3NQYA

Crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
174
Chain Sequence
ANKKYLNQQPTINNMVQSNVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
molecule keywords Secreted metalloprotease Mcp02
total genus 33
structure length 174
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA01
1SIHA 3AMOB 4EV2A 2OOVA 3K5TA 3MPHA 1IVUA 1JRQA 4BTXA 4EV5A 1W5ZA 2CG0A 1D6ZA 1SPUA 2OQEA 1QALA 2CFDA 1UI8A 1LVNA 1SIIA 3AMOA 1RKYA 2K0MA 5IW9A 1W2ZA 3WA2X 1N9EA 3ALAA 2WOHA 1IQYA 1QAKA 1IVXA 1W4NA 2PNCA 2WO0A 4BTWA 1PU4A 3NQZA 1AVLA 3HIIA 2CG1A 3N9HA 2WOFA 3KN4A 2E2VA 1W7CA 3X3XA 2CWUA 2CFLA 2GU3A 3HIGA 2CWTA 3X3ZA 2E2UA 2YX9A 3WA3A 3X42A 1KSIA 1UI7A 1WMPA 2OQEC 3NBJA 4EXRA 3T0UA 2IA7A 3NBBA 4KFFA 3NQYA 1RJOA 3SX1A 2D1WA 2OOVC 3HI7A 1D6YA 2WGQA 1IVWA 1W6CA 3PGBA 2Y73A 3X40A 2CFWA 2BT3A 4KFEA 4BTYA 4KFDA 2ZL8A 2C11A 2CFGA 1IQXA 1TU5A 1IU7A 3KIIA 4K90B 2C10A 2E2TA 1EKMA 1IVVA 1W6GA 3SXXA 1DYUA 1AV4A 3LOYA 1WMNA 2W0QA 3X3YA 1QAFA 1OACA 2CFKA 2Y74A 1US1A 1A2VA 1WMOA 1D6UA 2CWVA 3X41A 1AVKA
chains in the Genus database with same CATH superfamily
2F86B 4L8PA 1JN5A 2XF3A 2GBWB 4STDA 4K1VA 1ASKA 1ZGXA 2F99A 4XDWA 4BTXA 2FNQA 1FGRA 2RCDA 3AHWA 3K7CA 3V99A 1IYYA 4EC6A 3NHXA 4NPBA 3CC43 4HBRA 4BU4A 3KFQC 1VQ43 3MG2A 4FCMA 2A15A 1RRLA 2KF6A 3S28A 3S29A 4DKIA 2P0XA 1UI8A 1RRHA 3F14A 5GSPA 1LVNA 3ZG5A 4HM2B 3SYUA 5ELUA 1MWTA 2GSPA 3U1WA 4HOHA 4R80A 1QVF2 2QA43 5KP3A 3ZFZA 5IF6A 2W03A 3CMA3 1IQYA 2WOHA 2QGUA 3KCHA 1VQ53 4J9AA 4XBXA 1BSAA 1JZOA 5A0OB 4CCVA 1VQM3 1RGCA 3Q90A 2KF4A 2LYXA 4L7KA 3CCJ3 2AAEA 3CPW2 2BHMA 4GL6A 1JNQA 1RHLA 1O7GB 2CG1A 1WNHA 4WFOA 1MWRA 2WOFA 3KN4A 4ORLA 1QVG2 1MGRA 5HGRA 1JBSA 1E3VA 1CYVA 1G0TA 1I0XA 1LOYA 1NU3A 1FZUA 2GU3A 3HIGA 3LH4A 4FR9A 3EBYA 3DGNA 5JPPA 1N5HA 3GRDA 4GHOA 3SOYA 1K28A 2YX9A 3CNMA 1B27A 4HM5B 1KSIA 4LEHA 3RNTA 1OGXA 1G02A 1BIRA 1WMPA 1UCKA 2P05A 3JVCA 3O8YA 1TP6A 2PZVA 3FG4A 4FMBA 4CJNA 3CC73 3KSPA 3GAXA 