2 2KRTA 1A2VA 1NDOB 4FCZA 1STFI 1Z1SA 4XB5A 3L0RA 3RDEA 1W01A 4FMAA 5FW5A 2BMQB 1KC84 5ELUA 3EF8A 1HU9A 1O7WB 2FGTA 2GU3A 3NV0A 3EC9A 4HM7B 3TDGA 4HZBB 4X2OA 3OWSA 1FGTA 3N9HA 4HM6B 5CLKA 2E2UA 1Q824 3OWYA 4KFFA 3PYJA 3EQQB 3NBBA 3DGMA 2HMLB 3SOYA 4K1VA 3I553 4FMBA 4WYKA 1IVXA 1QALA 1E3VA 1YJN3 2B24B 4N6LA 3S29A 1UI8A 3MYTA 3M8CA 1YJW3 1O7PB 3LT9A 5AYRB 1TIJA 2HMNB 1OGZA 2CKFB 3K5TA 5EQLA 1AVLA 1S723 1GS3A 4XDWA 3J7Yd 4HKVB 2C11A 3NBRA 1O7MB 1OACA 4RBNA 1QMAA 2MF7A 2LYXA 2YX9A 3S5CA 3Q90A 2MC8A 4AKYA 2ML6A 1EA2A 2HMKB 3EJVA 3F8HA 4HJLB 3JUNA 1STDA 1N5HA 3SEDA 1YHQ3 3K0ZA 3DY5A 3BNDA 2LQVA 1SPUA 4J9AA 1JN5A 4LSOA 1PU4A 4KZ1A 1CEWI 1LOXA 1NO3A 4N6MA 1OH0A 2WO0A 3FSDA 5D82A 5AYSC 3S67A 3EHCA 5KP4A 3ER7A 1OCVA 2CWTA 3EN1B 3X41A 1O7GB 4O2HA 2CH9A 2HMJB 1M9GA 1SIIA 4STDA 4EBGA 3FGYA 1O7NB 4WFOA 2CHCA 2WOHA 2YFIB 3KSED 3DGLA 2E2TA 3B4PA 3EE1A 5FGOA 4FCMA 2UX0A 3UL5A 4WYKB 2BHMA 3VF1A 3G6E3 1IQ8A 2OQEC 3EX9A 1VQN3 1T5YA 4EC6A 2ZDJA 4AEQA 2ML5A 3EBTA 1FGQA 3GZYB 3QRDA 4N3VA 2FXTA 2C10A 5LC7A 3IJEB 1GY7A 1W02A 2CW9A 2R4IA 2QEX3 1V74A 3NM7A 3NUVA 1IT7A 4R80A 3V98A 4CCVA 5DRVA 3PCSA 1ULIB 1W5ZA 1UW1A 2CIUA 4FR9A 3G0KA 3SLUA 3MWZA 3V99A 3NHXA 3OXAA 1NB3I 2OWPA 4K90B 1U5OA 2P0XA 4R1KA 1JN5B 1TUHA 3BNEA 5CF2A 1VQP3 3A76A 1VQ53 1AR0A 4FMCA 2YFJB 3UJMA 5IG5A 3WA3A 4FCJA 1K734 2CFDA 2BNGA 4PEJA 5JBSA 4LGQA 1KD14 1Q864 2OTJ3 3KIIA 3G4S3 3LTAA 3FF0A 3GAXA 1VQ93 2W56A 3DGNA 3KZTA 4L8OA 3IPTA 1YGEA 2W03A 3HZPA 4NHFA 2OTL3 4EYCA 5STDA 3CC43 3CC23 1E3RA 4I4KA 2RGQA 3DM8A 4L8PA 1IK3A 1FGOA 1QAKA 3LH4A 4MJDA 1UUWB 4R9KA 2XRXB 3N8BA 5IENA 4KVHA 3B4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYZ A;  2MC8 A; 
#chains in the Genus database with same CATH topology
 4BIR A;  3A5E A;  3MG2 A;  4NRE A;  1BOX A;  2Q07 A;  1R4C A;  3FCS B;  1YVB I;  3G8Z A;  2WGQ A;  1ZX2 A;  1I3I A;  1JRQ A;  1FGM A;  2RCD A;  2BO9 B;  1M90 4;  1LOW A;  3GSP A;  1ULJ B;  5IG0 A;  3WMD A;  4H61 A;  1M1X B;  1PY3 A;  4XBY A;  1BGS A;  2P38 A;  4Q53 A;  1DMM A;  1SQW A;  4RNZ A;  3VGN A;  5I97 A;  4EV2 A;  3CMA 3;  3ALA A;  3LTD A;  1RJO A;  1B3S A;  1TTO A;  2XGN A;  2BIR A;  8RNT A;  2JDI H;  4EV5 A;  2PZV A;  1JBS A;  3NBJ A;  4HM5 B;  1GSP A;  2CK3 H;  1W7C A;  4KT3 B;  4MMY B;  5M18 A;  1AV4 A;  3OV4 A;  2W56 B;  7STD A;  1EUI C;  1US1 