4HYZA

Crystal structure of a duf3887 family protein (rumgna_01855) from ruminococcus gnavus atcc 29149 at 2.25 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
GEILKELPEGFDKETVRKQAMEDIEIAQSKDYESWKSRFTKDLQSSLTEESYDSYLKILEKQGEFKEFGKCTYLGQIKDNKKYGGVIIVVKYEEGNVNYSLAYDEDMNLVSFTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (RUMGNA_01855) from Ruminococcus gnavus ATCC 29149 at 2.25 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 33
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13026 DUF3887 Protein of unknown function (DUF3887)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.590 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hyzA00
4HYZA 2MC8A
chains in the Genus database with same CATH superfamily
2BMOB 1VQL3 5AYSC 1IDPA 1B3SA 1BIRA 1O7GB 2GEXA 2INXA 2XSOB 4WFOA 2WO0A 3HK4A 4X2HA 2F99A 1W5ZA 1B2UA 1I3IA 2IMJA 3HI7A 3EB8A 4L8PA 3NV0B 3NQYA 1VQK3 1GOVA 2XFSA 1HZ1A 1N5HA 1O7MB 1LNHA 1TIJA 3EBTA 3K63A 2L4VA 2CX0A 2HOHA 2BMRB 1V74A 2HMOB 4EC6A 4LEHA 2CKFB 1BSCA 2RCDA 2V1LA 4QWTA 1RN1A 1RRHA 1UW1A 1STFI 1JN5B 1WMOA 2YFIB 3B8LA 3EE1A 3OWUA 1A67A 3D4AA 3CCJ3 1RGHA 4RZMA 1SJWA 1QVG2 5AI1A 1CEWI 1BOXA 2CWVA 4RNYA 2F4YA 3S67A 1UCKA 3EJVA 2CFWA 2BT3A 1TRPA 4N6V0 1WTHA 5A0OB 1PYLA 1OGXA 1TUHA 3ALAA 2ZHXB 4N6NB 2W04A 4ZM8A 1KD14 3WR2A 1RLSA 3QRDA 1X1UA 3LH4A 1PFPA 5FW5A 3CCE3 1JB5A 5G2GA 1UCIA 5STDA 5CLKA 2K54A 3G0KA 1UCLA 3TDGA 1LOWA 1T3BA 4KVHA 1Q814 1BRNL 1BNGA 2KF4A 3PZWA 4HM0B 1EEJA 3PS8A 1GOYA 4HVNA 2E2TA 4XDWA 3CCS3 3EX9A 1ULIB 2RFRA 2HMLB 3GZYB 1BNIA 1WMPA 3D3LA 2GU1A 3RDEA 1MOLA 3OXAA 1LOXA 2F98A 4WP5A 4U13A 1JV2B 3SX1A 1UGHI 1A2KA 3D9RA 1YIT3 1FGOA 4LMIA 1SQWA 2BMQB 1TRQA 1AV4A 8RNTA 1C54A 3SLUA 2ML6A 4O02B 2HMJB 1GD3A 2E2UA 1FGQA 1TFOA 2R4IA 3G4S3 5DRVA 1OPYA 1K41A 1W00A 1G96A 4XB5A 1WNHA 2HMMB 1VZZA 1MGWA 3NBBA 3WHOA 3BNBA 1JBRA 3MPHA 1GD4A 3LOYA 3T0UA 5BXQA 1RGLA 3NUVA 2R41A 2J8XB 4XDVA 2Z76A 3MG2A 5TGNA 3U97A 4ORLA 4WYKB 3CNMA 3K9MC 4CPKA 3BNDA 1V57A 4N3VA 1IVWA 4K1UA 2UUGC 2OWPA 3RGAA 3CD63 4BTWA 2C4BA 2CFLA 3MG1A 1LOYA 3SOYA 4EV2A 7GSPA 5CK6A 1Q864 3D5IA 3PXMA 4GSPA 2JDIH 1HKXA 3WODG 4BL2A 1E3RA 1BVIA 2Z77A 3OWSA 2IUJA 3GRDA 3CC23 1YGEA 4HM5B 3SXXA 1OACA 4MEIA 1QALA 3L0RA 3MKIA 4PEJA 1NU3A 3F40A 1E97A 3DMCA 3JVCA 1IK3A 1LOVA 1W02A 3WDGB 1LQMB 4HM7B 3PYJA 4K1VA 1GMRA 2K0MA 3N8BA 5D82A 1M1K4 4AKYA 3DGMA 2YX9A 2AADA 3AMOA 3JUQA 1GY5A 1GS3A 3DGNA 3SVAA 1YJN3 2GXFA 1N8R4 1ISKA 6GSPA 3I563 1UI7A 1NWWA 2LYXA 3LT8A 5HOHA 5ELJA 3D79A 4I5QA 1W01A 3NM2A 3BIRA 3D5GA 3FGYA 3BNCA 3BLZA 3GAXA 4FCMA 1IV7A 1LRAA 3NM7A 2H0GA 4HM8B 4R9KA 3V99A 1TTOA 3CC73 1NDOB 1RJOA 4HOHA 4XBXA 5EQLA 1LNIA 2XR8B 3HIIA 4HM4B 4NPBA 3K7CA 1DMQA 1T2IA 1Y4KA 1HU9A 2A15A 2XH9A 3B4OA 3BNEA 3LTBA 4K90B 4NHFA 5FGOA 5KP3A 1E3VA 4O8SA 2ZA4A 4JF8A 2UGIA 1MWUA 1KQS2 4BU4A 5AYRB 1I2GA 3RGRA 1RNBA 1UUGB 1IV9A 1W6CA 5DREA 1LVNA 2CG0A 1ROVA 3GZXB 3WA2X 1MWTA 4HM3B 1VQO3 1JBSA 5AIIA 3RNTA 1BNSA 2RNTA 2MF7A 3FCSB 5KP1A 2IYJA 3IJEB 5IERA 4KFEA 3I553 4HM2B 4R9LA 1YJW3 3FSDA 2C11A 2RGQA 1BRIA 2XEPA 2ZL8A 2F86B 5KP4A 2FNQA 1EUIC 2KF6A 1IVVA 2CIUA 1TFKA 1O7HB 1FA3A 1N8QA 4EXRA 5IG3A 1LXEA 1Q7HA 2P0XA 3CCV3 1EA2A 1OGZA 1OF5A 1TJDA 1W2ZA 6RNTA 1OCVA 3AGOA 1FUTA 2OTL3 1AVKA 3PCRA 2KRTA 1CYVA 3LT9A 2Q07A 4N6UA 2OTJ3 1FGRA 3F7XA 3KCHA 4R1KA 1X1WA 2SARA 5IEOA 2MC8A 2AAEA 4XBTA 3OW22 3AMOB 3ZG5A 2W0QA 3G8ZA 2IY2A 3F9SA 1B27A 1G0TA 3LMLA 1RGCA 1RRLA 5IG4A 1UCJA 1W4NA 3ROBA 3URPA 1BSEA 1LQGC 3GSPA 1O7NB 4RNTA 3K5TA 1S5AA 3VF1A 1BSBA 5AIFA 4BTXA 1CYUA 1I2EA 1UGIA 4OUQA 4O3VA 2KF5A 2XF3A 3FH1A 1I0VA 3SYUA 3B7CA 3X41A 1YI23 3FG1A 1QMAA 2W56B 3HX8A 1SIHA 