1B21A

Deletion of a buried salt bridge in barnase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
QVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGSTWREADINYTSGFRNSDRILYSSNWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 31
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b21A00
1X1XA 1FUSA 3AGOA 1BNIA 1RCLA 1X1WA 1BNFA 1T2IA 1B2MA 2RNTA 1B2SA 1GMPA 1GOUA 3WR2A 2AAEA 1I2FA 1I3IA 2KF3A 3AHWA 1BUJA 1Q9EA 2AADA 2F56A 3DGYA 1BVIA 2SARA 1MGWA 3RNTA 1LOYA 1UCJA 1FW7A 1UCKA 1JBTA 1TRQA 2F5MA 6RNTA 1MGRA 1B2XA 1BRGA 1I0XA 1PY3A 1RNTA 3SYUA 1B3SA 1GMQA 1JBRA 1I2EA 3DH2A 3BU4A 1RGCA 1IYYA 4HAAA 1RGGA 1JBSA 1BRNL 7GSPA 1B20A 1FZUA 1UCLA 1B2UA 1I0VA 1BOXA 1BSDA 1T2HA 1HZ1A 3AGNA 3Q3FA 1B2ZA 1CH0A 3KCHA 1FUTA 1GOVA 2F5WA 6GSPA 1DE3A 7RNTA 5BU4A 1R4YA 1RCKA 1BIRA 1GOYA 1AQZA 1RHLA 9RNTA 3A5EA 5GSPA 1YGWA 1BANA 1DETA 1PYLA 3AHSA 1ZGXA 2ZA4A 1BNGA 2KF5A 2KF4A 1BSBA 1GSPA 1B27A 1BAOA 1RGHA 1YNVX 2KF6A 5HOHA 4J5KA 1RNBA 1RTUA 1BGSA 1RDSA 4HOHA 3D5IA 1B21A 1RLSA 1UCIA 1BNRA 3HOHA 1RGKA 1AY7A 3BIRA 4GSPA 1BRIA 4GHOA 4J5GA 1BNSA 1FYSA 2F4YA 1BRKA 1RN1A 1SARA 1TRPA 3WHOA 1I70A 1BU4A 5BIRA 1RGEA 1RSNA 1GMRA 1RGFA 2GSPA 1LOWA 1BNJA 1RN4A 2BU4A 1A2PA 2BIRA 1X1UA 1G02A 8RNTA 4BIRA 1X1YA 3D4AA 5RNTA 2C4BA 3D5GA 4BU4A 1LOVA 4RNTA 1C54A 1RGLA 1BSAA 1BSEA 2RBIA 3URPA 1I3FA 1BRSA 1BRJA 2KAAA 1LNIA 1I2GA 1TTOA 1RGAA 1BRHA 2HOHA 1BNEA 1RMSA 3GSPA 1YVSA 1HYFA 1LRAA 1I8VA 1BSCA
chains in the Genus database with same CATH superfamily
3AGOA 1Q7Y4 1NB3I 1Q40A 3Q1CA 5IERA 1JZOA 1QJGA 1TFKA 2GU3A 4I4KA 3SVAA 1YIJ3 2F98A 1B2SA 5AI1A 4FCJA 1NB5I 1I2FA 2KF3A 1LOXA 2W6JH 3AHWA 3GZYB 2F56A 2CFLA 3DGYA 2SARA 5IEPA 2BHMA 1NNVA 1VQM3 2ML5A 1OF5A 1WNHA 3HX8A 3S5CA 1UCKA 2L4VA 3DXOA 4N6NB 3V98A 4NREA 3LXUX 4GB5A 3NX0A 3NBJA 3GAXA 1K28A 2XSHB 2YFIB 1B2XA 1I0XA 2CW9A 3DGLA 1RRHA 3F7SA 1M904 1JKGB 2ZL8A 3BU4A 4X2OA 4WYKA 3D3LA 3X40A 1TUHA 3JUNA 3KFQC 4AKYA 4H3UA 1JBSA 2CK3H 4LZIA 4MEIA 1A2VA 2KCDA 7GSPA 4LYLB 1UCLA 1B2UA 1QAKA 3NM7A 3WOFB 2W2CA 2P0XA 3CPW2 4HZBB 3Q2PA 4L8PA 2W56B 3B7CA 1T2HA 3DGNA 3EN1B 2FXTA 1CYUA 3EBYA 4X2HA 3EC9A 1C7HA 3LOYA 2L1SA 2OTL3 1LQGC 3ALAA 1W02A 1K8A4 3B8LA 5AYRB 1FGOA 1KQS2 3BNEA 1NO3A 1T3BA 4RNZA 3FH1A 3LMLA 5GSPA 3A76A 2XSOB 1PYLA 4NHFA 3AHSA 2ZA4A 4WHAA 3CME3 3G8ZA 4EC6A 1W2B2 2KF4A 4OUQA 3G0KA 4K61A 3CCQ3 2ML6A 3CCS3 3OXAA 5KP1A 3SX1A 1U8CB 2Z7AA 1RNBA 3GWRA 3OW22 1HKXA 1VQO3 1UDII 1AR0A 3Q90A 3CC23 1G96A 1SJWA 4HOHA 3K63A 2STDA 4HM8B 1B21A 3DGOA 4JRFA 1DYUA 5D83A 3LT9A 1DMQA 3BIRA 3LTDA 1QMAA 3WA3A 1Q40B 4PEJA 4RZMA 3NBRA 4HBRA 1FGTA 4Q53A 4XB5A 1RN1A 3WMDA 1D6UA 1PU4A 1GD4A 3KSPA 1US1A 5EVHA 3CC43 2Y74A 3O8YA 5AIFA 2BT3A 3LTAA 5EEOA 1RGEA 1GY7A 1RSNA 3UNLA 1JV2B 5M18A 1RGFA 2E2TA 3UB1A 3BNDA 1LOWA 1RN4A 