4HYZA

Crystal structure of a duf3887 family protein (rumgna_01855) from ruminococcus gnavus atcc 29149 at 2.25 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
GEILKELPEGFDKETVRKQAMEDIEIAQSKDYESWKSRFTKDLQSSLTEESYDSYLKILEKQGEFKEFGKCTYLGQIKDNKKYGGVIIVVKYEEGNVNYSLAYDEDMNLVSFTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (RUMGNA_01855) from Ruminococcus gnavus ATCC 29149 at 2.25 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
total genus 33
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13026 DUF3887 Protein of unknown function (DUF3887)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.590 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hyzA00
2MC8A 4HYZA
chains in the Genus database with same CATH superfamily
1IQ8A 2HMOB 1DYUA 1IT8A 1YIJ3 1K734 2L4VA 3FKAA 1K41A 3EBTA 3NBRA 4TX4A 3WA2X 3LTBA 1U5OA 3AGOA 1RN4A 3FF0A 3JVCA 2D42A 1BUJA 2CHCA 2HOHA 1UW1A 1UI7A 3D3LA 3PYJA 3O8YA 2RSXA 2RFRA 3N54B 2K3DA 4WYKB 3CD63 1O7MB 4KFDA 4X2HA 5EEOA 2RCDA 1IVVA 2W9QA 3MG3A 3OWYA 2OOVA 3BB9A 3CCM3 3U1WA 1VQ93 3G8ZA 1ROAA 3WOFB 3IMAB 3LT9A 1TRPA 1Q864 3SX1A 1Q824 3KSPA 1I0XA 2HMNB 1NNVA 1G96A 3GWRA 1R4CA 3CPOA 3NM7A 3G4S3 1W7CA 4R80A 1VQ83 3NQZA 1QALA 5BIRA 5HOHA 1JJ22 1RLSA 4AKZA 1AY7A 2OQEC 5AI1A 4LZIA 3QRDA 3WHOA 3AMOB 1CYUA 1W2ZA 1B2MA 1LOVA 3RDEA 1Q814 3V98A 5EQLA 5M1AA 1V58A 2Z77A 1ZS7A 1QJGA 1T2IA 3BU4A 4NHFA 1YJ93 1CQSA 3KZTA 1V57A 2GU1A 1RN1A 1W6GA 1I70A 1RMSA 1PU4A 1WMPA 2QIYA 4MMXB 3B4PA 1IVWA 2YFLB 3FG4A 3LYGA 1LXEA 2E2TA 2OOVC 3CMA3 2XF3A 1UUGB 1AVKA 4Q53A 3LXUX 3I553 3KFQC 1SIHA 4CPKA 4HM0B 3HIGA 4CCVA 1OPYA 3K9MC 2Z76A 1LQGC 4CJNA 1W6CA 3N8BA 2UX0A 3UJMA 5A0OB 1IQYA 2J8XB 2XSOB 5GSPA 3EB8A 4XBXA 2BMRB 4LEHA 3F40A 4IIAA 1JBRA 3S67A 4L8PA 1HKXA 1JKGA 1BGSA 3L0RA 2FGTA 1IVXA 1GD4A 3CC23 1RTUA 3CPW2 4HM8B 3LT8A 2Q07A 1FW7A 5LC6A 3S28A 5AEUB 4KFEA 3B8LA 1UDII 1ISKA 1VQN3 1E3VA 2KCDA 2CWVA 1JB5A 3KIIA 3CU3A 4MMYB 4N6TA 4XB5A 3X40A 1AQZA 3B4OA 4BTYA 4GL6A 1IV7A 1SJWA 1OH0A 2UGIA 3PXMA 2W9PA 3SVAA 1A2PA 4HM6B 3LTAA 1WMNA 2JDIH 4N6LA 4WYKA 2Z7AA 1SPUA 2WOFA 3S29A 5JPUA 1NWWA 1BNRA 3QK9A 1W02A 3OXAA 4AKYA 3F7XA 4OK0A 1US1A 2P38A 5CXOA 3Q1CA 3Q90A 4KT3B 1YGEA 1O7NB 2L1SA 4HZBB 1JV2B 3H3HA 1UCIA 3SOYA 1UCKA 2KAAA 1OUNA 1FA3A 4MMZB 5AIFA 2IMJA 2F5MA 4NPBA 2ZDJA 3F7SA 3DMCA 3MSOA 3DGNA 4O02B 3SOAA 1DMQA 1QAKA 1VZZA 2BNGA 3K5TA 4BL3A 1Q42A 4ZM8A 1KD14 5D82A 2IUKA 3FSDA 3CME3 1TIJA 2YX9A 4R1KA 3DUKA 1VQO3 2CKFB 1BRNL 4GHOA 1Q7HA 4R9LA 1BUQA 4J5GA 1BRIA 1OGXA 4STDA 1LOYA 3MG2A 1YGWA 3PCSA 5CLKA 3V92A 3CCS3 1GMQA 1ZX2A 3SXXA 1EKMA 1UCLA 3BNDA 3CCU3 5RNTA 3AHWA 2WGOA 1DVDA 1B2SA 3V99A 3GRDA 6STDA 2CFWA 4KZ1A 4O8SA 3NV0A 5IEOA 1LOXA 2K54A 1TTOA 1MWUA 1R4YA 1WMOA 2I9WA 1BAOA 2OQEA 3X41A 1JKGB 4FCJA 1Q7Y4 1BSCA 1HYFA 4HOHA 5IG0A 3ZFZA 2C11A 3G6E3 1G02A 4I5QA 4IPBA 2F98A 1JNQA 2FNQA 1GYBA 3DGOA 4L8OA 5BXQA 1VQQA 2HMKB 1ZGXA 1CH0A 1I2EA 2KRTA 3F14A 6GSPA 2FXTA 3ROBA 4FMDA 3J7Yd 3GAXA 4L7KA 3LZAA 2IYJA 4FCZA 1BANA 4JF8A 3ER7A 8CHOA 3EHCA 3NQYA 1RJOA 3JUNA 2OWPA 2XGLA 1GMRA 1W2B2 1OCVA 1I0VA 1X1XA 2QA43 1BSAA 1BOXA 3DXOA 4IT7A 5IG4A 1BNGA 2C4BA 3B7CA 2RBIA 1I2GA 2IA7A 4XDWA 1V74A 2QGUA 4RNTA 1W5ZA 4HM2B 5AEWB 2LYXA 2BO9B 1X1YA 2KF4A 1MGRA 3Q3FA 2YFJB 5G1KA 1ZO2A 2V1LA 4JRFA 2HMMB 1ASKA 3AGNA 1N9EA 3BLZA 2XEPA 4N6NB 1I3IA 1MWTA 1Q9EA 1TUHA 2SBLA 2HMJB 4QWTA 1YI23 4EBGA 1KWIA 1PFPA 2ZHXB 3UL5A 1GOUA 3JUMA 5KP3A 3FF2A 5I97A 1RKYA 1E3RA 4BTWA 2LQVA 3DGLA 3FZWA 4K1VA 3F8XA 1IQXA 3H51A 4HAAA 1BRKA 1UCJA 2WO0A 3NBJA 4HM5B 3D79A 4WWUC 5ELUA 1N8R4 1VQ43 1OHOA 3T8NA 5IG3A 2INXA 2XH9A 3NX0A 2XRXB 2B1XB 4X2OA 1RGLA 1ULJB 1NB5I 