A;  1D6Y A;  3KE7 A;  2XGL A;  1RNB A;  3RGR A;  3NX0 A;  2GBX B;  1IVW A;  1VQ4 3;  2GEX A;  2RSX A;  2FNQ A;  5AEU B;  1UUG B;  3ROB A;  5BVB A;  3FG3 A;  3ZG5 A;  2KF6 A;  4HM3 B;  1YJ9 3;  3D9R A;  4HVN A;  1OHO A;  1WNH A;  4HOH A;  4R9L A;  3HK4 A;  4O02 B;  5CK6 A;  1DYU A;  1JB4 A;  4N6U A;  4XBX A;  2H0I A;  5AII A;  2IA7 A;  3H3H A;  4LZI A;  2P09 A;  1SIH A;  1L5G B;  1N9J A;  1JNQ A;  1TFO A;  3MG3 A;  1RGK A;  3MHE A;  6RNT A;  1PYL A;  1YIJ 3;  3HX8 A;  3LXU X;  2OQE A;  2RFR A;  1N9E A;  3K7C A;  4HM8 B;  2W9P A;  1BSA A;  3VSY A;  2F99 A;  2SAR A;  1CYV A;  3EB8 A;  1RRL A;  1W6C A;  1YGW A;  3PXM A;  1I3F A;  1LNH A;  2QIY A;  3JVC A;  3WHO A;  1ISK A;  3FZW A;  3LTC A;  3CD6 3;  3T8N A;  3K63 A;  3CCR 3;  1OUN A;  3NXJ A;  4IIA A;  2XFS A;  2OCT A;  3X3Z A;  1RN7 A;  1AVK A;  3G16 A;  1IYY A;  2CWV A;  3GZX B;  1RKY A;  3F8X A;  2KF5 A;  2OOV C;  3JUM A;  3E99 A;  2GBW B;  1BNJ A;  2W9Q A;  1KQS 2;  4GL6 A;  4AKZ A;  1TRQ A;  4HYZ A;  5EVH A;  3K9M C;  4X2H A;  5G2G A;  1FUW A;  2GSP A;  2IY2 A;  2Z76 A;  2BMR B;  1I2G A;  1LQM B;  1MNL A;  2HMM B;  3B8L A;  3BNC A;  3URP A;  1MGW A;  4ORL A;  1IVU A;  3RNT A;  1TU5 A;  1IT8 A;  4J8T A;  2KF3 A;  2CC3 A;  5CF1 A;  3MSO A;  8CHO A;  1YHQ 3;  3JUP A;  4EXR A;  1G0T A;  1I0V A;  1LXE A;  3LYG A;  5A0O B;  1I70 A;  3Q3F A;  2F98 A;  1GD4 A;  3U1W A;  1RSN A;  3HOH A;  1HZ1 A;  1ROA A;  3F14 A;  3MPH A;  1QJG A;  2K54 A;  1KWI A;  1N5P A;  2XEP A;  1IV9 A;  1NU3 A;  3HIG A;  3KFQ C;  2XFT A;  1N8Q A;  3NM2 A;  4MEI A;  4R4K A;  3JUO A;  1RCK A;  3ZFZ A;  1BNR A;  1OHP A;  3T8U A;  1MWR A;  3MG1 A;  1NB5 I;  3U97 A;  2B1X B;  1EQK A;  1D6Z A;  1GMP A;  1NJI 4;  3GZB A;  3Q2P A;  1UCK A;  1MWU A;  2Y73 A;  1JB5 A;  4HM2 B;  1CYU A;  2H0G A;  3CCU 3;  5AIH A;  1BNS A;  1BNI A;  3FG1 A;  4JRF A;  4HZ9 B;  5CXO A;  3LTB A;  3EBY A;  2XSO B;  1WMN A;  1RGF A;  3UB1 A;  2XR8 B;  1DVD A;  1C7H A;  4L7K A;  3OW2 2;  3LZA A;  1ROV A;  2A15 A;  1DMN A;  3CU3 A;  4FMD A;  2HMO B;  3CNX A;  1JKG A;  4QWT A;  2W6J H;  1B2S A;  2O3O A;  3BLZ A;  2PNC A;  4KVH A;  1UCL A;  4GB5 A;  2ZL8 A;  2AAD A;  1TJD A;  3QK9 A;  3CPO A;  4HM0 B;  3CCE 3;  1OHS A;  3X42 A;  4OUQ A;  4N6N B;  1W2Z A;  1T2I A;  1BSD A;  1JB2 A;  1X1X A;  1AQZ A;  2RBI A;  2Z77 