3B4PA 3DZLA 2IUJA 1VQQA 3CCE3 1UGIA 3DY5A 2IA7A 3LXUX 1OHOA 1RGEA 3CU3A 3B8LA 3ECFA 1ROVA 1TFKA 4MJDA 1BU4A 2C4BA 1LOWA 1RJOA 3NQYA 1EG9B 1V74A 1X1XA 5AIIA 3HI7A 1JKGB 1BNEA 5D81A 1DVDA 1UCLA 3LMLA 3BNCA 5JPUA 3PCSA 1RNBA 2CIUA 2L4VA 1O7MB 8RNTA 1K8A4 4K61A 1NJI4 1M9GA 5CLKA 3B4OA 3PGBA 1DE3A 6RNTA 1FUSA 2V1LA 4AKYA 1M1K4 2ML6A 1LOXA 4XDVA 3URPA 3FH1A 4BTYA 1RDSA 4KFDA 1I3FA 4XB5A 2ZL8A 3S5CA 2HOHA 3ER7A 3F7SA 1LOVA 1W6YA 2CFGA 2M7OA 3Q1CA 5AIFA 2OTJ3 3PCRA 1JB5A 1IQXA 3FZWA 3CCL3 2H0IA 2UUGC 5BIRA 3CC23 4HKVB 4LMIA 3LT8A 1IU7A 4AKZA 3CXC2 1M904 3LTCA 4K90B 3T8NA 3F9SA 1BRIA 2E2TA 5AIHA 3WOEB 1BSBA 1IVVA 1W6GA 5HOHA 2YFLB 1VQN3 2BMOB 1OH0A 1RCKA 3LOYA 2STDA 1DMQA 1B2XA 1OACA 3MHEA 2CFKA 2Y74A 3H51A 3DGOA 5IEOA 1UCIA 2W9PA 2W04A 1A2VA 1O7PB 2YFJB 1DVCA 1TIJA 3NV0B 1W02A 1S723 3WR2A 1SIHA 2CK3H 1YIJ3 1BUQA 1O7HB 5CF2A 4OK0A 2AADA 3AHSA 4N6MA 3CCM3 1GYBA 3EJVA 8CHOA 3STDA 1JRQA 1S5AA 4H61A 4ILFA 1CYUA 3RGRA 4EV5A 2CG0A 5CK6A 1D6ZA 1VQL3 1BRSA 3PXMA 1GMPA 2CX1A 2OQEA 1YGEA 2CFDA 3G16A 1CQSA 3JUOA 1BRNL 3AMOA 1OUNA 3MYTA 1RKYA 5IERA 1IT7A 3FCSB 1DETA 1LNIA 2K0MA 4JF8A 2QIYA 4HM8B 1ULIB 1OF5A 3LTBA 2BNGA 1I3IA 1QAKA 3L0RA 3EHCA 3HX8A 3JUNA 1JJ22 3DXOA 3SEDA 1HYFA 4N6OB 1DMNA 1W4NA 4CPKA 3GZBA 1PY3A 1Q7HA 1QJGA 1TFOA 3Q2PA 3NQZA 4WP5A 5G2GA 1STFI 4BTWA 5IENA 1AVLA 1PU4A 1BOXA 1YNVX 1TRQA 1AR0A 1I8VA 2IMJA 1BSDA 1A2KA 3WDGB 7STDA 4O2HA 2LQVA 4N3VA 2CWTA 1N5PA 3UL5A 3KE7A 1FA3A 4RNTA 1VQ73 2BMRB 2UX0A 1GS3A 3RGAA 2K3DA 1Q814 1V58A 3DUKA 1A67A 2Z6BA 1RN4A 4K1UA 4O8SA 4O02B 4N6UA 4BL2A 3MKIA 1BRHA 1GY7A 3GWRA 1X1WA 3NBJA 1Q7Y4 5LC6A 3V92A 4EXRA 3EQQB 1MGWA 3NBBA 3NX0A 3FKAA 5EQLA 4MMYB 2IY2A 2HMMB 1BNJA 2XGLA 1K734 2XR8B 4R1KA 5AEUB 2CH9A 1EUIC 1TRPA 1F8NA 2XFTA 3F7XA 2D1WA 3SX1A 4HM7B 3G4S3 2W56B 1KC84 1OHSA 1M1XB 3EN1B 1D6YA 3M8CA 4CDLA 3UB1A 2RNTA 1RGLA 1IVWA 1UUVB 3MG1A 4PEJA 3CNXA 2GXFA 1BNGA 1FGMA 3HOHA 4HYZA 1YJN3 3FSDA 4O3VA 