1JN5B

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna export factor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
182
Chain Sequence
APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords p15
publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 182
sequence length 186
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
B PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jn5B00
1Q42A 3JUPA 4L8PA 5IENA 4LMIA 3EN8A 5G2GA 1OH0A 4XBTA 2QGUA 5D83A 1OF5A 3NV0B 2GEYA 2XSOB 4X2HA 1W00A 3JUMA 1WQLB 1O7WB 1E3RA 1AR0A 1K41A 4J9AA 3KKGA 3F7SA 3B8LA 2YFJB 3CNXA 1O7HB 1UUVB 2HMJB 3F14A 4XB5A 4LEHA 2GEXA 1NDOB 4N3VA 3CNMA 4MJDA 5JPUA 3LZAA 3MYTA 3KZTA 2XSHB 1GS3A 2INXA 4K1VA 5BXQA 1EA2A 3HK4A 4XDVA 5IG4A 4HM6B 2HMMB 2YFLB 3G8ZA 1E3VA 3OWSA 4R9LA 2BMQB 1C7HA 2PZVA 5AIGA 3RGRA 4H3UA 4I4KA 3EJVA 2STDA 3ECFA 3EF8A 4WYKB 3BLZA 3UJMA 3OX9A 3DZLA 3HZPA 1OGXA 5AEUB 1JKGA 3GZYB 3IPTA 5CF1A 3NBRA 5STDA 5AIFA 5IG5A 1A2KA 2HMLB 1OCVA 2Z7AA 3MG1A 5AEWB 5IEOA 2I9WA 4PEJA 3OV4A 3UNLA 2HMOB 1U5OA 6STDA 4U13A 3EQQB 3F7XA 2BMRB 2UX0A 5CK6A 1ZO2A 3KSPA 2W2CA 3G0KA 2A15A 4HM7B 1W02A 3G16A 3DXOA 2RCDA 1ZX2A 8CHOA 1OUNA 4HKVB 3VGNA 1DMNA 3STDA 4HM8B 1Q40A 1OPYA 1JN5A 4KVHA 3RGAA 1NU3A 1ASKA 3F40A 1Z1SA 3I0YA 4ORLA 2IMJA 2RGQA 4HM1B 3FSDA 4HVNA 3FF0A 5AI1A 3GWRA 4K1UA 3NHXA 5IEPA 3KE7A 3ROBA 3JUQA 4X2OA 2GXFA 2B24B 4WWUC 1EG9B 2B1XB 3B4PA 1JKGB 2F86B 4R9KA 3EBYA 4RZMA 3Q90A 3MG3A 1O7NB 3F8XA 4CDLA 3WMDA 3FH1A 3GRDA 3SEDA 3E99A 3B7CA 1E97A 5KP3A 2BMOB 4R1KA 3GZXB 1STDA 4XBXA 2RFRA 3T8NA 1GY5A 1GY6A 5AIHA 2HMNB 1SJWA 3JUNA 5KP4A 3FZWA 2BNGA 3FGYA 4OUQA 5DREA 5CXOA 5D81A 1ULJB 3MHEA 4IIAA 3A76A 1Q40B 3H3HA 1JN5B 5AIIA 3D9RA 3DMCA 5JPPA 4J8TA 3MG2A 1OHSA 1TUHA 3CPOA 7STDA 4L8OA 4HM5B 1ISKA 1DMMA 2Z77A 4XDWA 5D82A 2F99A 2Z76A 1NWWA 3HX8A 3H51A 1S5AA 3EHCA 3FF2A 5BVBA 1QJGA 5CLKA 5TGNA 5FW5A 1GY7A 3DUKA 3FKAA 2CKFB 3NUVA 2JQ5A 3SOYA 1W6YA 3K7CA 4HM2B 2XR8B 1UUWB 4LGQA 5HGRA 3T8UA 3S5CA 2GBXB 2K54A 1W01A 4Q53A 5CF2A 3EBTA 4HM4B 4HZ9B 2XRXB 3LYGA 1OHOA 4STDA 3GZRA 4XM4A 4HZBB 5KP1A 2GBWB 1BUQA 1OGZA 1TP6A 1O7MB 2F98A 3BB9A 1OHPA 3FLJA 1JB2A 2OWPA 3SOAA 3OWUA 3NV0A 3VSYA 1JB4A 1JB5A 2HMKB 3EN1B 1O7GB 4HJLB 3OWYA 1ULIB 3DM8A 1IDPA 4L7KA 3OXAA 3GZBA 3MKIA 3NXJA 4FCMA 4OVMA 3ER7A 4XBYA 5IG0A 1O7PB 3K0ZA 3MSOA 5IF6A 3F8HA 3B4OA 1QMAA 1GYBA 3JUOA 3F9SA 4GB5A 3CU3A 3NM2A 1OF5B 4HM3B 5DRVA 5IG3A 5IERA 2CHCA 3EC9A 1HKXA 5EVHA 1CQSA 4HM0B 4FCJA 2R4IA 3EX9A 3M8CA 1VZZA 4WYKA 1DMQA 4WP5A 2QIYA 2YFIB
chains in the Genus database with same CATH superfamily
1MWRA 3PCRA 1Q42A 3JUPA 4K61A 4I5QA 4L8PA 4O02B 1OACA 2W6JH 3ZG0A 5EEOA 1Q824 1JZOA 2OQEA 5IENA 4LZIA 3AMOB 1BNSA 3GAXA 4LMIA 3EN8A 2PNCA 4RNZA 5G2GA 3LH4A 3LTDA 3JVCA 3LTAA 2CIUA 1IQYA 1RGAA 3K9MC 3X42A 2SARA 1BSCA 1OH0A 4XBTA 3I563 1RRLA 2ZL8A 2QGUA 3AHWA 3NQYA 1BSEA 5D83A 4HOHA 1OF5A 1LOYA 1M1XB 3NV0B 4EC6A 2GEYA 1M9GA 2XSOB 4X2HA 1JJ22 1W00A 3WA3A 3BNDA 3JUMA 1WQLB 1O7WB 1W2B2 1E3RA 1SQWA 1X1XA 5GSPA 2P05A 1AR0A 3V98A 1N9EA 3S67A 1K41A 3LXUX 1YVBI 3PXMA 4J9AA 3KKGA 3F7SA 3B8LA 3AHSA 1UI8A 1HZ1A 2E2VA 2YFJB 3CNXA 1O7HB 1LVNA 1UUVB 1BANA 2CG0A 2E2TA 1LQMB 1V58A 1TRQA 3Q2PA 2HMJB 3F14A 4XB5A 4LEHA 1PY3A 5IW9A 2GEXA 1PU4A 3N8BA 1NDOB 1RGEA 4N3VA 2F5WA 3CNMA 4MJDA 3AMOA 2OTJ3 5JPUA 2CC3A 1BAOA 3LZAA 3MYTA 1IVXA 3KZTA 1UGHI 2D42A 2XSHB 4FMCA 1MGWA 1GS3A 2L4VA 4MMZB 1Q7HA 2INXA 3SYUA 4K1VA 5BXQA 3ALAA 1EEJA 1EA2A 3EB8A 1RGLA 1GSPA 1AY7A 3S28A 7GSPA 1IT8A 1MWUA 1CYVA 3HK4A 4EV5A 4XDVA 5IG4A 4HM6B 1BU4A 2HMMB 1W7CA 2ZA4A 2YFLB 2KF4A 1KC84 1GD3A 2ML5A 3LTBA 3BNCA 3SXXA 3AGOA 3CCV3 1BRGA 1IVWA 1BSAA 3G8ZA 2AAEA 1N8R4 1IQ8A 1E3VA 1B2XA 3OWSA 3URPA 2XFSA 2BMQB 4HBRA 4R9LA 1LNHA 3WA2X 1FW7A 1JBTA 1C7HA 2PZVA 5AIGA 3RGRA 2KF6A 2C4BA 4H3UA 4I4KA 1C54A 1LQGC 3EJVA 4O8SA 5ELJA 2CG1A 2V1LA 1W2ZA 4EW5A 3I553 2STDA 3ECFA 3X40A 3EF8A 1VQQA 3Q3FA 1ZS7A 2RSXA 3CCU3 4WYKB 3NX0A 3CC43 4LYLB 4AEQA 1NO3A 1I2EA 1MNLA 1IQXA 3BLZA 3UJMA 2RBIA 2W04A 1IYYA 4GSPA 2LYXA 3OX9A 3SVAA 1FGMA 3DZLA 3HZPA 1AVKA 1OGXA 2KAAA 2MF7A 3KIIA 5AEUB 1JKGA 4N6NB 3GZYB 1STFI 3IPTA 1JV2B 5CF1A 2BU4A 4NREA 4KFFA 3NBRA 5STDA 3UL6A 1T3BA 3RNTA 2KF5A 5AIFA 3J7Yd 1IK3A 1IVVA 5IG5A 2CH9A 4MMXB 1A2KA 1RRHA 1UCIA 4O3VA 2XEPA 