2BU4A 2Z76A 4EV5A 2W9PA 3F8XA 2OQEA 1X1UA 3DZLA 3LH4A 1G02A 1KD14 5D81A 1UUGB 1IT7A 4DKIA 2GEYA 4XDWA 3D4AA 1W6CA 4WP5A 5JBSA 1AVLA 1JKGA 4XBTA 4RNTA 1RGLA 5IENA 1S5AA 3CCR3 1FGMA 3F9SA 3JUQA 4LGQA 3VF1A 1DVCA 1BRJA 2WO0A 3HIIA 3DM8A 1IQ8A 4IPBA 4N3VA 1TTOA 1Q7HA 3UL5A 3VGNA 5CXOA 2W56A 1O7PB 4H61A 4MMXB 1VQ93 5TGNA 4HM6B 3GSPA 1D6YA 3NQYA 5AIHA 1YVSA 3UL6A 1RJOA 1FUSA 1BNIA 1JB2A 2C11A 1MWTA 1BNFA 1E3VA 1T2IA 3NXJA 1B2MA 2RNTA 3J7Yd 1GMPA 2OOVA 3OWUA 3JUMA 3T8NA 4BTWA 2CC3A 2AAEA 3ER7A 4KFDA 1L5GB 3X41A 1Q9EA 2AADA 3FLJA 3FG4A 1BVIA 2P0MA 1EG9B 1HU9A 1UCJA 2ZHXB 3DUKA 3F8HA 2A15A 3NM2A 3PCSA 5M19A 4K1UA 1RN7A 1UGIA 4CPKA 4KFFA 2F5MA 5I97A 4N6LA 5AIGA 1MGRA 1BRGA 1ZO2A 1RNTA 5ELUA 2CG1A 1B3SA 4CCVA 1GMQA 4HVNA 3LYGA 1I2EA 3SXXA 1JBRA 2W04A 1N8QA 1LQMB 2RCDA 1GD3A 1QAFA 5A0OB 4O8SA 3WODG 1K734 3KE7A 1I0VA 1BOXA 2CWTA 3B4PA 2CKFB 5JPPA 5IW9A 4N6OB 1NJI4 2Q07A 3AGNA 3Q3FA 2XGNA 4L8OA 3CMA3 2Y73A 3CNMA 3KCHA 4FMCA 1FUTA 3KN4A 1Y4KA 3NV0B 4FMAA 1N5PA 2F5WA 2WGQA 6GSPA 3EE1A 3KKGA 5BU4A 4J9AA 1R4YA 4WFOA 3X3YA 5EQLA 5IG0A 5M1AA 1YHQ3 1GOYA 2CFKA 4XBXA 1VQ43 1AVKA 1JB4A 1RHLA 1ULIB 2F86B 3EQQB 5CF2A 3A5EA 3RGRA 3QK9A 5HGRA 1YGWA 1BANA 3CNXA 1DETA 3HI7A 5G2GA 2KF5A 3FKAA 1O7HB 1BUQA 4I5QA 1ZS7A 2CH9A 3K9MC 1RGHA 1N9EA 1YNVX 5BVBA 1A67A 1IVWA 4MJDA 4HYZA 5IG3A 3OX9A 5AYSC 4J5KA 5HOHA 3CD63 5CF1A 2W0QA 4KFEA 1BGSA 1RDSA 3S67A 2K0MA 1A90A 3KSED 1LVNA 1SQWA 2H0IA 1BNRA 4XM4A 5STDA 3SOYA 1AY7A 1W00A 3IMAB 1M1K4 3PZWA 1V74A 3OWYA 3T0UA 3ZG5A 4GHOA 1VQ83 1FYSA 3PCRA 1J2BA 6STDA 2R41A 3DMCA 3AMOB 1BU4A 2I9WA 3U97A 1GMRA 1IU7A 4FCMA 8CHOA 1DMNA 1EA2A 3N8BA 1W4NA 4J8TA 3G713 5CLKA 2BIRA 3BLZA 1W6YA 2CG0A 4BIRA 1PFPA 3GZRA 2HMKB 3LTCA 5RNTA 2C4BA 3D5GA 4XDVA 1WMOA 1OPYA 1YJW3 1BSAA 2HMOB 3FG1A 2RBIA 1V58A 1GS3A 3WA2X 2KAAA 3ECFA 1RGAA 4BTYA 2XEPA 3I563 3VSYA 4STDA 2HOHA 1G0TA 3WOEB 1NU3A 1OGZA 1RMSA 2IYJA 2OCTA 1IV7A 3FCSB 4OVMA 1JJ22 2ZDJA 3E99A 1LRAA 2GBWB 3NV0A 4LSOA 1I8VA 1OCVA 1BSCA 1MWSA 1F8NA 1X1XA 2D1WA 1N9JA 2HMMB 2PNCA 3PS8A 4N6TA 3FZWA 4FCZA 1TJDA 3N9HA 2LYXA 4EW5A 3N54B 3S29A 2B1XB 3PYJA 1TU5A 1WMNA 1I3IA 2CFGA 2IUJA 5IF6A 3RNTA 1MGWA 2JDIH 5IEOA 1Q42A 4XBYA 1VQ53 1FW7A 1KSIA 4HM4B 2QEX3 1YIT3 2BMQB 2CFWA 2Z77A 1T5YA 4HM5B 4IT7A 4O3VA 4EBGA 1UW1A 1MOLA 3SOAA 1PY3A 2RFRA 1GY6A 2UGIA 3D9RA 5G1KA 4CJNA 1UGHI 2XF3A 3DH2A 1N8R4 1RGCA 1IYYA 2CHCA 4EV2A 3S28A 1BRNL 1MWRA 1FZUA 3OV4A 1TFOA 3DY5A 1AV4A 1BSDA 3HIGA 4ILFA 1Q824 3CCM3 3MYTA 3MWZA 1VQ73 1HZ1A 1B2ZA 3K0ZA 1ROAA 1CH0A 3AMOA 5CK6A 1ZX2A 2GBXB 2J8XB 1CQSA 3LZAA 3PGBA 2HMNB 7RNTA 1DE3A 1E97A 1RCKA 1D6ZA 1BIRA 3FF2A 3HK4A 1VQN3 3JVCA 2BO9B 2KXGA 2P38A 4RBNA 2Z6BA 4N6UA 2K54A 3JUOA 4O02B 1LXEA 2D42A 3EHCA 5JPUA 3EX9A 2WGOA 2XFSA 1ZGXA 3EN8A 1BNGA 3WDGB 3GZXB 3IJEB 