A;  3FG4 A;  4I5Q A;  1YIT 3;  1S5A A;  3DXO A;  3SYU A;  1VZZ A;  1ZO2 A;  4LMI A;  1SJW A;  3DZL A;  3CC7 3;  1K41 A;  1K8A 4;  2F56 A;  2M7O A;  4LEH A;  3HII A;  1BRJ A;  4IPB A;  6GSP A;  5HGR A;  1WMO A;  3CNM A;  3LT8 A;  4BTX A;  3PZW A;  1QVF 2;  3DGO A;  5G1K A;  3UNL A;  1NWW A;  3OX9 A;  4GHO A;  4IT7 A;  4MMZ B;  1O7H B;  1B27 A;  1IDP A;  1W4N A;  2F5M A;  1RLS A;  9RNT A;  4O3V A;  1LOV A;  3AGO A;  1K28 A;  1IU7 A;  3X3Y A;  4ZM8 A;  2V1L A;  1SAR A;  5IEO A;  1RGA A;  5IF6 A;  3S27 A;  1VQ6 3;  4RZM A;  4WP5 A;  5BXQ A;  3DMC A;  3SVA A;  1HKX A;  3SXX A;  1GMR A;  2GEY A;  1RTU A;  1YI2 3;  1B2M A;  5D83 A;  2XH9 A;  1ASK A;  3X3X A;  1VQ8 3;  2D1W A;  1JKG B;  3PGB A;  3CCL 3;  3FLJ A;  1X1U A;  2RNT A;  3G71 3;  1IVV A;  3WOD G;  5JPU A;  1EKM A;  3JUQ A;  2CX0 A;  2W04 A;  5TGN A;  1JZD A;  1V57 A;  3KKG A;  1EG9 B;  1MGR A;  1A67 A;  3SX1 A;  1IQY A;  2IUK A;  2SBL A;  1J2B A;  5IEP A;  2OOV A;  1PFP A;  1BSC A;  3I0Y A;  1LNI A;  3N54 B;  3CCM 3;  3CCQ 3;  1RGG A;  1ZGX A;  1B2Z A;  2Z7A A;  2ZHX B;  4CDL A;  2GU1 A;  3MKI A;  3Q1C A;  1GD3 A;  3BB9 A;  1RN4 A;  5KP1 A;  3BNB A;  2CG1 A;  1LVN A;  1Y4K A;  3CPW 2;  1OPY A;  1GY5 A;  4H3U A;  4O8S A;  1VQL 3;  1YNV X;  3O8Y A;  1QAF A;  1GY6 A;  1UDI I;  1B2X A;  4N6O B;  1W6Y A;  5M1A A;  3FKA A;  3CCV 3;  1K9M 4;  1Q42 A;  3F7X A;  4MMX B;  5JPP A;  2W2C A;  2Z6B A;  3F7S A;  1TFK A;  2CFW A;  1WTH A;  4XBT A;  2IYJ A;  1DET A;  5DRE A;  3LML A;  4CPK A;  1G96 A;  1RMS A;  4XM4 A;  5AIF A;  2K3D A;  4N6T A;  4BL2 A;  4JF8 A;  2INX A;  1I2F A;  1D6U A;  1BRK A;  1BUQ A;  2STD A;  1W6G A;  4HM4 B;  2JQ5 A;  1RGC A;  2BT3 A;  3PCR A;  4DKI A;  3GZR A;  3NV0 B;  3WR2 A;  1IV7 A;  1M1K 4;  1FA3 A;  3LOY A;  4NPB A;  3AMO A;  1Q40 A;  1I0X A;  5ELJ A;  1Q7Y 4;  4EW5 A;  3WDG B;  2D42 A;  2O9U X;  1FYS A;  1CQS A;  1BNE A;  3IMA B;  4TX4 A;  1B20 A;  1JV2 B;  3WA2 X;  5AIG A;  1VQO 3;  3S28 A;  1A90 A;  2K0M A;  1UUV B;  1WQL B;  1B21 A;  1TP6 A;  2E2V A;  1OF5 A;  2ZA4 A;  2GXF A;  1KSI A;  4K61 A;  2CFL A;  1A2K A;  1DMQ A;  2CFG A;  3NQZ A;  3RGA A;  3FF2 A;  5AEW B;  3KSP A;  3SOA A;  6STD A;  2F5W A;  1WMP A;  5LC6 A;  4GSP A;  4RNY A;  1GOU A;  3HI7 A;  2BMO B;  3PS8 A;  3OWU A;  3T0U A;  1V58 A;  1BAN A;  2KCD A;  1OGX A;  