1B21A

Deletion of a buried salt bridge in barnase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
109
structure length
109
Chain Sequence
QVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGSTWREADINYTSGFRNSDRILYSSNWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 31
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b21A00
1B3SA 1RLSA 1B2XA 6RNTA 1BIRA 1BAOA 1I0XA 2HOHA 3SYUA 1TRQA 1DETA 2RBIA 4GHOA 1BUJA 1BANA 1BVIA 1X1UA 1YNVX 5HOHA 3WR2A 1BOXA 2F4YA 1UCJA 1R4YA 1GOUA 3WHOA 1MGWA 2AADA 1C54A 5RNTA 3AHSA 1JBTA 1FUSA 1RNTA 1YGWA 4BIRA 1RGCA 2F56A 8RNTA 1LNIA 5BU4A 1B2MA 1RNBA 1LOYA 1MGRA 1RMSA 3D5IA 1BRHA 1RGGA 5GSPA 1BRGA 3HOHA 1I2EA 1JBSA 1DE3A 3RNTA 1GSPA 1BRSA 4J5KA 1I0VA 2GSPA 3AHWA 2KAAA 3AGNA 1T2HA 3BIRA 1I70A 1BSBA 2KF6A 4HOHA 1LRAA 2F5WA 3AGOA 3URPA 2AAEA 1IYYA 2BIRA 1UCLA 1GOYA 4GSPA 1I3IA 1RTUA 1RDSA 3Q3FA 1GMPA 2RNTA 3KCHA 1PYLA 1BRNL 1RGFA 2KF3A 1B21A 1HYFA 3BU4A 1BNGA 1BGSA 1GMRA 1AQZA 1GMQA 1RCKA 1LOVA 1BNSA 1BRJA 1HZ1A 9RNTA 2ZA4A 1BNFA 1TTOA 1BRIA 1RHLA 3DH2A 1CH0A 1RGKA 1I2FA 1T2IA 3D4AA 4RNTA 1YVSA 1PY3A 1BSAA 1RSNA 1BNRA 6GSPA 1RGHA 1I3FA 1FZUA 3DGYA 1AY7A 1GOVA 1BNEA 1BNJA 1RCLA 1X1WA 2BU4A 1B27A 1BRKA 1B2ZA 1JBRA 4BU4A 2F5MA 3D5GA 1BSEA 1RN1A 1B2SA 1UCIA 1RGLA 1BSCA 1FYSA 1RN4A 4HAAA 1TRPA 1I2GA 1FUTA 1RGEA 2SARA 1X1XA 1G02A 1BSDA 7GSPA 3GSPA 1ZGXA 3A5EA 1FW7A 1BNIA 1I8VA 1X1YA 1UCKA 1A2PA 1BU4A 4J5GA 2KF4A 1SARA 1LOWA 1Q9EA 2C4BA 5BIRA 1B20A 2KF5A 1RGAA 1B2UA 7RNTA
chains in the Genus database with same CATH superfamily
2BHMA 2OWPA 3CPW2 3X3YA 4MMXB 1JB2A 3MKIA 1KQS2 2STDA 1VQ93 1BIRA 1V58A 2CX1A 3MG2A 4IPBA 5KP3A 1O7PB 1E3VA 1DYUA 2HOHA 3JUQA 1VQL3 3BLZA 1IQYA 5AIHA 3LTAA 4GHOA 1BUJA 3CC73 1YHQ3 3J7Yd 1ULIB 4WHAA 2XF3A 3WMDA 3FZWA 1DVDA 1GD4A 1BOXA 2F4YA 2GEXA 2W0QA 3CU3A 3DUKA 4KFFA 3WR2A 4AKYA 3G4S3 1VQ83 4LYLB 1R4YA 2Z76A 3WHOA 2UX0A 1MGWA 2BMOB 3EF8A 4CCVA 2HMOB 5G1LA 5RNTA 3AHSA 2C10A 2INXA 5JPPA 4KFEA 1UGHI 1EA2A 3EHCA 1RNBA 1MGRA 2BT3A 2CK3H 3D5IA 1KC84 1BRGA 1Q824 4ORLA 1IVVA 3HK4A 2CFWA 2RSXA 3FG4A 1NO3A 1AR0A 2XH9A 1HU9A 1DE3A 2IYJA 1FGMA 3L0RA 4FCZA 1VZZA 3RDEA 1TUHA 2GSPA 3MPHA 4L8PA 2E2VA 3FKAA 4EYCA 4EBGA 1YJ93 4H61A 1NWWA 2GU3A 5ELJA 3UL6A 3UL5A 1IV9A 1BSBA 2D1WA 3NBBA 3F8XA 1GS3A 3GZYB 4XDVA 2OOVC 1T3BA 2AAEA 4LMIA 1N8QA 2PZVA 1UCLA 1N5PA 2CWTA 3OV4A 1S5AA 3CCV3 4FCMA 2GEYA 3B4PA 3T8NA 4MEIA 7STDA 1TFOA 3S29A 1EUIC 1EEJA 1PYLA 3PXMA 1OGXA 3PS8A 4EW5A 2JQ5A 1GY5A 4CPKA 3D79A 1W2B2 1BGSA 3WA2X 3ER7A 5CF1A 1GMQA 1L5GB 5EVHA 1K8A4 2QA43 1BNSA 1BRJA 1W6CA 4HZ9B 1O7MB 9RNTA 3X40A 1Q814 2CFDA 1W2ZA 2W9QA 2XRXB 4FMBA 3UB1A 4EV2A 3SLUA 3DH2A 1JNQA 3X3XA 4AKZA 6STDA 3D4AA 1IU7A 1FGRA 4RNYA 4AEQA 1RSNA 1BNRA 5M18A 2CFLA 1CQSA 1AVKA 1OCVA 2O9UX 1FGQA 2Z6BA 1JZDA 3HIIA 