3FF0A 2CH9A 3OWYA 3SOAA 3KSED 1K734 1B2ZA 5JPPA 3F8XA 3EN1B 3PGBA 2YFLB 1DMNA 2QIYA 1VQN3 2W2CA 1GMPA 2BNGA 3NBRA 3EF8A 3E99A 1RCKA 2BU4A 1HYFA 7RNTA 1JBTA 1BNFA 4GL6A 3SEDA 4DKIA 2QA43 3LTCA 3K0ZA 4EV5A 2CK3H 4L8OA 1OH0A 1FZUA 1GSPA 1RN7A 3IMAB 1NB5I 5BIRA 2P0MA 1L5GB 1BSDA 2CFDA 2QGUA 3Q3FA 5AIHA 1AY7A 2STDA 5GSPA 2GEYA 2LQVA 4BTYA 1WQLB 5BU4A 3GWRA 1IQ8A 1Q9EA 1QAKA 3S28A 2GBXB 4HYZA 3HIGA 1B2SA 3DH2A 4FMDA 1IVXA 3H3HA 4HKVB 3S5CA 5BVBA 2M7OA 1IT7A 1F8NA 1FUSA 1MWRA 1Q42A 1X1XA 3JUOA 2CW9A 2CG1A 5IF6A 2E2VA 3N54B 3IPTA 2HMNB 1ZO2A 3JUNA 4HZ9B 3ZFZA 2OQEA 4FMBA 4WYKA 1ZGXA 5M19A 1C7HA 2IUKA 2RBIA 4HM1B 2KAAA 2ML5A 5CF1A 3MHEA 4MMZB 3CXC2 3X3ZA 3HOHA 1W6YA 5M18A 1V58A 1IU7A 3B4PA 3FKAA 1GY6A 1IQXA 1JZOA 3KKGA 4CCVA 1JB2A 2XRXB 1EQKA 4MJDA 3GZRA 4LGQA 1K8A4 3NBJA 3CME3 2GSPA 3CCU3 2IA7A 3I0YA 1X1YA 2CC3A 5I97A 1T2HA 1BNEA 1BRKA 1OHPA 1US1A 3ZG0A 1QJGA 2CFGA 3CMA3 2L1SA 3G6E3 4GHOA 3X42A 4FMCA 1BGSA 1A2VA 5M1AA 1BSAA 1VQ73 1GOUA 1NB3I 1RGAA 1BNRA 4HBRA 1QAFA 4OK0A 5JBSA 2PZVA 2SBLA 3G16A 2QEX3 1VQ83 1BUJA 3FLJA 3QK9A 1Q824 3DZLA 1Q7Y4 4STDA 2HMKB 3CU3A 1M1XB 2W9PA 3KE7A 3STDA 4FCZA 3X3XA 3KSPA 1NO3A 3Q90A 2OOVC 3EC9A 1JKGB 4NREA 2RSXA 3DM8A 1EG9B 1ZS7A 1B21A 1BRSA 3CCR3 4WHAA 3DGLA 3EN8A 3MSOA 4FCJA 1JZDA 4IIAA 2H0HA 4Q53A 5RNTA 2GU3A 1JRQA 2H0IA 4FR9A 3U1WA 1DVDA 1BUQA 1VQM3 3CCM3 4O2HA 3J7Yd 1B2MA 5IENA 2Z6BA 2JQ5A 1Q40B 2D42A 4LYLB 1OUNA 1PY3A 1A2PA 2WOFA 3FG4A 1BRHA 1N9JA 4EBGA 1O7PB 2C10A 4KZ1A 1G02A 2FGTA 4ILFA 1GMQA 1MWSA 2P05A 3LXUX 1U5OA 5G1LA 6STDA 1DETA 1JN5A 3LZAA 3WA3A 4LZIA 1CQSA 1DE3A 4HZBB 1AVLA 3AHSA 5AEUB 1VQP3 3ER7A 4N6TA 1YVBI 2KXGA 3LYGA 3VGNA 1YGWA 3WOEB 1BRJA 2F5MA 4J8TA 5HGRA 4CJNA 4CDLA 3HZPA 2D1WA 1YIJ3 1RTUA 3MG3A 3NV0A 1I70A 1KSIA 3Q2PA 1CH0A 4FMAA 2Y73A 4L7KA 4AKZA 1OHOA 1RGEA 3O8YA 1SPUA 1ULJB 4X2OA 4EW5A 2KCDA 3CCQ3 1AR0A 1D6UA 2W6JH 4KFFA 3UL6A 2B1XB 3A76A 4RNZA 1RDSA 2OQEC 4BL3A 3CPW2 1YJ93 2B24B 1VQ93 1BANA 3CC43 3GZBA 5IEPA 4GB5A 1IVUA 4IPBA 3NXJA 3KIIA 2OCTA 5LC6A 3V98A 1MGRA 2CWUA 5IG0A 1W7CA 3UJMA 3WMDA 1N9EA 2O9UX 1MNLA 2CFKA 2ZDJA 4N6MA 4R4KA 3NQZA 5G1KA 1D6ZA 1FGTA 2W03A 1SARA 1AQZA 1R4CA 1VQ43 1ROAA 3WOFB 2XFTA 9RNTA 3AHWA 1QVF2 1DYUA 1RCLA 1BAOA 4RBNA 4R80A 4XM4A 3F8HA 1O7WB 4N6LA 3ECFA 5EVHA 1I3FA 1RHLA 1RGKA 3CCL3 3A5EA 3DGOA 4H3UA 1DMMA 4EYCA 2PNCA 2W56A 1U8CB 3T8UA 3OX9A 2P09A 1KWIA 3UB1A 5IW9A 1I8VA 1K9M4 2I9WA 1J2BA 2W9QA 5ELUA 2F5WA 1VQ63 4HM6B 3BU4A 3LTDA 3DY5A 3MYTA 1K28A 3BB9A 1RGGA 3AGNA 3DUKA 1JKGA 2WOHA 1IT8A 4JRFA 1GYBA 2XGLA 1S723 1T5YA 3G713 1OHSA 3S27A 3PCSA 3KFQC 2O3OA 3Q1CA 1KC84 3F7SA 1BNJA 1UI8A 3KN4A 1BU4A 2FXTA 2KF3A 3CNXA 1M904 1DVCA 2WGOA 4J5KA 1B20A 3FG3A 1SIIA 2OOVA 3X40A 4BIRA 1B2XA 1I0XA 1Z1SA 4I4KA 2BO9B 1IYYA 4J5GA 4MMXB 4XBYA 1EKMA 1JJ22 3UL5A 2XGNA 3KZTA 1RGFA 1N5PA 2Z7AA 4WWUC 3JUMA 5D83A 2CHCA 4HAAA 5JPUA 4LSOA 1IQYA 1FUWA 2CX1A 3T8NA 1NNVA 3LTAA 1FGMA 1TP6A 2F56A 3EBYA 4N6OB 5EEOA 1VQ53 1RN4A 2YFJB 1TU5A 1ASKA 5AIGA 5LC7A 4IT7A 1PU4A 1WMNA 1STDA 3EHCA 2CWTA 1ZX2A 5D81A 1RMSA 2UX0A 1UUVB 4H61A 4KT3B 4G1MB 3H51A 3VSYA 4KFDA 3X3YA 1FYSA 1YHQ3 1YNVX 5CF2A 3DGYA 2BIRA 3NX0A 2K3DA 3FZWA 5CXOA 3F14A 1JB4A 1M9GA 2WGQA 1FW7A 4K61A 3UNLA 4TX4A 3FF2A 1R4YA 1W6GA 1YVSA 2P38A 1I2FA 7STDA 4HJLB 3JUPA 1UDII 4J9AA 8CHOA 5AEWB 2GBWB 2XSHB 1W2B2 1GY7A 1Q40A 1BRGA 1RNTA 1RSNA 3S29A 4AEQA 1D6YA 1UUWB 3MWZA 4MMYB 4OVMA 3V92A 1OF5B 3CPOA 1VQQA 3DXOA 5IG5A 1JNQA 3M8CA 3N9HA 3EQQB 3OV4A 1RKYA 1NJI4 1A90A 2BHMA 3NHXA 2Y74A
chains in the Genus database with same CATH topology
