1JN5B

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna export factor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
182
Chain Sequence
APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords p15
publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 54
structure length 182
sequence length 186
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
B PF03943 TAP_C TAP C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jn5B00
1DMQA 2HMOB 1C7HA 2F99A 5DREA 4RZMA 1QJGA 3H3HA 4HM7B 4XBTA 1CQSA 3F8HA 3T8UA 3FLJA 3FKAA 1NWWA 1AR0A 3CU3A 3FSDA 4U13A 3EF8A 5IG4A 4XDVA 1TUHA 1WQLB 2PZVA 3JUPA 2GEYA 4HZBB 1E97A 3EN1B 3EX9A 3NV0B 5CF2A 3DZLA 2STDA 4LGQA 2I9WA 3EBYA 4Q53A 2F86B 4WYKA 2QGUA 5IERA 2XR8B 3GZYB 2W2CA 2QIYA 4L8OA 3D9RA 3ECFA 1NU3A 1OHSA 4HJLB 4XDWA 4R9LA 4J8TA 3UJMA 1OHPA 3KSPA 3NM2A 3I0YA 2CKFB 1BUQA 3A76A 1NDOB 2INXA 3EQQB 1DMMA 1W01A 3JUMA 3WMDA 2YFJB 1E3VA 7STDA 3EN8A 1W6YA 3F14A 3SOYA 4H3UA 4HM5B 2RFRA 2GBWB 4HVNA 2HMNB 4OUQA 4HZ9B 1OGXA 3G16A 3B4OA 8CHOA 3NBRA 5IEOA 1W00A 4K1VA 3EHCA 3ER7A 4PEJA 2CHCA 4HM0B 5KP1A 5D82A 5D83A 4MJDA 5IEPA 5AIFA 4X2HA 3RGAA 2HMLB 3OX9A 3M8CA 2OWPA 1ZX2A 4STDA 3EJVA 2XSHB 3KE7A 2F98A 1SJWA 3MYTA 3K0ZA 3H51A 1Z1SA 1O7NB 3ROBA 3DUKA 1JB5A 3B8LA 2RGQA 3NXJA 5CK6A 1Q42A 3OWSA 1U5OA 2K54A 5FW5A 3HX8A 4L7KA 3KZTA 2B24B 5CXOA 4I4KA 3FGYA 1QMAA 5BXQA 2XSOB 1OH0A 3GRDA 3VGNA 2Z77A 2GXFA 4ORLA 3LYGA 4HKVB 1OHOA 1TP6A 5JPPA 1STDA 2BNGA 2BMOB 4IIAA 3T8NA 3MG3A 5AIIA 4XM4A 5KP4A 1OUNA 3E99A 5TGNA 3JUOA 2YFLB 3HZPA 1O7HB 1O7WB 2GBXB 3BLZA 1VZZA 5AEUB 4R1KA 1JN5A 1GYBA 3K7CA 3MG1A 3LZAA 2BMQB 3G0KA 1W02A 5HGRA 3OV4A 3MKIA 3F7XA 4WWUC 4J9AA 3DMCA 5IG3A 3FF2A 4WP5A 3DM8A 3GZRA 4X2OA 3MSOA 3GZXB 3S5CA 1IDPA 4WYKB 4HM4B 5G2GA 3EC9A 3JUQA 6STDA 5IENA 3F40A 5AEWB 2HMJB 5STDA 4L8PA 1GY7A 3NUVA 1ISKA 1OF5A 2UX0A 1GS3A 3JUNA 5IG0A 1EA2A 4XBXA 1GY6A 1ULJB 3F7SA 3KKGA 4XB5A 4HM3B 3NV0A 4HM1B 1O7MB 1HKXA 3NHXA 2R4IA 3CNXA 1DMNA 1Q40A 2GEXA 1JKGA 2BMRB 5CLKA 5IG5A 4KVHA 5BVBA 1UUWB 4LEHA 1OCVA 1S5AA 2YFIB 1E3RA 5KP3A 3RGRA 2B1XB 4HM8B 2HMKB 5DRVA 2XRXB 3EBTA 5IF6A 1OF5B 1EG9B 4LMIA 4R9KA 3G8ZA 1ZO2A 3F8XA 3OWUA 3OWYA 5AI1A 3SOAA 3DXOA 1GY5A 3BB9A 3STDA 2IMJA 2HMMB 5JPUA 3OXAA 5CF1A 1Q40B 1ASKA 1O7PB 1JKGB 3GZBA 4XBYA 1JB2A 3B7CA 3IPTA 4GB5A 1OPYA 4FCMA 3FH1A 2Z76A 3UNLA 3CPOA 1A2KA 1OGZA 5AIHA 4HM6B 3CNMA 4N3VA 3FZWA 4OVMA 4FCJA 3F9SA 2JQ5A 5D81A 4CDLA 3GWRA 3FF0A 5AIGA 3B4PA 2Z7AA 1K41A 2RCDA 1JN5B 3SEDA 2A15A 4K1UA 3VSYA 4HM2B 3MG2A 1O7GB 1ULIB 5EVHA 1JB4A 3HK4A 3MHEA 1UUVB 3Q90A
chains in the Genus database with same CATH superfamily
3UL6A 1DMQA 1L5GB 1RNBA 2OQEC 2HMOB 1A2PA 1C7HA 1FGTA 1JZOA 3D3LA 5G1KA 3CC43 2F99A 2GU1A 5DREA 1K9M4 1FW7A 4RZMA 1WMNA 1QJGA 2R41A 1JZDA 3H3HA 4HM7B 3ZG0A 4XBTA 3DGYA 3N8BA 3CCM3 3LOYA 1A67A 1TFKA 5LC6A 4EBGA 1LNIA 1CQSA 2FNQA 3F8HA 2WGOA 3FLJA 5EQLA 1SQWA 3SYUA 3T8UA 1KQS2 3GSPA 2LYXA 1GMQA 3HIIA 3N54B 4KFDA 3FKAA 2WO0A 3PYJA 3WHOA 1NWWA 1B2SA 1AR0A 3DGMA 5ELUA 1C54A 3CU3A 3FSDA 4U13A 1LQMB 2MC8A 1DETA 2Y73A 3EF8A 1RRHA 3CCU3 2KRTA 3BIRA 5LC7A 5IG4A 4XDVA 1ROAA 1TUHA 1W2ZA 3AHWA 3DGNA 1WQLB 2PZVA 1TU5A 3JUPA 2GEYA 4HZBB 2RNTA 4CJNA 2IUJA 1I3IA 8RNTA 3Q1CA 1J2BA 5BIRA 1E97A 3EN1B 1R4CA 1I2EA 2P05A 1SIHA 3HIGA 3EX9A 2W0QA 3NV0B 5CF2A 3DZLA 1BRHA 1GD3A 1GMRA 1UDII 2D1WA 2I9WA 2STDA 3EBYA 4LGQA 4ZM8A 3VF1A 1BRJA 2AADA 2P38A 5AYRB 2K3DA 2CX0A 3RDEA 1IVXA 1V57A 1YGWA 4Q53A 2F86B 3DGLA 4WYKA 3T0UA 4EV2A 2QGUA 2CW9A 5IERA 2XR8B 3LTBA 4FCZA 4FMAA 4AEQA 3GZYB 1AVKA 2W2CA 4N6V0 1KD14 1JRQA 4N6NB 3I553 3K9MC 1B20A 1RGEA 2QIYA 4L8OA 3WOFB 3D9RA 1LVNA 2XH9A 3G713 5RNTA 1LOYA 3HOHA 1NB3I 1RHLA 2GU3A 1BIRA 3ECFA 1NU3A 1OHSA 1RNTA 1I0VA 1RRLA 3NM7A 4FMBA 4HJLB 2F4YA 4R9LA 4XDWA 2CFGA 4J8TA 5FGOA 4NREA 1A2VA 3UJMA 1U8CB 3NQZA 1W6GA 1OHPA 3S28A 2ZHXB 1PY3A 1FUWA 1BVIA 3KSPA 1M1XB 3NM2A 2SARA 3I0YA 1BRIA 4O8SA 3BNBA 2CKFB 1BANA 1BUQA 1I2FA 1GOYA 1MGRA 3A5EA 3A76A 1QALA 2C4BA 1KSIA 2AAEA 1NDOB 3X3ZA 1LOWA 1FGOA 2XEPA 4MEIA 2OTL3 1BRKA 1TRQA 3V98A 3X3YA 1UI7A 3CCL3 4MMYB 3SXXA 1BU4A 2INXA 3UL5A 1DYUA 3EQQB 2IA7A 1DMMA 1W01A 3JUMA 3WMDA 1WMOA 2XGLA 2YFJB 4EXRA 3PCRA 1K734 1JBTA 1JBRA 1E3VA 1TIJA 2Q07A 4BTWA 7STDA 3EN8A 5M18A 2RSXA 1N9EA 3QK9A 3RNTA 2KF4A 1W6YA 