2F86 B;  1GYB A;  2L1S A;  2Y74 A;  4K1U A;  5BIR A;  1U8C B;  3AHS A;  1MOL A;  1UI7 A;  1FGR A;  2CWU A;  2C4B A;  2XF3 A;  3ECF A;  5AI1 A;  5KP3 A;  5M19 A;  4OVM A;  3CCS 3;  3X40 A;  2I9W A;  3KCH A;  4XDV A;  5IW9 A;  4WHA A;  2WOF A;  1HYF A;  1W00 A;  1BRI A;  2KF4 A;  5D81 A;  5IER A;  1RRH A;  2P0M A;  4BTW A;  1AY7 A;  2WGO A;  1JJ2 2;  3CME 3;  1UCJ A;  1JBT A;  3DGY A;  3ZG0 A;  2W0Q A;  4OK0 A;  3D3L A;  2QA4 3;  5HOH A;  3GRD A;  1VQK 3;  4KFD A;  3CXC 2;  1G02 A;  3D5I A;  2YFL B;  3AMO B;  1Q40 B;  3I56 3;  1Q81 4;  3STD A;  1IQX A;  5IG3 A;  1F8N A;  1BU4 A;  3UL6 A;  3NQY A;  3GWR A;  4U13 A;  3KN4 A;  4BTY A;  1VQM 3;  1R4Y A;  2IMJ A;  2XSH B;  4RNT A;  4HM1 B;  5G1L A;  4WWU C;  4HBR A;  5EEO A;  4N6V 0;  1DVC A;  3FH1 A;  3EN8 A;  2QGU A;  1I2E A;  1OF5 B;  2CG0 A;  3DUK A;  3WOE B;  2L4V A;  4KFE A;  3H51 A;  5IG4 A;  5GSP A;  3WOF B;  1N8R 4;  1VQ7 3;  1E97 A;  3F9S A;  1W2B 2;  2KXG A;  3V92 A;  2IUJ A;  3F40 A;  2P05 A;  2CFK A;  4G1M B;  3B7C A;  3D4A A;  1QVG 2;  2KRT A;  1FUS A;  1A2V A;  1NDO B;  4FCZ A;  1STF I;  1Z1S A;  4XB5 A;  3L0R A;  3RDE A;  1RCL A;  1W01 A;  4FMA A;  5FW5 A;  2BMQ B;  1KC8 4;  5ELU A;  3EF8 A;  3BIR A;  1HU9 A;  1BNF A;  1O7W B;  1RGL A;  2FGT A;  1FW7 A;  2GU3 A;  1BSE A;  3NV0 A;  3EC9 A;  4HM7 B;  3TDG A;  4HZB B;  4X2O A;  3OWS A;  1FGT A;  4CJN A;  3N9H A;  2R41 A;  4HM6 B;  5CLK A;  2E2U A;  1Q82 4;  3OWY A;  1I8V A;  4KFF A;  3PYJ A;  2UGI A;  1BRH A;  3EQQ B;  3NBB A;  3DGM A;  2HML B;  3SOY A;  1Q9E A;  4K1V A;  3I55 3;  1UGH I;  3DH2 A;  4FMB A;  2BU4 A;  4WYK A;  1BUJ A;  1IVX A;  1MWT A;  1RGE A;  1QAL A;  1E3V A;  1YJN 3;  2B24 B;  4N6L A;  3S29 A;  1UI8 A;  3MYT A;  1RDS A;  3M8C A;  1YJW 3;  1O7P B;  3LT9 A;  1UCI A;  5AYR B;  1GOV A;  4J5G A;  1TIJ A;  2HMN B;  1OGZ A;  1BVI A;  2CKF B;  3K5T A;  1AVL A;  5EQL A;  1C54 A;  1S72 3;  1GS3 A;  4XDW A;  3J7Y d;  4HKV B;  1BRN L;  2C11 A;  3NBR A;  1O7M B;  1OAC A;  4RBN A;  1QMA A;  1LQG C;  1T3B A;  2MF7 A;  1BSB A;  1RN1 A;  2LYX A;  2YX9 A;  3S5C A;  3Q90 A;  2MC8 A;  4AKY A;  2ML6 A;  1EA2 A;  2HMK B;  3EJV A;  3F8H A;  4HAA A;  4HJL B;  1RGH A;  1BNG A;  1STD A;  1N5H A;  3JUN A;  3SED A;  3K0Z A;  1GMQ A;  2H0H A;  3BND A;  3DY5 A;  2LQV A;  1SPU A;  1X1Y A;  5BU4 A;  