2BMOB 1VQL3 5AYSC 1IDPA 1O7GB 2GEXA 2INXA 2XSOB 4WFOA 2WO0A 3HK4A 4X2HA 2F99A 1W5ZA 2IMJA 3HI7A 4L8PA 3EB8A 3NV0B 3NQYA 1VQK3 2XFSA 1N5HA 1O7MB 1LNHA 1TIJA 3EBTA 3K63A 2L4VA 2BMRB 1V74A 2HMOB 4EC6A 4LEHA 2CKFB 2RCDA 2V1LA 4QWTA 1RRHA 1UW1A 1STFI 1JN5B 1WMOA 2YFIB 3B8LA 3EE1A 3OWUA 1A67A 3CCJ3 4RZMA 1SJWA 1QVG2 5AI1A 1CEWI 2CWVA 4RNYA 3S67A 3EJVA 2CFWA 2BT3A 4N6V0 1WTHA 5A0OB 1OGXA 1TUHA 3ALAA 4N6NB 2W04A 4ZM8A 1KD14 3QRDA 3LH4A 1PFPA 5FW5A 3CCE3 1JB5A 5G2GA 5STDA 5CLKA 2K54A 3G0KA 3TDGA 1Q814 4KVHA 3PZWA 4HM0B 3PS8A 4HVNA 2E2TA 4XDWA 3CCS3 3EX9A 1ULIB 2RFRA 2HMLB 3GZYB 1WMPA 3D3LA 2GU1A 3RDEA 1MOLA 3OXAA 1LOXA 2F98A 4WP5A 4U13A 1JV2B 3SX1A 1YIT3 1A2KA 3D9RA 1FGOA 4LMIA 1SQWA 2BMQB 1AV4A 3SLUA 2ML6A 4O02B 2HMJB 1GD3A 2E2UA 1FGQA 1TFOA 2R4IA 3G4S3 5DRVA 1OPYA 1K41A 1W00A 1G96A 4XB5A 1WNHA 2HMMB 1VZZA 3NBBA 3BNBA 3MPHA 1GD4A 3LOYA 3T0UA 5BXQA 3NUVA 4XDVA 5TGNA 2Z76A 3MG2A 3U97A 4ORLA 4WYKB 3CNMA 3K9MC 3BNDA 4N3VA 1IVWA 4K1UA 2OWPA 3RGAA 3CD63 4BTWA 2CFLA 3MG1A 3SOYA 4EV2A 5CK6A 1Q864 3PXMA 2JDIH 1HKXA 3WODG 1E3RA 2Z77A 3OWSA 2IUJA 3GRDA 3CC23 1YGEA 4HM5B 3SXXA 1OACA 4MEIA 1QALA 3L0RA 3MKIA 4PEJA 1NU3A 3F40A 1E97A 3DMCA 3JVCA 1IK3A 1W02A 3WDGB 4HM7B 3PYJA 4K1VA 2K0MA 3N8BA 5D82A 1M1K4 4AKYA 3DGMA 3AMOA 2YX9A 3JUQA 1GY5A 1GS3A 3DGNA 3SVAA 1YJN3 2GXFA 1N8R4 1ISKA 3I563 1UI7A 1NWWA 2LYXA 3LT8A 5ELJA 1W01A 3NM2A 4LZIA 3FGYA 3BNCA 3BLZA 3GAXA 4FCMA 1IV7A 3NM7A 4HM8B 4R9KA 3V99A 3CC73 1NDOB 1RJOA 4XBXA 5EQLA 2XR8B 3HIIA 4HM4B 3K7CA 1DMQA 4K90B 1Y4KA 1HU9A 2A15A 2XH9A 3BNEA 3B4OA 3LTBA 4NHFA 5FGOA 5KP3A 1E3VA 4O8SA 4JF8A 1KQS2 5AYRB 3RGRA 1IV9A 1W6CA 5DREA 1LVNA 2CG0A 1ROVA 3GZXB 3WA2X 4HM3B 1VQO3 5AIIA 2MF7A 3FCSB 5KP1A 3IJEB 5IERA 3I553 4KFEA 4HM2B 4R9LA 1YJW3 3FSDA 2C11A 2RGQA 2XEPA 2ZL8A 2F86B 5KP4A 2FNQA 1IVVA 2CIUA 1TFKA 1O7HB 1FA3A 1N8QA 4EXRA 5IG3A 1LXEA 2P0XA 3CCV3 1EA2A 1OGZA 1OF5A 1W2ZA 1OCVA 2OTL3 1AVKA 3PCRA 2KRTA 1CYVA 3LT9A 2Q07A 4N6UA 2OTJ3 1FGRA 3F7XA 4R1KA 5IEOA 2MC8A 4XBTA 3OW22 3AMOB 2W0QA 3G8ZA 3F9SA 3LMLA 1RRLA 5IG4A 1W4NA 3ROBA 1O7NB 3VF1A 3K5TA 1S5AA 5AIFA 4BTXA 1CYUA 4OUQA 4O3VA 2XF3A 3FH1A 3B7CA 3X41A 1YI23 3FG1A 1QMAA 2W56B 3HX8A 1SIHA 3FF0A 2CH9A 3OWYA 3SOAA 3KSED 1K734 5JPPA 3F8XA 3EN1B 3PGBA 2YFLB 1DMNA 2QIYA 1VQN3 2W2CA 2BNGA 3NBRA 3EF8A 3E99A 4GL6A 3SEDA 2QA43 3LTCA 3K0ZA 4EV5A 2CK3H 4L8OA 1OH0A 1RN7A 3IMAB 1NB5I 2P0MA 1L5GB 2CFDA 2QGUA 5AIHA 2STDA 2GEYA 2LQVA 4BTYA 1WQLB 3GWRA 1IQ8A 1QAKA 3S28A 2GBXB 4HYZA 3HIGA 4FMDA 3S5CA 4HKVB 1IVXA 3H3HA 5BVBA 2M7OA 1IT7A 1F8NA 2CG1A 1Q42A 3JUOA 5IF6A 2CW9A 2E2VA 3N54B 3IPTA 2HMNB 1ZO2A 3JUNA 4HZ9B 2OQEA 4FMBA 4WYKA 1C7HA 2IUKA 4HM1B 2ML5A 5CF1A 3MHEA 4MMZB 3CXC2 3X3ZA 1W6YA 1IU7A 3B4PA 3FKAA 1GY6A 1IQXA 3KKGA 4CCVA 1JB2A 2XRXB 1EQKA 4MJDA 3GZRA 4LGQA 1K8A4 3NBJA 3CME3 3CCU3 2IA7A 3I0YA 2CC3A 5I97A 1OHPA 1US1A 1QJGA 2CFGA 3CMA3 3G6E3 3X42A 4FMCA 1A2VA 1VQ73 1NB3I 4HBRA 1QAFA 4OK0A 5JBSA 2PZVA 2SBLA 3G16A 2QEX3 1VQ83 3FLJA 3QK9A 1Q824 3DZLA 1Q7Y4 4STDA 2HMKB 3CU3A 1M1XB 2W9PA 3KE7A 3STDA 4FCZA 3X3XA 3KSPA 1NO3A 3Q90A 2OOVC 3EC9A 1JKGB 4NREA 2RSXA 3DM8A 1EG9B 3CCR3 4WHAA 3DGLA 3EN8A 3MSOA 4FCJA 4IIAA 4Q53A 1DVDA 2GU3A 1JRQA 3U1WA 4FR9A 1BUQA 1VQM3 3CCM3 4O2HA 3J7Yd 5IENA 2Z6BA 2JQ5A 1Q40B 2D42A 1OUNA 2WOFA 3FG4A 1N9JA 4EBGA 1O7PB 2C10A 4KZ1A 2FGTA 2P05A 3LXUX 1U5OA 6STDA 1JN5A 3LZAA 3WA3A 1CQSA 4HZBB 1AVLA 5AEUB 1VQP3 3ER7A 4N6TA 1YVBI 2KXGA 3LYGA 3VGNA 3WOEB 4J8TA 5HGRA 4CDLA 3HZPA 2D1WA 1YIJ3 3MG3A 3NV0A 1KSIA 3Q2PA 4AKZA 4FMAA 2Y73A 4L7KA 1OHOA 3O8YA 4X2OA 1SPUA 1ULJB 2KCDA 3CCQ3 1AR0A 1D6UA 2W6JH 4KFFA 3UL6A 2B1XB 3A76A 4RNZA 2OQEC 1YJ93 3CPW2 3CC43 2B24B 1VQ93 3GZBA 5IEPA 4GB5A 1IVUA 4IPBA 3NXJA 3KIIA 2OCTA 5LC6A 3V98A 5IG0A 2CWUA 1W7CA 3UJMA 