3S27A 3FG1A 1YI23 4WFOA 3FCSB 1Q7Y4 1M1XB 4BU4A 1ROVA 3HI7A 1RN1A 2K54A 1B2SA 1YJW3 1OACA 2YFJB 1UUVB 1RGLA 3MG3A 1O7GB 4K1UA 5CLKA 1CYVA 1TRPA 1I2GA 4HAAA 1TU5A 1VQK3 5LC7A 3Q2PA 3BNBA 2B24B 2XSOB 1G0TA 3IJEB 2HMNB 1W01A 3A5EA 2OOVA 2KCDA 1RKYA 3FGYA 1IVUA 1Y4KA 4J5GA 2KF4A 1DVCA 1SARA 1LOWA 1SIHA 2JDIH 3N54B 3V92A 7RNTA 3GAXA 1LVNA 1JV2B 1YJN3 1B2XA 1IT8A 3FLJA 3DMCA 5G2GA 2P38A 2OTL3 5AIGA 1JKGA 3RGAA 3SYUA 1TRQA 2YFIB 4R9KA 1DETA 2WOHA 1BANA 1EKMA 2W9PA 3ZFZA 1N8R4 3O8YA 4K90B 3ZG0A 4L8OA 5KP4A 4MJDA 1ULJB 5DRVA 1D6UA 3LT9A 1GOUA 4FCJA 4J8TA 3BNCA 2E2UA 1JBTA 1FUSA 3N9HA 4HM1B 3EJVA 4NREA 2HMKB 5D83A 1CYUA 4BIRA 3ALAA 2K3DA 8CHOA 3WOEB 3F14A 5IEPA 3G8ZA 5GSPA 1O7NB 1VQ53 1OF5A 1GY7A 1VQ63 2XEPA 4O3VA 3NM7A 4STDA 1GSPA 1BRSA 3KZTA 4J5KA 3V99A 1I0VA 1Z1SA 4HKVB 1IVXA 5CK6A 5M1AA 3VGNA 4RNZA 1QVG2 3CNMA 3JUOA 4HM3B 3BIRA 4HZBB 2CW9A 3WOFB 2KF6A 2YX9A 4HM2B 5JPUA 4HM8B 1Q40A 1D6ZA 3S28A 3HIGA 3JUNA 1ZS7A 5IENA 2F5WA 3LTBA 2GU1A 1RRHA 3I553 3LMLA 3DM8A 2HMMB 4JRFA 3SVAA 4KFDA 2GBWB 2ZL8A 1TJDA 2RFRA 5KP1A 3KIIA 3EE1A 3MG1A 4X2HA 4EC6A 1NJI4 1NNVA 2RGQA 3JUMA 4OUQA 4K61A 3X42A 3GRDA 5IG0A 5IG5A 3CCS3 2XGNA 4OVMA 2CIUA 2XR8B 1SPUA 2RNTA 2XFSA 3DZLA 3FF2A 3IMAB 1G96A 1Q42A 5IEOA 1ASKA 1A67A 1QAFA 4BTWA 2BMQB 1BRNL 5EEOA 1OHOA 3ECFA 3PZWA 5DREA 1B21A 1HYFA 1JN5B 4MMZB 1K41A 2P05A 3OWSA 1W6GA 3GZBA 1MWSA 3EBYA 1JKGB 1HZ1A 3X41A 3SOYA 5D81A 2WO0A 4HM7B 3CCM3 2IY2A 2CWUA 2P0MA 3D3LA 2CG1A 4HYZA 1I2FA 4I4KA 1IQXA 1YVSA 3PGBA 2BMRB 3NX0A 3CME3 2F86B 1RGHA 3A76A 3EBTA 3S5CA 1VQO3 1W5ZA 2CFGA 4WYKA 1AY7A 2H0GA 2W04A 5ELUA 1MWTA 2C11A 3F7XA 1RCLA 1X1WA 2BU4A 4GL6A 4O8SA 3V98A 1BRKA 1B2ZA 1JBRA 2IA7A 5CXOA 1M1K4 2F5MA 1BSEA 1VQP3 4HM5B 3K7CA 2L1SA 2V1LA 1YVBI 1CEWI 1GYBA 3QK9A 1RN4A 1FYSA 2BO9B 1TIJA 1PFPA 4XBXA 1LOXA 1T5YA 2IUJA 1FUTA 2SARA 2CFKA 1BSDA 4L7KA 5BXQA 1ZGXA 4LSOA 1FW7A 1BNIA 4KT3B 3CCJ3 1X1YA 2KRTA 2I9WA 1STFI 3HX8A 1WQLB 3OWYA 4RBNA 3G713 1BU4A 2PNCA 1AV4A 1Q40B 3EN1B 3CXC2 5TGNA 4CJNA 5BIRA 3PCSA 4EV5A 4N3VA 1B2UA 1LQMB 3U97A 2FNQA 1B3SA 4I5QA 6RNTA 1U8CB 2HMLB 1QAKA 3SXXA 3MSOA 1OPYA 1UUGB 1QJGA 4XBTA 5LC6A 3LOYA 1VQ43 1STDA 1JZOA 3IPTA 2RBIA 1LQGC 1BVIA 2J8XB 1X1UA 1YNVX 1ZO2A 4HM0B 4WP5A 2M7OA 2IMJA 3BB9A 3G16A 1IDPA 2FGTA 2P09A 3NXJA 2AADA 3K63A 3CNXA 2ZHXB 3FG3A 4XDWA 2CH9A 4IIAA 3VSYA 3NHXA 8RNTA 1B2MA 1RGCA 1LNIA 1QALA 5IG3A 3S67A 1LOYA 4R80A 1A2KA 1F8NA 1W4NA 1K9M4 2Z7AA 2F98A 3LYGA 1SIIA 3NUVA 1I2EA 1US1A 5AI1A 3BNEA 1IQ8A 1EG9B 2H0IA 1WMPA 1IT7A 1E97A 1WNHA 1TP6A 2P0XA 2KXGA 2WOFA 2Z77A 3B7CA 2RCDA 2QIYA 3Q90A 4PEJA 4WYKB 3CCU3 3OW22 3E99A 1OH0A 3UNLA 3AHWA 1HKXA 5AEUB 3VF1A 3LZAA 1I70A 4BTXA 1UGIA 1VQM3 1UUWB 4QWTA 2R41A 1LRAA 3T0UA 2CWVA 3CCL3 3MWZA 1VQN3 3AMOA 3CCE3 2W56A 1OHSA 2A15A 4NHFA 5IF6A 2SBLA 3CCR3 3PYJA 2ML6A 1QVF2 1YIJ3 1IYYA 1GOYA 3LH4A 2MC8A 4N6OB 1W6YA 3EX9A 3KE7A 1E3RA 2CG0A 4ILFA 1RTUA 3Q3FA 2OTJ3 2W2CA 4HJLB 3FF0A 3G0KA 3NQYA 3OXAA 1J2BA 1ISKA 1RJOA 4WWUC 3K5TA 1SQWA 1RGFA 3M8CA 2KF3A 3BU4A 3I0YA 1K734 2WGQA 3DGOA 3I563 1IK3A 3Q1CA 1Q7HA 1LOVA 3GWRA 3NM2A 3X3ZA 3KN4A 3SOAA 3PCRA 5IERA 4HBRA 4K1VA 3RNTA 5AEWB 1RHLA 4N6LA 2LYXA 5AYSC 1T2IA 3UJMA 1PY3A 3H3HA 1BSAA 5EQLA 6GSPA 1N5HA 2CX0A 3GZXB 1FZUA 3NBJA 1GOVA 1JJ22 1BNJA 1JRQA 3HZPA 4NPBA 1SJWA 1M904 3EB8A 3D5GA 4R1KA 5AIFA 4U13A 4HVNA 1FGTA 3EQQB 1BSCA 3WDGB 1DMQA 1RGEA 3CD63 5BVBA 1WTHA 2FXTA 2W6JH 3DGMA 4G1MB 1OGZA 1NU3A 2XFTA 4LEHA 3LT8A 3B8LA 1IV7A 1DMNA 1K28A 3NBRA 3OX9A 4FMDA 4XBYA 4DKIA 3SEDA 2ZDJA 3G6E3 2H0HA 1Q9EA 3LXUX 3OWUA 2IUKA 3AMOB 4MMYB 1RGAA 3URPA 2UUGC 5I97A 5IW9A 2W56B 5CF2A 1WMOA 1RLSA 3JUPA 2B1XB 2OQEC 2XSHB 1U5OA 2D42A 2O3OA 3T8UA 3WODG 1W02A 1BAOA 1MOLA 1I0XA 1OHPA 3WA3A 1FUWA 1OF5B 3KFQC 3F9SA 1W00A 3TDGA 1BUQA 1MNLA 3NV0A 2HMJB 5HOHA 1O7HB 5FGOA 1GD3A 1UCJA 4FR9A 2CC3A 1NDOB 5A0OB 3CC23 1UI7A 1W7CA 3N8BA 1C54A 1LXEA 1V57A 4CDLA 3LTCA 1RNTA 1YGWA 1S723 2F56A 5BU4A 1RRLA 2WGOA 2L4VA 3F8HA 1VQ73 1RMSA 1BRHA 1RGGA 3KKGA 4O02B 3HOHA 2E2TA 3K9MC 3D9RA 3QRDA 1A90A 1JBSA 3BNDA 4N6UA 2CHCA 2YFLB 3DGLA 4OK0A 5G1KA 2F99A 4JF8A 1GY6A 1WMNA 1N9EA 4Q53A 1UI8A 3CCQ3 4J9AA 1NB5I 3FH1A 5HGRA 4BTYA 2MF7A 5M19A 2KAAA 3AGNA 1JB5A 1T2HA 2UGIA 5D82A 4O2HA 5JBSA 4HOHA 5IG4A 3CMA3 1DMMA 3JVCA 1O7WB 3AGOA 4HM6B 5FW5A 4KVHA 2QEX3 3F7SA 4RZMA 1MWRA 3ROBA 4N6TA 2BIRA 4FMAA 1V74A 3ZG5A 1YGEA 4GSPA 4LGQA 2CKFB 1UDII 1Q864 1I3IA 4XB5A 1RDSA 1R4CA 1GMPA 4TX4A 2Q07A 3KCHA 1UW1A 2OQEA 3SX1A 4FMCA 4EXRA 2W03A 4IT7A 3LTDA 1OUNA 3CPOA 4BL3A 4XM4A 3CC43 1N9JA 1ROAA 4KZ1A 3U1WA 1TFKA 1BNGA 3MHEA 1GMRA 1AQZA 1RCKA 2R4IA 4N6MA 5AIIA 2ZA4A 1BNFA 1EQKA 2K0MA 2Y74A 1TTOA 1YIT3 5STDA 1BRIA 3NV0B 1MWUA 3KSPA 1CH0A 1RGKA 1ZX2A 2BNGA 4ZM8A 1A2VA 4RNTA 4LZIA 1QMAA 3KSED 2QGUA 1KSIA 3RGRA 4HM4B 1IVWA 1I3FA 3K0ZA 3DGYA 4N6NB 1JN5A 1BNEA 1FA3A 4R4KA 1B27A 3DGNA 4H3UA 3NQZA 1KWIA 2LQVA 3DXOA 2ML5A 3GZRA 5AYRB 3H51A 2XGLA 2OCTA 4GB5A 1UCIA 3EN8A 1FGOA 3EC9A 1PU4A 4N6V0 1KD14 1X1XA 2GXFA 4R9LA 3FSDA 4X2OA 3B4OA 3F40A 3STDA 1G02A 1M9GA 2GBXB 3MYTA 1NB3I 1D6YA 3GSPA 7GSPA 1JB4A 1AVLA 1I8VA 1UCKA 1RN7A 1A2PA 1VQQA 4BL2A 2C4BA 3DY5A 1C7HA 2Y73A 1B20A 2KF5A 1LNHA
chains in the Genus database with same CATH topology