1N5HA 2CFLA 2HMLB 3BIRA 2IY2A 1UW1A 2HOHA 3WDGB 1OCVA 1K28A 2K0MA 2Z7AA 3SX1A 1GOVA 3MG1A 5AEWB 6GSPA 3CPW2 1B2SA 4MEIA 5IEOA 2I9WA 4PEJA 3X3XA 3OV4A 1YVSA 3UNLA 1WMOA 2HMOB 2CWTA 3T0UA 1G96A 5M19A 1U5OA 6STDA 1FGQA 3G6E3 4U13A 3EQQB 1RJOA 2Y74A 4EV2A 3F7XA 4RBNA 1NB3I 1UUGB 2CFWA 2BMRB 4EXRA 2UX0A 3BU4A 1I3IA 1ZO2A 2F4YA 5CK6A 1S723 1J2BA 3KSPA 2W2CA 1YIT3 1VQP3 1VQK3 2W9QA 3G0KA 5JBSA 2CFGA 2A15A 4HM7B 2JDIH 4MMYB 2CFKA 3LOYA 1W02A 1YJN3 3G16A 4GHOA 3DXOA 1RGFA 1D6YA 3CD63 1LXEA 1KWIA 1RN1A 2QEX3 2H0GA 1ZX2A 2RCDA 8CHOA 1YIJ3 1YGWA 3PCSA 1VQM3 1OUNA 4HKVB 3VGNA 1DMNA 3X3YA 3STDA 1FUSA 4HM8B 1Q40A 1BGSA 1D6ZA 1VQ93 1OPYA 2IUJA 1JN5A 1RLSA 4KVHA 1YI23 1FGOA 3RGAA 3CME3 5RNTA 1NU3A 2RNTA 1ASKA 3K63A 1DYUA 3LT8A 3F40A 3X41A 1Z1SA 3I0YA 4ORLA 1AQZA 1ZGXA 2IMJA 1JRQA 2RGQA 4HM1B 8RNTA 3HI7A 3FSDA 4HVNA 2XGNA 3FF0A 5AI1A 3D5IA 1I2GA 2QA43 4OK0A 3CXC2 3GWRA 4FCZA 4CJNA 1NNVA 2IA7A 3NHXA 4K1UA 1QALA 5IEPA 3DGNA 3UB1A 3CCJ3 1Q814 3KE7A 3ROBA 1VQL3 1RDSA 1SPUA 3AGNA 3JUQA 1KD14 3D5GA 1IT7A 4X2OA 1RGGA 2KRTA 1QAKA 3MWZA 3VF1A 1JBSA 1EKMA 2WO0A 3DGLA 2C10A 2P38A 1BSDA 2GXFA 2UGIA 2BT3A 1I2FA 3PYJA 4JRFA 1MOLA 4EYCA 5G1LA 1WMNA 2B24B 1T5YA 3CCQ3 4WWUC 1EG9B 2B1XB 4ILFA 3X3ZA 1NJI4 3B4PA 1JKGB 1RSNA 2AADA 3FCSB 4HAAA 1Y4KA 4NHFA 5BU4A 2F86B 2J8XB 4HYZA 4KZ1A 4R9KA 1YJ93 3CC73 3EBYA 4G1MB 1BRIA 1FUTA 4RZMA 3Q90A 3WOEB 4FR9A 1FUWA 3MG3A 2XGLA 1O7NB 3F8XA 2L1SA 4CDLA 3WMDA 2Y73A 3FG3A 3SLUA 3FH1A 1CEWI 1HYFA 1RCKA 2Z6BA 3GRDA 2WOFA 3SEDA 2O3OA 4R80A 3E99A 1PFPA 1WNHA 3B7CA 1BVIA 3FG1A 9RNTA 1E97A 5KP3A 2BMOB 2GSPA 2KF3A 5FGOA 5A0OB 4N6LA 4R1KA 4BL3A 1RGKA 1RN4A 1A2VA 1X1YA 3GZXB 3IJEB 4EBGA 1STDA 1GMRA 1LNIA 1V57A 4XBXA 1B20A 2OCTA 2RFRA 1YJW3 3CCL3 2ML6A 1VQ63 2KCDA 3T8NA 1GY5A 1GY6A 5AIHA 2W0QA 1B3SA 2HMNB 1R4YA 1SJWA 1LRAA 1FA3A 3JUNA 1GMPA 1A2PA 1BRHA 5KP4A 2OTL3 3FZWA 2BNGA 4QWTA 1NB5I 4AKZA 3FGYA 4OUQA 4NPBA 5DREA 5CXOA 1DVDA 5D81A 1ULJB 3MHEA 3NQZA 3WHOA 4IIAA 3OW22 5LC6A 5EQLA 2GU1A 1UDII 2WGQA 3A76A 1AV4A 1Q40B 1SARA 1I70A 1N8QA 3H3HA 1JN5B 5AIIA 3D9RA 1PYLA 1MWSA 1K9M4 4CPKA 1RNTA 4N6MA 1BNRA 2OOVC 3DMCA 3CCE3 1GD4A 1F8NA 6RNTA 4BTXA 5JPPA 1ROAA 2P0XA 3GSPA 2WOHA 3D79A 3FG4A 3NBJA 3QK9A 3MG2A 4J8TA 1BRSA 2W56A 5G1KA 3ZG5A 5BIRA 1OHSA 1TUHA 1FYSA 3O8YA 4IT7A 3CPOA 7STDA 4L8OA 1WTHA 1VQ73 4HM5B 1TFOA 1DE3A 1A90A 1GOUA 1ISKA 3DH2A 1DMMA 4BL2A 2OQEC 2Z77A 2YX9A 1N9JA 4K90B 4XDWA 1IU7A 1BNJA 1T2IA 1V74A 3HIIA 5D82A 1GOYA 2K3DA 2F99A 2FXTA 3A5EA 2Z76A 1NWWA 2P0MA 3HX8A 3H51A 1A67A 4J5GA 2D1WA 1IV9A 3N54B 1BRJA 1SIHA 3LT9A 1S5AA 1X1WA 2CX1A 3EHCA 1UGIA 3EE1A 3FF2A 2IUKA 5BVBA 1GMQA 3PGBA 1R4CA 3CCM3 1QJGA 1UI7A 5CLKA 5I97A 1TIJA 4N6OB 1RTUA 1X1UA 2ZDJA 1Q864 1N5PA 1Q9EA 1BOXA 5TGNA 3L0RA 3DGOA 2CX0A 5HOHA 4GL6A 1CYUA 5FW5A 3CMA3 3NBBA 1BNGA 1U8CB 1RCLA 1G02A 1GY7A 2CFDA 1RGCA 1YGEA 2CK3H 3DUKA 3FKAA 2CKFB 1VQ43 5ELUA 1FZUA 2CWVA 1UCLA 3NUVA 2R41A 2JQ5A 3NM7A 3RDEA 4BTYA 2CWUA 4CCVA 3WOFB 3SOYA 3N9HA 5LC7A 1W6YA 3K7CA 4HM2B 3MPHA 2XR8B 1UUWB 4LGQA 1TRPA 4BTWA 1SIIA 1BNFA 1I0XA 3PS8A 2LQVA 5HGRA 3T8UA 3S5CA 2GBXB 1RNBA 1UCKA 2WGOA 2K54A 1W01A 2GU3A 2KXGA 2XH9A 2SBLA 4Q53A 2BHMA 2XF3A 3EBTA 5CF2A 1FGTA 1BNEA 4HM4B 4IPBA 1TFKA 3KSED 3CCR3 3V99A 1MGRA 4HZ9B 4WFOA 2XRXB 1I8VA 2XFTA 5M1AA 3LYGA 3S27A 2CW9A 1OHOA 4STDA 1MWTA 3GZRA 4AKYA 1YHQ3 1I0VA 4XM4A 3S29A 2ZHXB 1FGRA 4HZBB 5KP1A 1RKYA 1L5GB 3DY5A 1VQO3 2FNQA 2GBWB 3DGYA 3G4S3 1OGZA 1BUQA 4ZM8A 1EQKA 1TP6A 3TDGA 1B27A 1O7MB 1TTOA 3LTCA 1VQN3 3BNEA 3U1WA 1B2ZA 1Q7Y4 3WODG 5M18A 4N6V0 1CH0A 2F98A 1LOVA 3BB9A 1B21A 1OHPA 1B2UA 1BRNL 3FLJA 1RMSA 1JB2A 1HU9A 1QAFA 2OWPA 3SOAA 2W56B 3OWUA 1BSBA 1I3FA 2BIRA 3KN4A 4FMAA 1B2MA 3NV0A 4KT3B 4BIRA 3BNBA 3VSYA 2W9PA 2BO9B 4JF8A 1JB4A 1RN7A 4BU4A 1JB5A 1W5ZA 2HMKB 3EN1B 1BIRA 1BNIA 1O7GB 3D4AA 4HJLB 1JNQA 3QRDA 1LOWA 3OWYA 1ULIB 2C11A 3DM8A 1IDPA 1JZDA 1IV7A 1D6UA 4L7KA 7RNTA 1G0TA 1TU5A 2H0IA 3OXAA 3GZBA 3MKIA 3Q1CA 1RGHA 2P09A 3NXJA 1DETA 2F56A 3WR2A 4H61A 4FCMA 1KQS2 1VQ83 1ROVA 4RNTA 4FMDA 4OVMA 1K8A4 1RHLA 2UUGC 1W6CA 3ER7A 3CCS3 2E2UA 1YNVX 4TX4A 4XBYA 4N6TA 4FMBA 5IG0A 1O7PB 2W03A 4O2HA 2M7OA 4DKIA 4LSOA 4J5KA 1QVF2 3K0ZA 1W6GA 1EUIC 3MSOA 1M1K4 5IF6A 3F8HA 3B4OA 3U97A 2Q07A 1QMAA 2F5MA 1GYBA 1AVLA 3JUOA 2H0HA 3HIGA 3F9SA 3V92A 4GB5A 4WHAA 2O9UX 3CU3A 3NM2A 2IYJA 1JBRA 1OF5B 1K734 4HM3B 5DRVA 3D3LA 5IG3A 1M904 5IERA 2CHCA 3EC9A 1HKXA 5EVHA 1CQSA 4HM0B 3CC23 3LMLA 2FGTA 4N6UA 3KFQC 1DVCA 1IVUA 3KCHA 4FCJA 1US1A 1BUJA 3ZFZA 2R4IA 3PZWA 1LOXA 3EX9A 3HOHA 1KSIA 1UCJA 1BRKA 1TJDA 1QVG2 2OOVA 4RNYA 3IMAB 3M8CA 3UL5A 1VZZA 4WYKA 1WMPA 5AYRB 1VQ53 3G713 4R4KA 1W4NA 2MC8A 1DMQA 3DGMA 4KFDA 4WP5A 5AYSC 1T2HA 3K5TA 2QIYA 2YFIB 4KFEA