3WMDA 1N9EA 2O9UX 1MNLA 2CFKA 2ZDJA 4N6MA 4R4KA 3NQZA 1D6ZA 1FGTA 2W03A 1R4CA 1VQ43 1ROAA 3WOFB 2XFTA 1QVF2 1DYUA 4RBNA 4R80A 4XM4A 3F8HA 1O7WB 4N6LA 3ECFA 5EVHA 3CCL3 3DGOA 4H3UA 1DMMA 4EYCA 2PNCA 2W56A 1U8CB 3T8UA 3OX9A 2P09A 1KWIA 3UB1A 5IW9A 1K9M4 2I9WA 1J2BA 2W9QA 5ELUA 1VQ63 4HM6B 3LTDA 3DY5A 3MYTA 1K28A 3BB9A 3DUKA 1JKGA 2WOHA 1IT8A 4JRFA 1GYBA 2XGLA 1S723 1T5YA 3G713 1OHSA 3S27A 3PCSA 3KFQC 2O3OA 3Q1CA 1KC84 3F7SA 1UI8A 3KN4A 2FXTA 3CNXA 1M904 1DVCA 2WGOA 3FG3A 1SIIA 2OOVA 3X40A 1Z1SA 4I4KA 2BO9B 4MMXB 4XBYA 1EKMA 1JJ22 3UL5A 2XGNA 3KZTA 1N5PA 2Z7AA 4WWUC 3JUMA 5D83A 2CHCA 5JPUA 4LSOA 1IQYA 1FUWA 3T8NA 3LTAA 1FGMA 1TP6A 3EBYA 4N6OB 5EEOA 1VQ53 2YFJB 1TU5A 1ASKA 5AIGA 5LC7A 4IT7A 1PU4A 1WMNA 1STDA 3EHCA 2CWTA 1ZX2A 5D81A 2UX0A 1UUVB 4H61A 4G1MB 3H51A 3VSYA 4KFDA 3X3YA 1YHQ3 5CF2A 3NX0A 3FZWA 5CXOA 3F14A 1JB4A 1M9GA 2WGQA 4K61A 3UNLA 4TX4A 3FF2A 1W6GA 2P38A 7STDA 4HJLB 3JUPA 4J9AA 8CHOA 5AEWB 2GBWB 2XSHB 1W2B2 1GY7A 1Q40A 3S29A 4AEQA 1D6YA 1UUWB 3MWZA 4MMYB 4OVMA 3V92A 1OF5B 3CPOA 3DXOA 5IG5A 1JNQA 3M8CA 3N9HA 3EQQB 3OV4A 1RKYA 1NJI4 1A90A 2BHMA 3NHXA 2Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYZ A;  2MC8 A; 
#chains in the Genus database with same CATH topology
 2BMO B;  1VQL 3;  5AYS C;  1IDP A;  1B3S A;  1BIR A;  1O7G B;  2GEX A;  2INX A;  2XSO B;  4WFO A;  2WO0 A;  3HK4 A;  4X2H A;  2F99 A;  1W5Z A;  1B2U A;  1I3I A;  2IMJ A;  3HI7 A;  3EB8 A;  4L8P A;  3NV0 B;  3NQY A;  1VQK 3;  1GOV A;  2XFS A;  1HZ1 A;  1N5H A;  1O7M B;  1LNH A;  1TIJ A;  3EBT A;  3K63 A;  2L4V A;  2CX0 A;  2HOH A;  2BMR B;  1V74 A;  2HMO B;  4EC6 A;  4LEH A;  2CKF B;  1BSC A;  2RCD A;  2V1L A;  4QWT A;  1RN1 A;  1RRH A;  1UW1 A;  1STF I;  1JN5 B;  1WMO A;  2YFI B;  3B8L A;  3EE1 A;  3OWU A;  1A67 A;  3D4A A;  3CCJ 3;  1RGH A;  4RZM A;  1SJW A;  1QVG 2;  5AI1 A;  1CEW I;  1BOX A;  2CWV A;  4RNY A;  2F4Y A;  3S67 A;  1UCK A;  3EJV A;  2CFW A;  2BT3 A;  1TRP A;  4N6V 0;  1WTH A;  5A0O B;  1PYL A;  1OGX A;  1TUH A;  3ALA A;  2ZHX B;  4N6N B;  2W04 A;  4ZM8 A;  1KD1 4;  3WR2 A;  1RLS A;  3QRD A;  1X1U A;  3LH4 A;  1PFP A;  5FW5 A;  3CCE 3;  1JB5 A;  5G2G A;  1UCI A;  5STD A;  5CLK A;  2K54 A;  3G0K A;  1UCL A;  3TDG A;  1LOW A;  1T3B A;  4KVH A;  1Q81 4;  1BRN L;  1BNG A;  2KF4 A;  3PZW A;  4HM0 B;  1EEJ A;  3PS8 A;  1GOY A;  4HVN A;  2E2T A;  4XDW A;  3CCS 3;  3EX9 A;  1ULI B;  2RFR A;  2HML B;  3GZY B;  1BNI A;  1WMP A;  3D3L A;  2GU1 A;  3RDE A;  1MOL A;  3OXA A;  1LOX A;  2F98 A;  4WP5 A;  4U13 A;  1JV2 B;  3SX1 A;  1UGH I;  1A2K A;  3D9R A;  1YIT 3;  1FGO A;  4LMI A;  1SQW A;  2BMQ B;  1TRQ A;  1AV4 A;  8RNT A;  1C54 A;  3SLU A;  2ML6 A;  4O02 B;  2HMJ B;  1GD3 A;  2E2U A;  1FGQ A;  1TFO A;  2R4I A;  3G4S 3;  5DRV A;  1OPY A;  1K41 A;  1W00 A;  1G96 A;  4XB5 A;  1WNH A;  2HMM B;  1VZZ A;  1MGW A;  3NBB A;  3WHO A;  3BNB A;  1JBR A;  3MPH A;  1GD4 A;  3LOY A;  3T0U A;  5BXQ A;  1RGL A;  3NUV A;  2R41 A;  2J8X B;  4XDV A;  2Z76 A;  3MG2 A;  5TGN A;  3U97 A;  4ORL A;  4WYK B;  3CNM A;  3K9M C;  4CPK A;  3BND A;  1V57 A;  4N3V A;  1IVW A;  4K1U A;  2UUG C;  2OWP A;  3RGA A;  3CD6 3;  4BTW A;  2C4B A;  2CFL A;  3MG1 A;  1LOY A;  3SOY A;  4EV2 A;  7GSP A;  5CK6 A;  1Q86 4;  3D5I A;  3PXM A;  4GSP A;  2JDI H;  1HKX A;  3WOD G;  4BL2 A;  1E3R A;  1BVI A;  2Z77 A;  3OWS A;  2IUJ A;  3GRD A;  3CC2 3;  1YGE A;  4HM5 B;  3SXX A;  1OAC A;  4MEI A;  1QAL A;  3L0R A;  3MKI A;  4PEJ A;  1NU3 A;  3F40 A;  1E97 A;  3DMC A;  3JVC A;  1IK3 A;  1LOV A;  1W02 A;  3WDG B;  1LQM B;  4HM7 B;  3PYJ A;  4K1V A;  1GMR A;  2K0M A;  3N8B A;  5D82 A;  