1B3SA 1RLSA 1B2XA 6RNTA 1BIRA 1BAOA 1I0XA 2HOHA 3SYUA 1TRQA 1DETA 2RBIA 4GHOA 1BUJA 1BANA 1BVIA 1X1UA 1YNVX 5HOHA 3WR2A 1BOXA 2F4YA 1UCJA 1R4YA 1GOUA 3WHOA 1MGWA 2AADA 1C54A 5RNTA 3AHSA 1JBTA 1FUSA 1RNTA 1YGWA 4BIRA 1RGCA 2F56A 8RNTA 1LNIA 5BU4A 1B2MA 1RNBA 1LOYA 1MGRA 1RMSA 3D5IA 1BRHA 1RGGA 5GSPA 1BRGA 3HOHA 1I2EA 1JBSA 1DE3A 3RNTA 1GSPA 1BRSA 4J5KA 1I0VA 2GSPA 3AHWA 2KAAA 3AGNA 1T2HA 3BIRA 1I70A 1BSBA 2KF6A 4HOHA 1LRAA 2F5WA 3AGOA 3URPA 2AAEA 1IYYA 2BIRA 1UCLA 1GOYA 4GSPA 1I3IA 1RTUA 1RDSA 3Q3FA 1GMPA 2RNTA 3KCHA 1PYLA 1BRNL 1RGFA 2KF3A 1B21A 1HYFA 3BU4A 1BNGA 1BGSA 1GMRA 1AQZA 1GMQA 1RCKA 1LOVA 1BNSA 1BRJA 1HZ1A 9RNTA 2ZA4A 1BNFA 1TTOA 1BRIA 1RHLA 3DH2A 1CH0A 1RGKA 1I2FA 1T2IA 3D4AA 4RNTA 1YVSA 1PY3A 1BSAA 1RSNA 1BNRA 6GSPA 1RGHA 1I3FA 1FZUA 3DGYA 1AY7A 1GOVA 1BNEA 1BNJA 1RCLA 1X1WA 2BU4A 1B27A 1BRKA 1B2ZA 1JBRA 4BU4A 2F5MA 3D5GA 1BSEA 1RN1A 1B2SA 1UCIA 1RGLA 1BSCA 1FYSA 1RN4A 4HAAA 1TRPA 1I2GA 1FUTA 1RGEA 2SARA 1X1XA 1G02A 1BSDA 7GSPA 3GSPA 1ZGXA 3A5EA 1FW7A 1BNIA 1I8VA 1X1YA 1UCKA 1A2PA 1BU4A 4J5GA 2KF4A 1SARA 1LOWA 1Q9EA 2C4BA 5BIRA 1B20A 2KF5A 1RGAA 1B2UA 7RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3S A;  1RLS A;  1B2X A;  6RNT A;  1BIR A;  1BAO A;  1I0X A;  2HOH A;  3SYU A;  1TRQ A;  1DET A;  2RBI A;  4GHO A;  1BUJ A;  1BAN A;  1BVI A;  1X1U A;  1YNV X;  5HOH A;  3WR2 A;  1BOX A;  2F4Y A;  1UCJ A;  1R4Y A;  1GOU A;  3WHO A;  1MGW A;  2AAD A;  1C54 A;  5RNT A;  3AHS A;  1JBT A;  1FUS A;  1RNT A;  1YGW A;  4BIR A;  1RGC A;  2F56 A;  8RNT A;  1LNI A;  5BU4 A;  1B2M A;  1RNB A;  1LOY A;  1MGR A;  1RMS A;  3D5I A;  1BRH A;  1RGG A;  5GSP A;  1BRG A;  3HOH A;  1I2E A;  1JBS A;  1DE3 A;  3RNT A;  1GSP A;  1BRS A;  4J5K A;  1I0V A;  2GSP A;  3AHW A;  2KAA A;  3AGN A;  1T2H A;  3BIR A;  1I70 A;  1BSB A;  2KF6 A;  4HOH A;  1LRA A;  2F5W A;  3AGO A;  3URP A;  2AAE A;  1IYY A;  2BIR A;  1UCL A;  1GOY A;  4GSP A;  1I3I A;  1RTU A;  1RDS A;  3Q3F A;  1GMP A;  2RNT A;  3KCH A;  1PYL A;  1BRN L;  1RGF A;  2KF3 A;  1B21 A;  1HYF A;  3BU4 A;  1BNG A;  1BGS A;  1GMR A;  1AQZ A;  1GMQ A;  1RCK A;  1LOV A;  1BNS A;  1BRJ A;  1HZ1 A;  9RNT A;  2ZA4 A;  1BNF A;  1TTO A;  1BRI A;  1RHL A;  3DH2 A;  1CH0 A;  1RGK A;  1I2F A;  1T2I A;  3D4A A;  4RNT A;  1YVS A;  1PY3 A;  1BSA A;  1RSN A;  1BNR A;  6GSP A;  1RGH A;  1I3F A;  1FZU A;  3DGY A;  1AY7 A;  1GOV A;  1BNE A;  1BNJ A;  1RCL A;  1X1W A;  2BU4 A;  1B27 A;  1BRK A;  1B2Z A;  1JBR A;  4BU4 A;  2F5M A;  3D5G A;  1BSE A;  1RN1 A;  1B2S A;  1UCI A;  1RGL A;  1BSC A;  1FYS A;  1RN4 A;  4HAA A;  1TRP A;  1I2G A;  1FUT A;  1RGE A;  2SAR A;  1X1X A;  1G02 A;  1BSD A;  7GSP A;  3GSP A;  1ZGX A;  3A5E A;  1FW7 A;  1BNI A;  1I8V A;  1X1Y A;  1UCK A;  1A2P A;  1BU4 A;  4J5G A;  2KF4 A;  1SAR A;  1LOW A;  1Q9E A;  2C4B A;  5BIR A;  1B20 A;  2KF5 A;  1RGA A;  1B2U A;  7RNT A; 
#chains in the Genus database with same CATH topology