4XM4A 4R9KA 1RGGA 4FCZA 1Q824 1FGOA 2IUKA 1NB5I 3MSOA 2O9UX 3CCQ3 3BNBA 1N8R4 1N8QA 1RGAA 2C11A 3TDGA 3JUMA 3S27A 3EF8A 1U5OA 3HZPA 1YJ93 3CCU3 5STDA 1O7NB 4WYKB 1LNHA 2KF3A 5CF1A 4WHAA 1KWIA 1RGFA 2CKFB 3E99A 1RSNA 3G0KA 1UUGB 3K9MC 4J5KA 2W9QA 4LSOA 5G1LA 2P09A 3HK4A 3BIRA 3JUPA 1I70A 3RDEA 3UL6A 3X3YA 3F8XA 5M18A 2FGTA 3SOAA 3VSYA 2HMKB 1EA2A 5M19A 2XGNA 3QK9A 1RMSA 3D5GA 1BNRA 2W2CA 1KD14 1AVKA 2OOVA 3ROBA 1JB2A 4IIAA 4MEIA 5RNTA 1BRKA 2J8XB 3EC9A 1OHPA 1IDPA 3K5TA 3MPHA 2BU4A 5FGOA 1GMRA 1IVUA 3EBTA 4GB5A 5D83A 4X2HA 1LXEA 2IYJA 1WQLB 1T5YA 5EVHA 2H0HA 4J8TA 3J7Yd 1I2GA 5TGNA 3KSED 3LTDA 1L5GB 3MWZA 3V98A 3BLZA 1W01A 2RFRA 3FGYA 1Z1SA 3EE1A 3OXAA 1SIIA 3DH2A 3DGMA 3F8HA 2UGIA 3LYGA 1K9M4 2OTL3 3N8BA 1W2ZA 3WA2X 1IK3A 1WTHA 1N9EA 5ELJA 3ALAA 3CME3 2F4YA 3DGYA 5DREA 5IG0A 7RNTA 1I0VA 1GD3A 2R4IA 1ROAA 1FGTA 1MWSA 2RBIA 1MOLA 2ZA4A 2SBLA 1ZO2A 1BNSA 2WO0A 3G8ZA 3PYJA 4J5GA 4RBNA 2GU1A 5AYSC 4EW5A 3G6E3 2R41A 3N9HA 1I2EA 1CEWI 1I2FA 5KP1A 1VQK3 1RN7A 2F56A 3BNEA 2E2VA 1W7CA 5IEPA 3UNLA 1BRGA 1NDOB 1RGKA 1Q864 3NUVA 3NBRA 5G1KA 3X3ZA 1Q40B 1BSCA 1UW1A 3I553 5I97A 2MF7A 3WMDA 1TUHA 3A76A 1GOVA 2OQEC 4FMCA 4U13A 3OV4A 2JDIH 3OX9A 1A2PA 1BGSA 4HJLB 3DM8A 3G713 2L1SA 5BU4A 2ML5A 1N9JA 4JRFA 1VQO3 1HZ1A 1KQS2 1IV9A 3T0UA 4ZM8A 3BNDA 4MMXB 1V57A 2SARA 2F5MA 1ISKA 1B2UA 3H3HA 1ZS7A 2XRXB 4FMAA 3B7CA 5AIGA 7GSPA 1YI23 1A90A 3GZYB 3T8UA 3CCV3 3FLJA 1T3BA 3EB8A 3OWUA 1AY7A 3FF2A 3OWYA 1GY6A 3CCS3 4N6V0 3N54B 1JZDA 1X1UA 3X40A 1J2BA 1JBTA 2I9WA 1TJDA 1B20A 1RLSA 1E3RA 3OWSA 2ZDJA 1JN5B 1QMAA 2CHCA 2F98A 1YGWA 2OWPA 3WHOA 1U8CB 5IG4A 2XFSA 3GZXB 3NV0A 1T2IA 1TU5A 1BRJA 1VQ83 1SARA 3K0ZA 4Q53A 3KIIA 2C10A 1NB3I 3K63A 3UJMA 1JBRA 1EKMA 1JV2B 2XSOB 4OVMA 4IT7A 3IPTA 4NHFA 1DYUA 3BU4A 3EN8A 2CW9A 1GMQA 1K41A 1IT8A 4LYLB 1RN1A 1QAFA 4MMZB 5CXOA 3EX9A 2D42A 2XH9A 1US1A 1GOUA 5AI1A 3KZTA 2QEX3 4EYCA 2CWVA 1LQMB 4HVNA 4HM4B 3X41A 1B2MA 1RGHA 2XSHB 