4K1VA 1B27A 1GYBA 2E2VA 2W03A 4EYCA 1UI8A 2BNGA 1GY5A 2QGUA 1STDA 1U5OA 2XFTA 4HM3B 4R9LA 3STDA 1RTUA 2IY2A 2KRTA 4G1MB 1EUIC 3EF8A 3K5TA 3D5IA 1V57A 1ROVA 4GL6A 1RLSA 1OGXA 1UCIA 1UI7A 2E2UA 4KZ1A 4BL2A 1DVDA 1RGKA 4L7KA 1DMMA 4GSPA 3MKIA 1BRIA 1NWWA 1SPUA 1W6GA 4HKVB 1IVXA 2V1LA 4WWUC 1QVG2 2CIUA 1BNSA 2F4YA 3BNCA 1JN5B 4FMBA 1SARA 1UUWB 3WHOA 1IT8A 1W2ZA 1VQQA 4K90B 1VQ63 3LT8A 2W9QA 4ZM8A 5DREA 2XRXB 4HJLB 1STFI 3GRDA 3SEDA 1EEJA 1O7GB 1A2PA 3U1WA 3MHEA 4HM2B 1ULJB 8RNTA 3I553 1YJN3 1O7WB 3FG3A 1S723 4HM7B 4NPBA 1W01A 4FR9A 5LC7A 1LOVA 1R4CA 2INXA 3F14A 1VQK3 4R4KA 5G1LA 2XR8B 1YJ93 2CWVA 2BMOB 2WOFA 3X3XA 1I3FA 1BRSA 1FUWA 1LNIA 3MSOA 1N5HA 3LTBA 2LQVA 3IPTA 1IVVA 5FW5A 3RDEA 3X42A 4AEQA 3CCL3 1WQLB 1BRHA 3I0YA 1JB5A 4U13A 1BNEA 3CPOA 1VQL3 1OUNA 3HZPA 3ZG0A 4LMIA 1HYFA 2H0HA 3ROBA 1FGRA 3CXC2 4R9KA 3NQZA 1NDOB 1RCLA 1X1WA 1Q814 2XGLA 1GOUA 1MWUA 1W7CA 3NBBA 2MF7A 3WR2A 3G4S3 1EKMA 3F7XA 2CWUA 1BUJA 4ORLA 1K41A 1Q864 1LOYA 2CFDA 3KIIA 2M7OA 3GZBA 2QIYA 3NHXA 1IK3A 2RGQA 1JBTA 1YVBI 1UUVB 3MPHA 5FGOA 1LNHA 3S27A 1TRQA 4KVHA 2UX0A 3BNBA 4MMYB 6RNTA 1SIIA 3F40A 3SYUA 4TX4A 3CCV3 1Z1SA 5LC6A 3RGAA 1JNQA 2BMRB 1A2KA 3EB8A 1KC84 4HAAA 3FSDA 3CCU3 1RGGA 2B24B 1YGEA 3QRDA 4HM0B 1B20A 4MMZB 1IQXA 5BXQA 1O7NB 4LEHA 2P09A 1RKYA 4R80A 3EJVA 4IIAA 4JF8A 1JN5A 5AEWB 1OHPA 1VQP3 2IA7A 2IMJA 5D82A 1SIHA 1FGQA 2HMLB 5KP3A 1GOVA 1TP6A 2PZVA 3CU3A 5IG4A 1MNLA 1TIJA 5IG5A 1AQZA 2FGTA 2O9UX 1EQKA 2OQEC 1CYVA 9RNTA 3CCE3 1OHSA 3L0RA 1IDPA 1OF5B 3OWSA 3ZFZA 1BSBA 1GSPA 4CDLA 1BAOA 1W5ZA 3V99A 4N6MA 3K7CA 3FF0A 2KF6A 1E3RA 1WTHA 2GEXA 2GU1A 2R4IA 3TDGA 2UUGC 1JZDA 1QALA 3V92A 2SBLA 2OTJ3 1IQYA 5AIIA 3B4OA 4WYKB 3PXMA 5DRVA 2H0GA 2YX9A 3DGMA 3HOHA 2RSXA 3KZTA 3MG2A 4HM1B 3MG1A 3CC73 2CX1A 3H51A 4O2HA 2MC8A 3SLUA 1ISKA 3FGYA 1M1XB 3G16A 3NUVA 3BB9A 4J5GA 4OK0A 3X3ZA 1OACA 1OHOA 1BRKA 2XH9A 1YI23 1FA3A 1TRPA 1QVF2 2OOVC 1I70A 1KWIA 1RRLA 5KP4A 5AEUB 2OWPA 5BIRA 7STDA 2GSPA 3EBTA 4AKZA 3CCJ3 2GXFA 1BNJA 3M8CA 1JRQA 2QA43 1ASKA 2K3DA 4HZ9B 4BTXA 4RNYA 1K9M4 1IV9A 1OH0A 1X1YA 1WMPA 4R1KA 3T8UA 3H3HA 1VZZA 4BU4A 2CX0A 3D79A 4FMDA 2P05A 1C54A 2C10A 1BSEA 3MG3A 4EXRA 2FNQA 3URPA 1IVUA 4KT3B 2WOHA 3UJMA 2F99A 1I2GA 2JQ5A 2IUKA 1CEWI 1M9GA 3G6E3 2YFLB 3JUPA 4N6V0 4BL3A 2HMJB 2O3OA 5ELJA 2YFJB 4QWTA 1O7MB
chains in the Genus database with same CATH topology