1M1K 4;  4AKY A;  3DGM A;  2YX9 A;  2AAD A;  3AMO A;  3JUQ A;  1GY5 A;  1GS3 A;  3DGN A;  3SVA A;  1YJN 3;  2GXF A;  1N8R 4;  1ISK A;  6GSP A;  3I56 3;  1UI7 A;  1NWW A;  2LYX A;  3LT8 A;  5HOH A;  5ELJ A;  3D79 A;  4I5Q A;  1W01 A;  3NM2 A;  3BIR A;  3D5G A;  3FGY A;  3BNC A;  3BLZ A;  3GAX A;  4FCM A;  1IV7 A;  1LRA A;  3NM7 A;  2H0G A;  4HM8 B;  4R9K A;  3V99 A;  1TTO A;  3CC7 3;  1NDO B;  1RJO A;  4HOH A;  4XBX A;  5EQL A;  1LNI A;  2XR8 B;  3HII A;  4HM4 B;  4NPB A;  3K7C A;  1DMQ A;  1T2I A;  1Y4K A;  1HU9 A;  2A15 A;  2XH9 A;  3B4O A;  3BNE A;  3LTB A;  4K90 B;  4NHF A;  5FGO A;  5KP3 A;  1E3V A;  4O8S A;  2ZA4 A;  4JF8 A;  2UGI A;  1MWU A;  1KQS 2;  4BU4 A;  5AYR B;  1I2G A;  3RGR A;  1RNB A;  1UUG B;  1IV9 A;  1W6C A;  5DRE A;  1LVN A;  2CG0 A;  1ROV A;  3GZX B;  3WA2 X;  1MWT A;  4HM3 B;  1VQO 3;  1JBS A;  5AII A;  3RNT A;  1BNS A;  2RNT A;  2MF7 A;  3FCS B;  5KP1 A;  2IYJ A;  3IJE B;  5IER A;  4KFE A;  3I55 3;  4HM2 B;  4R9L A;  1YJW 3;  3FSD A;  2C11 A;  2RGQ A;  1BRI A;  2XEP A;  2ZL8 A;  2F86 B;  5KP4 A;  2FNQ A;  1EUI C;  2KF6 A;  1IVV A;  2CIU A;  1TFK A;  1O7H B;  1FA3 A;  1N8Q A;  4EXR A;  5IG3 A;  1LXE A;  1Q7H A;  2P0X A;  3CCV 3;  1EA2 A;  1OGZ A;  1OF5 A;  1TJD A;  1W2Z A;  6RNT A;  1OCV A;  3AGO A;  1FUT A;  2OTL 3;  1AVK A;  3PCR A;  2KRT A;  1CYV A;  3LT9 A;  2Q07 A;  4N6U A;  2OTJ 3;  1FGR A;  3F7X A;  3KCH A;  4R1K A;  1X1W A;  2SAR A;  5IEO A;  2MC8 A;  2AAE A;  4XBT A;  3OW2 2;  3AMO B;  3ZG5 A;  2W0Q A;  3G8Z A;  2IY2 A;  3F9S A;  1B27 A;  1G0T A;  3LML A;  1RGC A;  1RRL A;  5IG4 A;  1UCJ A;  1W4N A;  3ROB A;  3URP A;  1BSE A;  1LQG C;  3GSP A;  1O7N B;  4RNT A;  3K5T A;  1S5A A;  3VF1 A;  1BSB A;  5AIF A;  4BTX A;  1CYU A;  1I2E A;  1UGI A;  4OUQ A;  4O3V A;  2KF5 A;  2XF3 A;  3FH1 A;  1I0V A;  3SYU A;  3B7C A;  3X41 A;  1YI2 3;  3FG1 A;  1QMA A;  2W56 B;  3HX8 A;  1SIH A;  3FF0 A;  2CH9 A;  3OWY A;  3SOA A;  3KSE D;  1K73 4;  1B2Z A;  5JPP A;  3F8X A;  3EN1 B;  3PGB A;  2YFL B;  1DMN A;  2QIY A;  1VQN 3;  2W2C A;  1GMP A;  2BNG A;  3NBR A;  3EF8 A;  3E99 A;  1RCK A;  2BU4 A;  1HYF A;  7RNT A;  1JBT A;  1BNF A;  4GL6 A;  3SED A;  4DKI A;  2QA4 3;  3LTC A;  3K0Z A;  4EV5 A;  2CK3 H;  4L8O A;  1OH0 A;  1FZU A;  1GSP A;  1RN7 A;  3IMA B;  1NB5 I;  5BIR A;  2P0M A;  1L5G B;  1BSD A;  2CFD A;  2QGU A;  3Q3F A;  5AIH A;  1AY7 A;  2STD A;  5GSP A;  2GEY A;  2LQV A;  4BTY A;  1WQL B;  5BU4 A;  3GWR A;  1IQ8 A;  1Q9E A;  1QAK A;  3S28 A;  2GBX B;  4HYZ A;  3HIG A;  1B2S A;  3DH2 A;  4FMD A;  1IVX A;  3H3H A;  4HKV B;  3S5C A;  5BVB A;  2M7O A;  1IT7 A;  1F8N A;  1FUS A;  1MWR A;  1Q42 A;  1X1X A;  3JUO A;  2CW9 A;  2CG1 A;  5IF6 A;  2E2V A;  3N54 B;  3IPT A;  2HMN B;  1ZO2 A;  3JUN A;  4HZ9 B;  3ZFZ A;  2OQE A;  4FMB A;  4WYK A;  1ZGX A;  5M19 A;  1C7H A;  2IUK A;  2RBI A;  4HM1 B;  2KAA A;  2ML5 A;  5CF1 A;  3MHE A;  4MMZ B;  3CXC 2;  3X3Z A;  3HOH A;  1W6Y A;  5M18 A;  1V58 A;  1IU7 A;  3B4P A;  3FKA A;  1GY6 A;  1IQX A;  1JZO A;  3KKG A;  4CCV A;  1JB2 A;  2XRX B;  1EQK A;  4MJD A;  3GZR A;  4LGQ A;  1K8A 4;  3NBJ A;  3CME 3;  2GSP A;  3CCU 3;  2IA7 A;  3I0Y A;  1X1Y A;  2CC3 A;  5I97 A;  1T2H A;  1BNE A;  1BRK A;  1OHP A;  1US1 A;  3ZG0 A;  1QJG A;  2CFG A;  3CMA 3;  2L1S A;  3G6E 3;  4GHO A;  3X42 A;  4FMC A;  1BGS A;  1A2V A;  5M1A A;  1BSA A;  1VQ7 3;  1GOU A;  1NB3 I;  1RGA A;  1BNR A;  4HBR A;  1QAF A;  4OK0 A;  5JBS A;  2PZV A;  2SBL A;  3G16 A;  2QEX 3;  1VQ8 3;  1BUJ A;  3FLJ A;  3QK9 A;  1Q82 4;  3DZL A;  1Q7Y 4;  4STD A;  2HMK B;  3CU3 A;  1M1X B;  2W9P A;  3KE7 A;  3STD A;  4FCZ A;  3X3X A;  3KSP A;  1NO3 A;  3Q90 A;  2OOV C;  3EC9 A;  1JKG B;  4NRE A;  2RSX A;  3DM8 A;  1EG9 B;  1ZS7 A;  1B21 A;  1BRS A;  3CCR 3;  4WHA A;  3DGL A;  3EN8 A;  3MSO A;  4FCJ A;  1JZD A;  4IIA A;  2H0H A;  4Q53 A;  5RNT A;  2GU3 A;  1JRQ A;  2H0I A;  4FR9 A;  3U1W A;  1DVD A;  1BUQ A;  1VQM 3;  3CCM 3;  4O2H A;  3J7Y d;  1B2M A;  5IEN A;  2Z6B A;  2JQ5 A;  1Q40 B;  2D42 A;  4LYL B;  1OUN A;  1PY3 A;  1A2P A;  2WOF A;  3FG4 A;  1BRH A;  1N9J A;  4EBG A;  1O7P B;  2C10 A;  4KZ1 A;  1G02 A;  2FGT A;  4ILF A;  1GMQ A;  1MWS A;  2P05 A;  3LXU X;  1U5O A;  5G1L A;  6STD A;  1DET A;  1JN5 A;  3LZA A;  3WA3 A;  4LZI A;  1CQS A;  1DE3 A;  4HZB B;  1AVL A;  3AHS A;  5AEU B;  1VQP 3;  3ER7 A;  4N6T A;  1YVB I;  2KXG A;  3LYG A;  3VGN A;  1YGW A;  3WOE B;  1BRJ A;  2F5M A;  4J8T A;  5HGR A;  4CJN A;  4CDL A;  3HZP A;  2D1W A;  1YIJ 3;  1RTU A;  3MG3 A;  3NV0 A;  1I70 A;  1KSI A;  3Q2P A;  1CH0 A;  4FMA A;  2Y73 A;  4L7K A;  4AKZ A;  1OHO A;  1RGE A;  3O8Y A;  1SPU A;  1ULJ B;  4X2O A;  4EW5 A;  2KCD A;  3CCQ 3;  1AR0 A;  1D6U A;  2W6J H;  4KFF A;  3UL6 A;  2B1X B;  3A76 A;  4RNZ A;  1RDS A;  2OQE C;  4BL3 A;  3CPW 2;  1YJ9 3;  2B24 B;  1VQ9 3;  1BAN A;  3CC4 3;  3GZB A;  5IEP A;  4GB5 A;  1IVU A;  4IPB A;  3NXJ A;  3KII A;  2OCT A;  5LC6 A;  3V98 A;  1MGR A;  2CWU A;  5IG0 A;  1W7C A;  3UJM A;  3WMD A;  1N9E A;  2O9U X;  1MNL A;  2CFK A;  2ZDJ A;  4N6M A;  4R4K A;  3NQZ A;  5G1K A;  1D6Z A;  1FGT A;  2W03 A;  1SAR A;  1AQZ A;  1R4C A;  1VQ4 3;  1ROA A;  3WOF B;  2XFT A;  9RNT A;  3AHW A;  1QVF 2;  1DYU A;  1RCL A;  1BAO A;  4RBN A;  4R80 A;  4XM4 A;  3F8H A;  1O7W B;  4N6L A;  3ECF A;  5EVH A;  1I3F A;  1RHL A;  1RGK A;  3CCL 3;  3A5E A;  3DGO A;  4H3U A;  1DMM A;  4EYC A;  2PNC A;  2W56 A;  1U8C B;  3T8U A;  3OX9 A;  2P09 A;  1KWI A;  3UB1 A;  5IW9 A;  1I8V A;  1K9M 4;  2I9W A;  1J2B A;  2W9Q A;  5ELU A;  2F5W A;  1VQ6 3;  4HM6 B;  3BU4 A;  3LTD A;  3DY5 A;  3MYT A;  1K28 A;  3BB9 A;  1RGG A;  3AGN A;  3DUK A;  1JKG A;  2WOH A;  1IT8 A;  4JRF A;  1GYB A;  2XGL A;  1S72 3;  1T5Y A;  3G71 3;  1OHS A;  3S27 A;  3PCS A;  3KFQ C;  2O3O A;  3Q1C A;  1KC8 4;  3F7S A;  1BNJ A;  1UI8 A;  3KN4 A;  1BU4 A;  2FXT A;  2KF3 A;  3CNX A;  1M90 4;  1DVC A;  2WGO A;  4J5K A;  1B20 A;  3FG3 A;  1SII A;  2OOV A;  3X40 A;  4BIR A;  1B2X A;  1I0X A;  1Z1S A;  4I4K A;  2BO9 B;  1IYY A;  4J5G A;  4MMX B;  4XBY A;  1EKM A;  1JJ2 2;  3UL5 A;  2XGN A;  3KZT A;  1RGF A;  1N5P A;  2Z7A A;  4WWU C;  3JUM A;  5D83 A;  2CHC A;  4HAA A;  5JPU A;  4LSO A;  1IQY A;  1FUW A;  2CX1 A;  3T8N A;  1NNV A;  3LTA A;  1FGM A;  1TP6 A;  2F56 A;  3EBY A;  4N6O B;  5EEO A;  1VQ5 3;  1RN4 A;  2YFJ B;  1TU5 A;  1ASK A;  5AIG A;  5LC7 A;  4IT7 A;  1PU4 A;  1WMN A;  1STD A;  3EHC A;  2CWT A;  1ZX2 A;  5D81 A;  1RMS A;  2UX0 A;  1UUV B;  4H61 A;  4KT3 B;  4G1M B;  3H51 A;  3VSY A;  4KFD A;  3X3Y A;  1FYS A;  1YHQ 3;  1YNV X;  5CF2 A;  3DGY A;  2BIR A;  3NX0 A;  2K3D A;  3FZW A;  5CXO A;  3F14 A;  1JB4 A;  1M9G A;  2WGQ A;  1FW7 A;  4K61 A;  3UNL A;  4TX4 A;  3FF2 A;  1R4Y A;  1W6G A;  1YVS A;  2P38 A;  1I2F A;  7STD A;  4HJL B;  3JUP A;  1UDI I;  4J9A A;  8CHO A;  5AEW B;  2GBW B;  2XSH B;  1W2B 2;  1GY7 A;  1Q40 A;  1BRG A;  1RNT A;  1RSN A;  3S29 A;  4AEQ A;  1D6Y A;  1UUW B;  3MWZ A;  4MMY B;  4OVM A;  3V92 A;  1OF5 B;  3CPO A;  1VQQ A;  3DXO A;  5IG5 A;  1JNQ A;  3M8C A;  3N9H A;  3EQQ B;  3OV4 A;  1RKY A;  1NJI 4;  1A90 A;  2BHM A;  3NHX A;  2Y74 A; 
#chains in the Genus database with same CATH homology