chains in the Genus database with same CATH topology
3U1WA 3PCRA 1Q42A 3JUPA 4K61A 4L8PA 4O02B 1OACA 2W6JH 1Q824 5EEOA 2OQEA 5IENA 4LZIA 3AMOB 3GAXA 4LMIA 3EN8A 2PNCA 4RNZA 5G2GA 3LH4A 3LTDA 3JVCA 3LTAA 2CIUA 1IQYA 3K9MC 3X42A 1OH0A 4XBTA 3I563 1RRLA 2ZL8A 2QGUA 3NQYA 5D83A 1OF5A 1M1XB 3NV0B 4EC6A 2GEYA 1M9GA 2XSOB 4X2HA 1JJ22 1W00A 3WA3A 3BNDA 3JUMA 1WQLB 1O7WB 1W2B2 1E3RA 1SQWA 2P05A 1AR0A 3V98A 1N9EA 3S67A 1K41A 3LXUX 1YVBI 3PXMA 4J9AA 3KKGA 3F7SA 3B8LA 1UI8A 2E2VA 2YFJB 3CNXA 1O7HB 1LVNA 1UUVB 2CG0A 2E2TA 3Q2PA 2HMJB 3F14A 4XB5A 4LEHA 5IW9A 2GEXA 1PU4A 3N8BA 1NDOB 4N3VA 3CNMA 4MJDA 3AMOA 2OTJ3 5JPUA 2CC3A 3LZAA 3MYTA 1IVXA 3KZTA 2D42A 2XSHB 4FMCA 1GS3A 2L4VA 4MMZB 2INXA 4K1VA 5BXQA 3ALAA 1EA2A 3EB8A 3S28A 1IT8A 4EV5A 1CYVA 3HK4A 4XDVA 5IG4A 4HM6B 2HMMB 1W7CA 2YFLB 1KC84 1GD3A 2ML5A 3LTBA 3BNCA 3SXXA 3CCV3 1IVWA 1N8R4 3G8ZA 1IQ8A 1E3VA 3OWSA 3WA2X 2XFSA 2BMQB 4HBRA 4R9LA 1LNHA 1C7HA 2PZVA 5AIGA 3RGRA 4H3UA 4I4KA 4O8SA 3EJVA 5ELJA 2CG1A 2V1LA 1W2ZA 3I553 2STDA 3ECFA 3X40A 3EF8A 3CCU3 2RSXA 4WYKB 3NX0A 3CC43 4AEQA 1NO3A 1MNLA 3BLZA 1IQXA 3UJMA 2W04A 2LYXA 3OX9A 3SVAA 1FGMA 3DZLA 3HZPA 1AVKA 1OGXA 2MF7A 3KIIA 5AEUB 1JKGA 4N6NB 3GZYB 1STFI 3IPTA 1JV2B 5CF1A 4NREA 4KFFA 3NBRA 5STDA 3UL6A 5AIFA 3J7Yd 1IK3A 1IVVA 5IG5A 2CH9A 4MMXB 1A2KA 1RRHA 4O3VA 2XEPA 1N5HA 2CFLA 2HMLB 1UW1A 3WDGB 1OCVA 1K28A 2K0MA 2Z7AA 3SX1A 3MG1A 5AEWB 3CPW2 4MEIA 5IEOA 2I9WA 4PEJA 3X3XA 3OV4A 3UNLA 1WMOA 2HMOB 2CWTA 3T0UA 1G96A 1U5OA 6STDA 1FGQA 3G6E3 4U13A 3EQQB 1RJOA 2Y74A 4EV2A 3F7XA 4RBNA 1NB3I 2CFWA 2BMRB 4EXRA 2UX0A 5CK6A 1J2BA 1ZO2A 1S723 3KSPA 2W2CA 1YIT3 1VQP3 1VQK3 2W9QA 3G0KA 5JBSA 2CFGA 2A15A 4HM7B 2JDIH 4MMYB 2CFKA 3LOYA 1W02A 1YJN3 3G16A 3DXOA 1D6YA 3CD63 1LXEA 1KWIA 2QEX3 2RCDA 1ZX2A 8CHOA 1YIJ3 3PCSA 1VQM3 1OUNA 4HKVB 3VGNA 1DMNA 3X3YA 3STDA 4HM8B 1Q40A 1D6ZA 1VQ93 1OPYA 2IUJA 1JN5A 4KVHA 1YI23 1FGOA 3RGAA 3CME3 1NU3A 3LT8A 1ASKA 3K63A 1DYUA 3X41A 3F40A 1Z1SA 3I0YA 4ORLA 2IMJA 1JRQA 2RGQA 4HM1B 3HI7A 3FSDA 4HVNA 2XGNA 3FF0A 5AI1A 2QA43 4OK0A 3CXC2 3GWRA 4FCZA 4K1UA 2IA7A 3NHXA 1QALA 5IEPA 3DGNA 3UB1A 3CCJ3 1Q814 3KE7A 3ROBA 1VQL3 1SPUA 3JUQA 1KD14 1IT7A 4X2OA 2KRTA 3MWZA 1QAKA 3VF1A 1EKMA 2WO0A 3DGLA 2C10A 2P38A 2GXFA 2BT3A 3PYJA 4JRFA 1MOLA 4EYCA 1WMNA 2B24B 1T5YA 3CCQ3 4WWUC 1EG9B 2B1XB 3X3ZA 1NJI4 3B4PA 1JKGB 3FCSB 4NHFA 1Y4KA 2F86B 4R9KA 4HYZA 4KZ1A 1YJ93 3CC73 3EBYA 4G1MB 4RZMA 3Q90A 3WOEB 4FR9A 1FUWA 3MG3A 2XGLA 1O7NB 3F8XA 4CDLA 3WMDA 2Y73A 3FG3A 3SLUA 3FH1A 1CEWI 3GRDA 2Z6BA 3SEDA 2WOFA 2O3OA 4R80A 3E99A 1PFPA 1WNHA 3B7CA 3FG1A 1E97A 5KP3A 2BMOB 5FGOA 5A0OB 4N6LA 4R1KA 4EBGA 1A2VA 3GZXB 3IJEB 1STDA 4XBXA 2OCTA 2RFRA 1YJW3 3CCL3 2ML6A 1VQ63 2KCDA 3T8NA 1GY5A 1GY6A 5AIHA 2W0QA 2HMNB 1SJWA 1FA3A 3JUNA 5KP4A 2OTL3 3FZWA 2BNGA 4QWTA 1NB5I 4AKZA 3FGYA 4OUQA 5DREA 5CXOA 5D81A 1ULJB 3MHEA 3NQZA 4IIAA 3OW22 5LC6A 5EQLA 2GU1A 2WGQA 3A76A 1AV4A 1Q40B 1N8QA 3H3HA 1JN5B 5AIIA 3D9RA 1K9M4 4N6MA 2OOVC 3DMCA 3CCE3 1GD4A 1F8NA 5JPPA 4BTXA 1ROAA 2P0XA 2WOHA 3FG4A 3QK9A 3NBJA 4J8TA 3MG2A 1RKYA 2W56A 1DVDA 1OHSA 1TUHA 3O8YA 4IT7A 3CPOA 7STDA 4L8OA 1WTHA 1VQ73 4HM5B 1TFOA 1A90A 1ISKA 1DMMA 2OQEC 2Z77A 2YX9A 1N9JA 4K90B 4XDWA 1IU7A 1V74A 3HIIA 5D82A 2F99A 2FXTA 2Z76A 1NWWA 2P0MA 3HX8A 3H51A 1A67A 2D1WA 1IV9A 3N54B 1SIHA 3LT9A 1S5AA 3EHCA 3EE1A 3FF2A 5BVBA 2IUKA 3PGBA 1R4CA 3CCM3 1QJGA 1UI7A 5CLKA 5I97A 1TIJA 4N6OB 1Q864 2ZDJA 1N5PA 5TGNA 3L0RA 3DGOA 4GL6A 1CYUA 5FW5A 3CMA3 3NBBA 1U8CB 2CFDA 1GY7A 1YGEA 2CK3H 3DUKA 3FKAA 2CKFB 1VQ43 5ELUA 2CWVA 3NUVA 3NM7A 2JQ5A 4BTYA 3RDEA 2CWUA 4CCVA 3WOFB 3SOYA 3N9HA 5LC7A 1W6YA 3K7CA 4HM2B 3MPHA 2XR8B 1UUWB 4LGQA 4BTWA 1SIIA 3PS8A 2LQVA 5HGRA 3T8UA 3S5CA 2GBXB 2WGOA 2K54A 1W01A 2GU3A 2KXGA 2XH9A 2SBLA 4Q53A 2BHMA 2XF3A 3EBTA 5CF2A 1FGTA 4HM4B 4IPBA 1TFKA 3KSED 3CCR3 3V99A 4HZ9B 4WFOA 