 2BHM A;  2OWP A;  3CPW 2;  3X3Y A;  4MMX B;  1JB2 A;  3MKI A;  1KQS 2;  2STD A;  1VQ9 3;  1BIR A;  1V58 A;  2CX1 A;  3MG2 A;  4IPB A;  5KP3 A;  1O7P B;  1E3V A;  1DYU A;  2HOH A;  3JUQ A;  1VQL 3;  3BLZ A;  1IQY A;  5AIH A;  3LTA A;  4GHO A;  1BUJ A;  3CC7 3;  1YHQ 3;  3J7Y d;  1ULI B;  4WHA A;  2XF3 A;  3WMD A;  3FZW A;  1DVD A;  1GD4 A;  1BOX A;  2F4Y A;  2GEX A;  2W0Q A;  3CU3 A;  3DUK A;  4KFF A;  3WR2 A;  4AKY A;  3G4S 3;  1VQ8 3;  4LYL B;  1R4Y A;  2Z76 A;  3WHO A;  2UX0 A;  1MGW A;  2BMO B;  3EF8 A;  4CCV A;  2HMO B;  5G1L A;  5RNT A;  3AHS A;  2C10 A;  2INX A;  5JPP A;  4KFE A;  1UGH I;  1EA2 A;  3EHC A;  1RNB A;  1MGR A;  2BT3 A;  2CK3 H;  3D5I A;  1KC8 4;  1BRG A;  1Q82 4;  4ORL A;  1IVV A;  3HK4 A;  2CFW A;  2RSX A;  3FG4 A;  1NO3 A;  1AR0 A;  2XH9 A;  1HU9 A;  1DE3 A;  2IYJ A;  1FGM A;  3L0R A;  4FCZ A;  1VZZ A;  3RDE A;  1TUH A;  2GSP A;  3MPH A;  4L8P A;  2E2V A;  3FKA A;  4EYC A;  4EBG A;  1YJ9 3;  4H61 A;  1NWW A;  2GU3 A;  5ELJ A;  3UL6 A;  3UL5 A;  1IV9 A;  1BSB A;  2D1W A;  3NBB A;  3F8X A;  1GS3 A;  3GZY B;  4XDV A;  2OOV C;  1T3B A;  2AAE A;  4LMI A;  1N8Q A;  2PZV A;  1UCL A;  1N5P A;  2CWT A;  3OV4 A;  1S5A A;  3CCV 3;  4FCM A;  2GEY A;  3B4P A;  3T8N A;  4MEI A;  7STD A;  1TFO A;  3S29 A;  1EUI C;  1EEJ A;  1PYL A;  3PXM A;  1OGX A;  3PS8 A;  4EW5 A;  2JQ5 A;  1GY5 A;  4CPK A;  3D79 A;  1W2B 2;  1BGS A;  3WA2 X;  3ER7 A;  5CF1 A;  1GMQ A;  1L5G B;  5EVH A;  1K8A 4;  2QA4 3;  1BNS A;  1BRJ A;  1W6C A;  4HZ9 B;  1O7M B;  9RNT A;  3X40 A;  1Q81 4;  2CFD A;  1W2Z A;  2W9Q A;  2XRX B;  4FMB A;  3UB1 A;  4EV2 A;  3SLU A;  3DH2 A;  1JNQ A;  3X3X A;  4AKZ A;  6STD A;  3D4A A;  1IU7 A;  1FGR A;  4RNY A;  4AEQ A;  1RSN A;  1BNR A;  5M18 A;  2CFL A;  1CQS A;  1AVK A;  1OCV A;  2O9U X;  1FGQ A;  2Z6B A;  1JZD A;  3HII A;  3S27 A;  3FG1 A;  1YI2 3;  4WFO A;  3FCS B;  1Q7Y 4;  1M1X B;  4BU4 A;  1ROV A;  3HI7 A;  1RN1 A;  2K54 A;  1B2S A;  1YJW 3;  1OAC A;  2YFJ B;  1UUV B;  1RGL A;  3MG3 A;  1O7G B;  4K1U A;  5CLK A;  1CYV A;  1TRP A;  1I2G A;  4HAA A;  1TU5 A;  1VQK 3;  5LC7 A;  3Q2P A;  3BNB A;  2B24 B;  2XSO B;  1G0T A;  3IJE B;  2HMN B;  1W01 A;  3A5E A;  2OOV A;  2KCD A;  1RKY A;  3FGY A;  1IVU A;  1Y4K A;  4J5G A;  2KF4 A;  1DVC A;  1SAR A;  1LOW A;  1SIH A;  2JDI H;  3N54 B;  3V92 A;  7RNT A;  3GAX A;  1LVN A;  1JV2 B;  1YJN 3;  1B2X A;  1IT8 A;  3FLJ A;  3DMC A;  5G2G A;  2P38 A;  2OTL 3;  5AIG A;  1JKG A;  3RGA A;  3SYU A;  1TRQ A;  2YFI B;  4R9K A;  1DET A;  2WOH A;  1BAN A;  1EKM A;  2W9P A;  3ZFZ A;  1N8R 4;  3O8Y A;  4K90 B;  3ZG0 A;  4L8O A;  5KP4 A;  4MJD A;  1ULJ B;  5DRV A;  1D6U A;  3LT9 A;  1GOU A;  4FCJ A;  4J8T A;  3BNC A;  2E2U A;  1JBT A;  1FUS A;  3N9H A;  4HM1 B;  3EJV A;  4NRE A;  2HMK B;  5D83 A;  1CYU A;  4BIR A;  3ALA A;  2K3D A;  8CHO A;  3WOE B;  3F14 A;  5IEP A;  3G8Z A;  5GSP A;  1O7N B;  1VQ5 3;  1OF5 A;  1GY7 A;  1VQ6 3;  2XEP A;  4O3V A;  3NM7 A;  4STD A;  1GSP A;  1BRS