3LT9A 2P38A 3AMOB 4EV2A 5KP4A 2BO9B 1LQGC 2JQ5A 2WGOA 3D79A 3I0YA 2KXGA 1MNLA 2KF5A 1FYSA 1OGZA 2HMNB 4BL3A 1BNIA 5JBSA 1FUTA 4LZIA 2MC8A 1BUJA 2GEXA 2GEYA 1MWUA 1BVIA 1VQ93 3CD63 1W5ZA 3WODG 3IMAB 1FUWA 1B2ZA 1SPUA 2BMQB 4H3UA 1VQ63 5M1AA 1QALA 2CC3A 1B3SA 2Z76A 1NWWA 1JB4A 1IV7A 3CCR3 3OW22 1PFPA 1G96A 3LTAA 1EQKA 1LRAA 2W6JH 1UDII 2OCTA 1YHQ3 3A5EA 4I4KA 1BSEA 3DMCA 1BAOA 5BVBA 5IW9A 4HZBB 4R9LA 5BXQA 3D3LA 3IJEB 4XBTA 3VF1A 4KVHA 2KCDA 1B21A 3SVAA 1NNVA 3CPOA 4HM6B 1IVXA 4GSPA 1SQWA 2PNCA 1PYLA 2B24B 1RTUA 5IG5A 1FW7A 2RGQA 4G1MB 2YFIB 3HIIA 3QRDA 2GBXB 1Q42A 1R4YA 3JUQA 3NM7A 4XBYA 2Q07A 1VQP3 2HMJB 2ZHXB 5AEWB 3Q3FA 1CH0A 3X3XA 2CWUA 2CFLA 2BIRA 2P0MA 2K54A 1VZZA 5EEOA 2E2UA 3FG1A 1JKGA 4FCJA 4IPBA 4AEQA 4HM0B 5LC7A 3WA3A 3X42A 1RCLA 4HM1B 1UI7A 1HKXA 4L8OA 1ZX2A 2KRTA 1YVSA 4N6TA 4RNZA 4QWTA 1FGQA 4KZ1A 1UUWB 1GY5A 3FF0A 2W56A 4NREA 4R4KA 1GSPA 5FW5A 1ULJB 4WYKA 3KKGA 2FXTA 3S67A 1HU9A 6STDA 4WWUC 1RNTA 3AGOA 4KFFA 9RNTA 3LZAA 4HAAA 1Q40A 2OOVC 2Z77A 3BB9A 4OUQA 3VGNA 1EEJA 3D4AA 1YJW3 1DMMA 1E97A 4N6LA 1BANA 1T2HA 2WGQA 1YIT3 1NO3A 3ZG0A 1W6CA 3SLUA 5IG3A 1IQ8A 1UGHI 2HMLB 2Y73A 1TTOA 5AYRB 3PS8A 2CFWA 4BIRA 2CX0A 6GSPA 1OCVA 4EBGA 4FMDA 2BT3A 4KFEA 1OPYA 3FG3A 2KAAA 1O7WB 2XEPA 5D82A 1X1YA 2Z7AA 3AGNA 1Q9EA 5DRVA 3D9RA 4I5QA 4N6NB 1R4CA 3WOFB 4HZ9B 1B2SA 1C7HA 3GSPA 1BNFA 3I563 3NXJA 3U97A 4X2OA 1YVBI 3SXXA 3D5IA 1W2B2 1AQZA 2F5WA 3GZRA 1AV4A 1GD4A 3PZWA 4RNYA 4RZMA 4TX4A 1WMNA 2W0QA 1UCJA 2INXA 2RSXA 4LGQA 1W00A 1STDA 4KT3B 1OF5B 2HMOB 3F40A 3NM2A 2B1XB 1WMOA 2H0GA 2O3OA 1SJWA 1D6UA 1Y4KA 3MG3A 1C54A 3DGLA 4HM3B 1GOYA
chains in the Genus database with same CATH topology