4J9A A;  1JN5 A;  4LSO A;  1PU4 A;  4KZ1 A;  5RNT A;  1CEW I;  1LOX A;  1NO3 A;  4N6M A;  1OH0 A;  2WO0 A;  3FSD A;  5D82 A;  5AYS C;  1NNV A;  3S67 A;  1DE3 A;  3EHC A;  5KP4 A;  3ER7 A;  7RNT A;  1OCV A;  2CWT A;  3EN1 B;  3X41 A;  1O7G B;  4O2H A;  2CH9 A;  2HMJ B;  1M9G A;  1SII A;  4LYL B;  4STD A;  4EBG A;  3FGY A;  1GOY A;  1O7N B;  4WFO A;  2CHC A;  2KAA A;  2WOH A;  2YFI B;  3D79 A;  3KSE D;  1FUT A;  4ILF A;  3DGL A;  2E2T A;  3B4P A;  3EE1 A;  5FGO A;  4FCM A;  2UX0 A;  3UL5 A;  4WYK B;  1B2U A;  2BHM A;  3VF1 A;  3G6E 3;  1IQ8 A;  2OQE C;  3EX9 A;  1VQN 3;  1T5Y A;  1EEJ A;  4EC6 A;  1JZO A;  2ZDJ A;  4AEQ A;  2ML5 A;  3EBT A;  1FGQ A;  3GZY B;  2J8X B;  3QRD A;  4N3V A;  1T2H A;  2C10 A;  2FXT A;  3AGN A;  5LC7 A;  3IJE B;  1GY7 A;  1W02 A;  2CW9 A;  2R4I A;  2QEX 3;  1BIR A;  1V74 A;  3NM7 A;  1IT7 A;  3NUV A;  4R80 A;  3V98 A;  4CCV A;  1RHL A;  5DRV A;  3PCS A;  1ULI B;  1X1W A;  1W5Z A;  1UW1 A;  2CIU A;  4FR9 A;  1RNT A;  3G0K A;  3SLU A;  3D5G A;  2AAE A;  3MWZ A;  2F4Y A;  3V99 A;  3NHX A;  3OXA A;  1NB3 I;  1BAO A;  1FZU A;  2OWP A;  4K90 B;  1U5O A;  1BRS A;  2P0X A;  4R1K A;  4BU4 A;  1JN5 B;  1TUH A;  1VQQ A;  3BNE A;  1Q7H A;  5CF2 A;  3A76 A;  1VQP 3;  1VQ5 3;  1AR0 A;  4FMC A;  4BL3 A;  2YFJ B;  3UJM A;  1JBR A;  5IG5 A;  1YVS A;  3WA3 A;  2CX1 A;  4FCJ A;  1UGI A;  2CFD A;  1K73 4;  2BNG A;  4PEJ A;  5JBS A;  1BRG A;  4LGQ A;  1LRA A;  1KD1 4;  1Q86 4;  2OTJ 3;  3KII A;  1MWS A;  3G4S 3;  1ZS7 A;  4J5K A;  3LTA A;  3FF0 A;  3GAX A;  3CCJ 3;  1VQ9 3;  2W56 A;  3DGN A;  3AHW A;  2HOH A;  3KZT A;  4L8O A;  3IPT A;  1YGE A;  2W03 A;  3HZP A;  4NHF A;  2OTL 3;  1CH0 A;  4EYC A;  5STD A;  2UUG C;  3CC4 3;  3CC2 3;  1A2P A;  1E3R A;  4I4K A;  2RGQ A;  3BU4 A;  3DM8 A;  4L8P A;  1IK3 A;  1FGO A;  1QAK A;  3LH4 A;  4MJD A;  1UUW B;  4R9K A;  2XRX B;  1LOY A;  3N8B A;  5IEN A;  1TRP A;  7GSP A;  3B4O A; 
#chains in the Genus database with same CATH homology