3F14A 1IVVA 3PZWA 3SOYA 2HOHA 3KN4A 4H3UA 1NO3A 4HM5B 2RFRA 2GBWB 4HAAA 2HMNB 4HVNA 1VQP3 2CX1A 3N9HA 4OUQA 4HZ9B 1Q9EA 1I0XA 2V1LA 1OGXA 3G16A 1V74A 3B4OA 1B3SA 1BSAA 1FZUA 3PXMA 8CHOA 2XFTA 3NBRA 1LOVA 5IEOA 1W00A 1X1UA 4K1VA 3SX1A 3U97A 3CCE3 3EHCA 3ER7A 4PEJA 2CHCA 4HM0B 5KP1A 5D82A 1WMPA 5D83A 4MJDA 4J5KA 5IEPA 1BNFA 5AIFA 4FR9A 4X2HA 1CH0A 3X42A 4CCVA 3RGAA 2HMLB 1FGRA 3OX9A 3M8CA 2OWPA 1T3BA 4BL3A 1ZX2A 4O02B 5BU4A 1B2UA 3URPA 3AMOB 4STDA 3CPW2 3EJVA 4ILFA 2XSHB 1BNRA 3J7Yd 3KE7A 5A0OB 1IT7A 1RGGA 2F98A 1VQM3 3TDGA 1IV7A 3D4AA 1SJWA 1IU7A 2C11A 2WOFA 3K0ZA 1BNSA 3MYTA 5GSPA 4EV5A 4MMXB 3H51A 1Z1SA 1YGEA 1K28A 3V92A 1GOVA 1O7NB 3ROBA 3DUKA 2CWUA 2W56A 1W2B2 1UGHI 2WGQA 2OCTA 1RGFA 1QVG2 1JB5A 3B8LA 3CXC2 2RGQA 3LMLA 3NXJA 5CK6A 1VQ43 1VQN3 1Q42A 3OWSA 1U5OA 1BSBA 1RGAA 2K54A 5M1AA 1FUSA 5FW5A 1MWUA 3HX8A 4L7KA 1YIJ3 3KZTA 2B24B 3QRDA 2ZA4A 5CXOA 2SBLA 1EEJA 3PS8A 4I4KA 3FGYA 1NJI4 1ROVA 1QMAA 2BIRA 5BXQA 2L1SA 1QVF2 2Z6BA 2XSOB 1BRNL 1OH0A 3GRDA 1RLSA 2Z77A 2GXFA 3VGNA 4BTXA 1IQXA 3BNDA 3CCS3 4GSPA 4ORLA 1GSPA 1HZ1A 5EEOA 1FYSA 3LYGA 2CK3H 6GSPA 3PGBA 2QA43 2CH9A 4HKVB 3LT8A 5HOHA 1TTOA 3S27A 1OHOA 3WOEB 1TP6A 1BOXA 5JPPA 1T2HA 3CMA3 1STDA 1DVDA 4KFEA 1YVBI 2BNGA 1LQGC 2BMOB 3Q2PA 1VQ63 2P0MA 4IIAA 3CCQ3 1G0TA 4FMCA 1Q7Y4 4QWTA 3T8NA 1RKYA 4NPBA 1EUIC 3MG3A 1BSDA 1BSCA 3LT9A 4AKYA 1AQZA 2CFLA 2CFKA 5AIIA 1Q824 4XM4A 4J5GA 5KP4A 1M9GA 1RTUA 4WHAA 3K5TA 1OUNA 1BRGA 3E99A 3WODG 1VQ83 2IYJA 5TGNA 1CYVA 3EE1A 3JUOA 2YFLB 4BIRA 1OACA 3HZPA 1HYFA 1O7HB 1O7WB 1RGHA 2GBXB 2Y74A 2ZDJA 3BLZA 4LZIA 1VZZA 1KWIA 5AEUB 4RNTA 3OW22 1GD4A 3WA2X 1QAFA 1JNQA 4N6OB 4R1KA 1JN5A 1GYBA 4O2HA 1AV4A 2FXTA 2W9PA 3G6E3 3CD63 3K7CA 3MG1A 3IJEB 4MMZB 3UB1A 1BSEA 1TJDA 1VQ53 1RN7A 2CFWA 3LZAA 1ZS7A 2BMQB 3G0KA 1W02A 3LTDA 5HGRA 1X1XA 1I3FA 3MKIA 1UCJA 3OV4A 4R4KA 3F7XA 4WWUC 4J9AA 1F8NA 2QEX3 3DMCA 1DVCA 5M19A 3SLUA 1MGWA 4HOHA 5IG3A 3FF2A 4WP5A 3FG1A 3DM8A 4KFFA 1W6CA 1DE3A 1TFOA 1N8R4 3GZRA 4X2OA 1EQKA 1SARA 3MSOA 3GZXB 4JF8A 3S5CA 3LTCA 3L0RA 1LOXA 1PU4A 4N6MA 1RN4A 1IDPA 1N5HA 2PNCA 1UCLA 2F56A 1JV2B 4WYKB 3KSED 4HM4B 2BO9B 3IMAB 3X3XA 4EYCA 1MWSA 1T2IA 5G2GA 1JBSA 2E2VA 1UCIA 3CC73 1YJN3 3O8YA 1Q864 2CC3A 7RNTA 4BL2A 4TX4A 1BNJA 3EC9A 2CFDA 3KIIA 3JUQA 6STDA 5IENA 4N6TA 1YJ93 1MWRA 2P0XA 3F40A 2KXGA 5AEWB 2HMJB 5STDA 4L8PA 2GSPA 3AGOA 1X1WA 4LYLB 1GY7A 1V58A 1IT8A 3NUVA 1YI23 1ISKA 3GAXA 1OF5A 2UX0A 3FG4A 2WOHA 1GS3A 2FGTA 2H0HA 3JUNA 3D79A 1CYUA 5IG0A 1EA2A 2UGIA 1GY6A 4XBXA 5AYSC 1ULJB 3F7SA 3K63A 1M904 4GHOA 1BNEA 1X1YA 2O9UX 2W6JH 1B2ZA 3KKGA 4XB5A 1S723 1IVWA 2IUKA 3ZFZA 2KF6A 1FGQA 4HM3B 1MNLA 3NV0A 2H0IA 1LXEA 4HM1B 1O7MB 1HKXA 3NHXA 6RNTA 2W04A 3DGOA 2R4IA 3CNXA 4FMDA 7GSPA 4G1MB 2F5MA 1DMNA 1VQ93 4BTYA 1VQ73 1Q40A 2GEXA 1IYYA 1UI8A 3ZG5A 1JKGA 3DH2A 3LXUX 2BMRB 3FG3A 5CLKA 5IG5A 1RDSA 1Y4KA 4KVHA 4WFOA 1RGKA 1BRSA 1BNGA 3MPHA 5BVBA 1VQL3 1SPUA 2E2UA 1UUWB 1RGCA 4LEHA 1GOUA 2OOVC 4EC6A 2XFSA 1OCVA 5IW9A 1QAKA 1S5AA 2YFIB 3EB8A 4RNZA 2YX9A 2OQEA 1E3RA 1YJW3 2KF5A 4HYZA 5KP3A 3RGRA 3U1WA 4N6LA 2BU4A 2B1XB 2XGNA 1M1K4 4HM8B 2HMKB 2L4VA 4RNYA 5DRVA 2XRXB 4BU4A 3WR2A 2OTJ3 2OOVA 1IK3A 1UGIA 2CWTA 4IT7A 1CEWI 3EBTA 2RBIA 5IF6A 1GMPA 1OF5B 1RN1A 1EG9B 1RCKA 1N8QA 2J8XB 4LSOA 3S29A 4LMIA 3CC23 4R9KA 1NNVA 3G8ZA 1ZO2A 1IV9A 3F8XA 5ELJA 5JBSA 5G1LA 3OWUA 3V99A 2ML6A 4JRFA 3OWYA 5AI1A 5I97A 3SOAA 3DXOA 1T5YA 1GY5A 1VQQA 2K0MA 1WTHA 4RBNA 2E2TA 4IPBA 4N6UA 2JDIH 1B27A 2C10A 3BB9A 3WA3A 3STDA 1BUJA 2IMJA 1EKMA 2HMMB 2KAAA 2W56B 4KZ1A 1D6ZA 5JPUA 3OXAA 1N5PA 1PYLA 1R4YA 4CPKA 1IQ8A 5CF1A 3CCR3 4H61A 1BNIA 1Q40B 1ASKA 3X40A 1O7PB 1HU9A 4OK0A 1I2GA 1JKGB 3GZBA 4XBYA 3WDGB 1LRAA 2ML5A 1NB5I 1FGMA 1MOLA 1D6UA 1JB2A 2BT3A 3B7CA 3IPTA 2D42A 1VQK3 3BNEA 1RMSA 3SVAA 4GB5A 1YIT3 3CCV3 3Q3FA 3CME3 1VQO3 1AVLA 4K61A 3KFQC 1OPYA 4FCMA 3FH1A 2Z76A 1K8A4 2KCDA 1SIIA 3UNLA 1YNVX 1MWTA 1RJOA 3BU4A 3AGNA 3CPOA 3LH4A 1I8VA 1UW1A 3AMOA 3NQYA 1A2KA 2P09A 4AKZA 3NBBA 1OGZA 1N9JA 3CCJ3 1IVUA 3PCSA 2W9QA 4O3VA 2ZL8A 1B2MA 2CG0A 5AIHA 3S67A 3FCSB 1FUTA 3DY5A 4HM6B 2H0GA 1I70A 2CWVA 9RNTA 1W5ZA 2CIUA 3CNMA 3D5IA 1G96A 4N3VA 3NX0A 4EW5A 3G4S3 2LQVA 2MF7A 2XF3A 3FZWA 4I5QA 4OVMA 4FCJA 3NBJA 1RSNA 3F9SA 2JQ5A 5D81A 1PFPA 1JJ22 1B21A 1YHQ3 2BHMA 2M7OA 4K90B 2W03A 4CDLA 1US1A 1LNHA 3MWZA 3GWRA 1Q7HA 1UUGB 1B2XA 3FF0A 5AIGA 3B4PA 1AY7A 2F5WA 4KT3B 2Z7AA 1K41A 2RCDA 1BAOA 2O3OA 1D6YA 1JN5B 3SEDA 2A15A 4K1UA 3X41A 4DKIA 1Q814 1A90A 3D5GA 2UUGC 3AHSA 2CG1A 1WNHA 3VSYA 1RCLA 1W7CA 1TRPA 2KF3A 1BGSA 1UCKA 3HI7A 4HM2B 1KC84 1O7GB 3MG2A 1RGLA 1ULIB 1ZGXA 5EVHA 3BNCA 2IY2A 1YVSA 1FA3A 1IQYA 3KCHA 1JB4A 3HK4A 4NHFA 4HBRA 3MHEA 1G02A 1UUVB 1W4NA 3LTAA 1STFI 4GL6A 3I563 3ALAA 3Q90A 4R80A 3JVCA