1X1XA 1FUSA 3AGOA 1BNIA 1RCLA 1X1WA 1BNFA 1T2IA 1B2MA 2RNTA 1B2SA 1GMPA 1GOUA 3WR2A 2AAEA 1I2FA 1I3IA 2KF3A 3AHWA 1BUJA 1Q9EA 2AADA 2F56A 3DGYA 1BVIA 2SARA 1MGWA 3RNTA 1LOYA 1UCJA 1FW7A 1UCKA 1JBTA 1TRQA 2F5MA 6RNTA 1MGRA 1B2XA 1BRGA 1I0XA 1PY3A 1RNTA 3SYUA 1B3SA 1GMQA 1JBRA 1I2EA 3DH2A 3BU4A 1RGCA 1IYYA 4HAAA 1RGGA 1JBSA 1BRNL 7GSPA 1B20A 1FZUA 1UCLA 1B2UA 1I0VA 1BOXA 1BSDA 1T2HA 1HZ1A 3AGNA 3Q3FA 1B2ZA 1CH0A 3KCHA 1FUTA 1GOVA 2F5WA 6GSPA 1DE3A 7RNTA 5BU4A 1R4YA 1RCKA 1BIRA 1GOYA 1AQZA 1RHLA 9RNTA 3A5EA 5GSPA 1YGWA 1BANA 1DETA 1PYLA 3AHSA 1ZGXA 2ZA4A 1BNGA 2KF5A 2KF4A 1BSBA 1GSPA 1B27A 1BAOA 1RGHA 1YNVX 2KF6A 5HOHA 4J5KA 1RNBA 1RTUA 1BGSA 1RDSA 4HOHA 3D5IA 1B21A 1RLSA 1UCIA 1BNRA 3HOHA 1RGKA 1AY7A 3BIRA 4GSPA 1BRIA 4GHOA 4J5GA 1BNSA 1FYSA 2F4YA 1BRKA 1RN1A 1SARA 1TRPA 3WHOA 1I70A 1BU4A 5BIRA 1RGEA 1RSNA 1GMRA 1RGFA 2GSPA 1LOWA 1BNJA 1RN4A 2BU4A 1A2PA 2BIRA 1X1UA 1G02A 8RNTA 4BIRA 1X1YA 3D4AA 5RNTA 2C4BA 3D5GA 4BU4A 1LOVA 4RNTA 1C54A 1RGLA 1BSAA 1BSEA 2RBIA 3URPA 1I3FA 1BRSA 1BRJA 2KAAA 1LNIA 1I2GA 1TTOA 1RGAA 1BRHA 2HOHA 1BNEA 1RMSA 3GSPA 1YVSA 1HYFA 1LRAA 1I8VA 1BSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1X A;  1FUS A;  3AGO A;  1BNI A;  1RCL A;  1X1W A;  1BNF A;  1T2I A;  1B2M A;  2RNT A;  1B2S A;  1GMP A;  1GOU A;  3WR2 A;  2AAE A;  1I2F A;  1I3I A;  2KF3 A;  3AHW A;  1BUJ A;  1Q9E A;  2AAD A;  2F56 A;  3DGY A;  1BVI A;  2SAR A;  1MGW A;  3RNT A;  1LOY A;  1UCJ A;  1FW7 A;  1UCK A;  1JBT A;  1TRQ A;  2F5M A;  6RNT A;  1MGR A;  1B2X A;  1BRG A;  1I0X A;  1PY3 A;  1RNT A;  3SYU A;  1B3S A;  1GMQ A;  1JBR A;  1I2E A;  3DH2 A;  3BU4 A;  1RGC A;  1IYY A;  4HAA A;  1RGG A;  1JBS A;  1BRN L;  7GSP A;  1B20 A;  1FZU A;  1UCL A;  1B2U A;  1I0V A;  1BOX A;  1BSD A;  1T2H A;  1HZ1 A;  3AGN A;  3Q3F A;  1B2Z A;  1CH0 A;  3KCH A;  1FUT A;  1GOV A;  2F5W A;  6GSP A;  1DE3 A;  7RNT A;  5BU4 A;  1R4Y A;  1RCK A;  1BIR A;  1GOY A;  1AQZ A;  1RHL A;  9RNT A;  3A5E A;  5GSP A;  1YGW A;  1BAN A;  1DET A;  1PYL A;  3AHS A;  1ZGX A;  2ZA4 A;  1BNG A;  2KF5 A;  2KF4 A;  1BSB A;  1GSP A;  1B27 A;  1BAO A;  1RGH A;  1YNV X;  2KF6 A;  5HOH A;  4J5K A;  1RNB A;  1RTU A;  1BGS A;  1RDS A;  4HOH A;  3D5I A;  1B21 A;  1RLS A;  1UCI A;  1BNR A;  3HOH A;  1RGK A;  1AY7 A;  3BIR A;  4GSP A;  1BRI A;  4GHO A;  4J5G A;  1BNS A;  1FYS A;  2F4Y A;  1BRK A;  1RN1 A;  1SAR A;  1TRP A;  3WHO A;  1I70 A;  1BU4 A;  5BIR A;  1RGE A;  1RSN A;  1GMR A;  1RGF A;  2GSP A;  1LOW A;  1BNJ A;  1RN4 A;  2BU4 A;  1A2P A;  2BIR A;  1X1U A;  1G02 A;  8RNT A;  4BIR A;  1X1Y A;  3D4A A;  5RNT A;  2C4B A;  3D5G A;  4BU4 A;  1LOV A;  4RNT A;  1C54 A;  1RGL A;  1BSA A;  1BSE A;  2RBI A;  3URP A;  1I3F A;  1BRS A;  1BRJ A;  2KAA A;  1LNI A;  1I2G A;  1TTO A;  1RGA A;  1BRH A;  2HOH A;  1BNE A;  1RMS A;  3GSP A;  1YVS A;  1HYF A;  1LRA A;  1I8V A;  1BSC A; 
#chains in the Genus database with same CATH topology