A;  3KZT A;  4J5K A;  3V99 A;  1I0V A;  1Z1S A;  4HKV B;  1IVX A;  5CK6 A;  5M1A A;  3VGN A;  4RNZ A;  1QVG 2;  3CNM A;  3JUO A;  4HM3 B;  3BIR A;  4HZB B;  2CW9 A;  3WOF B;  2KF6 A;  2YX9 A;  4HM2 B;  5JPU A;  4HM8 B;  1Q40 A;  1D6Z A;  3S28 A;  3HIG A;  3JUN A;  1ZS7 A;  5IEN A;  2F5W A;  3LTB A;  2GU1 A;  1RRH A;  3I55 3;  3LML A;  3DM8 A;  2HMM B;  4JRF A;  3SVA A;  4KFD A;  2GBW B;  2ZL8 A;  1TJD A;  2RFR A;  5KP1 A;  3KII A;  3EE1 A;  3MG1 A;  4X2H A;  4EC6 A;  1NJI 4;  1NNV A;  2RGQ A;  3JUM A;  4OUQ A;  4K61 A;  3X42 A;  3GRD A;  5IG0 A;  5IG5 A;  3CCS 3;  2XGN A;  4OVM A;  2CIU A;  2XR8 B;  1SPU A;  2RNT A;  2XFS A;  3DZL A;  3FF2 A;  3IMA B;  1G96 A;  1Q42 A;  5IEO A;  1ASK A;  1A67 A;  1QAF A;  4BTW A;  2BMQ B;  1BRN L;  5EEO A;  1OHO A;  3ECF A;  3PZW A;  5DRE A;  1B21 A;  1HYF A;  1JN5 B;  4MMZ B;  1K41 A;  2P05 A;  3OWS A;  1W6G A;  3GZB A;  1MWS A;  3EBY A;  1JKG B;  1HZ1 A;  3X41 A;  3SOY A;  5D81 A;  2WO0 A;  4HM7 B;  3CCM 3;  2IY2 A;  2CWU A;  2P0M A;  3D3L A;  2CG1 A;  4HYZ A;  1I2F A;  4I4K A;  1IQX A;  1YVS A;  3PGB A;  2BMR B;  3NX0 A;  3CME 3;  2F86 B;  1RGH A;  3A76 A;  3EBT A;  3S5C A;  1VQO 3;  1W5Z A;  2CFG A;  4WYK A;  1AY7 A;  2H0G A;  2W04 A;  5ELU A;  1MWT A;  2C11 A;  3F7X A;  1RCL A;  1X1W A;  2BU4 A;  4GL6 A;  4O8S A;  3V98 A;  1BRK A;  1B2Z A;  1JBR A;  2IA7 A;  5CXO A;  1M1K 4;  2F5M A;  1BSE A;  1VQP 3;  4HM5 B;  3K7C A;  2L1S A;  2V1L A;  1YVB I;  1CEW I;  1GYB A;  3QK9 A;  1RN4 A;  1FYS A;  2BO9 B;  1TIJ A;  1PFP A;  4XBX A;  1LOX A;  1T5Y A;  2IUJ A;  1FUT A;  2SAR A;  2CFK A;  1BSD A;  4L7K A;  5BXQ A;  1ZGX A;  4LSO A;  1FW7 A;  1BNI A;  4KT3 B;  3CCJ 3;  1X1Y A;  2KRT A;  2I9W A;  1STF I;  3HX8 A;  1WQL B;  3OWY A;  4RBN A;  3G71 3;  1BU4 A;  2PNC A;  1AV4 A;  1Q40 B;  3EN1 B;  3CXC 2;  5TGN A;  4CJN A;  5BIR A;  3PCS A;  4EV5 A;  4N3V A;  1B2U A;  1LQM B;  3U97 A;  2FNQ A;  1B3S A;  4I5Q A;  6RNT A;  1U8C B;  2HML B;  1QAK A;  3SXX A;  3MSO A;  1OPY A;  1UUG B;  1QJG A;  4XBT A;  5LC6 A;  3LOY A;  1VQ4 3;  1STD A;  1JZO A;  3IPT A;  2RBI A;  1LQG C;  1BVI A;  2J8X B;  1X1U A;  1YNV X;  1ZO2 A;  4HM0 B;  4WP5 A;  2M7O A;  2IMJ A;  3BB9 A;  3G16 A;  1IDP A;  2FGT A;  2P09 A;  3NXJ A;  2AAD A;  3K63 A;  3CNX A;  2ZHX B;  3FG3 A;  4XDW A;  2CH9 A;  4IIA A;  3VSY A;  3NHX A;  8RNT A;  1B2M A;  1RGC A;  1LNI A;  1QAL A;  5IG3 A;  3S67 A;  1LOY A;  4R80 A;  1A2K A;  1F8N A;  1W4N A;  1K9M 4;  2Z7A A;  2F98 A;  3LYG A;  1SII A;  3NUV A;  1I2E A;  1US1 A;  5AI1 A;  3BNE A;  1IQ8 A;  1EG9 B;  2H0I A;  1WMP A;  1IT7 A;  1E97 A;  1WNH A;  1TP6 A;  2P0X A;  2KXG A;  2WOF A;  2Z77 A;  3B7C A;  2RCD A;  2QIY A;  3Q90 A;  4PEJ A;  4WYK B;  3CCU 3;  3OW2 2;  3E99 A;  1OH0 A;  3UNL A;  3AHW