 3MG2 A;  4NRE A;  2Q07 A;  1R4C A;  3FCS B;  1YVB I;  3G8Z A;  2WGQ A;  1ZX2 A;  1JRQ A;  1FGM A;  2RCD A;  2BO9 B;  1M90 4;  5IG0 A;  1ULJ B;  3WMD A;  4H61 A;  1M1X B;  4XBY A;  2P38 A;  4Q53 A;  1DMM A;  1SQW A;  4RNZ A;  3VGN A;  5I97 A;  4EV2 A;  3CMA 3;  3ALA A;  3LTD A;  1RJO A;  2XGN A;  2JDI H;  4EV5 A;  2PZV A;  3NBJ A;  4HM5 B;  2CK3 H;  1W7C A;  4MMY B;  1AV4 A;  3OV4 A;  2W56 B;  7STD A;  1US1 A;  1D6Y A;  3KE7 A;  2XGL A;  3RGR A;  3NX0 A;  2GBX B;  1IVW A;  1VQ4 3;  2GEX A;  2RSX A;  2FNQ A;  5AEU B;  3ROB A;  5BVB A;  3FG3 A;  4HM3 B;  1YJ9 3;  3D9R A;  4HVN A;  1OHO A;  1WNH A;  5CK6 A;  4R9L A;  3HK4 A;  4O02 B;  1DYU A;  1JB4 A;  4N6U A;  4XBX A;  5AII A;  2IA7 A;  3H3H A;  4LZI A;  2P09 A;  1SIH A;  1L5G B;  1N9J A;  1JNQ A;  1TFO A;  3MG3 A;  3MHE A;  1YIJ 3;  3HX8 A;  3LXU X;  2OQE A;  2RFR A;  1N9E A;  3K7C A;  4HM8 B;  2W9P A;  3VSY A;  2F99 A;  1CYV A;  3EB8 A;  1RRL A;  1W6C A;  3PXM A;  1ISK A;  3JVC A;  1LNH A;  2QIY A;  3FZW A;  3LTC A;  3CD6 3;  3T8N A;  3K63 A;  3CCR 3;  1OUN A;  3NXJ A;  4IIA A;  2XFS A;  2OCT A;  3X3Z A;  1RN7 A;  1AVK A;  3G16 A;  2CWV A;  3GZX B;  1RKY A;  3F8X A;  2OOV C;  3JUM A;  3E99 A;  2GBW B;  2W9Q A;  1KQS 2;  4GL6 A;  4AKZ A;  4HYZ A;  5EVH A;  3K9M C;  4X2H A;  5G2G A;  1FUW A;  3CCJ 3;  2Z76 A;  2BMR B;  1MNL A;  2HMM B;  3B8L A;  3BNC A;  4ORL A;  1IVU A;  1TU5 A;  1IT8 A;  4J8T A;  2CC3 A;  5CF1 A;  3MSO A;  8CHO A;  3JUP A;  4EXR A;  1LXE A;  3LYG A;  5A0O B;  2F98 A;  1GD4 A;  3U1W A;  1ROA A;  3F14 A;  3MPH A;  1QJG A;  2K54 A;  1KWI A;  1N5P A;  2XEP A;  1IV9 A;  1NU3 A;  3HIG A;  3KFQ C;  2XFT A;  1N8Q A;  3NM2 A;  4MEI A;  4R4K A;  3JUO A;  1OHP A;  3T8U A;  3MG1 A;  1NB5 I;  3U97 A;  2B1X B;  1EQK A;  1D6Z A;  1NJI 4;  3GZB A;  3Q2P A;  4HM2 B;  2Y73 A;  1JB5 A;  1CYU A;  3CCU 3;  5AIH A;  4JRF A;  3FG1 A;  5CXO A;  4HZ9 B;  3LTB A;  3EBY A;  2XSO B;  1WMN A;  3UB1 A;  2XR8 B;  1DVD A;  1C7H A;  4L7K A;  3OW2 2;  3LZA A;  1ROV A;  2A15 A;  1DMN A;  3CU3 A;  4FMD A;  2HMO B;  3CNX A;  1JKG A;  4QWT A;  2W6J H;  2O3O A;  3BLZ A;  2PNC A;  4GB5 A;  2ZL8 A;  3QK9 A;  4HM0 B;  3CPO A;  3CCE 3;  1OHS A;  3X42 A;  4OUQ A;  4N6N B;  1W2Z A;  1JB2 A;  2Z77 A;  3FG4 A;  1YIT 3;  1S5A A;  3DXO A;  1VZZ A;  1ZO2 A;  4LMI A;  1SJW A;  3DZL A;  3CC7 3;  1K41 A;  1K8A 4;  2M7O A;  4LEH A;  3HII A;  4IPB A;  5HGR A;  1WMO A;  3CNM A;  3LT8 A;  4BTX A;  3PZW A;  1QVF 2;  3DGO A;  3UNL A;  1NWW A;  3OX9 A;  4IT7 A;  4MMZ B;  1O7H B;  1IDP A;  1W4N A;  4O3V A;  1K28 A;  1IU7 A;  3X3Y A;  4ZM8 A;  2V1L A;  5IEO A;  5IF6 A;  3S27 A;  1VQ6 3;  4RZM A;  4WP5 A;  