 3AGO A;  1Q7Y 4;  1NB3 I;  1Q40 A;  3Q1C A;  5IER A;  1JZO A;  1QJG A;  1TFK A;  2GU3 A;  4I4K A;  3SVA A;  1YIJ 3;  2F98 A;  1B2S A;  5AI1 A;  4FCJ A;  1NB5 I;  1I2F A;  2KF3 A;  1LOX A;  2W6J H;  3AHW A;  3GZY B;  2F56 A;  2CFL A;  3DGY A;  2SAR A;  5IEP A;  2BHM A;  1NNV A;  1VQM 3;  2ML5 A;  1OF5 A;  1WNH A;  3HX8 A;  3S5C A;  1UCK A;  2L4V A;  3DXO A;  4N6N B;  3V98 A;  4NRE A;  3LXU X;  4GB5 A;  3NX0 A;  3NBJ A;  3GAX A;  1K28 A;  2XSH B;  2YFI B;  1B2X A;  1I0X A;  2CW9 A;  3DGL A;  1RRH A;  3F7S A;  1M90 4;  1JKG B;  2ZL8 A;  3BU4 A;  4X2O A;  4WYK A;  3D3L A;  3X40 A;  1TUH A;  3JUN A;  3KFQ C;  4AKY A;  4H3U A;  1JBS A;  2CK3 H;  4LZI A;  4MEI A;  1A2V A;  2KCD A;  7GSP A;  4LYL B;  1UCL A;  1B2U A;  1QAK A;  3NM7 A;  3WOF B;  2W2C A;  2P0X A;  3CPW 2;  4HZB B;  3Q2P A;  4L8P A;  2W56 B;  3B7C A;  1T2H A;  3DGN A;  3EN1 B;  2FXT A;  1CYU A;  3EBY A;  4X2H A;  3EC9 A;  1C7H A;  3LOY A;  2L1S A;  2OTL 3;  1LQG C;  3ALA A;  1W02 A;  1K8A 4;  3B8L A;  5AYR B;  1FGO A;  1KQS 2;  3BNE A;  1NO3 A;  1T3B A;  4RNZ A;  3FH1 A;  3LML A;  5GSP A;  3A76 A;  2XSO B;  1PYL A;  4NHF A;  3AHS A;  2ZA4 A;  4WHA A;  3CME 3;  3G8Z A;  4EC6 A;  1W2B 2;  2KF4 A;  4OUQ A;  3G0K A;  4K61 A;  3CCQ 3;  2ML6 A;  3CCS 3;  3OXA A;  5KP1 A;  3SX1 A;  1U8C B;  2Z7A A;  1RNB A;  3GWR A;  3OW2 2;  1HKX A;  1VQO 3;  1UDI I;  1AR0 A;  3Q90 A;  3CC2 3;  1G96 A;  1SJW A;  4HOH A;  3K63 A;  2STD A;  4HM8 B;  1B21 A;  3DGO A;  4JRF A;  1DYU A;  5D83 A;  3LT9 A;  1DMQ A;  3BIR A;  3LTD A;  1QMA A;  3WA3 A;  1Q40 B;  4PEJ A;  4RZM A;  3NBR A;  4HBR A;  1FGT A;  4Q53 A;  4XB5 A;  1RN1 A;  3WMD A;  1D6U A;  1PU4 A;  1GD4 A;  3KSP A;  1US1 A;  5EVH A;  3CC4 3;  2Y74 A;  3O8Y A;  5AIF A;  2BT3 A;  3LTA A;  5EEO A;  1RGE A;  1GY7 A;  1RSN A;  3UNL A;  1JV2 B;  5M18 A;  1RGF A;  2E2T A;  3UB1 A;  3BND A;  1LOW A;  1RN4 A;  2BU4 A;  2Z76 A;  4EV5 A;  2W9P A;  3F8X A;  2OQE A;  1X1U A;  3DZL A;  3LH4 A;  1G02 A;  1KD1 4;  5D81 A;  1UUG B;  1IT7 A;  4DKI A;  2GEY A;  4XDW A;  3D4A A;  1W6C A;  4WP5 A;  5JBS A;  1AVL A;  1JKG A;  4XBT A;  4RNT A;  1RGL A;  5IEN A;  1S5A A;  3CCR 3;  1FGM A;  3F9S A;  3JUQ A;  4LGQ A;  3VF1 A;  1DVC A;  1BRJ A;  2WO0 A;  3HII A;  3DM8 A;  1IQ8 A;  4IPB A;  4N3V A;  1TTO A;  1Q7H A;  3UL5 A;  3VGN A;  5CXO A;  2W56 A;  1O7P B;  4H61 A;  4MMX B;  1VQ9 3;  5TGN A;  4HM6 B;  3GSP A;  1D6Y A;  3NQY A;  5AIH A;  1YVS A;  3UL6 A;  1RJO A;  1FUS A;  1BNI A;  1JB2 A;  2C11 A;  1MWT A;  1BNF A;  1E3V A;  1T2I A;  3NXJ A;  1B2M A;  2RNT A;  3J7Y d;  1GMP A;  2OOV A;  3OWU A;  3JUM A;  3T8N A;  4BTW A;  2CC3 A;  2AAE A;  3ER7 A;  4KFD A;  1L5G B;  3X41 A;  1Q9E A;  2AAD A;  3FLJ A;  3FG4 A;  1BVI A;  2P0M A;  1EG9 B;  1HU9 A;  1UCJ A;  2ZHX B;  3DUK A;  3F8H A;  2A15 A;  3NM2 A;  3PCS A;  5M19 A;  4K1U A;  1RN7 A;  1UGI A;  4CPK A;  4KFF A;  2F5M A;  5I97 A;  4N6L A;  5AIG A;  1MGR A;  1BRG A;  1ZO2 A;  1RNT A;  5ELU A;  2CG1 A;  1B3S A;  4CCV A;  1GMQ A;  4HVN A;  3LYG A;  1I2E A;  3SXX A;  1JBR A;  2W04 A;  1N8Q A;  1LQM B;  2RCD A;  1GD3 A;  1QAF A;  5A0O B;  4O8S A;  3WOD G;  1K73 4;  3KE7 A;  1I0V A;  1BOX A;  2CWT A;  3B4P A;  2CKF B;  5JPP A;  5IW9 A;  4N6O B;  1NJI 4;  2Q07 A;  3AGN A;  3Q3F A;  2XGN A;  4L8O A;  3CMA 3;  2Y73 A;  3CNM A;  3KCH A;  4FMC A;  1FUT A;  3KN4 A;  1Y4K A;  3NV0 B;  4FMA A;  1N5P A;  2F5W A;  2WGQ A;  6GSP A;  3EE1 A;  3KKG A;  5BU4 A;  4J9A A;  1R4Y A;  4WFO A;  3X3Y A;  5EQL A;  5IG0 A;  5M1A A;  1YHQ 3;  1GOY A;  2CFK A;  4XBX A;  1VQ4 3;  1AVK A;  1JB4 A;  1RHL A;  1ULI B;  2F86 B;  3EQQ B;  5CF2 A;  3A5E A;  3RGR A;  3QK9 A;  5HGR A;  1YGW A;  1BAN A;  3CNX A;  1DET A;  3HI7 A;  5G2G A;  2KF5 A;  3FKA A;  1O7H B;  1BUQ A;  4I5Q A;  1ZS7 A;  2CH9 A;  3K9M C;  1RGH A;  1N9E A;  1YNV X;  5BVB A;  1A67 A;  1IVW A;  4MJD A;  4HYZ A;  5IG3 A;  3OX9 A;  5AYS C;  4J5K A;  5HOH A;  3CD6 3;  5CF1 A;  2W0Q A;  4KFE A;  1BGS A;  1RDS A;  3S67 A;  2K0M A;  1A90 A;  3KSE D;  1LVN A;  1SQW A;  2H0I A;  1BNR A;  4XM4 A;  5STD A;  3SOY A;  1AY7 A;  1W00 A;  3IMA B;  1M1K 4;  3PZW A;  1V74 A;  3OWY A;  3T0U A;  3ZG5 A;  4GHO A;  1VQ8 3;  1FYS A;  3PCR A;  1J2B A;  6STD A;  2R41 A;  3DMC A;  3AMO B;  1BU4 A;  2I9W A;  3U97 A;  1GMR A;  1IU7 A;  4FCM A;  8CHO A;  1DMN A;  1EA2 A;  3N8B A;  1W4N A;  4J8T A;  3G71 3;  5CLK A;  2BIR A;  3BLZ A;  1W6Y A;  2CG0 A;  4BIR A;  1PFP A;  3GZR A;  2HMK B;  3LTC A;  5RNT A;  2C4B A;  3D5G A;  4XDV A;  1WMO A;  1OPY A;  1YJW 3;  1BSA A;  2HMO B;  3FG1 A;  2RBI A;  1V58 A;  1GS3 A;  3WA2 X;  2KAA A;  3ECF A;  1RGA A;  4BTY A;  2XEP A;  3I56 3;  3VSY A;  4STD A;  2HOH A;  1G0T A;  3WOE B;  1NU3 A;  1OGZ A;  1RMS A;  2IYJ A;  2OCT A;  1IV7 A;  3FCS B;  4OVM A;  1JJ2 2;  2ZDJ A;  3E99 A;  1LRA A;  2GBW B;  3NV0 A;  4LSO A;  1I8V A;  1OCV A;  1BSC A;  1MWS A;  1F8N A;  1X1X A;  2D1W A;  1N9J A;  2HMM B;  2PNC A;  3PS8 A;  4N6T A;  3FZW A;  4FCZ A;  1TJD A;  3N9H A;  2LYX A;  4EW5 A;  3N54 B;  3S29 A;  2B1X B;  3PYJ A;  1TU5 A;  1WMN A;  1I3I A;  2CFG A;  2IUJ A;  5IF6 A;  3RNT A;  1MGW A;  2JDI H;  5IEO A;  1Q42 A;  4XBY A;  1VQ5 3;  1FW7 A;  1KSI A;  4HM4 B;  2QEX 3;  1YIT 3;  2BMQ B;  2CFW A;  2Z77 A;  1T5Y A;  4HM5 B;  4IT7 A;  4O3V A;  4EBG A;  1UW1 A;  1MOL A;  3SOA A;  1PY3 A;  2RFR A;  1GY6 A;  2UGI A;  3D9R A;  5G1K A;  4CJN A;  1UGH I;  2XF3 A;  3DH2 A;  1N8R 4;  1RGC A;  1IYY A;  2CHC A;  4EV2 A;  3S28 A;  1BRN L;  1MWR A;  1FZU A;  3OV4 A;  1TFO A;  3DY5 A;  1AV4 A;  1BSD A;  3HIG A;  4ILF A;  1Q82 4;  3CCM 3;  3MYT A;  3MWZ A;  1VQ7 3;  1HZ1 A;  1B2Z A;  3K0Z A;  1ROA A;  1CH0 A;  3AMO A;  5CK6 A;  1ZX2 A;  2GBX B;  2J8X B;  1CQS A;  3LZA A;  3PGB A;  2HMN B;  7RNT A;  1DE3 A;  1E97 A;  1RCK A;  1D6Z A;  1BIR A;  3FF2 A;  3HK4 A;  1VQN 3;  3JVC A;  2BO9 B;  2KXG A;  2P38 A;  4RBN A;  2Z6B A;  4N6U A;  2K54 A;  3JUO A;  4O02 B;  1LXE A;  2D42 A;  3EHC A;  5JPU A;  3EX9 A;  2WGO A;  2XFS A;  1ZGX A;  3EN8 A;  1BNG A;  3WDG B;  3GZX B;  3IJE B;  4K1V A;  1B27 A;  1GYB A;  2E2V A;  2W03 A;  4EYC A;  1UI8 A;  2BNG A;  1GY5 A;  2QGU A;  1STD A;  1U5O A;  2XFT A;  4HM3 B;  4R9L A;  3STD A;  1RTU A;  2IY2 A;  2KRT A;  4G1M B;  1EUI C;  3EF8 A;  3K5T A;  3D5I A;  1V57 A;  1ROV A;  4GL6 A;  1RLS A;  1OGX A;  1UCI A;  1UI7 A;  2E2U A;  4KZ1 A;  4BL2 A;  1DVD A;  1RGK A;  4L7K A;  1DMM A;  4GSP A;  3MKI A;  1BRI A;  1NWW A;  1SPU A;  1W6G A;  4HKV B;  1IVX A;  2V1L A;  4WWU C;  1QVG 2;  2CIU A;  1BNS A;  2F4Y A;  3BNC A;  1JN5 B;  4FMB A;  1SAR A;  1UUW B;  3WHO A;  1IT8 A;  1W2Z A;  1VQQ A;  4K90 B;  1VQ6 3;  3LT8 A;  2W9Q A;  4ZM8 A;  5DRE A;  2XRX B;  4HJL B;  1STF I;  3GRD A;  3SED A;  1EEJ A;  1O7G B;  1A2P A;  3U1W A;  3MHE A;  4HM2 B;  1ULJ B;  8RNT A;  3I55 3;  1YJN 3;  1O7W B;  3FG3 A;  1S72 3;  4HM7 B;  4NPB A;  1W01 A;  4FR9 A;  5LC7 A;  1LOV A;  1R4C A;  2INX A;  3F14 A;  1VQK 3;  4R4K A;  5G1L A;  2XR8 B;  1YJ9 3;  2CWV A;  2BMO B;  2WOF A;  3X3X A;  1I3F A;  1BRS A;  1FUW A;  1LNI A;  3MSO A;  1N5H A;  3LTB A;  2LQV A;  3IPT A;  1IVV A;  5FW5 A;  3RDE A;  3X42 A;  4AEQ A;  3CCL 3;  1WQL B;  1BRH A;  3I0Y A;  1JB5 A;  4U13 A;  1BNE A;  3CPO A;  1VQL 3;  1OUN A;  3HZP A;  3ZG0 A;  4LMI A;  1HYF A;  2H0H A;  3ROB A;  1FGR A;  3CXC 2;  4R9K A;  3NQZ A;  1NDO B;  1RCL A;  1X1W A;  1Q81 4;  2XGL A;  1GOU A;  1MWU A;  1W7C A;  3NBB A;  2MF7 A;  3WR2 A;  3G4S 3;  1EKM A;  3F7X A;  2CWU A;  1BUJ A;  4ORL A;  1K41 A;  1Q86 4;  1LOY A;  2CFD A;  3KII A;  2M7O A;  3GZB A;  2QIY A;  3NHX A;  1IK3 A;  2RGQ A;  1JBT A;  1YVB I;  1UUV B;  3MPH A;  5FGO A;  1LNH A;  3S27 A;  1TRQ A;  4KVH A;  2UX0 A;  3BNB A;  4MMY B;  6RNT A;  1SII A;  3F40 A;  3SYU A;  4TX4 A;  3CCV 3;  1Z1S A;  5LC6 A;  3RGA A;  1JNQ A;  2BMR B;  1A2K A;  3EB8 A;  1KC8 4;  4HAA A;  3FSD A;  3CCU 3;  1RGG A;  2B24 B;  1YGE A;  3QRD A;  4HM0 B;  1B20 A;  4MMZ B;  1IQX A;  5BXQ A;  1O7N B;  4LEH A;  2P09 A;  1RKY A;  4R80 A;  3EJV A;  4IIA A;  4JF8 A;  1JN5 A;  5AEW B;  1OHP A;  1VQP 3;  2IA7 A;  2IMJ A;  5D82 A;  1SIH A;  1FGQ A;  2HML B;  5KP3 A;  1GOV A;  1TP6 A;  2PZV A;  3CU3 A;  5IG4 A;  1MNL A;  1TIJ A;  5IG5 A;  1AQZ A;  2FGT A;  2O9U X;  1EQK A;  2OQE C;  1CYV A;  9RNT A;  3CCE 3;  1OHS A;  3L0R A;  1IDP A;  1OF5 B;  3OWS A;  3ZFZ A;  1BSB A;  1GSP A;  4CDL A;  1BAO A;  1W5Z A;  3V99 A;  4N6M A;  3K7C A;  3FF0 A;  2KF6 A;  1E3R A;  1WTH A;  2GEX A;  2GU1 A;  2R4I A;  3TDG A;  2UUG C;  1JZD A;  1QAL A;  3V92 A;  2SBL A;  2OTJ 3;  1IQY