4WFOA 1BIRA 3T8UA 4AEQA 1I8VA 1PYLA 2AADA 2WGQA 5IEPA 1W6YA 3F9SA 3NV0B 3STDA 2H0IA 1W01A 1VQP3 3D4AA 5FGOA 2RNTA 5TGNA 2E2VA 3MYTA 1VQL3 1MWRA 1GD3A 1BSDA 2Z6BA 1JB4A 2GBXB 3JUQA 4RNYA 4EV2A 5CK6A 3OV4A 3OWSA 1IU7A 1UI8A 4FMBA 2CG1A 3G713 1BNSA 1BNJA 4WHAA 4EW5A 3NHXA 1BU4A 3EC9A 2C10A 1BRSA 8RNTA 1O7HB 3M8CA 1W00A 3KKGA 3X3ZA 4K61A 1K8A4 3CCR3 1DE3A 3FGYA 1A90A 2XGNA 1FGOA 1Q40A 2F86B 2P0XA 2R41A 2ZA4A 3NBBA 4HM7B 1M9GA 1LNHA 1RSNA 4XBYA 3WODG 1N9JA 1E97A 1RDSA 2A15A 3E99A 1MGWA 1RGFA 5IG5A 1GY5A 2BHMA 2CFLA 2P05A 3LMLA 3A76A 1DETA 1QVG2 1M1XB 4FMAA 2CK3H 1FGTA 3HZPA 3KE7A 3UNLA 1YHQ3 3FG1A 3CCV3 1B2XA 4LSOA 3CCL3 1BNFA 4U13A 2BMQB 2K0MA 7RNTA 4R9KA 1B2ZA 3GZXB 3DGYA 3X3YA 1N5HA 5JPPA 2Y74A 1RGHA 4EC6A 3HI7A 3FG3A 1BVIA 3CCE3 5DREA 1A67A 3EJVA 1HZ1A 1X1WA 2KF6A 4HJLB 1YVBI 4RNZA 1OHSA 3EQQB 4OUQA 5D83A 2H0HA 4GB5A 2ML5A 1N5PA 4EXRA 3SYUA 1I3FA 1S723 1LVNA 3CCJ3 3X3XA 2MF7A 1F8NA 4LYLB 2D1WA 1BRGA 1LRAA 3OX9A 1OF5A 3BNCA 5AYRB 1SIIA 2OTJ3 4J9AA 4RBNA 2AAEA 1VQ53 3T0UA 4KVHA 4FCMA 3EX9A 4J8TA 3CCQ3 3N9HA 1K28A 3S5CA 1FZUA 1GOYA 1NB3I 4HYZA 4BU4A 2CFDA 1BRHA 1X1UA 3OW22 1AVLA 4J5KA 7STDA 4HZ9B 1IK3A 2WOHA 3AHSA 2CFGA 5M19A 1OGZA 3BNBA 3ECFA 3DH2A 2P09A 5STDA 2GEXA 1VQ73 1A2KA 1T5YA 2O9UX 2BMOB 3PCRA 1VQ63 3HIIA 1FGRA 1RGAA 2CIUA 2GEYA 3IJEB 3RNTA 2W2CA 1RGGA 2STDA 1JZDA 1Q40B 5G2GA 3VSYA 1YVSA 3MPHA 1TP6A 2BIRA 2XFTA 1GMPA 2UUGC 3D5IA 1K9M4 1M1K4 1BSBA 3HOHA 5IERA 1ROVA 7GSPA 4XBTA 1RNBA 1T3BA 2W56B 2M7OA 3PZWA 1S5AA 1GY7A 1YJW3 4BTXA 1BNIA 1IT7A 1MOLA 5ELJA 1PY3A 4LMIA 1SQWA 4HM1B 4ORLA 1L5GB 2O3OA 1QVF2 1QAFA 3G16A 3GZBA 3LTDA 1STDA 3TDGA 3KCHA 1O7GB 3WR2A 2CG0A 3FLJA 3K63A 1FUWA 3EN8A 2W0QA 1IDPA 1STFI 1TFOA 4N6OB 1JRQA 2E2UA 2B24B 2RGQA 1KSIA 3GSPA 3I0YA 3KSED 4XDVA 4BIRA 1RHLA 3BIRA 4H61A 1YJN3 1UUVB 3SEDA 3CC43 1RCLA 1OF5B 4MEIA 2XR8B 4XM4A 5KP1A 1VQM3 4HVNA 1RNTA 1UGHI 3DM8A 5G1LA 5LC7A 3OWUA 1BNEA 4EV5A 6RNTA 4GSPA 1TFKA 3WOEB 1DMMA 4MJDA 1IYYA 1JN5B 4N3VA 3PS8A 1TRQA 3NXJA 2Y73A 5AYSC 4CDLA 4EYCA 3JUOA 2CX1A 4K1UA 1RRLA 5KP4A 1D6UA 2BU4A 3S27A 1BRJA 1ULIB 3I563 1SARA 3IPTA 1B3SA 1M904 3PGBA 5JBSA 3F8HA 3LH4A 1RGKA 1UGIA 1KC84 1YNVX 1GS3A 3K7CA 5AIGA 1VQK3 3MG1A 1CEWI 1Z1SA 1BSEA 3ALAA 3UL6A 2CW9A 3FH1A 1W4NA 3RGRA 1A2VA 1LOWA 1NDOB 1TJDA 3A5EA 4I4KA 1D6ZA 3SLUA 1DVCA 5CF2A 3U97A 1JZOA 1EQKA 1OACA 2KXGA 1WTHA 1GOVA 2CH9A 2GXFA 1MWSA 4K90B 4OVMA 3CXC2 1EG9B 2GSPA 3LOYA 2W56A 3CNXA 3ZG0A 3DY5A 1CYVA 1GSPA 4DKIA 1B21A 3EE1A 2ML6A 3K0ZA 1UUWB 2XFSA 3WDGB 1FUTA 1HU9A 1TU5A 2IUJA 3MWZA 1FUSA 2JQ5A 4ILFA 3EF8A 1B20A 5HGRA 5IF6A 1IV9A 3DGMA 3URPA 2W6JH 1DMNA 1O7WB 1WNHA 2CWUA 4WP5A 2CC3A 3CNMA 1B2UA 1NO3A 5AIIA 4RZMA 4N6UA 4LGQA 3KN4A 4HM3B 2MC8A 4H3UA 4R4KA 4KFFA 1FGQA 2CX0A 1MNLA 2OCTA 2IY2A 4HM4B 3WA3A 1FYSA 3EBYA 3X42A 1C54A 3GZYB 1JB2A 4FMCA 4HKVB 1EA2A 2PZVA 1YIT3 1EUIC 4FR9A 3G0KA 3NM2A 5EVHA 1JBTA 2CFKA 4N6V0 4PEJA 2R4IA 1LQMB 1I2FA 5D81A 3RGAA 2GBWB 5M18A 3FCSB 1C7HA 1EEJA 1N8QA 3DZLA 4O3VA 1G0TA 3UB1A 5CF1A 2KF3A 3D9RA 3Q2PA 1AV4A 1WQLB 1AR0A 2H0GA 2GU3A 4O2HA 1JN5A 1FGMA 1RCKA 1IVUA 2BT3A 1NU3A 1T2HA 2F5WA 1QMAA 2W04A 3MKIA 1D6YA 2YFIB 9RNTA 1OHPA 3AMOA 4N6MA 1JBSA 2P0MA 3GZRA 2SARA 4BL2A 1NJI4 3HK4A 5BVBA 3VGNA 5DRVA 5FW5A 2F99A 1GY6A 3JUPA 1RGCA 4NREA 3CC73 2F56A 3VF1A 3EN1B 3LTCA 3WMDA 3NUVA 5AIHA 3MHEA 5IENA 3BNEA 2F4YA 5BU4A 2XSHB 5IW9A 2CWTA 1U8CB 1J2BA 3ZG5A 1RN7A 1RRHA 1B27A 2HMLB 1Y4KA 2OTL3 4G1MB 1RGEA 1KQS2 2PNCA 3HX8A 4HBRA 2ZL8A 2KF5A 1LNIA 2W03A 2QEX3 3D5GA 1O7PB
chains in the Genus database with same CATH topology