2F86B 4L8PA 1JN5A 2XF3A 2GBWB 4STDA 4K1VA 1ASKA 2F99A 4XDWA 4BTXA 2FNQA 1FGRA 2RCDA 3K7CA 3V99A 4EC6A 3NHXA 3CC43 4HBRA 3KFQC 1VQ43 3MG2A 4FCMA 2A15A 1RRLA 3S28A 3S29A 2P0XA 1UI8A 1RRHA 3F14A 1LVNA 4HM2B 5ELUA 3U1WA 4R80A 1QVF2 2QA43 5KP3A 5IF6A 2W03A 3CMA3 1IQYA 2WOHA 2QGUA 1VQ53 4J9AA 4XBXA 5A0OB 4CCVA 1VQM3 3Q90A 2LYXA 4L7KA 3CCJ3 3CPW2 2BHMA 4GL6A 1JNQA 1O7GB 2CG1A 1WNHA 4WFOA 2WOFA 3KN4A 4ORLA 1QVG2 5HGRA 1E3VA 1CYVA 3LH4A 2GU3A 1NU3A 3HIGA 3CXC2 4FR9A 3EBYA 3DGNA 5JPPA 1N5HA 3GRDA 3SOYA 1K28A 2YX9A 3CNMA 4HM5B 1KSIA 4LEHA 1OGXA 1WMPA 3O8YA 4IIAA 2P05A 3JVCA 1TP6A 2PZVA 3FG4A 4FMBA 3CC73 3KSPA 3GAXA 3B4PA 3DZLA 2IUJA 3CCE3 3DY5A 2IA7A 3LXUX 1OHOA 3CU3A 3B8LA 3ECFA 1ROVA 1TFKA 4MJDA 3NQYA 1RJOA 1EG9B 1V74A 5AIIA 3HI7A 1JKGB 5D81A 1DVDA 3LMLA 3BNCA 5JPUA 3PCSA 2CIUA 2L4VA 1O7MB 1K8A4 4K61A 1NJI4 1M9GA 5CLKA 3B4OA 3PGBA 2V1LA 4AKYA 1M1K4 2ML6A 1LOXA 4XDVA 3FH1A 4BTYA 4KFDA 3S5CA 4XB5A 2ZL8A 3ER7A 3F7SA 2M7OA 1W6YA 2CFGA 5AIFA 3Q1CA 2OTJ3 3PCRA 1JB5A 1IQXA 3FZWA 3CCL3 3CC23 4HKVB 4LMIA 3LT8A 1IU7A 4AKZA 1M904 3LTCA 4K90B 3T8NA 3F9SA 2E2TA 5AIHA 3WOEB 1IVVA 1W6GA 2YFLB 1VQN3 2BMOB 1OH0A 3LOYA 2STDA 1DMQA 1OACA 3MHEA 2Y74A 2CFKA 3H51A 3DGOA 5IEOA 2W9PA 2W04A 1A2VA 1O7PB 2YFJB 1DVCA 1TIJA 3NV0B 1W02A 1S723 1SIHA 2CK3H 1YIJ3 1BUQA 1O7HB 5CF2A 4OK0A 4N6MA 3CCM3 1GYBA 3EJVA 8CHOA 3STDA 1JRQA 1S5AA 4H61A 1CYUA 3RGRA 4EV5A 2CG0A 5CK6A 1D6ZA 1VQL3 3PXMA 2OQEA 1YGEA 2CFDA 3G16A 1CQSA 3JUOA 3AMOA 1OUNA 3MYTA 1RKYA 5IERA 1IT7A 3FCSB 2K0MA 4JF8A 2QIYA 4HM8B 1ULIB 1OF5A 3LTBA 2BNGA 1QAKA 3L0RA 3EHCA 3HX8A 3JUNA 1JJ22 3DXOA 3SEDA 4N6OB 1DMNA 1W4NA 3GZBA 1QJGA 4BTWA 1TFOA 3Q2PA 3NQZA 4WP5A 5G2GA 1STFI 5IENA 1PU4A 1AVLA 1AR0A 2IMJA 1A2KA 3WDGB 7STDA 4O2HA 2LQVA 4N3VA 2CWTA 1N5PA 3UL5A 3KE7A 1FA3A 1VQ73 2BMRB 2UX0A 1GS3A 3RGAA 1Q814 3DUKA 1A67A 2Z6BA 4K1UA 4O8SA 4O02B 4N6UA 3MKIA 3GWRA 1GY7A 3NBJA 1Q7Y4 5LC6A 3V92A 4EXRA 3EQQB 3NBBA 3NX0A 3FKAA 5EQLA 4MMYB 2HMMB 1K734 2XGLA 2XR8B 4R1KA 5AEUB 2CH9A 2XFTA 1F8NA 3F7XA 3SX1A 2D1WA 4HM7B 3G4S3 2W56B 1KC84 1OHSA 1M1XB 3EN1B 1D6YA 3M8CA 4CDLA 3UB1A 1IVWA 1UUVB 3MG1A 4PEJA 3CNXA 2GXFA 1FGMA 4HYZA 1YJN3 3FSDA 4O3VA 4XM4A 4R9KA 4FCZA 1Q824 1FGOA 