chains in the Genus database with same CATH topology
3UL6A 1DMQA 1L5GB 2OQEC 2HMOB 1C7HA 1FGTA 3D3LA 3CC43 2F99A 2GU1A 5DREA 1K9M4 4RZMA 1WMNA 1QJGA 3H3HA 4HM7B 4XBTA 3N8BA 3CCM3 3LOYA 1A67A 1TFKA 5LC6A 4EBGA 1CQSA 2FNQA 3F8HA 2WGOA 3FLJA 5EQLA 1SQWA 3T8UA 1KQS2 2LYXA 3HIIA 3N54B 4KFDA 3FKAA 2WO0A 3PYJA 1NWWA 1AR0A 3DGMA 5ELUA 3CU3A 3FSDA 4U13A 2MC8A 2Y73A 3EF8A 1RRHA 3CCU3 2KRTA 5LC7A 5IG4A 4XDVA 1ROAA 1TUHA 1W2ZA 3DGNA 1WQLB 2PZVA 1TU5A 3JUPA 2GEYA 4HZBB 2IUJA 3Q1CA 1J2BA 1E97A 3EN1B 1R4CA 2P05A 1SIHA 3HIGA 3EX9A 2W0QA 3NV0B 5CF2A 3DZLA 1GD3A 2STDA 4LGQA 2I9WA 2D1WA 3EBYA 4ZM8A 3VF1A 2P38A 5AYRB 3RDEA 1IVXA 4Q53A 2F86B 3DGLA 4WYKA 3T0UA 4EV2A 2QGUA 2CW9A 5IERA 2XR8B 3LTBA 4FCZA 4FMAA 4AEQA 3GZYB 1AVKA 2W2CA 4N6V0 1KD14 1JRQA 4N6NB 3I553 3K9MC 3WOFB 2QIYA 4L8OA 3D9RA 1LVNA 2XH9A 3G713 1NB3I 2GU3A 3ECFA 1NU3A 1OHSA 4HJLB 1RRLA 4XDWA 3NM7A 4FMBA 4R9LA 2CFGA 4J8TA 5FGOA 4NREA 1A2VA 3UJMA 1U8CB 3NQZA 1W6GA 1OHPA 3S28A 1FUWA 3KSPA 1M1XB 3NM2A 4O8SA 3I0YA 3BNBA 2CKFB 1BUQA 3A76A 1QALA 1KSIA 1NDOB 3X3ZA 1FGOA 2XEPA 4MEIA 2OTL3 3V98A 3X3YA 3CCL3 1UI7A 4MMYB 3SXXA 2INXA 3UL5A 1DYUA 3EQQB 2IA7A 1DMMA 1W01A 3JUMA 3WMDA 1WMOA 2XGLA 2YFJB 4EXRA 3PCRA 1K734 1E3VA 1TIJA 2Q07A 4BTWA 7STDA 3EN8A 2RSXA 1N9EA 3QK9A 1W6YA 3F14A 1IVVA 3PZWA 3SOYA 3KN4A 4H3UA 1NO3A 4HM5B 2RFRA 2GBWB 4HVNA 2HMNB 1VQP3 3N9HA 4OUQA 4HZ9B 2V1LA 1OGXA 3G16A 1V74A 3B4OA 3PXMA 8CHOA 2XFTA 3NBRA 5IEOA 1W00A 4K1VA 3SX1A 3U97A 3CCE3 3EHCA 3ER7A 4PEJA 2CHCA 4HM0B 5KP1A 5D82A 1WMPA 5D83A 4MJDA 5IEPA 5AIFA 4FR9A 4X2HA 3X42A 4CCVA 3RGAA 2HMLB 1FGRA 3OX9A 3M8CA 2OWPA 1ZX2A 4O02B 3AMOB 4STDA 3CPW2 3EJVA 2XSHB 3J7Yd 3KE7A 5A0OB 1IT7A 2F98A 1VQM3 3TDGA 1IV7A 1SJWA 1IU7A 2C11A 2WOFA 3K0ZA 3MYTA 4EV5A 4MMXB 3H51A 1Z1SA 1YGEA 1K28A 3V92A 1O7NB 3ROBA 3DUKA 2CWUA 2W56A 1W2B2 2WGQA 2OCTA 1QVG2 1JB5A 3B8LA 3CXC2 2RGQA 3LMLA 3NXJA 5CK6A 1VQ43 1VQN3 1Q42A 3OWSA 1U5OA 2K54A 5FW5A 3HX8A 4L7KA 1YIJ3 3KZTA 2B24B 3QRDA 5CXOA 2SBLA 3PS8A 4I4KA 3FGYA 1NJI4 1ROVA 1QMAA 5BXQA 1QVF2 2Z6BA 2XSOB 1OH0A 3GRDA 3VGNA 2Z77A 2GXFA 4BTXA 3CCS3 1IQXA 3BNDA 4ORLA 5EEOA 3LYGA 2CK3H 2QA43 3PGBA 2CH9A 4HKVB 3LT8A 3S27A 3WOEB 1OHOA 1TP6A 5JPPA 3CMA3 1STDA 1DVDA 4KFEA 1YVBI 2BNGA 2BMOB 3Q2PA 1VQ63 2P0MA 4IIAA 3CCQ3 4FMCA 1Q7Y4 4QWTA 3T8NA 1RKYA 3MG3A 3LT9A 4AKYA 2CFLA 2CFKA 5AIIA 1Q824 4XM4A 5KP4A 1M9GA 4WHAA 3K5TA 1OUNA 3E99A 3WODG 1VQ83 5TGNA 1CYVA 3EE1A 3JUOA 2YFLB 1OACA 3HZPA 1O7HB 1O7WB 2GBXB 2Y74A 2ZDJA 3BLZA 4LZIA 1VZZA 1KWIA 5AEUB 3OW22 1GD4A 3WA2X 1QAFA 1JNQA 4N6OB 4R1KA 1JN5A 1GYBA 4O2HA 1AV4A 2FXTA 2W9PA 3G6E3 3CD63 3K7CA 3MG1A 3IJEB 4MMZB 3UB1A 1VQ53 1RN7A 2CFWA 3LZAA 2BMQB 3G0KA 1W02A 3LTDA 5HGRA 3OV4A 3MKIA 4R4KA 3F7XA 4WWUC 4J9AA 1F8NA 2QEX3 3DMCA 1DVCA 3SLUA 5IG3A 3FF2A 4WP5A 3FG1A 3DM8A 4KFFA 1W6CA 1TFOA 1N8R4 3GZRA 4X2OA 1EQKA 3MSOA 3GZXB 4JF8A 3S5CA 3LTCA 3L0RA 1LOXA 1PU4A 4N6MA 1IDPA 1N5HA 2PNCA 1JV2B 4WYKB 3KSED 4HM4B 2BO9B 3IMAB 3X3XA 4EYCA 5G2GA 2E2VA 1YJN3 3CC73 1Q864 3O8YA 2CC3A 4TX4A 3EC9A 2CFDA 3KIIA 3JUQA 6STDA 5IENA 4N6TA 1YJ93 2P0XA 3F40A 2KXGA 5AEWB 2HMJB 5STDA 4L8PA 1GY7A 3NUVA 1IT8A 1YI23 1ISKA 3GAXA 1OF5A 2UX0A 3FG4A 2WOHA 1GS3A 2FGTA 3JUNA 1CYUA 5IG0A 1EA2A 4XBXA 1GY6A 5AYSC 1ULJB 3F7SA 3K63A 1M904 2W6JH 2O9UX 3KKGA 4XB5A 1S723 1IVWA 2IUKA 1FGQA 4HM3B 1MNLA 3NV0A 1LXEA 4HM1B 1O7MB 1HKXA 3NHXA 2W04A 3DGOA 2R4IA 3CNXA 4FMDA 4G1MB 1DMNA 1VQ93 4BTYA 1VQ73 1Q40A 2GEXA 1UI8A 1JKGA 3LXUX 2BMRB 3FG3A 5CLKA 5IG5A 1Y4KA 4KVHA 4WFOA 3MPHA 5BVBA 1VQL3 1SPUA 2E2UA 1UUWB 4LEHA 2OOVC 4EC6A 2XFSA 1OCVA 5IW9A 2YFIB 1QAKA 1S5AA 3EB8A 4RNZA 2YX9A 2OQEA 1E3RA 1YJW3 4HYZA 5KP3A 3RGRA 3U1WA 4N6LA 2B1XB 2XGNA 1M1K4 4HM8B 2HMKB 2L4VA 4RNYA 5DRVA 2XRXB 2OTJ3 2OOVA 1IK3A 2CWTA 4IT7A 1CEWI 3EBTA 5IF6A 1OF5B 1EG9B 4LSOA 1N8QA 3S29A 3CC23 4LMIA 4R9KA 