2XRXB 3S27A 2XFTA 3LYGA 2CW9A 1OHOA 4STDA 3GZRA 4AKYA 1YHQ3 4XM4A 3S29A 1FGRA 4HZBB 5KP1A 1L5GB 3DY5A 1VQO3 2FNQA 2GBWB 3G4S3 1BUQA 1OGZA 4ZM8A 1EQKA 1TP6A 3TDGA 1O7MB 3LTCA 1VQN3 3BNEA 1Q7Y4 3WODG 4N6V0 2F98A 3BB9A 1OHPA 3FLJA 1HU9A 1JB2A 1QAFA 2OWPA 3SOAA 2W56B 3OWUA 4FMAA 3KN4A 3NV0A 3BNBA 3VSYA 2W9PA 2BO9B 4JF8A 1JB4A 1RN7A 1JB5A 1W5ZA 2HMKB 3EN1B 1O7GB 4HJLB 1JNQA 3QRDA 3OWYA 1ULIB 2C11A 3DM8A 1IDPA 1IV7A 1D6UA 4L7KA 1TU5A 3OXAA 3GZBA 3MKIA 3Q1CA 2P09A 3NXJA 1KQS2 4H61A 4FCMA 1VQ83 1ROVA 4FMDA 4OVMA 1K8A4 1W6CA 3ER7A 3CCS3 2E2UA 4XBYA 4TX4A 4N6TA 4FMBA 5IG0A 1O7PB 2W03A 4O2HA 2M7OA 4LSOA 1QVF2 3K0ZA 1W6GA 3MSOA 1M1K4 5IF6A 3F8HA 3B4OA 3U97A 2Q07A 1QMAA 1GYBA 1AVLA 3JUOA 3HIGA 3F9SA 3V92A 4GB5A 4WHAA 2O9UX 3CU3A 3NM2A 1OF5B 1K734 4HM3B 5DRVA 3D3LA 5IG3A 1M904 5IERA 2CHCA 3EC9A 1HKXA 5EVHA 1CQSA 4HM0B 3CC23 3LMLA 2FGTA 4N6UA 3KFQC 1DVCA 1IVUA 4FCJA 1US1A 2R4IA 3PZWA 1LOXA 3EX9A 1KSIA 1QVG2 2OOVA 4RNYA 3IMAB 3M8CA 3UL5A 1VZZA 4WYKA 1WMPA 5AYRB 1VQ53 3G713 4R4KA 1W4NA 2MC8A 1DMQA 3DGMA 4KFDA 4WP5A 5AYSC 3K5TA 2QIYA 2YFIB 4KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q42 A;  3JUP A;  4L8P A;  5IEN A;  4LMI A;  3EN8 A;  5G2G A;  1OH0 A;  4XBT A;  2QGU A;  5D83 A;  1OF5 A;  3NV0 B;  2GEY A;  2XSO B;  4X2H A;  1W00 A;  3JUM A;  1WQL B;  1O7W B;  1E3R A;  1AR0 A;  1K41 A;  4J9A A;  3KKG A;  3F7S A;  3B8L A;  2YFJ B;  3CNX A;  1O7H B;  1UUV B;  2HMJ B;  3F14 A;  4XB5 A;  4LEH A;  2GEX A;  1NDO B;  4N3V A;  3CNM A;  4MJD A;  5JPU A;  3LZA A;  3MYT A;  3KZT A;  2XSH B;  1GS3 A;  2INX A;  4K1V A;  5BXQ A;  1EA2 A;  3HK4 A;  4XDV A;  5IG4 A;  4HM6 B;  2HMM B;  2YFL B;  3G8Z A;  1E3V A;  3OWS A;  4R9L A;  2BMQ B;  1C7H A;  2PZV A;  5AIG A;  3RGR A;  4H3U A;  4I4K A;  3EJV A;  2STD A;  3ECF A;  3EF8 A;  4WYK B;  3BLZ A;  3UJM A;  3OX9 A;  3DZL A;  3HZP A;  1OGX A;  5AEU B;  1JKG A;  3GZY B;  3IPT A;  5CF1 A;  3NBR A;  5STD A;  5AIF A;  5IG5 A;  1A2K A;  2HML B;  1OCV A;  2Z7A A;  3MG1 A;  5AEW B;  5IEO A;  2I9W A;  4PEJ A;  3OV4 A;  3UNL A;  2HMO B;  1U5O A;  6STD A;  4U13 A;  3EQQ B;  3F7X A;  2BMR B;  2UX0 A;  5CK6 A;  1ZO2 A;  3KSP A;  2W2C A;  3G0K A;  2A15 A;  4HM7 B;  1W02 A;  3G16 A;  3DXO A;  2RCD A;  1ZX2 A;  8CHO A;  1OUN A;  4HKV B;  3VGN A;  1DMN A;  3STD A;  4HM8 B;  1Q40 A;  1OPY A;  1JN5 A;  4KVH A;  3RGA A;  1NU3 A;  1ASK A;  3F40 A;  1Z1S A;  3I0Y A;  4ORL A;  2IMJ A;  2RGQ A;  4HM1 B;  3FSD A;  4HVN A;  3FF0 A;  5AI1 A;  3GWR A;  4K1U A;  3NHX A;  5IEP A;  3KE7 A;  3ROB A;  3JUQ A;  4X2O A;  2GXF A;  2B24 B;  4WWU C;  1EG9 B;  2B1X B;  3B4P A;  1JKG B;  2F86 B;  4R9K A;  3EBY A;  4RZM A;  3Q90 A;  3MG3 A;  1O7N B;  3F8X A;  4CDL A;  3WMD A;  3FH1 A;  3GRD A;  3SED A;  3E99 A;  3B7C A;  1E97 A;  5KP3 A;  2BMO B;  4R1K A;  3GZX B;  1STD A;  4XBX A;  2RFR A;  3T8N A;  1GY5 A;  1GY6 A;  5AIH A;  2HMN B;  1SJW A;  3JUN A;  5KP4 A;  3FZW A;  2BNG A;  3FGY A;  4OUQ A;  5DRE A;  5CXO A;  5D81 A;  1ULJ B;  3MHE A;  4IIA A;  3A76 A;  1Q40 B;  3H3H A;  1JN5 B;  5AII A;  3D9R A;  3DMC A;  5JPP A;  4J8T A;  3MG2 A;  1OHS A;  1TUH A;  3CPO A;  7STD A;  4L8O A;  4HM5 B;  1ISK A;  1DMM A;  2Z77 A;  4XDW A;  5D82 A;  2F99 A;  2Z76 A;  1NWW A;  3HX8 A;  3H51 A;  1S5A A;  3EHC A;  3FF2 A;  5BVB A;  1QJG A;  5CLK A;  5TGN A;  5FW5 A;  1GY7 A;  3DUK A;  3FKA A;  2CKF B;  3NUV A;  2JQ5 A;  3SOY A;  1W6Y A;  3K7C A;  4HM2 B;  2XR8 B;  1UUW B;  4LGQ A;  5HGR A;  3T8U A;  3S5C A;  2GBX B;  2K54 A;  1W01 A;  4Q53 A;  5CF2 A;  3EBT A;  4HM4 B;  4HZ9 B;  2XRX B;  3LYG A;  1OHO A;  4STD A;  3GZR A;  4XM4 A;  4HZB B;  5KP1 A;  2GBW B;  1BUQ A;  1OGZ A;  1TP6 A;  1O7M B;  2F98 A;  3BB9 A;  1OHP A;  3FLJ A;  1JB2 A;  2OWP A;  3SOA A;  3OWU A;  3NV0 A;  3VSY A;  1JB4 A;  1JB5 A;  2HMK B;  3EN1 B;  1O7G B;  4HJL B;  3OWY A;  1ULI B;  3DM8 A;  1IDP A;  4L7K A;  3OXA A;  3GZB A;  3MKI A;  3NXJ A;  4FCM A;  4OVM A;  3ER7 A;  4XBY A;  5IG0 A;  1O7P B;  3K0Z A;  3MSO A;  5IF6 A;  3F8H A;  3B4O A;  1QMA A;  1GYB A;  3JUO A;  3F9S A;  4GB5 A;  3CU3 A;  3NM2 A;  1OF5 B;  4HM3 B;  5DRV A;  5IG3 A;  5IER A;  2CHC A;  3EC9 A;  1HKX A;  5EVH A;  1CQS A;  4HM0 B;  4FCJ A;  2R4I A;  3EX9 A;  3M8C A;  1VZZ A;  4WYK A;  1DMQ A;  4WP5 A;  2QIY A;  2YFI B; 