2IUKA 1NB5I 3MSOA 2O9UX 3CCQ3 3BNBA 1N8R4 1N8QA 2C11A 3TDGA 3JUMA 3S27A 3EF8A 1U5OA 3HZPA 1YJ93 3CCU3 5STDA 1O7NB 4WYKB 1LNHA 5CF1A 4WHAA 1KWIA 2CKFB 3E99A 3G0KA 3K9MC 2W9QA 4LSOA 2P09A 3HK4A 3JUPA 3RDEA 3UL6A 3X3YA 3F8XA 2FGTA 3SOAA 3VSYA 2HMKB 1EA2A 2XGNA 3QK9A 2W2CA 1KD14 1AVKA 2OOVA 3ROBA 1JB2A 4MEIA 3EC9A 1OHPA 1IDPA 3K5TA 3MPHA 5FGOA 1IVUA 3EBTA 4GB5A 5D83A 4X2HA 1LXEA 1WQLB 1T5YA 5EVHA 4J8TA 3J7Yd 5TGNA 3KSED 3LTDA 1L5GB 3MWZA 3V98A 3BLZA 1W01A 2RFRA 3FGYA 1Z1SA 3EE1A 3OXAA 1SIIA 3DGMA 3F8HA 3LYGA 1K9M4 2OTL3 3N8BA 1W2ZA 3WA2X 1IK3A 1WTHA 1N9EA 5ELJA 3ALAA 3CME3 5DREA 5IG0A 1GD3A 2R4IA 1ROAA 1FGTA 3PZWA 1MOLA 2SBLA 1ZO2A 2WO0A 3G8ZA 3PYJA 4RBNA 2GU1A 5AYSC 3G6E3 3N9HA 1CEWI 5KP1A 1VQK3 1RN7A 3BNEA 1Q864 2E2VA 1W7CA 5IEPA 3UNLA 1NDOB 3NUVA 3NBRA 3X3ZA 1Q40B 1UW1A 3I553 5I97A 2MF7A 3WMDA 1TUHA 3A76A 4FMCA 2OQEC 4U13A 3OV4A 2JDIH 3OX9A 4HJLB 3DM8A 3G713 1KQS2 2ML5A 1N9JA 4JRFA 1VQO3 1IV9A 3T0UA 4ZM8A 3BNDA 4MMXB 1ISKA 3H3HA 2XRXB 4FMAA 3B7CA 5AIGA 1YI23 1A90A 3GZYB 3T8UA 3CCV3 3FLJA 3EB8A 3OWUA 3FF2A 3OWYA 1GY6A 3CCS3 4N6V0 3N54B 3X40A 1J2BA 2I9WA 1E3RA 3OWSA 2ZDJA 1JN5B 1QMAA 2CHCA 2F98A 2OWPA 5IG4A 1U8CB 2XFSA 3GZXB 3NV0A 1TU5A 1VQ83 3K0ZA 4Q53A 3KIIA 2C10A 1NB3I 3K63A 3UJMA 1EKMA 1JV2B 2XSOB 4OVMA 4IT7A 3IPTA 4NHFA 1DYUA 3EN8A 2CW9A 1K41A 1IT8A 1QAFA 4MMZB 5CXOA 3EX9A 2D42A 2XH9A 1US1A 5AI1A 3KZTA 2QEX3 4EYCA 2CWVA 4HVNA 4HM4B 3X41A 2XSHB 3LT9A 2P38A 3AMOB 4EV2A 5KP4A 2BO9B 2JQ5A 2WGOA 3I0YA 2KXGA 1MNLA 5JBSA 1OGZA 2HMNB 2MC8A 4LZIA 2GEXA 2GEYA 1VQ93 3CD63 1W5ZA 3WODG 3IMAB 1FUWA 1SPUA 2BMQB 4H3UA 1VQ63 1QALA 2CC3A 3OW22 2Z76A 1NWWA 1JB4A 1IV7A 3CCR3 1PFPA 1G96A 3LTAA 1EQKA 2W6JH 2OCTA 1YHQ3 4I4KA 5BVBA 3DMCA 5IW9A 4HZBB 4R9LA 5BXQA 3D3LA 3IJEB 4XBTA 3VF1A 4KVHA 2KCDA 3SVAA 3CPOA 4HM6B 1IVXA 1SQWA 2PNCA 2B24B 5IG5A 2RGQA 4G1MB 2YFIB 3HIIA 3QRDA 2GBXB 1Q42A 3NM7A 3JUQA 4XBYA 2Q07A 1VQP3 2HMJB 5AEWB 3X3XA 2CWUA 2CFLA 2P0MA 