3G8ZA 1ZO2A 1IV9A 3F8XA 5ELJA 5JBSA 3V99A 3OWUA 2ML6A 4JRFA 3OWYA 5AI1A 5I97A 3SOAA 3DXOA 1T5YA 1GY5A 2K0MA 1WTHA 4RBNA 2E2TA 4IPBA 4N6UA 2JDIH 2C10A 3BB9A 3WA3A 3STDA 2IMJA 1EKMA 2HMMB 2W56B 4KZ1A 1D6ZA 5JPUA 3OXAA 1N5PA 1IQ8A 5CF1A 3CCR3 4H61A 1Q40B 1ASKA 3X40A 1O7PB 1HU9A 4OK0A 1JKGB 3GZBA 4XBYA 3WDGB 2ML5A 1NB5I 1FGMA 1MOLA 1D6UA 1JB2A 2BT3A 3B7CA 3IPTA 2D42A 1VQK3 3BNEA 3SVAA 4GB5A 1YIT3 3CCV3 3CME3 1VQO3 1AVLA 4K61A 3KFQC 1OPYA 4FCMA 3FH1A 2Z76A 1K8A4 2KCDA 1SIIA 3UNLA 1RJOA 3CPOA 3LH4A 1UW1A 3AMOA 3NQYA 1A2KA 2P09A 4AKZA 3NBBA 1OGZA 1N9JA 3CCJ3 1IVUA 3PCSA 2W9QA 4O3VA 2ZL8A 2CG0A 5AIHA 3S67A 3FCSB 3DY5A 4HM6B 2CWVA 1W5ZA 2CIUA 3CNMA 1G96A 4N3VA 3NX0A 3G4S3 2LQVA 2MF7A 2XF3A 3FZWA 4OVMA 4FCJA 3NBJA 3F9SA 2JQ5A 5D81A 1PFPA 1JJ22 1YHQ3 2BHMA 2M7OA 4K90B 2W03A 4CDLA 1US1A 1LNHA 3MWZA 3GWRA 3FF0A 5AIGA 3B4PA 2Z7AA 1K41A 2RCDA 2O3OA 1D6YA 1JN5B 3SEDA 2A15A 4K1UA 3X41A 1Q814 1A90A 2CG1A 1WNHA 3VSYA 1W7CA 3HI7A 4HM2B 1KC84 1O7GB 3MG2A 1ULIB 5EVHA 3BNCA 1FA3A 1IQYA 1JB4A 3HK4A 4NHFA 4HBRA 3MHEA 1UUVB 1W4NA 3LTAA 1STFI 4GL6A 3I563 3ALAA 3Q90A 4R80A 3JVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMQ A;  2HMO B;  1C7H A;  2F99 A;  5DRE A;  4RZM A;  1QJG A;  3H3H A;  4HM7 B;  4XBT A;  1CQS A;  3F8H A;  3T8U A;  3FLJ A;  3FKA A;  1NWW A;  1AR0 A;  3CU3 A;  3FSD A;  4U13 A;  3EF8 A;  5IG4 A;  4XDV A;  1TUH A;  1WQL B;  2PZV A;  3JUP A;  2GEY A;  4HZB B;  1E97 A;  3EN1 B;  3EX9 A;  3NV0 B;  5CF2 A;  3DZL A;  2STD A;  4LGQ A;  2I9W A;  3EBY A;  4Q53 A;  2F86 B;  4WYK A;  2QGU A;  5IER A;  2XR8 B;  3GZY B;  2W2C A;  2QIY A;  4L8O A;  3D9R A;  3ECF A;  1NU3 A;  1OHS A;  4HJL B;  4XDW A;  4R9L A;  4J8T A;  3UJM A;  1OHP A;  3KSP A;  3NM2 A;  3I0Y A;  2CKF B;  1BUQ A;  3A76 A;  1NDO B;  2INX A;  3EQQ B;  1DMM A;  1W01 A;  3JUM A;  3WMD A;  2YFJ B;  1E3V A;  7STD A;  3EN8 A;  1W6Y A;  3F14 A;  3SOY A;  4H3U A;  4HM5 B;  2RFR A;  2GBW B;  4HVN A;  2HMN B;  4OUQ A;  4HZ9 B;  1OGX A;  3G16 A;  3B4O A;  8CHO A;  3NBR A;  5IEO A;  1W00 A;  4K1V A;  3EHC A;  3ER7 A;  4PEJ A;  2CHC A;  4HM0 B;  5KP1 A;  5D82 A;  5D83 A;  4MJD A;  5IEP A;  5AIF A;  4X2H A;  3RGA A;  2HML B;  3OX9 A;  3M8C A;  2OWP A;  1ZX2 A;  4STD A;  3EJV A;  2XSH B;  3KE7 A;  2F98 A;  1SJW A;  3MYT A;  3K0Z A;  3H51 A;  1Z1S A;  1O7N B;  3ROB A;  3DUK A;  1JB5 A;  3B8L A;  2RGQ A;  3NXJ A;  5CK6 A;  1Q42 A;  3OWS A;  1U5O A;  2K54 A;  5FW5 A;  3HX8 A;  4L7K A;  3KZT A;  2B24 B;  5CXO A;  4I4K A;  3FGY A;  1QMA A;  5BXQ A;  2XSO B;  1OH0 A;  3GRD A;  3VGN A;  2Z77 A;  2GXF A;  4ORL A;  3LYG A;  4HKV B;  1OHO A;  1TP6 A;  5JPP A;  1STD A;  2BNG A;  2BMO B;  4IIA A;  3T8N A;  3MG3 A;  5AII A;  4XM4 A;  5KP4 A;  1OUN A;  3E99 A;  5TGN A;  3JUO A;  2YFL B;  3HZP A;  1O7H B;  1O7W B;  2GBX B;  3BLZ A;  1VZZ A;  5AEU B;  4R1K A;  1JN5 A;  1GYB A;  3K7C A;  3MG1 A;  3LZA A;  2BMQ B;  3G0K A;  1W02 A;  5HGR A;  3OV4 A;  3MKI A;  3F7X A;  4WWU C;  4J9A A;  3DMC A;  5IG3 A;  3FF2 A;  4WP5 A;  3DM8 A;  3GZR A;  4X2O A;  3MSO A;  3GZX B;  3S5C A;  1IDP A;  4WYK B;  4HM4 B;  5G2G A;  3EC9 A;  3JUQ A;  6STD A;  5IEN A;  3F40 A;  5AEW B;  2HMJ B;  5STD A;  4L8P A;  1GY7 A;  3NUV A;  1ISK A;  1OF5 A;  2UX0 A;  1GS3 A;  3JUN A;  5IG0 A;  1EA2 A;  4XBX A;  1GY6 A;  1ULJ B;  3F7S A;  3KKG A;  4XB5 A;  4HM3 B;  3NV0 A;  4HM1 B;  1O7M B;  1HKX A;  3NHX A;  2R4I A;  3CNX A;  1DMN A;  1Q40 A;  2GEX A;  1JKG A;  2BMR B;  5CLK A;  5IG5 A;  4KVH A;  5BVB A;  1UUW B;  4LEH A;  1OCV A;  1S5A A;  2YFI B;  1E3R A;  5KP3 A;  3RGR A;  2B1X B;  4HM8 B;  2HMK B;  5DRV A;  2XRX B;  3EBT A;  5IF6 A;  1OF5 B;  1EG9 B;  4LMI A;  4R9K A;  3G8Z A;  1ZO2 A;  3F8X A;  3OWU A;  3OWY A;  5AI1 A;  3SOA A;  3DXO A;  1GY5 A;  3BB9 A;  3STD A;  2IMJ A;  2HMM B;  5JPU A;  3OXA A;  5CF1 A;  1Q40 B;  1ASK A;  1O7P B;  1JKG B;  3GZB A;  4XBY A;  1JB2 A;  3B7C A;  3IPT A;  4GB5 A;  1OPY A;  4FCM A;  3FH1 A;  2Z76 A;  3UNL A;  3CPO A;  1A2K A;  1OGZ A;  5AIH A;  4HM6 B;  3CNM A;  4N3V A;  3FZW A;  4OVM A;  4FCJ A;  3F9S A;  2JQ5 A;  5D81 A;  4CDL A;  3GWR A;  3FF0 A;  5AIG A;  3B4P A;  2Z7A A;  1K41 A;  2RCD A;  1JN5 B;  3SED A;  2A15 A;  4K1U A;  3VSY A;  4HM2 B;  3MG2 A;  1O7G B;  1ULI B;  5EVH A;  1JB4 A;  3HK4 A;  3MHE A;  1UUV B;  3Q90 A; 