 2BMO B;  1VQL 3;  5AYS C;  1IDP A;  1O7G B;  2GEX A;  2INX A;  2XSO B;  4WFO A;  2WO0 A;  3HK4 A;  4X2H A;  2F99 A;  1W5Z A;  2IMJ A;  3HI7 A;  4L8P A;  3EB8 A;  3NV0 B;  3NQY A;  1VQK 3;  2XFS A;  1N5H A;  1O7M B;  1LNH A;  1TIJ A;  3EBT A;  3K63 A;  2L4V A;  2BMR B;  1V74 A;  2HMO B;  4EC6 A;  4LEH A;  2CKF B;  2RCD A;  2V1L A;  4QWT A;  1RRH A;  1UW1 A;  1STF I;  1JN5 B;  1WMO A;  2YFI B;  3B8L A;  3EE1 A;  3OWU A;  1A67 A;  3CCJ 3;  4RZM A;  1SJW A;  1QVG 2;  5AI1 A;  1CEW I;  2CWV A;  4RNY A;  3S67 A;  3EJV A;  2CFW A;  2BT3 A;  4N6V 0;  1WTH A;  5A0O B;  1OGX A;  1TUH A;  3ALA A;  4N6N B;  2W04 A;  4ZM8 A;  1KD1 4;  3QRD A;  3LH4 A;  1PFP A;  5FW5 A;  3CCE 3;  1JB5 A;  5G2G A;  5STD A;  5CLK A;  2K54 A;  3G0K A;  3TDG A;  1Q81 4;  4KVH A;  3PZW A;  4HM0 B;  3PS8 A;  4HVN A;  2E2T A;  4XDW A;  3CCS 3;  3EX9 A;  1ULI B;  2RFR A;  2HML B;  3GZY B;  1WMP A;  3D3L A;  2GU1 A;  3RDE A;  1MOL A;  3OXA A;  1LOX A;  2F98 A;  4WP5 A;  4U13 A;  1JV2 B;  3SX1 A;  1YIT 3;  1A2K A;  3D9R A;  1FGO A;  4LMI A;  1SQW A;  2BMQ B;  1AV4 A;  3SLU A;  2ML6 A;  4O02 B;  2HMJ B;  1GD3 A;  2E2U A;  1FGQ A;  1TFO A;  2R4I A;  3G4S 3;  5DRV A;  1OPY A;  1K41 A;  1W00 A;  1G96 A;  4XB5 A;  1WNH A;  2HMM B;  1VZZ A;  3NBB A;  3BNB A;  3MPH A;  1GD4 A;  3LOY A;  3T0U A;  5BXQ A;  3NUV A;  4XDV A;  5TGN A;  2Z76 A;  3MG2 A;  3U97 A;  4ORL A;  4WYK B;  3CNM A;  3K9M C;  3BND A;  4N3V A;  1IVW A;  4K1U A;  2OWP A;  3RGA A;  3CD6 3;  4BTW A;  2CFL A;  3MG1 A;  3SOY A;  4EV2 A;  5CK6 A;  1Q86 4;  3PXM A;  2JDI H;  1HKX A;  3WOD G;  1E3R A;  2Z77 A;  3OWS A;  2IUJ A;  3GRD A;  3CC2 3;  1YGE A;  4HM5 B;  3SXX A;  1OAC A;  4MEI A;  1QAL A;  3L0R A;  3MKI A;  4PEJ A;  1NU3 A;  3F40 A;  1E97 A;  3DMC A;  3JVC A;  1IK3 A;  1W02 A;  3WDG B;  4HM7 B;  3PYJ A;  4K1V A;  2K0M A;  3N8B A;  5D82 A;  1M1K 4;  4AKY A;  3DGM A;  3AMO A;  2YX9 A;  3JUQ A;  1GY5 A;  1GS3 A;  3DGN A;  3SVA A;  1YJN 3;  2GXF A;  1N8R 4;  1ISK A;  3I56 3;  1UI7 A;  1NWW A;  2LYX A;  3LT8 A;  5ELJ A;  1W01 A;  3NM2 A;  4LZI A;  3FGY A;  3BNC A;  3BLZ A;  3GAX A;  4FCM A;  1IV7 A;  3NM7 A;  4HM8 B;  4R9K A;  3V99 A;  3CC7 3;  1NDO B;  1RJO A;  4XBX A;  5EQL A;  2XR8 B;  3HII A;  4HM4 B;  3K7C A;  1DMQ A;  4K90 B;  1Y4K A;  1HU9 A;  2A15 A;  2XH9 A;  3BNE A;  3B4O A;  3LTB A;  4NHF A;  5FGO A;  5KP3 A;  1E3V A;  4O8S A;  4JF8 A;  1KQS 2;  5AYR B;  3RGR A;  1IV9 A;  1W6C A;  5DRE A;  1LVN A;  2CG0 A;  1ROV A;  3GZX B;  3WA2 X;  4HM3 B;  1VQO 3;  5AII A;  2MF7 A;  3FCS B;  5KP1 A;  3IJE B;  5IER A;  3I55 3;  4KFE A;  4HM2 B;  4R9L A;  1YJW 3;  3FSD A;  2C11 A;  2RGQ A;  2XEP A;  2ZL8 A;  2F86 B;  5KP4 A;  2FNQ A;  1IVV A;  2CIU A;  1TFK A;  1O7H B;  1FA3 A;  1N8Q A;  4EXR A;  5IG3 A;  1LXE A;  2P0X A;  3CCV 3;  1EA2 A;  1OGZ A;  1OF5 A;  1W2Z A;  1OCV A;  2OTL 3;  1AVK A;  3PCR A;  2KRT A;  1CYV A;  3LT9 A;  2Q07 A;  4N6U A;  2OTJ 3;  1FGR A;  3F7X A;  4R1K A;  5IEO A;  2MC8 A;  4XBT A;  3OW2 2;  3AMO B;  2W0Q A;  3G8Z A;  3F9S A;  3LML A;  1RRL A;  5IG4 A;  1W4N A;  3ROB A;  1O7N B;  3VF1 A;  3K5T A;  1S5A A;  5AIF A;  4BTX A;  1CYU A;  4OUQ A;  4O3V A;  2XF3 A;  3FH1 A;  3B7C A;  3X41 A;  1YI2 3;  3FG1 A;  1QMA A;  2W56 B;  3HX8 A;  1SIH A;  3FF0 A;  2CH9 A;  3OWY A;  3SOA A;  3KSE D;  1K73 4;  5JPP A;  3F8X A;  3EN1 B;  3PGB A;  2YFL B;  1DMN A;  2QIY A;  1VQN 3;  2W2C A;  2BNG A;  3NBR A;  3EF8 A;  3E99 A;  4GL6 A;  3SED A;  2QA4 3;  3LTC A;  3K0Z A;  4EV5 A;  2CK3 H;  4L8O A;  1OH0 A;  1RN7 A;  3IMA B;  1NB5 I;  2P0M A;  1L5G B;  2CFD A;  2QGU A;  5AIH A;  2STD A;  2GEY A;  2LQV A;  4BTY A;  1WQL B;  3GWR A;  1IQ8 A;  1QAK A;  3S28 A;  2GBX