5BXQ A;  3DMC A;  3SVA A;  1HKX A;  3SXX A;  2GEY A;  1YI2 3;  5D83 A;  2XH9 A;  1ASK A;  3X3X A;  1VQ8 3;  2D1W A;  1JKG B;  3PGB A;  3CCL 3;  3FLJ A;  3G71 3;  1IVV A;  3WOD G;  5JPU A;  1EKM A;  3JUQ A;  5TGN A;  2W04 A;  3KKG A;  1EG9 B;  1A67 A;  3SX1 A;  1IQY A;  2IUK A;  2SBL A;  1J2B A;  5IEP A;  2OOV A;  1PFP A;  3I0Y A;  3CCM 3;  3N54 B;  3CCQ 3;  2Z7A A;  4CDL A;  2GU1 A;  3MKI A;  3Q1C A;  1GD3 A;  3BB9 A;  5KP1 A;  3BNB A;  2CG1 A;  1LVN A;  1Y4K A;  3CPW 2;  1OPY A;  1GY5 A;  4H3U A;  4O8S A;  1VQL 3;  3O8Y A;  1QAF A;  1GY6 A;  4N6O B;  1W6Y A;  3CCV 3;  3FKA A;  1K9M 4;  1Q42 A;  3F7X A;  4MMX B;  5JPP A;  2W2C A;  2Z6B A;  3F7S A;  1TFK A;  2CFW A;  1WTH A;  4XBT A;  5DRE A;  3LML A;  1G96 A;  4XM4 A;  5AIF A;  4N6T A;  4JF8 A;  2INX A;  1D6U A;  1BUQ A;  2STD A;  1W6G A;  4HM4 B;  2JQ5 A;  2BT3 A;  3PCR A;  3GZR A;  3NV0 B;  1M1K 4;  1IV7 A;  1FA3 A;  3LOY A;  3AMO A;  1Q40 A;  5ELJ A;  1Q7Y 4;  3WDG B;  2D42 A;  2O9U X;  1CQS A;  3IMA B;  4TX4 A;  3WA2 X;  1JV2 B;  5AIG A;  1VQO 3;  3S28 A;  1A90 A;  2K0M A;  1UUV B;  1WQL B;  1TP6 A;  2E2V A;  1OF5 A;  2GXF A;  1KSI A;  4K61 A;  2CFL A;  1A2K A;  1DMQ A;  2CFG A;  3NQZ A;  3RGA A;  3FF2 A;  5AEW B;  3KSP A;  3SOA A;  6STD A;  1WMP A;  5LC6 A;  4RNY A;  3HI7 A;  2BMO B;  3PS8 A;  3OWU A;  3T0U A;  2KCD A;  1OGX A;  2F86 B;  1GYB A;  2Y74 A;  4K1U A;  1U8C B;  1MOL A;  1UI7 A;  1FGR A;  2CWU A;  2XF3 A;  3ECF A;  5AI1 A;  5KP3 A;  4OVM A;  3CCS 3;  3X40 A;  2I9W A;  4XDV A;  5IW9 A;  4WHA A;  2WOF A;  1W00 A;  5D81 A;  5IER A;  1RRH A;  2P0M A;  4BTW A;  2WGO A;  1JJ2 2;  3CME 3;  2W0Q A;  4OK0 A;  3D3L A;  2QA4 3;  3GRD A;  1VQK 3;  4KFD A;  3CXC 2;  2YFL B;  3AMO B;  1Q40 B;  3I56 3;  1Q81 4;  3STD A;  1IQX A;  5IG3 A;  1F8N A;  3UL6 A;  3NQY A;  3GWR A;  4U13 A;  3KN4 A;  4BTY A;  1VQM 3;  2IMJ A;  2XSH B;  4HM1 B;  4WWU C;  4HBR A;  5EEO A;  4N6V 0;  1DVC A;  3FH1 A;  3EN8 A;  2QGU A;  1OF5 B;  2CG0 A;  3DUK A;  3WOE B;  2L4V A;  4KFE A;  3H51 A;  5IG4 A;  1N8R 4;  3WOF B;  1VQ7 3;  1E97 A;  3F9S A;  1W2B 2;  2KXG A;  3V92 A;  2IUJ A;  3F40 A;  2P05 A;  2CFK A;  4G1M B;  3B7C A;  1QVG 2;  2KRT A;  1A2V A;  1NDO B;  4FCZ A;  1STF I;  1Z1S A;  4XB5 A;  3L0R A;  3RDE A;  1W01 A;  4FMA A;  5FW5 A;  2BMQ B;  1KC8 4;  5ELU A;  3EF8 