1IQ8A 2HMOB 1DYUA 1IT8A 1YIJ3 1K734 2L4VA 3FKAA 1K41A 3EBTA 3NBRA 4TX4A 3WA2X 3LTBA 1U5OA 3FF0A 3JVCA 2D42A 2CHCA 1UW1A 1UI7A 3D3LA 3PYJA 3O8YA 2RSXA 2RFRA 3N54B 4WYKB 3CD63 1O7MB 4KFDA 4X2HA 5EEOA 2RCDA 1IVVA 2W9QA 3MG3A 3OWYA 2OOVA 3BB9A 3CCM3 3U1WA 1VQ93 3G8ZA 1ROAA 3WOFB 3IMAB 3LT9A 1Q864 3SX1A 1Q824 3KSPA 2HMNB 1G96A 3GWRA 1R4CA 3CPOA 3NM7A 3G4S3 1W7CA 4R80A 1VQ83 3NQZA 1QALA 1JJ22 4AKZA 2OQEC 5AI1A 4LZIA 3QRDA 3AMOB 1W2ZA 3RDEA 1Q814 3V98A 5EQLA 2Z77A 1QJGA 4NHFA 1YJ93 1CQSA 3KZTA 2GU1A 1W6GA 1PU4A 1WMPA 2QIYA 4MMXB 3B4PA 1IVWA 2YFLB 3FG4A 3LYGA 1LXEA 2E2TA 2OOVC 3CMA3 2XF3A 1AVKA 4Q53A 3LXUX 3I553 3KFQC 1SIHA 4HM0B 3HIGA 4CCVA 1OPYA 3K9MC 2Z76A 1W6CA 3N8BA 2UX0A 3UJMA 5A0OB 1IQYA 2XSOB 3EB8A 4XBXA 2BMRB 4LEHA 3F40A 4IIAA 3S67A 4L8PA 1HKXA 1JKGA 3CC23 3L0RA 2FGTA 1IVXA 1GD4A 3CPW2 4HM8B 3LT8A 2Q07A 5LC6A 3S28A 5AEUB 4KFEA 3B8LA 1ISKA 1VQN3 1E3VA 2KCDA 2CWVA 1JB5A 3KIIA 3CU3A 4MMYB 4N6TA 4XB5A 3X40A 3B4OA 4BTYA 4GL6A 1IV7A 1SJWA 1OH0A 3PXMA 3SVAA 2W9PA 4HM6B 3LTAA 1WMNA 2JDIH 4N6LA 4WYKA 2Z7AA 1SPUA 2WOFA 3S29A 5JPUA 1NWWA 3QK9A 1W02A 3OXAA 4AKYA 3F7XA 4OK0A 1US1A 2P38A 5CXOA 3Q1CA 3Q90A 1YGEA 1O7NB 4HZBB 1JV2B 3H3HA 3SOYA 1OUNA 1FA3A 4MMZB 5AIFA 2IMJA 2ZDJA 3F7SA 3DMCA 3MSOA 3DGNA 4O02B 3SOAA 1DMQA 1QAKA 1VZZA 2BNGA 3K5TA 4ZM8A 1Q42A 1KD14 5D82A 2IUKA 3FSDA 3CME3 1TIJA 2YX9A 4R1KA 3DUKA 1VQO3 2CKFB 1BUQA 4R9LA 1OGXA 4STDA 3MG2A 3PCSA 5CLKA 3V92A 3CCS3 1ZX2A 3SXXA 1EKMA 3BNDA 3CCU3 2WGOA 1DVDA 3V99A 3GRDA 6STDA 2CFWA 4KZ1A 4O8SA 3NV0A 5IEOA 1LOXA 2K54A 1WMOA 2I9WA 2OQEA 3X41A 1JKGB 4FCJA 1Q7Y4 5IG0A 2C11A 3G6E3 4IPBA 2F98A 1JNQA 2FNQA 1GYBA 3DGOA 4L8OA 5BXQA 2HMKB 2KRTA 3F14A 2FXTA 3ROBA 4FMDA 3J7Yd 3GAXA 4L7KA 3LZAA 4FCZA 4JF8A 3ER7A 8CHOA 3EHCA 3NQYA 1RJOA 3JUNA 2OWPA 2XGLA 1W2B2 1OCVA 2QA43 5IG4A 3DXOA 4IT7A 3B7CA 2IA7A 4XDWA 1V74A 2QGUA 1W5ZA 4HM2B 5AEWB 2LYXA 2BO9B 2YFJB 1ZO2A 2V1LA 4JRFA 2HMMB 1ASKA 1N9EA 3BLZA 2XEPA 4N6NB 1TUHA 2SBLA 2HMJB 4QWTA 1YI23 4EBGA 1KWIA 1PFPA 3UL5A 3JUMA 5KP3A 3FF2A 5I97A 1RKYA 1E3RA 4BTWA 2LQVA 3DGLA 3FZWA 4K1VA 3F8XA 1IQXA 3H51A 2WO0A 4WWUC 3NBJA 4HM5B 5ELUA 1VQ43 1N8R4 1OHOA 3T8NA 5IG3A 2INXA 2XH9A 3NX0A 2XRXB 2B1XB 4X2OA 1ULJB 1NB5I 4WFOA 3T8UA 4AEQA 5IEPA 2WGQA 1W6YA 3F9SA 3NV0B 3STDA 1W01A 1VQP3 5FGOA 5TGNA 2E2VA 3MYTA 1VQL3 1GD3A 2Z6BA 1JB4A 2GBXB 3JUQA 4RNYA 4EV2A 5CK6A 3OV4A 3OWSA 1IU7A 1UI8A 4FMBA 2CG1A 3G713 4WHAA 3NHXA 3EC9A 2C10A 1O7HB 3M8CA 1W00A 3KKGA 3X3ZA 4K61A 3CCR3 3FGYA 1A90A 2XGNA 1FGOA 1Q40A 2F86B 2P0XA 3NBBA 4HM7B 1M9GA 1LNHA 4XBYA 5IG5A 3WODG 1N9JA 1E97A 2A15A 3E99A 1CYUA 1GY5A 2BHMA 2CFLA 2P05A 3LMLA 3A76A 1QVG2 1M1XB 4FMAA 2CK3H 1FGTA 3HZPA 3KE7A 3UNLA 1YHQ3 3FG1A 3CCV3 4LSOA 3CCL3 4U13A 2BMQB 2K0MA 4R9KA 3GZXB 3X3YA 1N5HA 5JPPA 2Y74A 4EC6A 3HI7A 3FG3A 3CCE3 1A67A 5DREA 3EJVA 4HJLB 4RNZA 1YVBI 1OHSA 3EQQB 4OUQA 5D83A 4GB5A 4EXRA 2ML5A 1N5PA 1S723 1LVNA 3CCJ3 3X3XA 2MF7A 1F8NA 2D1WA 3OX9A 1OF5A 3BNCA 5AYRB 1SIIA 2OTJ3 4J9AA 4RBNA 1VQ53 3T0UA 4KVHA 4FCMA 3EX9A 4J8TA 3CCQ3 3N9HA 1K28A 3S5CA 4HYZA 1NB3I 2CFDA 3OW22 1AVLA 7STDA 4HZ9B 1IK3A 2WOHA 2CFGA 1OGZA 3BNBA 3ECFA 2P09A 5STDA 2GEXA 1VQ73 1A2KA 1T5YA 2O9UX 2BMOB 3PCRA 1VQ63 3HIIA 1FGRA 2CIUA 2GEYA 3IJEB 2W2CA 2STDA 1Q40B 5G2GA 3VSYA 3MPHA 1TP6A 2XFTA 1K9M4 1M1K4 5IERA 1ROVA 4XBTA 2W56B 2M7OA 3PZWA 1S5AA 1GY7A 1YJW3 4BTXA 1IT7A 1MOLA 5ELJA 4LMIA 4ORLA 1SQWA 4HM1B 1L5GB 2O3OA 1QAFA 3G16A 3GZBA 3LTDA 1STDA 3TDGA 1O7GB 2CG0A 3FLJA 3K63A 1FUWA 3EN8A 2W0QA 1IDPA 1STFI 1TFOA 4N6OB 1JRQA 2E2UA 2B24B 2RGQA 1KSIA 3I0YA 3KSED 4XDVA 1K8A4 1QVF2 4H61A 1YJN3 1UUVB 3SEDA 3CC43 1OF5B 4MEIA 2XR8B 4XM4A 5KP1A 1VQM3 4HVNA 3DM8A 5LC7A 3OWUA 4EV5A 1TFKA 3WOEB 1DMMA 4MJDA 1JN5B 4N3VA 3PS8A 3NXJA 2Y73A 5AYSC 