2K54A 1VZZA 5EEOA 2E2UA 3FG1A 1JKGA 4FCJA 4IPBA 4AEQA 4HM0B 5LC7A 3WA3A 3X42A 4HM1B 1UI7A 1HKXA 4L8OA 1ZX2A 2KRTA 4N6TA 4RNZA 4QWTA 1FGQA 4KZ1A 1UUWB 1GY5A 3FF0A 2W56A 4NREA 4R4KA 5FW5A 1ULJB 4WYKA 3KKGA 2FXTA 3S67A 1HU9A 6STDA 4WWUC 4KFFA 3LZAA 1Q40A 2OOVC 2Z77A 3BB9A 4OUQA 3VGNA 1YJW3 1DMMA 1E97A 4N6LA 2WGQA 1YIT3 1NO3A 1W6CA 3SLUA 5IG3A 1IQ8A 2HMLB 2Y73A 5AYRB 3PS8A 2CFWA 1OCVA 4EBGA 4FMDA 2BT3A 4KFEA 1OPYA 3FG3A 1O7WB 2XEPA 5D82A 2Z7AA 5DRVA 3D9RA 4N6NB 1R4CA 3WOFB 4HZ9B 1C7HA 3I563 3NXJA 3U97A 4X2OA 1YVBI 3SXXA 1W2B2 3GZRA 1AV4A 1GD4A 4RNYA 4RZMA 4TX4A 1WMNA 2W0QA 2INXA 2RSXA 4LGQA 1W00A 1STDA 1OF5B 2HMOB 3F40A 3NM2A 2B1XB 1WMOA 2O3OA 1SJWA 1D6UA 1Y4KA 3MG3A 3DGLA 4HM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIH A;  3AMO B;  4EV2 A;  2OOV A;  3K5T A;  3MPH A;  1IVU A;  1JRQ A;  4BTX A;  4EV5 A;  1W5Z A;  2CG0 A;  1D6Z A;  1SPU A;  2OQE A;  1QAL A;  2CFD A;  1UI8 A;  1LVN A;  1SII A;  3AMO A;  1RKY A;  2K0M A;  5IW9 A;  1W2Z A;  3WA2 X;  1N9E A;  3ALA A;  2WOH A;  1IQY A;  1QAK A;  1IVX A;  1W4N A;  2PNC A;  2WO0 A;  4BTW A;  1PU4 A;  3NQZ A;  1AVL A;  3HII A;  2CG1 A;  3N9H A;  2WOF A;  3KN4 A;  2E2V A;  1W7C A;  3X3X A;  2CWU A;  2CFL A;  2GU3 A;  3HIG A;  2CWT A;  3X3Z A;  2E2U A;  2YX9 A;  3WA3 A;  3X42 A;  1KSI A;  1UI7 A;  1WMP A;  2OQE C;  3NBJ A;  4EXR A;  3T0U A;  2IA7 A;  3NBB A;  4KFF A;  3NQY A;  1RJO A;  3SX1 A;  2D1W A;  2OOV C;  3HI7 A;  1D6Y A;  2WGQ A;  1IVW A;  1W6C A;  3PGB A;  2Y73 A;  3X40 A;  2CFW A;  2BT3 A;  4KFE A;  4BTY A;  4KFD A;  2ZL8 A;  2C11 A;  2CFG A;  1IQX A;  1TU5 A;  1IU7 A;  3KII A;  4K90 B;  2C10 A;  2E2T A;  1EKM A;  1IVV A;  1W6G A;  3SXX A;  1DYU A;  1AV4 A;  3LOY A;  1WMN A;  2W0Q A;  3X3Y A;  1QAF A;  1OAC A;  2CFK A;  2Y74 A;  1US1 A;  1A2V A;  1WMO A;  1D6U A;  2CWV A;  3X41 A;  1AVK A; 
#chains in the Genus database with same CATH topology