#chains in the Genus database with same CATH topology
 3UL6 A;  1DMQ A;  1L5G B;  1RNB A;  2OQE C;  2HMO B;  1A2P A;  1C7H A;  1FGT A;  1JZO A;  3D3L A;  5G1K A;  3CC4 3;  2F99 A;  2GU1 A;  5DRE A;  1K9M 4;  1FW7 A;  4RZM A;  1WMN A;  1QJG A;  2R41 A;  1JZD A;  3H3H A;  4HM7 B;  3ZG0 A;  4XBT A;  3DGY A;  3N8B A;  3CCM 3;  3LOY A;  1A67 A;  1TFK A;  5LC6 A;  4EBG A;  1LNI A;  1CQS A;  2FNQ A;  3F8H A;  2WGO A;  3FLJ A;  5EQL A;  1SQW A;  3SYU A;  3T8U A;  1KQS 2;  3GSP A;  2LYX A;  1GMQ A;  3HII A;  3N54 B;  4KFD A;  3FKA A;  2WO0 A;  3PYJ A;  3WHO A;  1NWW A;  1B2S A;  1AR0 A;  3DGM A;  5ELU A;  1C54 A;  3CU3 A;  3FSD A;  4U13 A;  1LQM B;  2MC8 A;  1DET A;  2Y73 A;  3EF8 A;  1RRH A;  3CCU 3;  2KRT A;  3BIR A;  5LC7 A;  5IG4 A;  4XDV A;  1ROA A;  1TUH A;  1W2Z A;  3AHW A;  3DGN A;  1WQL B;  2PZV A;  1TU5 A;  3JUP A;  2GEY A;  4HZB B;  2RNT A;  4CJN A;  2IUJ A;  1I3I A;  8RNT A;  3Q1C A;  1J2B A;  5BIR A;  1E97 A;  3EN1 B;  1R4C A;  1I2E A;  2P05 A;  1SIH A;  3HIG A;  3EX9 A;  2W0Q A;  3NV0 B;  5CF2 A;  3DZL A;  1BRH A;  1GD3 A;  1GMR A;  1UDI I;  2D1W A;  2I9W A;  2STD A;  3EBY A;  4LGQ A;  4ZM8 A;  3VF1 A;  1BRJ A;  2AAD A;  2P38 A;  5AYR B;  2K3D A;  2CX0 A;  3RDE A;  1IVX A;  1V57 A;  1YGW A;  4Q53 A;  2F86 B;  3DGL A;  4WYK A;  3T0U A;  4EV2 A;  2QGU A;  2CW9 A;  5IER A;  2XR8 B;  3LTB A;  4FCZ A;  4FMA A;  4AEQ A;  3GZY B;  1AVK A;  2W2C A;  4N6V 0;  1KD1 4;  1JRQ A;  4N6N B;  3I55 3;  3K9M C;  1B20 A;  1RGE A;  2QIY A;  4L8O A;  3WOF B;  3D9R A;  1LVN A;  2XH9 A;  3G71 3;  5RNT A;  1LOY A;  3HOH A;  1NB3 I;  1RHL A;  2GU3 A;  1BIR A;  3ECF A;  1NU3 A;  1OHS A;  1RNT A;  1I0V A;  1RRL A;  3NM7 A;  4FMB A;  4HJL B;  2F4Y A;  4R9L A;  4XDW A;  2CFG A;  4J8T A;  5FGO A;  4NRE A;  1A2V A;  3UJM A;  1U8C B;  3NQZ A;  1W6G A;  1OHP A;  3S28 A;  2ZHX B;  1PY3 A;  1FUW A;  1BVI A;  3KSP A;  1M1X B;  3NM2 A;  2SAR A;  3I0Y A;  1BRI A;  4O8S A;  3BNB A;  2CKF B;  1BAN A;  1BUQ A;  1I2F A;  1GOY A;  1MGR A;  3A5E A;  3A76 A;  1QAL A;  2C4B A;  1KSI A;  2AAE A;  1NDO B;  3X3Z A;  1LOW A;  1FGO A;  2XEP A;  4MEI A;  2OTL 3;  1BRK A;  1TRQ A;  3V98 A;  3X3Y A;  1UI7 A;  3CCL 3;  4MMY B;  3SXX A;  1BU4 A;  2INX A;  3UL5 A;  1DYU A;  3EQQ B;  2IA7 A;  1DMM A;  1W01 A;  3JUM A;  3WMD A;  1WMO A;  2XGL A;  2YFJ B;  4EXR A;  3PCR A;  1K73 4;  1JBT A;  1JBR A;  1E3V A;  1TIJ A;  2Q07 A;  4BTW A;  7STD A;  3EN8 A;  5M18 A;  2RSX A;  1N9E A;  3QK9 A;  3RNT A;  2KF4 A;  1W6Y A;  3F14 A;  1IVV A;  3PZW A;  3SOY A;  2HOH A;  3KN4 A;  4H3U A;  1NO3 A;  4HM5 B;  2RFR A;  2GBW B;  4HAA A;  2HMN B;  4HVN A;  1VQP 3;  2CX1 A;  3N9H A;  4OUQ A;  4HZ9 B;  1Q9E A;  1I0X A;  2V1L A;  1OGX A;  3G16 A;  1V74 A;  3B4O A;  1B3S A;  1BSA A;  1FZU A;  3PXM A;  8CHO A;  2XFT A;  3NBR A;  1LOV A;  5IEO A;  1W00 A;  1X1U A;  4K1V A;  3SX1 A;  3U97 A;  3CCE 3;  3EHC A;  3ER7 A;  4PEJ A;  2CHC A;  4HM0 B;  5KP1 A;  5D82 A;  1WMP A;  5D83 A;  4MJD A;  4J5K A;  5IEP A;  1BNF A;  5AIF A;  4FR9 A;  4X2H A;  1CH0 A;  3X42 A;  4CCV A;  3RGA A;  2HML B;  1FGR A;  3OX9 A;  3M8C A;  2OWP A;  1T3B A;  4BL3 A;  1ZX2 A;  4O02 B;  5BU4 A;  1B2U A;  3URP A;  3AMO B;  4STD A;  3CPW 2;  3EJV A;  4ILF A;  2XSH B;  1BNR A;  3J7Y d;  3KE7 A;  5A0O B;  1IT7 A;  1RGG A;  2F98 A;  1VQM 3;  3TDG A;  1IV7 A;  3D4A A;  1SJW A;  1IU7 A;  2C11 A;  2WOF A;  3K0Z A;  1BNS A;  3MYT A;  5GSP A;  4EV5 A;  4MMX B;  3H51 A;  1Z1S A;  1YGE A;  1K28 A;  3V92 A;  1GOV A;  1O7N B;  3ROB A;  3DUK A;  2CWU A;  2W56 A;  1W2B 2;  1UGH I;  2WGQ A;  2OCT A;  1RGF A;  1QVG 2;  1JB5 A;  3B8L A;  3CXC 2;  2RGQ A;  3LML A;  3NXJ A;  5CK6 A;  1VQ4 3;  1VQN 3;  1Q42 A;  3OWS A;  1U5O A;  1BSB A;  1RGA A;  2K54 A;  5M1A A;  1FUS A;  5FW5 A;  1MWU A;  3HX8 A;  4L7K A;  1YIJ 3;  3KZT A;  2B24 B;  3QRD A;  2ZA4 A;  5CXO A;  2SBL A;  1EEJ A;  3PS8 A;  4I4K A;  3FGY A;  1NJI 4;  1ROV A;  1QMA A;  2BIR A;  5BXQ A;  2L1S A;  1QVF 2;  2Z6B A;  2XSO B;  1BRN L;  1OH0 A;  3GRD A;  1RLS A;  2Z77 A;  2GXF A;  3VGN A;  4BTX A;  1IQX A;  3BND A;  3CCS 3;  4GSP A;  4ORL A;  1GSP A;  1HZ1 A;  5EEO A;  1FYS A;  3LYG A;  2CK3 H;  6GSP A;  3PGB A;  2QA4 3;  2CH9 