#chains in the Genus database with same CATH topology
 1MWR A;  3PCR A;  1Q42 A;  3JUP A;  4K61 A;  4I5Q A;  4L8P A;  4O02 B;  1OAC A;  2W6J H;  3ZG0 A;  5EEO A;  1Q82 4;  1JZO A;  2OQE A;  5IEN A;  4LZI A;  3AMO B;  1BNS A;  3GAX A;  4LMI A;  3EN8 A;  2PNC A;  4RNZ A;  5G2G A;  3LH4 A;  3LTD A;  3JVC A;  3LTA A;  2CIU A;  1IQY A;  1RGA A;  3K9M C;  3X42 A;  2SAR A;  1BSC A;  1OH0 A;  4XBT A;  3I56 3;  1RRL A;  2ZL8 A;  2QGU A;  3AHW A;  3NQY A;  1BSE A;  5D83 A;  4HOH A;  1OF5 A;  1LOY A;  1M1X B;  3NV0 B;  4EC6 A;  2GEY A;  1M9G A;  2XSO B;  4X2H A;  1JJ2 2;  1W00 A;  3WA3 A;  3BND A;  3JUM A;  1WQL B;  1O7W B;  1W2B 2;  1E3R A;  1SQW A;  1X1X A;  5GSP A;  2P05 A;  1AR0 A;  3V98 A;  1N9E A;  3S67 A;  1K41 A;  3LXU X;  1YVB I;  3PXM A;  4J9A A;  3KKG A;  3F7S A;  3B8L A;  3AHS A;  1UI8 A;  1HZ1 A;  2E2V A;  2YFJ B;  3CNX A;  1O7H B;  1LVN A;  1UUV B;  1BAN A;  2CG0 A;  2E2T A;  1LQM B;  1V58 A;  1TRQ A;  3Q2P A;  2HMJ B;  3F14 A;  4XB5 A;  4LEH A;  1PY3 A;  5IW9 A;  2GEX A;  1PU4 A;  3N8B A;  1NDO B;  1RGE A;  4N3V A;  2F5W A;  3CNM A;  4MJD A;  3AMO A;  2OTJ 3;  5JPU A;  2CC3 A;  1BAO A;  3LZA A;  3MYT A;  1IVX A;  3KZT A;  1UGH I;  2D42 A;  2XSH B;  4FMC A;  1MGW A;  1GS3 A;  2L4V A;  4MMZ B;  1Q7H A;  2INX A;  3SYU A;  4K1V A;  5BXQ A;  3ALA A;  1EEJ A;  1EA2 A;  3EB8 A;  1RGL A;  1GSP A;  1AY7 A;  3S28 A;  7GSP A;  1IT8 A;  1MWU A;  1CYV A;  3HK4 A;  4EV5 A;  4XDV A;  5IG4 A;  4HM6 B;  1BU4 A;  2HMM B;  1W7C A;  2ZA4 A;  2YFL B;  2KF4 A;  1KC8 4;  1GD3 A;  2ML5 A;  3LTB A;  3BNC A;  3SXX A;  3AGO A;  3CCV 3;  1BRG A;  1IVW A;  1BSA A;  3G8Z A;  2AAE A;  1N8R 4;  1IQ8 A;  1E3V A;  1B2X A;  3OWS A;  3URP A;  2XFS A;  2BMQ B;  4HBR A;  4R9L A;  1LNH A;  3WA2 X;  1FW7 A;  1JBT A;  1C7H A;  2PZV A;  5AIG A;  3RGR A;  2KF6 A;  2C4B A;  4H3U A;  4I4K A;  1C54 A;  1LQG C;  3EJV A;  4O8S A;  5ELJ A;  2CG1 A;  2V1L A;  1W2Z A;  4EW5 A;  3I55 3;  2STD A;  3ECF A;  3X40 A;  3EF8 A;  1VQQ A;  3Q3F A;  1ZS7 A;  2RSX A;  3CCU 3;  4WYK B;  3NX0 A;  3CC4 3;  4LYL B;  4AEQ A;  1NO3 A;  1I2E A;  1MNL A;  1IQX A;  3BLZ A;  3UJM A;  2RBI A;  2W04 A;  1IYY A;  4GSP A;  2LYX A;  3OX9 A;  3SVA A;  1FGM A;  3DZL A;  3HZP A;  1AVK A;  1OGX A;  2KAA A;  2MF7 A;  3KII A;  5AEU B;  1JKG A;  4N6N B;  3GZY B;  1STF I;  3IPT A;  1JV2 B;  5CF1 A;  2BU4 A;  4NRE A;  4KFF A;  3NBR A;  5STD A;  3UL6 A;  1T3B A;  3RNT A;  2KF5 A;  5AIF A;  3J7Y d;  1IK3 A;  1IVV A;  5IG5 A;  2CH9 A;  4MMX B;  1A2K A;  1RRH A;  1UCI A;  4O3V A;  2XEP A;  1N5H A;  2CFL A;  2HML B;  3BIR A;  2IY2 A;  1UW1 A;  2HOH A;  3WDG B;  1OCV A;  1K28 A;  2K0M A;  2Z7A A;  3SX1 A;  1GOV A;  3MG1 A;  5AEW B;  6GSP A;  3CPW 2;  1B2S A;  4MEI A;  5IEO A;  2I9W A;  4PEJ A;  3X3X A;  3OV4 A;  1YVS A;  3UNL A;  1WMO A;  2HMO B;  2CWT A;  3T0U A;  1G96 A;  5M19 A;  1U5O A;  6STD A;  1FGQ A;  3G6E 3;  4U13 A;  3EQQ B;  1RJO A;  2Y74 A;  4EV2 A;  3F7X A;  4RBN A;  1NB3 I;  1UUG B;  2CFW A;  2BMR B;  4EXR A;  2UX0 A;  3BU4 A;  1I3I A;  1ZO2 A;  2F4Y A;  5CK6 A;  1S72 3;  1J2B A;  3KSP A;  2W2C A;  1YIT 3;  1VQP 3;  1VQK 3;  2W9Q A;  3G0K A;  5JBS A;  2CFG A;  2A15 A;  4HM7 B;  2JDI H;  4MMY B;  2CFK A;  3LOY A;  1W02 A;  1YJN 3;  3G16 A;  4GHO A;  3DXO A;  1RGF A;  1D6Y A;  3CD6 3;  1LXE A;  1KWI A;  1RN1 A;  2QEX 3;  2H0G A;  1ZX2 A;  2RCD A;  8CHO A;  1YIJ 3;  1YGW A;  3PCS A;  1VQM 3;  1OUN A;  4HKV B;  3VGN A;  1DMN A;  3X3Y A;  3STD A;  1FUS A;  4HM8 B;  1Q40 A;  1BGS A;  1D6Z A;  1VQ9 3;  1OPY A;  2IUJ A;  1JN5 A;  1RLS A;  4KVH A;  1YI2 3;  1FGO A;  3RGA A;  3CME 3;  5RNT A;  1NU3 A;  2RNT A;  1ASK A;  3K63 A;  1DYU A;  3LT8 A;  3F40 A;  3X41 A;  1Z1S A;  3I0Y A;  4ORL A;  1AQZ A;  1ZGX A;  2IMJ A;  1JRQ A;  2RGQ A;  4HM1 B;  8RNT A;  3HI7 A;  3FSD A;  4HVN A;  2XGN A;  3FF0 A;  5AI1 A;  3D5I A;  1I2G A;  2QA4 3;  4OK0 A;  3CXC 2;  3GWR A;  4FCZ A;  4CJN A;  1NNV A;  2IA7 A;  3NHX A;  4K1U A;  1QAL A;  5IEP A;  3DGN A;  3UB1 A;  3CCJ 3;  1Q81 4;  3KE7 A;  3ROB A;  1VQL 3;  1RDS A;  1SPU A;  3AGN A;  3JUQ A;  1KD1 4;  3D5G A;  1IT7 A;  4X2O A;  1RGG A;  2KRT A;  1QAK A;  3MWZ A;  3VF1 A;  1JBS A;  1EKM A;  2WO0 A;  3DGL A;  2C10 A;  