A;  1HKX A;  5AEU B;  3VF1 A;  3LZA A;  1I70 A;  4BTX A;  1UGI A;  1VQM 3;  1UUW B;  4QWT A;  2R41 A;  1LRA A;  3T0U A;  2CWV A;  3CCL 3;  3MWZ A;  1VQN 3;  3AMO A;  3CCE 3;  2W56 A;  1OHS A;  2A15 A;  4NHF A;  5IF6 A;  2SBL A;  3CCR 3;  3PYJ A;  2ML6 A;  1QVF 2;  1YIJ 3;  1IYY A;  1GOY A;  3LH4 A;  2MC8 A;  4N6O B;  1W6Y A;  3EX9 A;  3KE7 A;  1E3R A;  2CG0 A;  4ILF A;  1RTU A;  3Q3F A;  2OTJ 3;  2W2C A;  4HJL B;  3FF0 A;  3G0K A;  3NQY A;  3OXA A;  1J2B A;  1ISK A;  1RJO A;  4WWU C;  3K5T A;  1SQW A;  1RGF A;  3M8C A;  2KF3 A;  3BU4 A;  3I0Y A;  1K73 4;  2WGQ A;  3DGO A;  3I56 3;  1IK3 A;  3Q1C A;  1Q7H A;  1LOV A;  3GWR A;  3NM2 A;  3X3Z A;  3KN4 A;  3SOA A;  3PCR A;  5IER A;  4HBR A;  4K1V A;  3RNT A;  5AEW B;  1RHL A;  4N6L A;  2LYX A;  5AYS C;  1T2I A;  3UJM A;  1PY3 A;  3H3H A;  1BSA A;  5EQL A;  6GSP A;  1N5H A;  2CX0 A;  3GZX B;  1FZU A;  3NBJ A;  1GOV A;  1JJ2 2;  1BNJ A;  1JRQ A;  3HZP A;  4NPB A;  1SJW A;  1M90 4;  3EB8 A;  3D5G A;  4R1K A;  5AIF A;  4U13 A;  4HVN A;  1FGT A;  3EQQ B;  1BSC A;  3WDG B;  1DMQ A;  1RGE A;  3CD6 3;  5BVB A;  1WTH A;  2FXT A;  2W6J H;  3DGM A;  4G1M B;  1OGZ A;  1NU3 A;  2XFT A;  4LEH A;  3LT8 A;  3B8L A;  1IV7 A;  1DMN A;  1K28 A;  3NBR A;  3OX9 A;  4FMD A;  4XBY A;  4DKI A;  3SED A;  2ZDJ A;  3G6E 3;  2H0H A;  1Q9E A;  3LXU X;  3OWU A;  2IUK A;  3AMO B;  4MMY B;  1RGA A;  3URP A;  2UUG C;  5I97 A;  5IW9 A;  2W56 B;  5CF2 A;  1WMO A;  1RLS A;  3JUP A;  2B1X B;  2OQE C;  2XSH B;  1U5O A;  2D42 A;  2O3O A;  3T8U A;  3WOD G;  1W02 A;  1BAO A;  1MOL A;  1I0X A;  1OHP A;  3WA3 A;  1FUW A;  1OF5 B;  3KFQ C;  3F9S A;  1W00 A;  3TDG A;  1BUQ A;  1MNL A;  3NV0 A;  2HMJ B;  5HOH A;  1O7H B;  5FGO A;  1GD3 A;  1UCJ A;  4FR9 A;  2CC3 A;  1NDO B;  5A0O B;  3CC2 3;  1UI7 A;  1W7C A;  3N8B A;  1C54 A;  1LXE A;  1V57 A;  4CDL A;  3LTC A;  1RNT A;  1YGW A;  1S72 3;  2F56 A;  5BU4 A;  1RRL A;  2WGO A;  2L4V A;  3F8H A;  1VQ7 3;  1RMS A;  1BRH A;  1RGG A;  3KKG A;  4O02 B;  3HOH A;  2E2T A;  3K9M C;  3D9R A;  3QRD A;  1A90 A;  1JBS A;  3BND A;  4N6U A;  2CHC A;  2YFL B;  3DGL A;  4OK0 A;  5G1K A;  2F99 A;  4JF8 A;  1GY6 A;  1WMN A;  1N9E A;  4Q53 A;  1UI8 A;  3CCQ 3;  4J9A A;  1NB5 I;  3FH1 A;  5HGR A;  4BTY A;  2MF7 A;  5M19 A;  2KAA A;  3AGN A;  1JB5 A;  1T2H A;  2UGI A;  5D82 A;  4O2H A;  5JBS A;  4HOH A;  5IG4 A;  3CMA 3;  1DMM A;  3JVC A;  1O7W B;  3AGO A;  4HM6 B;  5FW5 A;  4KVH A;  2QEX 3;  3F7S A;  4RZM A;  1MWR A;  3ROB A;  4N6T A;  2BIR A;  4FMA A;  1V74 A;  3ZG5 A;  1YGE A;  4GSP A;  4LGQ A;  2CKF B;  1UDI I;  1Q86 4;  1I3I A;  4XB5 A;  1RDS A;  1R4C A;  1GMP A;  4TX4 A;  2Q07 A;  3KCH A;  1UW1 A;  2OQE A;  3SX1 A;  4FMC A;  4EXR A;  2W03 A;  4IT7 A;  3LTD A;  1OUN A;  3CPO A;  