A;  4HKV B;  3LT8 A;  5HOH A;  1TTO A;  3S27 A;  1OHO A;  3WOE B;  1TP6 A;  1BOX A;  5JPP A;  1T2H A;  3CMA 3;  1STD A;  1DVD A;  4KFE A;  1YVB I;  2BNG A;  1LQG C;  2BMO B;  3Q2P A;  1VQ6 3;  2P0M A;  4IIA A;  3CCQ 3;  1G0T A;  4FMC A;  1Q7Y 4;  4QWT A;  3T8N A;  1RKY A;  4NPB A;  1EUI C;  3MG3 A;  1BSD A;  1BSC A;  3LT9 A;  4AKY A;  1AQZ A;  2CFL A;  2CFK A;  5AII A;  1Q82 4;  4XM4 A;  4J5G A;  5KP4 A;  1M9G A;  1RTU A;  4WHA A;  3K5T A;  1OUN A;  1BRG A;  3E99 A;  3WOD G;  1VQ8 3;  2IYJ A;  5TGN A;  1CYV A;  3EE1 A;  3JUO A;  2YFL B;  4BIR A;  1OAC A;  3HZP A;  1HYF A;  1O7H B;  1O7W B;  1RGH A;  2GBX B;  2Y74 A;  2ZDJ A;  3BLZ A;  4LZI A;  1VZZ A;  1KWI A;  5AEU B;  4RNT A;  3OW2 2;  1GD4 A;  3WA2 X;  1QAF A;  1JNQ A;  4N6O B;  4R1K A;  1JN5 A;  1GYB A;  4O2H A;  1AV4 A;  2FXT A;  2W9P A;  3G6E 3;  3CD6 3;  3K7C A;  3MG1 A;  3IJE B;  4MMZ B;  3UB1 A;  1BSE A;  1TJD A;  1VQ5 3;  1RN7 A;  2CFW A;  3LZA A;  1ZS7 A;  2BMQ B;  3G0K A;  1W02 A;  3LTD A;  5HGR A;  1X1X A;  1I3F A;  3MKI A;  1UCJ A;  3OV4 A;  4R4K A;  3F7X A;  4WWU C;  4J9A A;  1F8N A;  2QEX 3;  3DMC A;  1DVC A;  5M19 A;  3SLU A;  1MGW A;  4HOH A;  5IG3 A;  3FF2 A;  4WP5 A;  3FG1 A;  3DM8 A;  4KFF A;  1W6C A;  1DE3 A;  1TFO A;  1N8R 4;  3GZR A;  4X2O A;  1EQK A;  1SAR A;  3MSO A;  3GZX B;  4JF8 A;  3S5C A;  3LTC A;  3L0R A;  1LOX A;  1PU4 A;  4N6M A;  1RN4 A;  1IDP A;  1N5H A;  2PNC A;  1UCL A;  2F56 A;  1JV2 B;  4WYK B;  3KSE D;  4HM4 B;  2BO9 B;  3IMA B;  3X3X A;  4EYC A;  1MWS A;  1T2I A;  5G2G A;  1JBS A;  2E2V A;  1UCI A;  3CC7 3;  1YJN 3;  3O8Y A;  1Q86 4;  2CC3 A;  7RNT A;  4BL2 A;  4TX4 A;  1BNJ A;  3EC9 A;  2CFD A;  3KII A;  3JUQ A;  6STD A;  5IEN A;  4N6T A;  1YJ9 3;  1MWR A;  2P0X A;  3F40 A;  2KXG A;  5AEW B;  2HMJ B;  5STD A;  4L8P A;  2GSP A;  3AGO A;  1X1W A;  4LYL B;  1GY7 A;  1V58 A;  1IT8 A;  3NUV A;  1YI2 3;  1ISK A;  3GAX A;  1OF5 A;  2UX0 A;  3FG4 A;  2WOH A;  1GS3 A;  2FGT A;  2H0H A;  3JUN A;  3D79 A;  1CYU A;  5IG0 A;  1EA2 A;  2UGI A;  1GY6 A;  4XBX A;  5AYS C;  1ULJ B;  3F7S A;  3K63 A;  1M90 4;  4GHO A;  1BNE A;  1X1Y A;  2O9U X;  2W6J H;  1B2Z A;  3KKG A;  4XB5 A;  1S72 3;  1IVW A;  2IUK A;  3ZFZ A;  2KF6 A;  1FGQ A;  4HM3 B;  1MNL A;  3NV0 A;  2H0I A;  1LXE A;  4HM1 B;  1O7M B;  1HKX A;  3NHX A;  6RNT A;  2W04 A;  3DGO A;  2R4I A;  3CNX A;  4FMD A;  7GSP A;  4G1M B;  2F5M A;  1DMN A;  1VQ9 3;  4BTY A;  1VQ7 3;  1Q40 A;  2GEX A;  1IYY A;  1UI8 A;  3ZG5 A;  1JKG A;  3DH2 A;  3LXU X;  2BMR B;  3FG3 A;  5CLK A;  5IG5 A;  1RDS A;  1Y4K A;  4KVH A;  4WFO A;  1RGK A;  1BRS A;  1BNG A;  3MPH A;  5BVB A;  1VQL 3;  1SPU A;  2E2U A;  1UUW B;  1RGC A;  4LEH A;  1GOU A;  2OOV C;  4EC6 A;  2XFS A;  1OCV A;  5IW9 A;  1QAK A;  1S5A A;  2YFI B;  3EB8 A;  4RNZ A;  2YX9 A;  2OQE A;  1E3R A;  1YJW 3;  2KF5 A;  4HYZ A;  5KP3 A;  3RGR A;  3U1W A;  4N6L A;  2BU4 A;  2B1X B;  2XGN A;  1M1K 4;  4HM8 B;  2HMK B;  2L4V A;  4RNY A;  5DRV A;  2XRX B;  4BU4 A;  3WR2 A;  2OTJ 3;  2OOV A;  1IK3 A;  1UGI A;  2CWT A;  4IT7 A;  1CEW I;  3EBT A;  2RBI A;  5IF6 A;  1GMP A;  1OF5 B;  1RN1 A;  1EG9 B;  1RCK A;  1N8Q A;  2J8X B;  4LSO A;  3S29 A;  4LMI A;  3CC2 3;  4R9K A;  1NNV A;  3G8Z A;  1ZO2 A;  1IV9 A;  3F8X A;  5ELJ A;  5JBS A;  5G1L A;  3OWU A;  3V99 A;  2ML6 A;  4JRF A;  3OWY A;  5AI1 A;  5I97 A;  3SOA A;  3DXO A;  1T5Y A;  1GY5 A;  1VQQ A;  2K0M A;  1WTH A;  4RBN A;  2E2T A;  4IPB A;  4N6U A;  2JDI H;  1B27 A;  2C10 A;  3BB9 A;  3WA3 A;  3STD A;  1BUJ A;  2IMJ A;  1EKM A;  2HMM B;  2KAA A;  2W56 B;  4KZ1 A;  1D6Z A;  5JPU A;  3OXA A;  1N5P A;  1PYL A;  1R4Y A;  4CPK A;  1IQ8 A;  5CF1 A;  3CCR 3;  4H61 A;  1BNI A;  1Q40 B;  1ASK A;  3X40 A;  1O7P B;  1HU9 A;  4OK0 A;  1I2G A;  1JKG B;  3GZB A;  4XBY A;  3WDG B;  1LRA A;  2ML5 A;  1NB5 I;  1FGM A;  1MOL A;  1D6U A;  1JB2 A;  2BT3 A;  3B7C A;  3IPT A;  2D42 A;  1VQK 3;  3BNE A;  1RMS A;  3SVA A;  4GB5 A;  1YIT 3;  3CCV 3;  3Q3F A;  3CME 3;  1VQO 3;  1AVL A;  4K61 A;  3KFQ C;  1OPY A;  4FCM A;  3FH1 A;  2Z76 A;  1K8A 4;  2KCD A;  1SII A;  3UNL A;  1YNV X;  1MWT A;  1RJO A;  3BU4 A;  3AGN A;  3CPO A;  3LH4 A;  1I8V A;  1UW1 A;  3AMO A;  3NQY A;  1A2K A;  2P09 A;  4AKZ A;  3NBB A;  1OGZ A;  1N9J A;  3CCJ 3;  1IVU A;  3PCS A;  2W9Q A;  4O3V A;  2ZL8 A;  1B2M A;  2CG0 A;  5AIH A;  3S67 A;  3FCS B;  1FUT A;  3DY5 A;  4HM6 B;  2H0G A;  1I70 A;  2CWV A;  9RNT A;  1W5Z A;  2CIU A;  3CNM A;  3D5I A;  1G96 A;  4N3V A;  3NX0 A;  4EW5 A;  3G4S 3;  2LQV A;  2MF7 A;  2XF3 A;  3FZW A;  4I5Q A;  4OVM A;  4FCJ A;  3NBJ A;  1RSN A;  3F9S A;  2JQ5 A;  5D81 A;  1PFP A;  1JJ2 2;  1B21 A;  1YHQ 3;  2BHM A;  2M7O A;  4K90 B;  2W03 A;  4CDL A;  1US1 A;  1LNH A;  3MWZ A;  3GWR A;  1Q7H A;  1UUG B;  1B2X A;  3FF0 A;  5AIG A;  3B4P A;  1AY7 A;  2F5W A;  4KT3 B;  2Z7A A;  1K41 A;  2RCD A;  1BAO A;  2O3O A;  1D6Y A;  1JN5 B;  3SED A;  2A15 A;  4K1U A;  3X41 A;  4DKI A;  1Q81 4;  1A90 A;  3D5G A;  2UUG C;  3AHS A;  2CG1 A;  1WNH A;  3VSY A;  1RCL A;  1W7C A;  1TRP A;  2KF3 A;  1BGS A;  1UCK A;  3HI7 A;  4HM2 B;  1KC8 4;  1O7G B;  3MG2 A;  1RGL A;  1ULI B;  1ZGX A;  5EVH A;  3BNC A;  2IY2 A;  1YVS A;  1FA3 A;  1IQY A;  3KCH A;  1JB4 A;  3HK4 A;  4NHF A;  4HBR A;  3MHE A;  1G02 A;  1UUV B;  1W4N A;  3LTA A;  1STF I;  4GL6 A;  3I56 3;  3ALA A;  3Q90 A;  4R80 A;  3JVC A; 
#chains in the Genus database with same CATH homology
 3UL6 A;  1DMQ A;  1L5G B;  2OQE C;  2HMO B;  1C7H A;  1FGT A;  3D3L A;  3CC4 3;  2F99 A;  2GU1 A;  5DRE A;  1K9M 4;  4RZM A;  1WMN A;  1QJG A;  3H3H A;  4HM7 B;  4XBT A;  3N8B A;  3CCM 3;  3LOY A;  1A67 A;  1TFK A;  5LC6 A;  4EBG A;  1CQS A;  2FNQ A;  3F8H A;  2WGO A;  3FLJ A;  5EQL A;  1SQW A;  3T8U A;  1KQS 2;  2LYX A;  3HII A;  3N54 B;  4KFD A;  3FKA A;  2WO0 A;  3PYJ A;  1NWW A;  1AR0 A;  3DGM A;  5ELU A;  3CU3 A;  3FSD A;  4U13 A;  2MC8 A;  2Y73 A;  3EF8 A;  1RRH A;  3CCU 3;  2KRT A;  5LC7 A;  5IG4 A;  4XDV A;  1ROA A;  1TUH A;  1W2Z A;  3DGN A;  1WQL B;  2PZV A;  1TU5 A;  3JUP A;  2GEY A;  4HZB B;  2IUJ A;  3Q1C A;  1J2B A;  1E97 A;  3EN1 B;  1R4C A;  2P05 A;  1SIH A;  3HIG A;  3EX9 A;  2W0Q A;  3NV0 B;  5CF2 A;  3DZL A;  1GD3 A;  2STD A;  4LGQ A;  2I9W A;  2D1W A;  3EBY A;  4ZM8 A;  3VF1 A;  2P38 A;  5AYR B;  3RDE A;  1IVX A;  4Q53 A;  2F86 B;  3DGL A;  4WYK A;  3T0U A;  4EV2 A;  2QGU A;  2CW9 A;  5IER A;  2XR8 B;  3LTB A;  4FCZ A;  4FMA A;  4AEQ A;  3GZY B;  1AVK A;  2W2C A;  4N6V 0;  1KD1 4;  1JRQ A;  4N6N B;  3I55 3;  3K9M C;  3WOF B;  2QIY A;  4L8O A;  3D9R A;  1LVN A;  2XH9 A;  3G71 3;  1NB3 I;  2GU3 A;  3ECF A;  1NU3 A;  1OHS A;  4HJL B;  1RRL A;  4XDW A;  3NM7 A;  4FMB A;  4R9L A;  2CFG A;  4J8T A;  5FGO A;  4NRE A;  1A2V A;  3UJM A;  1U8C B;  3NQZ A;  1W6G A;  1OHP A;  3S28 A;  1FUW A;  3KSP A;  1M1X B;  3NM2 A;  4O8S A;  3I0Y A;  3BNB A;  2CKF B;  1BUQ A;  3A76 A;  1QAL A;  1KSI A;  1NDO B;  3X3Z A;  1FGO A;  2XEP A;  4MEI A;  2OTL 3;  3V98 A;  3X3Y A;  3CCL 3;  1UI7 A;  4MMY B;  3SXX A;  2INX A;  3UL5 A;  1DYU A;  3EQQ B;  2IA7 A;  1DMM A;  1W01 A;  3JUM A;  3WMD A;  1WMO A;  2XGL A;  2YFJ B;  4EXR A;  3PCR A;  1K73 4;  1E3V A;  1TIJ A;  2Q07 A;  4BTW A;  7STD A;  3EN8 A;  2RSX A;  1N9E A;  3QK9 A;  1W6Y A;  3F14 A;  1IVV A;  3PZW A;  3SOY A;  3KN4 A;  4H3U A;  1NO3 A;  4HM5 B;  2RFR A;  2GBW B;  4HVN A;  2HMN B;  1VQP 3;  3N9H A;  4OUQ A;  4HZ9 B;  2V1L A;  1OGX A;  3G16 A;  1V74 A;  3B4O A;  3PXM A;  8CHO A;  2XFT A;  3NBR A;  5IEO A;  1W00 A;  4K1V A;  3SX1 A;  3U97 A;  3CCE 3;  3EHC A;  3ER7 A;  4PEJ A;  2CHC A;  4HM0 B;  5KP1 A;  5D82 A;  1WMP A;  5D83 A;  4MJD A;  5IEP A;  5AIF A;  4FR9 A;  4X2H A;  3X42 A;  4CCV A;  3RGA A;  2HML B;  1FGR A;  3OX9 A;  3M8C A;  2OWP A;  1ZX2 A;  4O02 B;  3AMO B;  4STD A;  3CPW 2;  3EJV A;  2XSH B;  3J7Y d;  3KE7 A;  5A0O B;  1IT7 A;  2F98 A;  1VQM 3;  3TDG A;  1IV7 A;  1SJW A;  1IU7 A;  2C11 A;  2WOF A;  3K0Z A;  3MYT A;  4EV5 A;  4MMX B;  3H51 A;  1Z1S A;  1YGE A;  1K28 A;  3V92 A;  1O7N B;  3ROB A;  3DUK A;  2CWU A;  2W56 A;  1W2B 2;  2WGQ A;  2OCT A;  1QVG 2;  1JB5 A;  3B8L A;  3CXC 2;  2RGQ A;  3LML A;  3NXJ A;  5CK6 A;  1VQ4 3;  1VQN 3;  1Q42 A;  3OWS A;  1U5O A;  2K54 A;  5FW5 A;  3HX8 A;  4L7K A;  1YIJ 3;  3KZT A;  2B24 B;  3QRD A;  5CXO A;  2SBL A;  3PS8 A;  4I4K A;  3FGY A;  1NJI 4;  1ROV A;  1QMA A;  5BXQ A;  1QVF 2;  2Z6B A;  2XSO B;  1OH0 A;  3GRD A;  3VGN A;  2Z77 A;  2GXF A;  4BTX A;  3CCS 3;  1IQX A;  3BND A;  4ORL A;  5EEO A;  