2P38 A;  1BSD A;  2GXF A;  2UGI A;  2BT3 A;  1I2F A;  3PYJ A;  4JRF A;  1MOL A;  4EYC A;  5G1L A;  1WMN A;  2B24 B;  1T5Y A;  3CCQ 3;  4WWU C;  1EG9 B;  2B1X B;  4ILF A;  3X3Z A;  1NJI 4;  3B4P A;  1JKG B;  1RSN A;  2AAD A;  3FCS B;  4HAA A;  1Y4K A;  4NHF A;  5BU4 A;  2F86 B;  2J8X B;  4HYZ A;  4KZ1 A;  4R9K A;  1YJ9 3;  3CC7 3;  3EBY A;  4G1M B;  1BRI A;  1FUT A;  4RZM A;  3Q90 A;  3WOE B;  4FR9 A;  1FUW A;  3MG3 A;  2XGL A;  1O7N B;  3F8X A;  2L1S A;  4CDL A;  3WMD A;  2Y73 A;  3FG3 A;  3SLU A;  3FH1 A;  1CEW I;  1HYF A;  1RCK A;  2Z6B A;  3GRD A;  2WOF A;  3SED A;  2O3O A;  4R80 A;  3E99 A;  1PFP A;  1WNH A;  3B7C A;  1BVI A;  3FG1 A;  9RNT A;  1E97 A;  5KP3 A;  2BMO B;  2GSP A;  2KF3 A;  5FGO A;  5A0O B;  4N6L A;  4R1K A;  4BL3 A;  1RGK A;  1RN4 A;  1A2V A;  1X1Y A;  3GZX B;  3IJE B;  4EBG A;  1STD A;  1GMR A;  1LNI A;  1V57 A;  4XBX A;  1B20 A;  2OCT A;  2RFR A;  1YJW 3;  3CCL 3;  2ML6 A;  1VQ6 3;  2KCD A;  3T8N A;  1GY5 A;  1GY6 A;  5AIH A;  2W0Q A;  1B3S A;  2HMN B;  1R4Y A;  1SJW A;  1LRA A;  1FA3 A;  3JUN A;  1GMP A;  1A2P A;  1BRH A;  5KP4 A;  2OTL 3;  3FZW A;  2BNG A;  4QWT A;  1NB5 I;  4AKZ A;  3FGY A;  4OUQ A;  4NPB A;  5DRE A;  5CXO A;  1DVD A;  5D81 A;  1ULJ B;  3MHE A;  3NQZ A;  3WHO A;  4IIA A;  3OW2 2;  5LC6 A;  5EQL A;  2GU1 A;  1UDI I;  2WGQ A;  3A76 A;  1AV4 A;  1Q40 B;  1SAR A;  1I70 A;  1N8Q A;  3H3H A;  1JN5 B;  5AII A;  3D9R A;  1PYL A;  1MWS A;  1K9M 4;  4CPK A;  1RNT A;  4N6M A;  1BNR A;  2OOV C;  3DMC A;  3CCE 3;  1GD4 A;  1F8N A;  6RNT A;  4BTX A;  5JPP A;  1ROA A;  2P0X A;  3GSP A;  2WOH A;  3D79 A;  3FG4 A;  3NBJ A;  3QK9 A;  3MG2 A;  4J8T A;  1BRS A;  2W56 A;  5G1K A;  3ZG5 A;  5BIR A;  1OHS A;  1TUH A;  1FYS A;  3O8Y A;  4IT7 A;  3CPO A;  7STD A;  4L8O A;  1WTH A;  1VQ7 3;  4HM5 B;  1TFO A;  1DE3 A;  1A90 A;  1GOU A;  1ISK A;  3DH2 A;  1DMM A;  4BL2 A;  2OQE C;  2Z77 A;  2YX9 A;  1N9J A;  4K90 B;  4XDW A;  1IU7 A;  1BNJ A;  1T2I A;  1V74 A;  3HII A;  5D82 A;  1GOY A;  2K3D A;  2F99 A;  2FXT A;  3A5E A;  2Z76 A;  1NWW A;  2P0M A;  3HX8 A;  3H51 A;  1A67 A;  4J5G A;  2D1W A;  1IV9 A;  3N54 B;  1BRJ A;  1SIH A;  3LT9 A;  1S5A A;  1X1W A;  2CX1 A;  3EHC A;  1UGI A;  3EE1 A;  3FF2 A;  2IUK A;  5BVB A;  1GMQ A;  3PGB A;  1R4C A;  3CCM 3;  1QJG A;  1UI7 A;  5CLK A;  5I97 A;  1TIJ A;  4N6O B;  1RTU A;  1X1U A;  2ZDJ A;  1Q86 4;  1N5P A;  1Q9E A;  1BOX A;  5TGN A;  3L0R A;  3DGO A;  2CX0 A;  5HOH A;  4GL6 A;  1CYU A;  5FW5 A;  3CMA 3;  3NBB A;  1BNG A;  1U8C B;  1RCL A;  1G02 A;  1GY7 A;  2CFD A;  1RGC A;  1YGE A;  2CK3 H;  3DUK A;  3FKA A;  2CKF B;  1VQ4 3;  5ELU A;  1FZU A;  2CWV A;  1UCL A;  3NUV A;  2R41 A;  2JQ5 A;  3NM7 A;  3RDE A;  4BTY A;  2CWU A;  4CCV A;  3WOF B;  3SOY A;  3N9H A;  5LC7 A;  1W6Y A;  3K7C A;  4HM2 B;  3MPH A;  2XR8 B;  1UUW B;  4LGQ A;  1TRP A;  4BTW A;  1SII A;  1BNF A;  1I0X A;  3PS8 A;  2LQV A;  5HGR A;  3T8U A;  3S5C A;  2GBX B;  1RNB A;  1UCK A;  2WGO A;  2K54 A;  1W01 A;  2GU3 A;  2KXG A;  2XH9 A;  2SBL A;  4Q53 A;  2BHM A;  2XF3 A;  3EBT A;  5CF2 A;  1FGT A;  1BNE A;  4HM4 B;  4IPB A;  1TFK A;  3KSE D;  3CCR 3;  3V99 A;  1MGR A;  4HZ9 B;  4WFO A;  2XRX B;  1I8V A;  2XFT A;  5M1A A;  3LYG A;  3S27 A;  2CW9 A;  1OHO A;  4STD A;  1MWT A;  3GZR A;  4AKY A;  1YHQ 3;  1I0V A;  4XM4 A;  3S29 A;  2ZHX B;  1FGR A;  4HZB B;  5KP1 A;  1RKY A;  1L5G B;  3DY5 A;  1VQO 3;  2FNQ A;  2GBW B;  3DGY A;  3G4S 3;  1OGZ A;  1BUQ A;  4ZM8 A;  1EQK A;  1TP6 A;  3TDG A;  1B27 A;  1O7M B;  1TTO A;  3LTC A;  1VQN 3;  3BNE A;  3U1W A;  1B2Z A;  1Q7Y 4;  3WOD G;  5M18 A;  4N6V 0;  1CH0 A;  2F98 A;  1LOV A;  3BB9 A;  1B21 A;  1OHP A;  1B2U A;  1BRN L;  3FLJ A;  1RMS A;  1JB2 A;  1HU9 A;  1QAF A;  2OWP A;  3SOA A;  2W56 B;  3OWU A;  1BSB A;  1I3F A;  2BIR A;  3KN4 A;  4FMA A;  1B2M A;  3NV0 A;  4KT3 B;  4BIR A;  3BNB A;  3VSY A;  2W9P A;  2BO9 B;  4JF8 A;  1JB4 A;  1RN7 A;  4BU4 A;  1JB5 A;  1W5Z A;  2HMK B;  3EN1 B;  1BIR A;  1BNI A;  1O7G B;  3D4A A;  4HJL B;  1JNQ A;  3QRD A;  1LOW A;  3OWY A;  1ULI B;  2C11 A;  3DM8 A;  1IDP A;  1JZD A;  1IV7 A;  1D6U A;  4L7K A;  7RNT A;  1G0T A;  1TU5 A;  2H0I A;  3OXA A;  3GZB A;  3MKI A;  3Q1C A;  1RGH A;  2P09 A;  3NXJ A;  