4BL3 A;  4XM4 A;  3CC4 3;  1N9J A;  1ROA A;  4KZ1 A;  3U1W A;  1TFK A;  1BNG A;  3MHE A;  1GMR A;  1AQZ A;  1RCK A;  2R4I A;  4N6M A;  5AII A;  2ZA4 A;  1BNF A;  1EQK A;  2K0M A;  2Y74 A;  1TTO A;  1YIT 3;  5STD A;  1BRI A;  3NV0 B;  1MWU A;  3KSP A;  1CH0 A;  1RGK A;  1ZX2 A;  2BNG A;  4ZM8 A;  1A2V A;  4RNT A;  4LZI A;  1QMA A;  3KSE D;  2QGU A;  1KSI A;  3RGR A;  4HM4 B;  1IVW A;  1I3F A;  3K0Z A;  3DGY A;  4N6N B;  1JN5 A;  1BNE A;  1FA3 A;  4R4K A;  1B27 A;  3DGN A;  4H3U A;  3NQZ A;  1KWI A;  2LQV A;  3DXO A;  2ML5 A;  3GZR A;  5AYR B;  3H51 A;  2XGL A;  2OCT A;  4GB5 A;  1UCI A;  3EN8 A;  1FGO A;  3EC9 A;  1PU4 A;  4N6V 0;  1KD1 4;  1X1X A;  2GXF A;  4R9L A;  3FSD A;  4X2O A;  3B4O A;  3F40 A;  3STD A;  1G02 A;  1M9G A;  2GBX B;  3MYT A;  1NB3 I;  1D6Y A;  3GSP A;  7GSP A;  1JB4 A;  1AVL A;  1I8V A;  1UCK A;  1RN7 A;  1A2P A;  1VQQ A;  4BL2 A;  2C4B A;  3DY5 A;  1C7H A;  2Y73 A;  1B20 A;  2KF5 A;  1LNH A; 
#chains in the Genus database with same CATH homology
 1B3S A;  1RLS A;  1B2X A;  6RNT A;  1BIR A;  1BAO A;  1I0X A;  2HOH A;  3SYU A;  1TRQ A;  1DET A;  2RBI A;  4GHO A;  1BUJ A;  1BAN A;  1BVI A;  1X1U A;  1YNV X;  5HOH A;  3WR2 A;  1BOX A;  2F4Y A;  1UCJ A;  1R4Y A;  1GOU A;  3WHO A;  1MGW A;  2AAD A;  1C54 A;  5RNT A;  3AHS A;  1JBT A;  1FUS A;  1RNT A;  1YGW A;  4BIR A;  1RGC A;  2F56 A;  8RNT A;  1LNI A;  5BU4 A;  1B2M A;  1RNB A;  1LOY A;  1MGR A;  1RMS A;  3D5I A;  1BRH A;  1RGG A;  5GSP A;  1BRG A;  3HOH A;  1I2E A;  1JBS A;  1DE3 A;  3RNT A;  1GSP A;  1BRS A;  4J5K A;  1I0V A;  2GSP A;  3AHW A;  2KAA A;  3AGN A;  1T2H A;  3BIR A;  1I70 A;  1BSB A;  2KF6 A;  4HOH A;  1LRA A;  2F5W A;  3AGO A;  3URP A;  2AAE A;  1IYY A;  2BIR A;  1UCL A;  1GOY A;  4GSP A;  1I3I A;  1RTU A;  1RDS A;  3Q3F A;  1GMP A;  2RNT A;  3KCH A;  1PYL A;  1BRN L;  1RGF A;  2KF3 A;  1B21 A;  1HYF A;  3BU4 A;  1BNG A;  1BGS A;  1GMR A;  1AQZ A;  1GMQ A;  1RCK A;  1LOV A;  1BNS A;  1BRJ A;  1HZ1 A;  9RNT A;  2ZA4 A;  1BNF A;  1TTO A;  1BRI A;  1RHL A;  3DH2 A;  1CH0 A;  1RGK A;  1I2F A;  1T2I A;  3D4A A;  4RNT A;  1YVS A;  1PY3 A;  1BSA A;  1RSN A;  1BNR A;  6GSP A;  1RGH A;  1I3F A;  1FZU A;  3DGY A;  1AY7 A;  1GOV A;  1BNE A;  1BNJ A;  1RCL A;  1X1W A;  2BU4 A;  1B27 A;  1BRK A;  1B2Z A;  1JBR A;  4BU4 A;  2F5M A;  3D5G A;  1BSE A;  1RN1 A;  1B2S A;  1UCI A;  1RGL A;  1BSC A;  1FYS A;  1RN4 A;  4HAA A;  1TRP A;  1I2G A;  1FUT A;  1RGE A;  2SAR A;  1X1X A;  1G02 A;  1BSD A;  7GSP A;  3GSP A;  1ZGX A;  3A5E A;  1FW7 A;  1BNI A;  1I8V A;  1X1Y A;  1UCK A;  1A2P A;  1BU4 A;  4J5G A;  2KF4 A;  1SAR A;  1LOW A;  1Q9E A;  2C4B A;  5BIR A;  1B20 A;  2KF5 A;  1RGA A;  1B2U A;  7RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...