4CDLA 4EYCA 3JUOA 4K1UA 1RRLA 5KP4A 1D6UA 3S27A 1ULIB 3I563 3IPTA 1M904 3PGBA 5JBSA 3F8HA 3LH4A 1KC84 1GS3A 3K7CA 5AIGA 1VQK3 3MG1A 1CEWI 1Z1SA 3ALAA 3UL6A 2CW9A 3FH1A 1W4NA 3RGRA 1A2VA 4I4KA 1NDOB 1D6ZA 3SLUA 1DVCA 5CF2A 3U97A 1EQKA 1OACA 2KXGA 1WTHA 2CH9A 2GXFA 4K90B 4OVMA 3CXC2 1EG9B 3LOYA 2W56A 3CNXA 3DY5A 1CYVA 3EE1A 2ML6A 3K0ZA 1UUWB 2XFSA 3WDGB 1HU9A 1TU5A 2IUJA 3MWZA 2JQ5A 3EF8A 5HGRA 5IF6A 1IV9A 3DGMA 2W6JH 1DMNA 1O7WB 1WNHA 2CWUA 4WP5A 2CC3A 3CNMA 1NO3A 5AIIA 4RZMA 4N6UA 4LGQA 3KN4A 4HM3B 2MC8A 4H3UA 4R4KA 4KFFA 1FGQA 1MNLA 2OCTA 4HM4B 3WA3A 3EBYA 3X42A 3GZYB 1JB2A 4FMCA 4HKVB 1EA2A 2PZVA 1YIT3 4FR9A 3G0KA 3NM2A 5EVHA 2CFKA 4N6V0 4PEJA 2R4IA 5D81A 3RGAA 2GBWB 3FCSB 1C7HA 1N8QA 3DZLA 4O3VA 3UB1A 5CF1A 3D9RA 3Q2PA 1AV4A 1WQLB 1AR0A 2GU3A 4O2HA 1JN5A 1FGMA 1IVUA 2BT3A 1NU3A 1QMAA 2W04A 3MKIA 1D6YA 2YFIB 1OHPA 3AMOA 4N6MA 2P0MA 3GZRA 1NJI4 3HK4A 5BVBA 3VGNA 5DRVA 5FW5A 2F99A 1GY6A 3JUPA 4NREA 3CC73 3VF1A 3EN1B 3LTCA 3WMDA 3NUVA 5AIHA 3MHEA 5IENA 3BNEA 1J2BA 2XSHB 5IW9A 2CWTA 1U8CB 1RN7A 1RRHA 2HMLB 1Y4KA 2OTL3 4G1MB 1KQS2 2PNCA 3HX8A 4HBRA 2ZL8A 2W03A 2QEX3 1O7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC8 A;  4HYZ A; 
#chains in the Genus database with same CATH topology
 1IQ8 A;  2HMO B;  1DYU A;  1IT8 A;  1YIJ 3;  1K73 4;  2L4V A;  3FKA A;  1K41 A;  3EBT A;  3NBR A;  4TX4 A;  3WA2 X;  3LTB A;  1U5O A;  3AGO A;  1RN4 A;  3FF0 A;  3JVC A;  2D42 A;  1BUJ A;  2CHC A;  2HOH A;  1UW1 A;  1UI7 A;  3D3L A;  3PYJ A;  3O8Y A;  2RSX A;  2RFR A;  3N54 B;  2K3D A;  4WYK B;  3CD6 3;  1O7M B;  4KFD A;  4X2H A;  5EEO A;  2RCD A;  1IVV A;  2W9Q A;  3MG3 A;  3OWY A;  2OOV A;  3BB9 A;  3CCM 3;  3U1W A;  1VQ9 3;  3G8Z A;  1ROA A;  3WOF B;  3IMA B;  3LT9 A;  1TRP A;  1Q86 4;  3SX1 A;  1Q82 4;  3KSP A;  1I0X A;  2HMN B;  1NNV A;  1G96 A;  3GWR A;  1R4C A;  3CPO A;  3NM7 A;  3G4S 3;  1W7C A;  4R80 A;  1VQ8 3;  3NQZ A;  1QAL A;  5BIR A;  5HOH A;  1JJ2 2;  1RLS A;  4AKZ A;  1AY7 A;  2OQE C;  5AI1 A;  4LZI A;  3QRD A;  3WHO A;  3AMO B;  1CYU A;  1W2Z A;  1B2M A;  1LOV A;  3RDE A;  1Q81 4;  3V98 A;  5EQL A;  5M1A A;  1V58 A;  2Z77 A;  1ZS7 A;  1QJG A;  1T2I A;  3BU4 A;  4NHF A;  1YJ9 3;  1CQS A;  3KZT A;  1V57 A;  2GU1 A;  1RN1 A;  1W6G A;  1I70 A;  1RMS A;  1PU4 A;  1WMP A;  2QIY A;  4MMX B;  3B4P A;  1IVW A;  2YFL B;  3FG4 A;  3LYG A;  1LXE A;  2E2T A;  2OOV C;  3CMA 3;  2XF3 A;  1UUG B;  1AVK A;  4Q53 A;  3LXU X;  3I55 3;  3KFQ C;  1SIH A;  4CPK A;  4HM0 B;  3HIG A;  4CCV A;  1OPY A;  3K9M C;  2Z76 A;  1LQG C;  4CJN A;  1W6C A;  3N8B A;  2UX0 A;  3UJM A;  5A0O B;  1IQY A;  2J8X B;  2XSO B;  5GSP A;  3EB8 A;  4XBX A;  2BMR B;  4LEH A;  3F40 A;  4IIA A;  1JBR A;  3S67 A;  4L8P A;  1HKX A;  1JKG A;  1BGS A;  3L0R A;  2FGT A;  1IVX A;  1GD4 A;  3CC2 3;  1RTU A;  3CPW 2;  4HM8 B;  3LT8 A;  2Q07 A;  1FW7 A;  5LC6 A;  3S28 A;  5AEU B;  4KFE A;  3B8L A;  1UDI I;  1ISK A;  1VQN 3;  1E3V A;  2KCD A;  2CWV A;  1JB5 A;  3KII A;  3CU3 A;  4MMY B;  4N6T A;  4XB5 A;  3X40 A;  1AQZ A;  3B4O A;  4BTY A;  4GL6 A;  1IV7 A;  1SJW A;  1OH0 A;  2UGI A;  3PXM A;  2W9P A;  3SVA A;  1A2P A;  4HM6 B;  3LTA A;  1WMN A;  2JDI H;  4N6L A;  4WYK A;  2Z7A A;  1SPU A;  2WOF A;  3S29 A;  5JPU A;  1NWW A;  1BNR A;  3QK9 A;  1W02 A;  3OXA A;  4AKY A;  3F7X A;  4OK0 A;  1US1 A;  2P38 A;  5CXO A;  3Q1C A;  3Q90 A;  4KT3 B;  1YGE A;  1O7N B;  2L1S A;  4HZB B;  1JV2 B;  3H3H A;  1UCI A;  3SOY A;  1UCK A;  2KAA A;  1OUN A;  1FA3 A;  4MMZ B;  5AIF A;  2IMJ A;  2F5M A;  4NPB A;  2ZDJ A;  3F7S A;  3DMC A;  3MSO A;  3DGN A;  4O02 B;  3SOA A;  1DMQ A;  1QAK A;  1VZZ A;  2BNG A;  3K5T A;  4BL3 A;  1Q42 A;  4ZM8 A;  1KD1 4;  5D82 A;  2IUK A;  3FSD A;  3CME 3;  1TIJ A;  2YX9 A;  4R1K A;  3DUK A;  1VQO 3;  2CKF B;  1BRN L;  4GHO A;  1Q7H A;  4R9L A;  1BUQ A;  4J5G A;  1BRI A;  1OGX A;  4STD A;  1LOY A;  3MG2 A;  1YGW A;  3PCS A;  5CLK A;  3V92 A;  3CCS 3;  1GMQ A;  1ZX2 A;  3SXX A;  1EKM A;  1UCL A;  3BND A;  3CCU 3;  5RNT A;  3AHW A;  2WGO A;  1DVD A;  1B2S A;  3V99 A;  3GRD A;  6STD A;  2CFW A;  4KZ1 A;  4O8S A;  3NV0 A;  5IEO A;  1LOX A;  2K54 A;  1TTO A;  1MWU A;  1R4Y A;  1WMO A;  2I9W A;  1BAO A;  2OQE A;  3X41 A;  1JKG B;  4FCJ A;  1Q7Y 4;  1BSC A;  1HYF A;  4HOH A;  5IG0 A;  3ZFZ A;  2C11 A;  3G6E 3;  1G02 A;  4I5Q A;  4IPB A;  2F98 A;  1JNQ A;  2FNQ A;  1GYB A;  3DGO A;  4L8O A;  5BXQ A;  1VQQ A;  2HMK B;  1ZGX A;  1CH0 A;  1I2E A;  2KRT A;  3F14 A;  6GSP A;  2FXT A;  3ROB A;  4FMD A;  3J7Y d;  3GAX A;  4L7K A;  3LZA A;  2IYJ A;  4FCZ A;  1BAN A;  4JF8 A;  3ER7 A;  8CHO A;  3EHC A;  3NQY A;  1RJO A;  3JUN A;  2OWP A;  2XGL A;  1GMR A;  1W2B 2;  1OCV A;  1I0V A;  1X1X A;  2QA4 3;  1BSA A;  1BOX A;  3DXO A;  4IT7 A;  5IG4 A;  1BNG A;  2C4B A;  3B7C A;  2RBI A;  1I2G A;  2IA7 A;  4XDW A;  1V74 A;  2QGU A;  4RNT A;  1W5Z A;  4HM2 B;  5AEW B;  2LYX A;  2BO9 B;  1X1Y A;  2KF4 A;  1MGR A;  3Q3F A;  2YFJ B;  5G1K A;  1ZO2 A;  2V1L A;  4JRF A;  2HMM B;  1ASK A;  3AGN A;  1N9E A;  3BLZ A;  2XEP A;  4N6N B;  1I3I A;  1MWT A;  1Q9E A;  1TUH A;  2SBL A;  2HMJ B;  4QWT A;  1YI2 3;  4EBG A;  1KWI A;  1PFP A;  2ZHX B;  3UL5 A;  1GOU A;  3JUM A;  5KP3 A;  3FF2 A;  5I97 A;  1RKY A;  1E3R A;  4BTW A;  2LQV A;  3DGL A;  3FZW A;  4K1V A;  3F8X A;  1IQX A;  3H51 A;  4HAA A;  1BRK A;  1UCJ A;  2WO0 A;  3NBJ A;  4HM5 B;  3D79 A;  4WWU C;  5ELU A;  1N8R 4;  1VQ4 3;  1OHO A;  3T8N A;  5IG3 A;  2INX A;  2XH9 A;  3NX0 A;  2XRX B;  2B1X B;  4X2O A;  1RGL A;  1ULJ B;  1NB5 I;  4WFO A;  1BIR A;  3T8U A;  4AEQ A;  1I8V A;  1PYL A;  2AAD A;  2WGQ A;  5IEP A;  1W6Y A;  3F9S A;  3NV0 B;  3STD A;  2H0I A;  1W01 A;  1VQP 3;  3D4A A;  5FGO A;  2RNT A;  5TGN A;  2E2V A;  3MYT A;  1VQL 3;  1MWR A;  1GD3 A;  1BSD A;  2Z6B A;  1JB4 A;  2GBX B;  3JUQ A;  4RNY A;  4EV2 A;  5CK6 A;  3OV4 A;  3OWS A;  1IU7 A;  1UI8 A;  4FMB A;  2CG1 A;  3G71 3;  1BNS A;  1BNJ A;  4WHA A;  4EW5 A;  3NHX A;  1BU4 A;  3EC9 A;  2C10 A;  1BRS A;  8RNT A;  1O7H B;  3M8C A;  1W00 A;  3KKG A;  3X3Z A;  4K61 A;  1K8A 4;  3CCR 3;  1DE3 A;  3FGY A;  1A90 A;  2XGN A;  1FGO A;  1Q40 A;  2F86 B;  2P0X A;  2R41 A;  2ZA4 A;  3NBB A;  4HM7 B;  1M9G A;  1LNH A;  1RSN A;  4XBY A;  3WOD G;  1N9J A;  1E97 A;  1RDS A;  2A15 A;  3E99 A;  1MGW A;  1RGF A;  5IG5 A;  1GY5 A;  2BHM A;  2CFL A;  2P05 A;  3LML A;  3A76 A;  1DET A;  1QVG 2;  1M1X B;  4FMA A;  2CK3 H;  1FGT A;  3HZP A;  3KE7 A;  3UNL A;  1YHQ 3;  3FG1 A;  3CCV 3;  1B2X A;  4LSO A;  3CCL 3;  1BNF A;  4U13 A;  2BMQ B;  2K0M A;  7RNT A;  4R9K A;  1B2Z A;  3GZX B;  3DGY A;  3X3Y A;  1N5H A;  5JPP A;  2Y74 A;  1RGH A;  4EC6 A;  3HI7 A;  3FG3 A;  1BVI A;  3CCE 3;  5DRE A;  1A67 A;  3EJV A;  1HZ1 A;  1X1W A;  2KF6 A;  4HJL B;  1YVB I;  4RNZ A;  1OHS A;  3EQQ B;  4OUQ A;  5D83 A;  2H0H A;  4GB5 A;  2ML5 A;  1N5P A;  4EXR A;  3SYU A;  1I3F A;  1S72 3;  1LVN A;  3CCJ 3;  3X3X A;  2MF7 A;  1F8N A;  4LYL B;  2D1W A;  1BRG A;  1LRA A;  3OX9 A;  1OF5 A;  3BNC A;  5AYR B;  1SII A;  2OTJ 3;  4J9A A;  4RBN A;  2AAE A;  1VQ5 3;  3T0U A;  4KVH A;  4FCM A;  3EX9 A;  4J8T A;  3CCQ 3;  3N9H A;  1K28 A;  3S5C A;  1FZU A;  1GOY A;  1NB3 I;  4HYZ A;  4BU4 A;  2CFD A;  1BRH A;  1X1U A;  3OW2 2;  1AVL A;  4J5K A;  7STD A;  4HZ9 