1DET A;  2F56 A;  3WR2 A;  4H61 A;  4FCM A;  1KQS 2;  1VQ8 3;  1ROV A;  4RNT A;  4FMD A;  4OVM A;  1K8A 4;  1RHL A;  2UUG C;  1W6C A;  3ER7 A;  3CCS 3;  2E2U A;  1YNV X;  4TX4 A;  4XBY A;  4N6T A;  4FMB A;  5IG0 A;  1O7P B;  2W03 A;  4O2H A;  2M7O A;  4DKI A;  4LSO A;  4J5K A;  1QVF 2;  3K0Z A;  1W6G A;  1EUI C;  3MSO A;  1M1K 4;  5IF6 A;  3F8H A;  3B4O A;  3U97 A;  2Q07 A;  1QMA A;  2F5M A;  1GYB A;  1AVL A;  3JUO A;  2H0H A;  3HIG A;  3F9S A;  3V92 A;  4GB5 A;  4WHA A;  2O9U X;  3CU3 A;  3NM2 A;  2IYJ A;  1JBR A;  1OF5 B;  1K73 4;  4HM3 B;  5DRV A;  3D3L A;  5IG3 A;  1M90 4;  5IER A;  2CHC A;  3EC9 A;  1HKX A;  5EVH A;  1CQS A;  4HM0 B;  3CC2 3;  3LML A;  2FGT A;  4N6U A;  3KFQ C;  1DVC A;  1IVU A;  3KCH A;  4FCJ A;  1US1 A;  1BUJ A;  3ZFZ A;  2R4I A;  3PZW A;  1LOX A;  3EX9 A;  3HOH A;  1KSI A;  1UCJ A;  1BRK A;  1TJD A;  1QVG 2;  2OOV A;  4RNY A;  3IMA B;  3M8C A;  3UL5 A;  1VZZ A;  4WYK A;  1WMP A;  5AYR B;  1VQ5 3;  3G71 3;  4R4K A;  1W4N A;  2MC8 A;  1DMQ A;  3DGM A;  4KFD A;  4WP5 A;  5AYS C;  1T2H A;  3K5T A;  2QIY A;  2YFI B;  4KFE A; 
#chains in the Genus database with same CATH homology
 3U1W A;  3PCR A;  1Q42 A;  3JUP A;  4K61 A;  4L8P A;  4O02 B;  1OAC A;  2W6J H;  1Q82 4;  5EEO A;  2OQE A;  5IEN A;  4LZI A;  3AMO B;  3GAX A;  4LMI A;  3EN8 A;  2PNC A;  4RNZ A;  5G2G A;  3LH4 A;  3LTD A;  3JVC A;  3LTA A;  2CIU A;  1IQY A;  3K9M C;  3X42 A;  1OH0 A;  4XBT A;  3I56 3;  1RRL A;  2ZL8 A;  2QGU A;  3NQY A;  5D83 A;  1OF5 A;  1M1X B;  3NV0 B;  4EC6 A;  2GEY A;  1M9G A;  2XSO B;  4X2H A;  1JJ2 2;  1W00 A;  3WA3 A;  3BND A;  3JUM A;  1WQL B;  1O7W B;  1W2B 2;  1E3R A;  1SQW A;  2P05 A;  1AR0 A;  3V98 A;  1N9E A;  3S67 A;  1K41 A;  3LXU X;  1YVB I;  3PXM A;  4J9A A;  3KKG A;  3F7S A;  3B8L A;  1UI8 A;  2E2V A;  2YFJ B;  3CNX A;  1O7H B;  1LVN A;  1UUV B;  2CG0 A;  2E2T A;  3Q2P A;  2HMJ B;  3F14 A;  4XB5 A;  4LEH A;  5IW9 A;  2GEX A;  1PU4 A;  3N8B A;  1NDO B;  4N3V A;  3CNM A;  4MJD A;  3AMO A;  2OTJ 3;  5JPU A;  2CC3 A;  3LZA A;  3MYT A;  1IVX A;  3KZT A;  2D42 A;  2XSH B;  4FMC A;  1GS3 A;  2L4V A;  4MMZ B;  2INX A;  4K1V A;  5BXQ A;  3ALA A;  1EA2 A;  3EB8 A;  3S28 A;  1IT8 A;  4EV5 A;  1CYV A;  3HK4 A;  4XDV A;  5IG4 A;  4HM6 B;  2HMM B;  1W7C A;  2YFL B;  1KC8 4;  1GD3 A;  2ML5 A;  3LTB A;  3BNC A;  3SXX A;  3CCV 3;  1IVW A;  1N8R 4;  3G8Z A;  1IQ8 A;  1E3V A;  3OWS A;  3WA2 X;  2XFS A;  2BMQ B;  4HBR A;  4R9L A;  1LNH A;  1C7H A;  2PZV A;  5AIG A;  3RGR A;  4H3U A;  4I4K A;  4O8S A;  3EJV A;  5ELJ A;  2CG1 A;  2V1L A;  1W2Z A;  3I55 3;  2STD A;  3ECF A;  3X40 A;  3EF8 A;  3CCU 3;  2RSX A;  4WYK B;  3NX0 A;  3CC4 3;  4AEQ A;  1NO3 A;  1MNL A;  3BLZ A;  1IQX A;  3UJM A;  2W04 A;  2LYX A;  3OX9 A;  3SVA A;  1FGM A;  3DZL A;  3HZP A;  1AVK A;  1OGX A;  2MF7 A;  3KII A;  5AEU B;  1JKG A;  4N6N B;  3GZY B;  1STF I;  3IPT A;  1JV2 B;  5CF1 A;  4NRE A;  4KFF A;  3NBR A;  5STD A;  3UL6 A;  5AIF A;  3J7Y d;  1IK3 A;  1IVV A;  5IG5 A;  2CH9 A;  4MMX B;  1A2K A;  1RRH A;  4O3V A;  2XEP A;  1N5H A;  2CFL A;  2HML B;  1UW1 A;  3WDG B;  1OCV A;  1K28 A;  2K0M A;  2Z7A A;  3SX1 A;  3MG1 A;  5AEW B;  3CPW 2;  4MEI A;  5IEO A;  2I9W A;  4PEJ A;  3X3X A;  3OV4 A;  3UNL A;  1WMO A;  2HMO B;  2CWT A;  3T0U A;  1G96 A;  1U5O A;  6STD A;  1FGQ A;  3G6E 3;  4U13 A;  3EQQ B;  1RJO A;  2Y74 A;  4EV2 A;  3F7X A;  4RBN A;  1NB3 I;  2CFW A;  2BMR B;  4EXR A;  2UX0 A;  5CK6 A;  1J2B A;  1ZO2 A;  1S72 3;  3KSP A;  2W2C A;  1YIT 3;  1VQP 3;  1VQK 3;  2W9Q A;  3G0K A;  5JBS A;  2CFG A;  2A15 A;  4HM7 B;  2JDI H;  4MMY B;  2CFK A;  3LOY A;  1W02 A;  1YJN 3;  3G16 A;  3DXO A;  1D6Y A;  3CD6 3;  1LXE A;  1KWI A;  2QEX 3;  2RCD A;  1ZX2 A;  8CHO A;  1YIJ 3;  3PCS A;  1VQM 3;  1OUN A;  4HKV B;  3VGN A;  1DMN A;  3X3Y A;  3STD A;  4HM8 B;  1Q40 A;  1D6Z A;  1VQ9 3;  1OPY A;  2IUJ A;  1JN5 A;  4KVH A;  1YI2 3;  1FGO A;  3RGA A;  3CME 3;  1NU3 A;  3LT8 A;  1ASK A;  3K63 A;  1DYU A;  3X41 A;  3F40 A;  1Z1S A;  3I0Y A;  4ORL A;  2IMJ A;  1JRQ A;  2RGQ A;  4HM1 B;  3HI7 A;  3FSD A;  4HVN A;  2XGN A;  3FF0 A;  5AI1 A;  2QA4 3;  4OK0 A;  3CXC 2;  3GWR A;  4FCZ A;  4K1U A;  2IA7 A;  3NHX A;  1QAL A;  5IEP A;  3DGN A;  3UB1 A;  