A;  5AII A;  3B4O A;  4WYK B;  3PXM A;  5DRV A;  2H0G A;  2YX9 A;  3DGM A;  3HOH A;  2RSX A;  3KZT A;  3MG2 A;  4HM1 B;  3MG1 A;  3CC7 3;  2CX1 A;  3H51 A;  4O2H A;  2MC8 A;  3SLU A;  1ISK A;  3FGY A;  1M1X B;  3G16 A;  3NUV A;  3BB9 A;  4J5G A;  4OK0 A;  3X3Z A;  1OAC A;  1OHO A;  1BRK A;  2XH9 A;  1YI2 3;  1FA3 A;  1TRP A;  1QVF 2;  2OOV C;  1I70 A;  1KWI A;  1RRL A;  5KP4 A;  5AEU B;  2OWP A;  5BIR A;  7STD A;  2GSP A;  3EBT A;  4AKZ A;  3CCJ 3;  2GXF A;  1BNJ A;  3M8C A;  1JRQ A;  2QA4 3;  1ASK A;  2K3D A;  4HZ9 B;  4BTX A;  4RNY A;  1K9M 4;  1IV9 A;  1OH0 A;  1X1Y A;  1WMP A;  4R1K A;  3T8U A;  3H3H A;  1VZZ A;  4BU4 A;  2CX0 A;  3D79 A;  4FMD A;  2P05 A;  1C54 A;  2C10 A;  1BSE A;  3MG3 A;  4EXR A;  2FNQ A;  3URP A;  1IVU A;  4KT3 B;  2WOH A;  3UJM A;  2F99 A;  1I2G A;  2JQ5 A;  2IUK A;  1CEW I;  1M9G A;  3G6E 3;  2YFL B;  3JUP A;  4N6V 0;  4BL3 A;  2HMJ B;  2O3O A;  5ELJ A;  2YFJ B;  4QWT A;  1O7M B; 
#chains in the Genus database with same CATH homology
 1X1X A;  1FUS A;  3AGO A;  1BNI A;  1RCL A;  1X1W A;  1BNF A;  1T2I A;  1B2M A;  2RNT A;  1B2S A;  1GMP A;  1GOU A;  3WR2 A;  2AAE A;  1I2F A;  1I3I A;  2KF3 A;  3AHW A;  1BUJ A;  1Q9E A;  2AAD A;  2F56 A;  3DGY A;  1BVI A;  2SAR A;  1MGW A;  3RNT A;  1LOY A;  1UCJ A;  1FW7 A;  1UCK A;  1JBT A;  1TRQ A;  2F5M A;  6RNT A;  1MGR A;  1B2X A;  1BRG A;  1I0X A;  1PY3 A;  1RNT A;  3SYU A;  1B3S A;  1GMQ A;  1JBR A;  1I2E A;  3DH2 A;  3BU4 A;  1RGC A;  1IYY A;  4HAA A;  1RGG A;  1JBS A;  1BRN L;  7GSP A;  1B20 A;  1FZU A;  1UCL A;  1B2U A;  1I0V A;  1BOX A;  1BSD A;  1T2H A;  1HZ1 A;  3AGN A;  3Q3F A;  1B2Z A;  1CH0 A;  3KCH A;  1FUT A;  1GOV A;  2F5W A;  6GSP A;  1DE3 A;  7RNT A;  5BU4 A;  1R4Y A;  1RCK A;  1BIR A;  1GOY A;  1AQZ A;  1RHL A;  9RNT A;  3A5E A;  5GSP A;  1YGW A;  1BAN A;  1DET A;  1PYL A;  3AHS A;  1ZGX A;  2ZA4 A;  1BNG A;  2KF5 A;  2KF4 A;  1BSB A;  1GSP A;  1B27 A;  1BAO A;  1RGH A;  1YNV X;  2KF6 A;  5HOH A;  4J5K A;  1RNB A;  1RTU A;  1BGS A;  1RDS A;  4HOH A;  3D5I A;  1B21 A;  1RLS A;  1UCI A;  1BNR A;  3HOH A;  1RGK A;  1AY7 A;  3BIR A;  4GSP A;  1BRI A;  4GHO A;  4J5G A;  1BNS A;  1FYS A;  2F4Y A;  1BRK A;  1RN1 A;  1SAR A;  1TRP A;  3WHO A;  1I70 A;  1BU4 A;  5BIR A;  1RGE A;  1RSN A;  1GMR A;  1RGF A;  2GSP A;  1LOW A;  1BNJ A;  1RN4 A;  2BU4 A;  1A2P A;  2BIR A;  1X1U A;  1G02 A;  8RNT A;  4BIR A;  1X1Y A;  3D4A A;  5RNT A;  2C4B A;  3D5G A;  4BU4 A;  1LOV A;  4RNT A;  1C54 A;  1RGL A;  1BSA A;  1BSE A;  2RBI A;  3URP A;  1I3F A;  1BRS A;  1BRJ A;  2KAA A;  1LNI A;  1I2G A;  1TTO A;  1RGA A;  1BRH A;  2HOH A;  1BNE A;  1RMS A;  3GSP A;  1YVS A;  1HYF A;  1LRA A;  1I8V A;  1BSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...