B;  1IK3 A;  2WOH A;  3AHS A;  2CFG A;  5M19 A;  1OGZ A;  3BNB A;  3ECF A;  3DH2 A;  2P09 A;  5STD A;  2GEX A;  1VQ7 3;  1A2K A;  1T5Y A;  2O9U X;  2BMO B;  3PCR A;  1VQ6 3;  3HII A;  1FGR A;  1RGA A;  2CIU A;  2GEY A;  3IJE B;  3RNT A;  2W2C A;  1RGG A;  2STD A;  1JZD A;  1Q40 B;  5G2G A;  3VSY A;  1YVS A;  3MPH A;  1TP6 A;  2BIR A;  2XFT A;  1GMP A;  2UUG C;  3D5I A;  1K9M 4;  1M1K 4;  1BSB A;  3HOH A;  5IER A;  1ROV A;  7GSP A;  4XBT A;  1RNB A;  1T3B A;  2W56 B;  2M7O A;  3PZW A;  1S5A A;  1GY7 A;  1YJW 3;  4BTX A;  1BNI A;  1IT7 A;  1MOL A;  5ELJ A;  1PY3 A;  4LMI A;  1SQW A;  4HM1 B;  4ORL A;  1L5G B;  2O3O A;  1QVF 2;  1QAF A;  3G16 A;  3GZB A;  3LTD A;  1STD A;  3TDG A;  3KCH A;  1O7G B;  3WR2 A;  2CG0 A;  3FLJ A;  3K63 A;  1FUW A;  3EN8 A;  2W0Q A;  1IDP A;  1STF I;  1TFO A;  4N6O B;  1JRQ A;  2E2U A;  2B24 B;  2RGQ A;  1KSI A;  3GSP A;  3I0Y A;  3KSE D;  4XDV A;  4BIR A;  1RHL A;  3BIR A;  4H61 A;  1YJN 3;  1UUV B;  3SED A;  3CC4 3;  1RCL A;  1OF5 B;  4MEI A;  2XR8 B;  4XM4 A;  5KP1 A;  1VQM 3;  4HVN A;  1RNT A;  1UGH I;  3DM8 A;  5G1L A;  5LC7 A;  3OWU A;  1BNE A;  4EV5 A;  6RNT A;  4GSP A;  1TFK A;  3WOE B;  1DMM A;  4MJD A;  1IYY A;  1JN5 B;  4N3V A;  3PS8 A;  1TRQ A;  3NXJ A;  2Y73 A;  5AYS C;  4CDL A;  4EYC A;  3JUO A;  2CX1 A;  4K1U A;  1RRL A;  5KP4 A;  1D6U A;  2BU4 A;  3S27 A;  1BRJ A;  1ULI B;  3I56 3;  1SAR A;  3IPT A;  1B3S A;  1M90 4;  3PGB A;  5JBS A;  3F8H A;  3LH4 A;  1RGK A;  1UGI A;  1KC8 4;  1YNV X;  1GS3 A;  3K7C A;  5AIG A;  1VQK 3;  3MG1 A;  1CEW I;  1Z1S A;  1BSE A;  3ALA A;  3UL6 A;  2CW9 A;  3FH1 A;  1W4N A;  3RGR A;  1A2V A;  1LOW A;  1NDO B;  1TJD A;  3A5E A;  4I4K A;  1D6Z A;  3SLU A;  1DVC A;  5CF2 A;  3U97 A;  1JZO A;  1EQK A;  1OAC A;  2KXG A;  1WTH A;  1GOV A;  2CH9 A;  2GXF A;  1MWS A;  4K90 B;  4OVM A;  3CXC 2;  1EG9 B;  2GSP A;  3LOY A;  2W56 A;  3CNX A;  3ZG0 A;  3DY5 A;  1CYV A;  1GSP A;  4DKI A;  1B21 A;  3EE1 A;  2ML6 A;  3K0Z A;  1UUW B;  2XFS A;  3WDG B;  1FUT A;  1HU9 A;  1TU5 A;  2IUJ A;  3MWZ A;  1FUS A;  2JQ5 A;  4ILF A;  3EF8 A;  1B20 A;  5HGR A;  5IF6 A;  1IV9 A;  3DGM A;  3URP A;  2W6J H;  1DMN A;  1O7W B;  1WNH A;  2CWU A;  4WP5 A;  2CC3 A;  3CNM A;  1B2U A;  1NO3 A;  5AII A;  4RZM A;  4N6U A;  4LGQ A;  3KN4 A;  4HM3 B;  2MC8 A;  4H3U A;  4R4K A;  4KFF A;  1FGQ A;  2CX0 A;  1MNL A;  2OCT A;  2IY2 A;  4HM4 B;  3WA3 A;  1FYS A;  3EBY A;  3X42 A;  1C54 A;  3GZY B;  1JB2 A;  4FMC A;  4HKV B;  1EA2 A;  2PZV A;  1YIT 3;  1EUI C;  4FR9 A;  3G0K A;  3NM2 A;  5EVH A;  1JBT A;  2CFK A;  4N6V 0;  4PEJ A;  2R4I A;  1LQM B;  1I2F A;  5D81 A;  3RGA A;  2GBW B;  5M18 A;  3FCS B;  1C7H A;  1EEJ A;  1N8Q A;  3DZL A;  4O3V A;  1G0T A;  3UB1 A;  5CF1 A;  2KF3 A;  3D9R A;  3Q2P A;  1AV4 A;  1WQL B;  1AR0 A;  2H0G A;  2GU3 A;  4O2H A;  1JN5 A;  1FGM A;  1RCK A;  1IVU A;  2BT3 A;  1NU3 A;  1T2H A;  2F5W A;  1QMA A;  2W04 A;  3MKI A;  1D6Y A;  2YFI B;  9RNT A;  1OHP A;  3AMO A;  4N6M A;  1JBS A;  2P0M A;  3GZR A;  2SAR A;  4BL2 A;  1NJI 4;  3HK4 A;  5BVB A;  3VGN A;  5DRV A;  5FW5 A;  2F99 A;  1GY6 A;  3JUP A;  1RGC A;  4NRE A;  3CC7 3;  2F56 A;  3VF1 A;  3EN1 B;  3LTC A;  3WMD A;  3NUV A;  5AIH A;  3MHE A;  5IEN A;  3BNE A;  2F4Y A;  5BU4 A;  2XSH B;  5IW9 A;  2CWT A;  1U8C B;  1J2B A;  3ZG5 A;  1RN7 A;  1RRH A;  1B27 A;  2HML B;  1Y4K A;  2OTL 3;  4G1M B;  1RGE A;  1KQS 2;  2PNC A;  3HX8 A;  4HBR A;  2ZL8 A;  2KF5 A;  1LNI A;  2W03 A;  2QEX 3;  3D5G A;  1O7P B; 
#chains in the Genus database with same CATH homology