3CCJ 3;  1Q81 4;  3KE7 A;  3ROB A;  1VQL 3;  1SPU A;  3JUQ A;  1KD1 4;  1IT7 A;  4X2O A;  2KRT A;  3MWZ A;  1QAK A;  3VF1 A;  1EKM A;  2WO0 A;  3DGL A;  2C10 A;  2P38 A;  2GXF A;  2BT3 A;  3PYJ A;  4JRF A;  1MOL A;  4EYC A;  1WMN A;  2B24 B;  1T5Y A;  3CCQ 3;  4WWU C;  1EG9 B;  2B1X B;  3X3Z A;  1NJI 4;  3B4P A;  1JKG B;  3FCS B;  4NHF A;  1Y4K A;  2F86 B;  4R9K A;  4HYZ A;  4KZ1 A;  1YJ9 3;  3CC7 3;  3EBY A;  4G1M B;  4RZM A;  3Q90 A;  3WOE B;  4FR9 A;  1FUW A;  3MG3 A;  2XGL A;  1O7N B;  3F8X A;  4CDL A;  3WMD A;  2Y73 A;  3FG3 A;  3SLU A;  3FH1 A;  1CEW I;  3GRD A;  2Z6B A;  3SED A;  2WOF A;  2O3O A;  4R80 A;  3E99 A;  1PFP A;  1WNH A;  3B7C A;  3FG1 A;  1E97 A;  5KP3 A;  2BMO B;  5FGO A;  5A0O B;  4N6L A;  4R1K A;  4EBG A;  1A2V A;  3GZX B;  3IJE B;  1STD A;  4XBX A;  2OCT A;  2RFR A;  1YJW 3;  3CCL 3;  2ML6 A;  1VQ6 3;  2KCD A;  3T8N A;  1GY5 A;  1GY6 A;  5AIH A;  2W0Q A;  2HMN B;  1SJW A;  1FA3 A;  3JUN A;  5KP4 A;  2OTL 3;  3FZW A;  2BNG A;  4QWT A;  1NB5 I;  4AKZ A;  3FGY A;  4OUQ A;  5DRE A;  5CXO A;  5D81 A;  1ULJ B;  3MHE A;  3NQZ A;  4IIA A;  3OW2 2;  5LC6 A;  5EQL A;  2GU1 A;  2WGQ A;  3A76 A;  1AV4 A;  1Q40 B;  1N8Q A;  3H3H A;  1JN5 B;  5AII A;  3D9R A;  1K9M 4;  4N6M A;  2OOV C;  3DMC A;  3CCE 3;  1GD4 A;  1F8N A;  5JPP A;  4BTX A;  1ROA A;  2P0X A;  2WOH A;  3FG4 A;  3QK9 A;  3NBJ A;  4J8T A;  3MG2 A;  1RKY A;  2W56 A;  1DVD A;  1OHS A;  1TUH A;  3O8Y A;  4IT7 A;  3CPO A;  7STD A;  4L8O A;  1WTH A;  1VQ7 3;  4HM5 B;  1TFO A;  1A90 A;  1ISK A;  1DMM A;  2OQE C;  2Z77 A;  2YX9 A;  1N9J A;  4K90 B;  4XDW A;  1IU7 A;  1V74 A;  3HII A;  5D82 A;  2F99 A;  2FXT A;  2Z76 A;  1NWW A;  2P0M A;  3HX8 A;  3H51 A;  1A67 A;  2D1W A;  1IV9 A;  3N54 B;  1SIH A;  3LT9 A;  1S5A A;  3EHC A;  3EE1 A;  3FF2 A;  5BVB A;  2IUK A;  3PGB A;  1R4C A;  3CCM 3;  1QJG A;  1UI7 A;  5CLK A;  5I97 A;  1TIJ A;  4N6O B;  1Q86 4;  2ZDJ A;  1N5P A;  5TGN A;  3L0R A;  3DGO A;  4GL6 A;  1CYU A;  5FW5 A;  3CMA 3;  3NBB A;  1U8C B;  2CFD A;  1GY7 A;  1YGE A;  2CK3 H;  3DUK A;  3FKA A;  2CKF B;  1VQ4 3;  5ELU A;  2CWV A;  3NUV A;  3NM7 A;  2JQ5 A;  4BTY A;  3RDE A;  2CWU A;  4CCV A;  3WOF B;  3SOY A;  3N9H A;  5LC7 A;  1W6Y A;  3K7C A;  4HM2 B;  3MPH A;  2XR8 B;  1UUW B;  4LGQ A;  4BTW A;  1SII A;  3PS8 A;  2LQV A;  5HGR A;  3T8U A;  3S5C A;  2GBX B;  2WGO A;  2K54 A;  1W01 A;  2GU3 A;  2KXG A;  2XH9 A;  2SBL A;  4Q53 A;  2BHM A;  2XF3 A;  3EBT A;  5CF2 A;  1FGT A;  4HM4 B;  4IPB A;  1TFK A;  3KSE D;  3CCR 3;  3V99 A;  4HZ9 B;  4WFO A;  2XRX B;  3S27 A;  2XFT A;  3LYG A;  2CW9 A;  1OHO A;  4STD A;  3GZR A;  4AKY A;  1YHQ 3;  4XM4 A;  3S29 A;  1FGR A;  4HZB B;  5KP1 A;  1L5G B;  3DY5 A;  1VQO 3;  2FNQ A;  2GBW B;  3G4S 3;  1BUQ A;  1OGZ A;  4ZM8 A;  1EQK A;  1TP6 A;  3TDG A;  1O7M B;  3LTC A;  1VQN 3;  3BNE A;  1Q7Y 4;  3WOD G;  4N6V 0;  2F98 A;  3BB9 A;  1OHP A;  3FLJ A;  1HU9 A;  1JB2 A;  1QAF A;  2OWP A;  3SOA A;  2W56 B;  3OWU A;  4FMA A;  3KN4 A;  3NV0 A;  3BNB A;  3VSY A;  2W9P A;  2BO9 B;  4JF8 A;  1JB4 A;  1RN7 A;  1JB5 A;  1W5Z A;  2HMK B;  3EN1 B;  1O7G B;  4HJL B;  1JNQ A;  3QRD A;  3OWY A;  1ULI B;  2C11 A;  3DM8 A;  1IDP A;  1IV7 A;  1D6U A;  4L7K A;  1TU5 A;  3OXA A;  3GZB A;  3MKI A;  3Q1C A;  2P09 A;  3NXJ A;  1KQS 2;  4H61 A;  4FCM A;  1VQ8 3;  1ROV A;  4FMD A;  4OVM A;  1K8A 4;  1W6C A;  3ER7 A;  3CCS 3;  2E2U A;  4XBY A;  4TX4 A;  4N6T A;  4FMB A;  5IG0 A;  1O7P B;  2W03 A;  4O2H A;  2M7O A;  4LSO A;  1QVF 2;  3K0Z A;  1W6G A;  3MSO A;  1M1K 4;  5IF6 A;  3F8H A;  3B4O A;  3U97 A;  2Q07 A;  1QMA A;  1GYB A;  1AVL A;  3JUO A;  3HIG A;  3F9S A;  3V92 A;  4GB5 A;  4WHA A;  2O9U X;  3CU3 A;  3NM2 A;  1OF5 B;  1K73 4;  4HM3 B;  5DRV A;  3D3L A;  5IG3 A;  1M90 4;  5IER A;  2CHC A;  3EC9 A;  1HKX A;  5EVH A;  1CQS A;  4HM0 B;  3CC2 3;  3LML A;  2FGT A;  4N6U A;  3KFQ C;  1DVC A;  1IVU A;  4FCJ A;  1US1 A;  2R4I A;  3PZW A;  1LOX A;  3EX9 A;  1KSI A;  1QVG 2;  2OOV A;  4RNY A;  3IMA B;  3M8C A;  3UL5 A;  1VZZ A;  4WYK A;  1WMP A;  5AYR B;  1VQ5 3;  3G71 3;  4R4K A;  1W4N A;  2MC8 A;  1DMQ A;  3DGM A;  4KFD A;  4WP5 A;  5AYS C;  3K5T A;  2QIY A;  2YFI B;  4KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...