3LYG A;  2CK3 H;  2QA4 3;  3PGB A;  2CH9 A;  4HKV B;  3LT8 A;  3S27 A;  3WOE B;  1OHO A;  1TP6 A;  5JPP A;  3CMA 3;  1STD A;  1DVD A;  4KFE A;  1YVB I;  2BNG A;  2BMO B;  3Q2P A;  1VQ6 3;  2P0M A;  4IIA A;  3CCQ 3;  4FMC A;  1Q7Y 4;  4QWT A;  3T8N A;  1RKY A;  3MG3 A;  3LT9 A;  4AKY A;  2CFL A;  2CFK A;  5AII A;  1Q82 4;  4XM4 A;  5KP4 A;  1M9G A;  4WHA A;  3K5T A;  1OUN A;  3E99 A;  3WOD G;  1VQ8 3;  5TGN A;  1CYV A;  3EE1 A;  3JUO A;  2YFL B;  1OAC A;  3HZP A;  1O7H B;  1O7W B;  2GBX B;  2Y74 A;  2ZDJ A;  3BLZ A;  4LZI A;  1VZZ A;  1KWI A;  5AEU B;  3OW2 2;  1GD4 A;  3WA2 X;  1QAF A;  1JNQ A;  4N6O B;  4R1K A;  1JN5 A;  1GYB A;  4O2H A;  1AV4 A;  2FXT A;  2W9P A;  3G6E 3;  3CD6 3;  3K7C A;  3MG1 A;  3IJE B;  4MMZ B;  3UB1 A;  1VQ5 3;  1RN7 A;  2CFW A;  3LZA A;  2BMQ B;  3G0K A;  1W02 A;  3LTD A;  5HGR A;  3OV4 A;  3MKI A;  4R4K A;  3F7X A;  4WWU C;  4J9A A;  1F8N A;  2QEX 3;  3DMC A;  1DVC A;  3SLU A;  5IG3 A;  3FF2 A;  4WP5 A;  3FG1 A;  3DM8 A;  4KFF A;  1W6C A;  1TFO A;  1N8R 4;  3GZR A;  4X2O A;  1EQK A;  3MSO A;  3GZX B;  4JF8 A;  3S5C A;  3LTC A;  3L0R A;  1LOX A;  1PU4 A;  4N6M A;  1IDP A;  1N5H A;  2PNC A;  1JV2 B;  4WYK B;  3KSE D;  4HM4 B;  2BO9 B;  3IMA B;  3X3X A;  4EYC A;  5G2G A;  2E2V A;  1YJN 3;  3CC7 3;  1Q86 4;  3O8Y A;  2CC3 A;  4TX4 A;  3EC9 A;  2CFD A;  3KII A;  3JUQ A;  6STD A;  5IEN A;  4N6T A;  1YJ9 3;  2P0X A;  3F40 A;  2KXG A;  5AEW B;  2HMJ B;  5STD A;  4L8P A;  1GY7 A;  3NUV A;  1IT8 A;  1YI2 3;  1ISK A;  3GAX A;  1OF5 A;  2UX0 A;  3FG4 A;  2WOH A;  1GS3 A;  2FGT A;  3JUN A;  1CYU A;  5IG0 A;  1EA2 A;  4XBX A;  1GY6 A;  5AYS C;  1ULJ B;  3F7S A;  3K63 A;  1M90 4;  2W6J H;  2O9U X;  3KKG A;  4XB5 A;  1S72 3;  1IVW A;  2IUK A;  1FGQ A;  4HM3 B;  1MNL A;  3NV0 A;  1LXE A;  4HM1 B;  1O7M B;  1HKX A;  3NHX A;  2W04 A;  3DGO A;  2R4I A;  3CNX A;  4FMD A;  4G1M B;  1DMN A;  1VQ9 3;  4BTY A;  1VQ7 3;  1Q40 A;  2GEX A;  1UI8 A;  1JKG A;  3LXU X;  2BMR B;  3FG3 A;  5CLK A;  5IG5 A;  1Y4K A;  4KVH A;  4WFO A;  3MPH A;  5BVB A;  1VQL 3;  1SPU A;  2E2U A;  1UUW B;  4LEH A;  2OOV C;  4EC6 A;  2XFS A;  1OCV A;  5IW9 A;  2YFI B;  1QAK A;  1S5A A;  3EB8 A;  4RNZ A;  2YX9 A;  2OQE A;  1E3R A;  1YJW 3;  4HYZ A;  5KP3 A;  3RGR A;  3U1W A;  4N6L A;  2B1X B;  2XGN A;  1M1K 4;  4HM8 B;  2HMK B;  2L4V A;  4RNY A;  5DRV A;  2XRX B;  2OTJ 3;  2OOV A;  1IK3 A;  2CWT A;  4IT7 A;  1CEW I;  3EBT A;  5IF6 A;  1OF5 B;  1EG9 B;  4LSO A;  1N8Q A;  3S29 A;  3CC2 3;  4LMI A;  4R9K A;  3G8Z A;  1ZO2 A;  1IV9 A;  3F8X A;  5ELJ A;  5JBS A;  3V99 A;  3OWU A;  2ML6 A;  4JRF A;  3OWY A;  5AI1 A;  5I97 A;  3SOA A;  3DXO A;  1T5Y A;  1GY5 A;  2K0M A;  1WTH A;  4RBN A;  2E2T A;  4IPB A;  4N6U A;  2JDI H;  2C10 A;  3BB9 A;  3WA3 A;  3STD A;  2IMJ A;  1EKM A;  2HMM B;  2W56 B;  4KZ1 A;  1D6Z A;  5JPU A;  3OXA A;  1N5P A;  1IQ8 A;  5CF1 A;  3CCR 3;  4H61 A;  1Q40 B;  1ASK A;  3X40 A;  1O7P B;  1HU9 A;  4OK0 A;  1JKG B;  3GZB A;  4XBY A;  3WDG B;  2ML5 A;  1NB5 I;  1FGM A;  1MOL A;  1D6U A;  1JB2 A;  2BT3 A;  3B7C A;  3IPT A;  2D42 A;  1VQK 3;  3BNE A;  3SVA A;  4GB5 A;  1YIT 3;  3CCV 3;  3CME 3;  1VQO 3;  1AVL A;  4K61 A;  3KFQ C;  1OPY A;  4FCM A;  3FH1 A;  2Z76 A;  1K8A 4;  2KCD A;  1SII A;  3UNL A;  1RJO A;  3CPO A;  3LH4 A;  1UW1 A;  3AMO A;  3NQY A;  1A2K A;  2P09 A;  4AKZ A;  3NBB A;  1OGZ A;  1N9J A;  3CCJ 3;  1IVU A;  3PCS A;  2W9Q A;  4O3V A;  2ZL8 A;  2CG0 A;  5AIH A;  3S67 A;  3FCS B;  3DY5 A;  4HM6 B;  2CWV A;  1W5Z A;  2CIU A;  3CNM A;  1G96 A;  4N3V A;  3NX0 A;  3G4S 3;  2LQV A;  2MF7 A;  2XF3 A;  3FZW A;  4OVM A;  4FCJ A;  3NBJ A;  3F9S A;  2JQ5 A;  5D81 A;  1PFP A;  1JJ2 2;  1YHQ 3;  2BHM A;  2M7O A;  4K90 B;  2W03 A;  4CDL A;  1US1 A;  1LNH A;  3MWZ A;  3GWR A;  3FF0 A;  5AIG A;  3B4P A;  2Z7A A;  1K41 A;  2RCD A;  2O3O A;  1D6Y A;  1JN5 B;  3SED A;  2A15 A;  4K1U A;  3X41 A;  1Q81 4;  1A90 A;  2CG1 A;  1WNH A;  3VSY A;  1W7C A;  3HI7 A;  4HM2 B;  1KC8 4;  1O7G B;  3MG2 A;  1ULI B;  5EVH A;  3BNC A;  1FA3 A;  1IQY A;  1JB4 A;  3HK4 A;  4NHF A;  4HBR A;  3MHE A;  1UUV B;  1W4N A;  3LTA A;  1STF I;  4GL6 A;  3I56 3;  3ALA A;  3Q90 A;  4R80 A;  3JVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...