 1IQ8 A;  2HMO B;  1DYU A;  1IT8 A;  1YIJ 3;  1K73 4;  2L4V A;  3FKA A;  1K41 A;  3EBT A;  3NBR A;  4TX4 A;  3WA2 X;  3LTB A;  1U5O A;  3FF0 A;  3JVC A;  2D42 A;  2CHC A;  1UW1 A;  1UI7 A;  3D3L A;  3PYJ A;  3O8Y A;  2RSX A;  2RFR A;  3N54 B;  4WYK B;  3CD6 3;  1O7M B;  4KFD A;  4X2H A;  5EEO A;  2RCD A;  1IVV A;  2W9Q A;  3MG3 A;  3OWY A;  2OOV A;  3BB9 A;  3CCM 3;  3U1W A;  1VQ9 3;  3G8Z A;  1ROA A;  3WOF B;  3IMA B;  3LT9 A;  1Q86 4;  3SX1 A;  1Q82 4;  3KSP A;  2HMN B;  1G96 A;  3GWR A;  1R4C A;  3CPO A;  3NM7 A;  3G4S 3;  1W7C A;  4R80 A;  1VQ8 3;  3NQZ A;  1QAL A;  1JJ2 2;  4AKZ A;  2OQE C;  5AI1 A;  4LZI A;  3QRD A;  3AMO B;  1W2Z A;  3RDE A;  1Q81 4;  3V98 A;  5EQL A;  2Z77 A;  1QJG A;  4NHF A;  1YJ9 3;  1CQS A;  3KZT A;  2GU1 A;  1W6G A;  1PU4 A;  1WMP A;  2QIY A;  4MMX B;  3B4P A;  1IVW A;  2YFL B;  3FG4 A;  3LYG A;  1LXE A;  2E2T A;  2OOV C;  3CMA 3;  2XF3 A;  1AVK A;  4Q53 A;  3LXU X;  3I55 3;  3KFQ C;  1SIH A;  4HM0 B;  3HIG A;  4CCV A;  1OPY A;  3K9M C;  2Z76 A;  1W6C A;  3N8B A;  2UX0 A;  3UJM A;  5A0O B;  1IQY A;  2XSO B;  3EB8 A;  4XBX A;  2BMR B;  4LEH A;  3F40 A;  4IIA A;  3S67 A;  4L8P A;  1HKX A;  1JKG A;  3CC2 3;  3L0R A;  2FGT A;  1IVX A;  1GD4 A;  3CPW 2;  4HM8 B;  3LT8 A;  2Q07 A;  5LC6 A;  3S28 A;  5AEU B;  4KFE A;  3B8L A;  1ISK A;  1VQN 3;  1E3V A;  2KCD A;  2CWV A;  1JB5 A;  3KII A;  3CU3 A;  4MMY B;  4N6T A;  4XB5 A;  3X40 A;  3B4O A;  4BTY A;  4GL6 A;  1IV7 A;  1SJW A;  1OH0 A;  3PXM A;  3SVA A;  2W9P A;  4HM6 B;  3LTA A;  1WMN A;  2JDI H;  4N6L A;  4WYK A;  2Z7A A;  1SPU A;  2WOF A;  3S29 A;  5JPU A;  1NWW A;  3QK9 A;  1W02 A;  3OXA A;  4AKY A;  3F7X A;  4OK0 A;  1US1 A;  2P38 A;  5CXO A;  3Q1C A;  3Q90 A;  1YGE A;  1O7N B;  4HZB B;  1JV2 B;  3H3H A;  3SOY A;  1OUN A;  1FA3 A;  4MMZ B;  5AIF A;  2IMJ A;  2ZDJ A;  3F7S A;  3DMC A;  3MSO A;  3DGN A;  4O02 B;  3SOA A;  1DMQ A;  1QAK A;  1VZZ A;  2BNG A;  3K5T A;  4ZM8 A;  1Q42 A;  1KD1 4;  5D82 A;  2IUK A;  3FSD A;  3CME 3;  1TIJ A;  2YX9 A;  4R1K A;  3DUK A;  1VQO 3;  2CKF B;  1BUQ A;  4R9L A;  1OGX A;  4STD A;  3MG2 A;  3PCS A;  5CLK A;  3V92 A;  3CCS 3;  1ZX2 A;  3SXX A;  1EKM A;  3BND A;  3CCU 3;  2WGO A;  1DVD A;  3V99 A;  3GRD A;  6STD A;  2CFW A;  4KZ1 A;  4O8S A;  3NV0 A;  5IEO A;  1LOX A;  2K54 A;  1WMO A;  2I9W A;  2OQE A;  3X41 A;  1JKG B;  4FCJ A;  1Q7Y 4;  5IG0 A;  2C11 A;  3G6E 3;  4IPB A;  2F98 A;  1JNQ A;  2FNQ A;  1GYB A;  3DGO A;  4L8O A;  5BXQ A;  2HMK B;  2KRT A;  3F14 A;  2FXT A;  3ROB A;  4FMD A;  3J7Y d;  3GAX A;  4L7K A;  3LZA A;  4FCZ A;  4JF8 A;  3ER7 A;  8CHO A;  3EHC A;  3NQY A;  1RJO A;  3JUN A;  2OWP A;  2XGL A;  1W2B 2;  1OCV A;  2QA4 3;  5IG4 A;  3DXO A;  4IT7 A;  3B7C A;  2IA7 A;  4XDW A;  1V74 A;  2QGU A;  1W5Z A;  4HM2 B;  5AEW B;  2LYX A;  2BO9 B;  2YFJ B;  1ZO2 A;  2V1L A;  4JRF A;  2HMM B;  1ASK A;  1N9E A;  3BLZ A;  2XEP A;  4N6N B;  1TUH A;  2SBL A;  2HMJ B;  4QWT A;  1YI2 3;  4EBG A;  1KWI A;  1PFP A;  3UL5 A;  3JUM A;  5KP3 A;  3FF2 A;  5I97 A;  1RKY A;  1E3R A;  4BTW A;  2LQV A;  3DGL A;  3FZW A;  4K1V A;  3F8X A;  1IQX A;  3H51 A;  2WO0 A;  4WWU C;  3NBJ A;  4HM5 B;  5ELU A;  1VQ4 3;  1N8R 4;  1OHO A;  3T8N A;  5IG3 A;  2INX A;  2XH9 A;  3NX0 A;  2XRX B;  2B1X B;  4X2O A;  1ULJ B;  1NB5 I;  4WFO A;  3T8U A;  4AEQ A;  5IEP A;  2WGQ A;  1W6Y A;  3F9S A;  3NV0 B;  3STD A;  1W01 A;  1VQP 3;  5FGO A;  5TGN A;  2E2V A;  3MYT A;  1VQL 3;  1GD3 A;  2Z6B A;  1JB4 A;  2GBX B;  3JUQ A;  4RNY A;  4EV2 A;  5CK6 A;  3OV4 A;  3OWS A;  1IU7 A;  1UI8 A;  4FMB A;  2CG1 A;  3G71 3;  4WHA A;  3NHX A;  3EC9 A;  2C10 A;  1O7H B;  3M8C A;  1W00 A;  3KKG A;  3X3Z A;  4K61 A;  3CCR 