B;  4HYZ A;  3HIG A;  4FMD A;  3S5C A;  4HKV B;  1IVX A;  3H3H A;  5BVB A;  2M7O A;  1IT7 A;  1F8N A;  2CG1 A;  1Q42 A;  3JUO A;  5IF6 A;  2CW9 A;  2E2V A;  3N54 B;  3IPT A;  2HMN B;  1ZO2 A;  3JUN A;  4HZ9 B;  2OQE A;  4FMB A;  4WYK A;  1C7H A;  2IUK A;  4HM1 B;  2ML5 A;  5CF1 A;  3MHE A;  4MMZ B;  3CXC 2;  3X3Z A;  1W6Y A;  1IU7 A;  3B4P A;  3FKA A;  1GY6 A;  1IQX A;  3KKG A;  4CCV A;  1JB2 A;  2XRX B;  1EQK A;  4MJD A;  3GZR A;  4LGQ A;  1K8A 4;  3NBJ A;  3CME 3;  3CCU 3;  2IA7 A;  3I0Y A;  2CC3 A;  5I97 A;  1OHP A;  1US1 A;  1QJG A;  2CFG A;  3CMA 3;  3G6E 3;  3X42 A;  4FMC A;  1A2V A;  1VQ7 3;  1NB3 I;  4HBR A;  1QAF A;  4OK0 A;  5JBS A;  2PZV A;  2SBL A;  3G16 A;  2QEX 3;  1VQ8 3;  3FLJ A;  3QK9 A;  1Q82 4;  3DZL A;  1Q7Y 4;  4STD A;  2HMK B;  3CU3 A;  1M1X B;  2W9P A;  3KE7 A;  3STD A;  4FCZ A;  3X3X A;  3KSP A;  1NO3 A;  3Q90 A;  2OOV C;  3EC9 A;  1JKG B;  4NRE A;  2RSX A;  3DM8 A;  1EG9 B;  3CCR 3;  4WHA A;  3DGL A;  3EN8 A;  3MSO A;  4FCJ A;  4IIA A;  4Q53 A;  1DVD A;  2GU3 A;  1JRQ A;  3U1W A;  4FR9 A;  1BUQ A;  1VQM 3;  3CCM 3;  4O2H A;  3J7Y d;  5IEN A;  2Z6B A;  2JQ5 A;  1Q40 B;  2D42 A;  1OUN A;  2WOF A;  3FG4 A;  1N9J A;  4EBG A;  1O7P B;  2C10 A;  4KZ1 A;  2FGT A;  2P05 A;  3LXU X;  1U5O A;  6STD A;  1JN5 A;  3LZA A;  3WA3 A;  1CQS A;  4HZB B;  1AVL A;  5AEU B;  1VQP 3;  3ER7 A;  4N6T A;  1YVB I;  2KXG A;  3LYG A;  3VGN A;  3WOE B;  4J8T A;  5HGR A;  4CDL A;  3HZP A;  2D1W A;  1YIJ 3;  3MG3 A;  3NV0 A;  1KSI A;  3Q2P A;  4AKZ A;  4FMA A;  2Y73 A;  4L7K A;  1OHO A;  3O8Y A;  4X2O A;  1SPU A;  1ULJ B;  2KCD A;  3CCQ 3;  1AR0 A;  1D6U A;  2W6J H;  4KFF A;  3UL6 A;  2B1X B;  3A76 A;  4RNZ A;  2OQE C;  1YJ9 3;  3CPW 2;  3CC4 3;  2B24 B;  1VQ9 3;  3GZB A;  5IEP A;  4GB5 A;  1IVU A;  4IPB A;  3NXJ A;  3KII A;  2OCT A;  5LC6 A;  3V98 A;  5IG0 A;  2CWU A;  1W7C A;  3UJM A;  3WMD A;  1N9E A;  2O9U X;  1MNL A;  2CFK A;  2ZDJ A;  4N6M A;  4R4K A;  3NQZ A;  1D6Z A;  1FGT A;  2W03 A;  1R4C A;  1VQ4 3;  1ROA A;  3WOF B;  2XFT A;  1QVF 2;  1DYU A;  4RBN A;  4R80 A;  4XM4 A;  3F8H A;  1O7W B;  4N6L A;  3ECF A;  5EVH A;  3CCL 3;  3DGO A;  4H3U A;  1DMM A;  4EYC A;  2PNC A;  2W56 A;  1U8C B;  3T8U A;  3OX9 A;  2P09 A;  1KWI A;  3UB1 A;  5IW9 A;  1K9M 4;  2I9W A;  1J2B A;  2W9Q A;  5ELU A;  1VQ6 3;  4HM6 B;  3LTD A;  3DY5 A;  3MYT A;  1K28 A;  3BB9 A;  3DUK A;  1JKG A;  2WOH A;  1IT8 A;  4JRF A;  1GYB A;  2XGL A;  1S72 3;  1T5Y A;  3G71 3;  1OHS A;  3S27 A;  3PCS A;  3KFQ C;  2O3O A;  3Q1C A;  1KC8 4;  3F7S A;  1UI8 A;  3KN4 A;  2FXT A;  3CNX A;  1M90 4;  1DVC A;  2WGO A;  3FG3 A;  1SII A;  2OOV A;  3X40 A;  1Z1S A;  4I4K A;  2BO9 B;  4MMX B;  4XBY A;  1EKM A;  1JJ2 2;  3UL5 A;  2XGN A;  3KZT A;  1N5P A;  2Z7A A;  4WWU C;  3JUM A;  5D83 A;  2CHC A;  5JPU A;  4LSO A;  1IQY A;  1FUW A;  3T8N A;  3LTA A;  1FGM A;  1TP6 A;  3EBY A;  4N6O B;  5EEO A;  1VQ5 3;  2YFJ B;  1TU5 A;  1ASK A;  5AIG A;  5LC7 A;  4IT7 A;  1PU4 A;  1WMN A;  1STD A;  3EHC A;  2CWT A;  1ZX2 A;  5D81 A;  2UX0 A;  1UUV B;  4H61 A;  4G1M B;  3H51 A;  3VSY A;  4KFD A;  3X3Y A;  1YHQ 3;  5CF2 A;  3NX0 A;  3FZW A;  5CXO A;  3F14 A;  1JB4 A;  1M9G A;  2WGQ A;  4K61 A;  3UNL A;  4TX4 A;  3FF2 A;  1W6G A;  2P38 A;  7STD A;  4HJL B;  3JUP A;  4J9A A;  8CHO A;  5AEW B;  2GBW B;  2XSH B;  1W2B 2;  1GY7 A;  1Q40 A;  3S29 A;  4AEQ A;  1D6Y A;  1UUW B;  3MWZ A;  4MMY B;  4OVM A;  3V92 A;  1OF5 B;  3CPO A;  3DXO A;  5IG5 A;  1JNQ A;  3M8C A;  3N9H A;  3EQQ B;  3OV4 A;  1RKY A;  1NJI 4;  1A90 A;  2BHM A;  3NHX A;  2Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...