A;  1HU9 A;  1O7W B;  2FGT A;  2GU3 A;  3NV0 A;  3EC9 A;  4HM7 B;  3TDG A;  4HZB B;  4X2O A;  3OWS A;  1FGT A;  3N9H A;  4HM6 B;  5CLK A;  2E2U A;  1Q82 4;  3OWY A;  4KFF A;  3PYJ A;  3EQQ B;  3NBB A;  3DGM A;  2HML B;  3SOY A;  4K1V A;  3I55 3;  4FMB A;  4WYK A;  1IVX A;  1QAL A;  1E3V A;  1YJN 3;  2B24 B;  4N6L A;  3S29 A;  1UI8 A;  3MYT A;  3M8C A;  1YJW 3;  1O7P B;  3LT9 A;  5AYR B;  1TIJ A;  2HMN B;  1OGZ A;  2CKF B;  3K5T A;  5EQL A;  1AVL A;  1S72 3;  1GS3 A;  4XDW A;  3J7Y d;  4HKV B;  2C11 A;  3NBR A;  1O7M B;  1OAC A;  4RBN A;  1QMA A;  2MF7 A;  2LYX A;  2YX9 A;  3S5C A;  3Q90 A;  2MC8 A;  4AKY A;  2ML6 A;  1EA2 A;  2HMK B;  3EJV A;  3F8H A;  4HJL B;  3JUN A;  1STD A;  1N5H A;  3SED A;  1YHQ 3;  3K0Z A;  3DY5 A;  3BND A;  2LQV A;  1SPU A;  4J9A A;  1JN5 A;  4LSO A;  1PU4 A;  4KZ1 A;  1CEW I;  1LOX A;  1NO3 A;  4N6M A;  1OH0 A;  2WO0 A;  3FSD A;  5D82 A;  5AYS C;  3S67 A;  3EHC A;  5KP4 A;  3ER7 A;  1OCV A;  2CWT A;  3EN1 B;  3X41 A;  1O7G B;  4O2H A;  2CH9 A;  2HMJ B;  1M9G A;  1SII A;  4STD A;  4EBG A;  3FGY A;  1O7N B;  4WFO A;  2CHC A;  2WOH A;  2YFI B;  3KSE D;  3DGL A;  2E2T A;  3B4P A;  3EE1 A;  5FGO A;  4FCM A;  2UX0 A;  3UL5 A;  4WYK B;  2BHM A;  3VF1 A;  3G6E 3;  1IQ8 A;  2OQE C;  3EX9 A;  1VQN 3;  1T5Y A;  4EC6 A;  2ZDJ A;  4AEQ A;  2ML5 A;  3EBT A;  1FGQ A;  3GZY B;  3QRD A;  4N3V A;  2FXT A;  2C10 A;  5LC7 A;  3IJE B;  1GY7 A;  1W02 A;  2CW9 A;  2R4I A;  2QEX 3;  1V74 A;  3NM7 A;  3NUV A;  1IT7 A;  4R80 A;  3V98 A;  4CCV A;  5DRV A;  3PCS A;  1ULI B;  1W5Z A;  1UW1 A;  2CIU A;  4FR9 A;  3G0K A;  3SLU A;  3MWZ A;  3V99 A;  3NHX A;  3OXA A;  1NB3 I;  2OWP A;  4K90 B;  1U5O A;  2P0X A;  4R1K A;  1JN5 B;  1TUH A;  3BNE A;  5CF2 A;  1VQP 3;  3A76 A;  1VQ5 3;  1AR0 A;  4FMC A;  2YFJ B;  3UJM A;  5IG5 A;  3WA3 A;  4FCJ A;  1K73 4;  2CFD A;  2BNG A;  4PEJ A;  5JBS A;  4LGQ A;  1KD1 4;  1Q86 4;  2OTJ 3;  3KII A;  3G4S 3;  3LTA A;  3FF0 A;  3GAX A;  1VQ9 3;  2W56 A;  3DGN A;  3KZT A;  4L8O A;  3IPT A;  1YGE A;  2W03 A;  3HZP A;  4NHF A;  2OTL 3;  4EYC A;  5STD A;  3CC4 3;  3CC2 3;  1E3R A;  4I4K A;  2RGQ A;  3DM8 A;  4L8P A;  1IK3 A;  1FGO A;  1QAK A;  3LH4 A;  4MJD A;  1UUW B;  4R9K A;  2XRX B;  3N8B A;  5IEN A;  4KVH A;  3B4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...