3;  3FGY A;  1A90 A;  2XGN A;  1FGO A;  1Q40 A;  2F86 B;  2P0X A;  3NBB A;  4HM7 B;  1M9G A;  1LNH A;  4XBY A;  5IG5 A;  3WOD G;  1N9J A;  1E97 A;  2A15 A;  3E99 A;  1CYU A;  1GY5 A;  2BHM A;  2CFL A;  2P05 A;  3LML A;  3A76 A;  1QVG 2;  1M1X B;  4FMA A;  2CK3 H;  1FGT A;  3HZP A;  3KE7 A;  3UNL A;  1YHQ 3;  3FG1 A;  3CCV 3;  4LSO A;  3CCL 3;  4U13 A;  2BMQ B;  2K0M A;  4R9K A;  3GZX B;  3X3Y A;  1N5H A;  5JPP A;  2Y74 A;  4EC6 A;  3HI7 A;  3FG3 A;  3CCE 3;  1A67 A;  5DRE A;  3EJV A;  4HJL B;  4RNZ A;  1YVB I;  1OHS A;  3EQQ B;  4OUQ A;  5D83 A;  4GB5 A;  4EXR A;  2ML5 A;  1N5P A;  1S72 3;  1LVN A;  3CCJ 3;  3X3X A;  2MF7 A;  1F8N A;  2D1W A;  3OX9 A;  1OF5 A;  3BNC A;  5AYR B;  1SII A;  2OTJ 3;  4J9A A;  4RBN A;  1VQ5 3;  3T0U A;  4KVH A;  4FCM A;  3EX9 A;  4J8T A;  3CCQ 3;  3N9H A;  1K28 A;  3S5C A;  4HYZ A;  1NB3 I;  2CFD A;  3OW2 2;  1AVL A;  7STD A;  4HZ9 B;  1IK3 A;  2WOH A;  2CFG A;  1OGZ A;  3BNB A;  3ECF A;  2P09 A;  5STD A;  2GEX A;  1VQ7 3;  1A2K A;  1T5Y A;  2O9U X;  2BMO B;  3PCR A;  1VQ6 3;  3HII A;  1FGR A;  2CIU A;  2GEY A;  3IJE B;  2W2C A;  2STD A;  1Q40 B;  5G2G A;  3VSY A;  3MPH A;  1TP6 A;  2XFT A;  1K9M 4;  1M1K 4;  5IER A;  1ROV A;  4XBT A;  2W56 B;  2M7O A;  3PZW A;  1S5A A;  1GY7 A;  1YJW 3;  4BTX A;  1IT7 A;  1MOL A;  5ELJ A;  4LMI A;  4ORL A;  1SQW A;  4HM1 B;  1L5G B;  2O3O A;  1QAF A;  3G16 A;  3GZB A;  3LTD A;  1STD A;  3TDG A;  1O7G B;  2CG0 A;  3FLJ A;  3K63 A;  1FUW A;  3EN8 A;  2W0Q A;  1IDP A;  1STF I;  1TFO A;  4N6O B;  1JRQ A;  2E2U A;  2B24 B;  2RGQ A;  1KSI A;  3I0Y A;  3KSE D;  4XDV A;  1K8A 4;  1QVF 2;  4H61 A;  1YJN 3;  1UUV B;  3SED A;  3CC4 3;  1OF5 B;  4MEI A;  2XR8 B;  4XM4 A;  5KP1 A;  1VQM 3;  4HVN A;  3DM8 A;  5LC7 A;  3OWU A;  4EV5 A;  1TFK A;  3WOE B;  1DMM A;  4MJD A;  1JN5 B;  4N3V A;  3PS8 A;  3NXJ A;  2Y73 A;  5AYS C;  4CDL A;  4EYC A;  3JUO A;  4K1U A;  1RRL A;  5KP4 A;  1D6U A;  3S27 A;  1ULI B;  3I56 3;  3IPT A;  1M90 4;  3PGB A;  5JBS A;  3F8H A;  3LH4 A;  1KC8 4;  1GS3 A;  3K7C A;  5AIG A;  1VQK 3;  3MG1 A;  1CEW I;  1Z1S A;  3ALA A;  3UL6 A;  2CW9 A;  3FH1 A;  1W4N A;  3RGR A;  1A2V A;  4I4K A;  1NDO B;  1D6Z A;  3SLU A;  1DVC A;  5CF2 A;  3U97 A;  1EQK A;  1OAC A;  2KXG A;  1WTH A;  2CH9 A;  2GXF A;  4K90 B;  4OVM A;  3CXC 2;  1EG9 B;  3LOY A;  2W56 A;  3CNX A;  3DY5 A;  1CYV A;  3EE1 A;  2ML6 A;  3K0Z A;  1UUW B;  2XFS A;  3WDG B;  1HU9 A;  1TU5 A;  2IUJ A;  3MWZ A;  2JQ5 A;  3EF8 A;  5HGR A;  5IF6 A;  1IV9 A;  3DGM A;  2W6J H;  1DMN A;  1O7W B;  1WNH A;  2CWU A;  4WP5 A;  2CC3 A;  3CNM A;  1NO3 A;  5AII A;  4RZM A;  4N6U A;  4LGQ A;  3KN4 A;  4HM3 B;  2MC8 A;  4H3U A;  4R4K A;  4KFF A;  1FGQ A;  1MNL A;  2OCT A;  4HM4 B;  3WA3 A;  3EBY A;  3X42 A;  3GZY B;  1JB2 A;  4FMC A;  4HKV B;  1EA2 A;  2PZV A;  1YIT 3;  4FR9 A;  3G0K A;  3NM2 A;  5EVH A;  2CFK A;  4N6V 0;  4PEJ A;  2R4I A;  5D81 A;  3RGA A;  2GBW B;  3FCS B;  1C7H A;  1N8Q A;  3DZL A;  4O3V A;  3UB1 A;  5CF1 A;  3D9R A;  3Q2P A;  1AV4 A;  1WQL B;  1AR0 A;  2GU3 A;  4O2H A;  1JN5 A;  1FGM A;  1IVU A;  2BT3 A;  1NU3 A;  1QMA A;  2W04 A;  3MKI A;  1D6Y A;  2YFI B;  1OHP A;  3AMO A;  4N6M A;  2P0M A;  3GZR A;  1NJI 4;  3HK4 A;  5BVB A;  3VGN A;  5DRV A;  5FW5 A;  2F99 A;  1GY6 A;  3JUP A;  4NRE A;  3CC7 3;  3VF1 A;  3EN1 B;  3LTC A;  3WMD A;  3NUV A;  5AIH A;  3MHE A;  5IEN A;  3BNE A;  1J2B A;  2XSH B;  5IW9 A;  2CWT A;  1U8C B;  1RN7 A;  1RRH A;  2HML B;  1Y4K A;  2OTL 3;  4G1M B;  1KQS 2;  2PNC A;  3HX8 A;  4HBR A;  2ZL8 A;  2W03 A;  2QEX 3;  1O7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...