 2F86 B;  4L8P A;  1JN5 A;  2XF3 A;  2GBW B;  4STD A;  4K1V A;  1ASK A;  1ZGX A;  2F99 A;  4XDW A;  4BTX A;  2FNQ A;  1FGR A;  2RCD A;  3AHW A;  3K7C A;  3V99 A;  1IYY A;  4EC6 A;  3NHX A;  4NPB A;  3CC4 3;  4HBR A;  4BU4 A;  3KFQ C;  1VQ4 3;  3MG2 A;  4FCM A;  2A15 A;  1RRL A;  2KF6 A;  3S28 A;  3S29 A;  4DKI A;  2P0X A;  1UI8 A;  1RRH A;  3F14 A;  5GSP A;  1LVN A;  3ZG5 A;  4HM2 B;  3SYU A;  5ELU A;  1MWT A;  2GSP A;  3U1W A;  4HOH A;  4R80 A;  1QVF 2;  2QA4 3;  5KP3 A;  3ZFZ A;  5IF6 A;  2W03 A;  3CMA 3;  1IQY A;  2WOH A;  2QGU A;  3KCH A;  1VQ5 3;  4J9A A;  4XBX A;  1BSA A;  1JZO A;  5A0O B;  4CCV A;  1VQM 3;  1RGC A;  3Q90 A;  2KF4 A;  2LYX A;  4L7K A;  3CCJ 3;  2AAE A;  3CPW 2;  2BHM A;  4GL6 A;  1JNQ A;  1RHL A;  1O7G B;  2CG1 A;  1WNH A;  4WFO A;  1MWR A;  2WOF A;  3KN4 A;  4ORL A;  1QVG 2;  1MGR A;  5HGR A;  1JBS A;  1E3V A;  1CYV A;  1G0T A;  1I0X A;  1LOY A;  1NU3 A;  1FZU A;  2GU3 A;  3HIG A;  3LH4 A;  4FR9 A;  3EBY A;  3DGN A;  5JPP A;  1N5H A;  3GRD A;  4GHO A;  3SOY A;  1K28 A;  2YX9 A;  3CNM A;  1B27 A;  4HM5 B;  1KSI A;  4LEH A;  3RNT A;  1OGX A;  1G02 A;  1BIR A;  1WMP A;  1UCK A;  2P05 A;  3JVC A;  3O8Y A;  1TP6 A;  2PZV A;  3FG4 A;  4FMB A;  4CJN A;  3CC7 3;  3KSP A;  3GAX A;  3B4P A;  3DZL A;  2IUJ A;  1VQQ A;  3CCE 3;  1UGI A;  3DY5 A;  2IA7 A;  3LXU X;  1OHO A;  1RGE A;  3CU3 A;  3B8L A;  3ECF A;  1ROV A;  1TFK A;  4MJD A;  1BU4 A;  2C4B A;  1LOW A;  1RJO A;  3NQY A;  1EG9 B;  1V74 A;  1X1X A;  5AII A;  3HI7 A;  1JKG B;  1BNE A;  5D81 A;  1DVD A;  1UCL A;  3LML A;  3BNC A;  5JPU A;  3PCS A;  1RNB A;  2CIU A;  2L4V A;  1O7M B;  8RNT A;  1K8A 4;  4K61 A;  1NJI 4;  1M9G A;  5CLK A;  3B4O A;  3PGB A;  1DE3 A;  6RNT A;  1FUS A;  2V1L A;  4AKY A;  1M1K 4;  2ML6 A;  1LOX A;  4XDV A;  3URP A;  3FH1 A;  4BTY A;  1RDS A;  4KFD A;  1I3F A;  4XB5 A;  2ZL8 A;  3S5C A;  2HOH A;  3ER7 A;  3F7S A;  1LOV A;  1W6Y A;  2CFG A;  2M7O A;  3Q1C A;  5AIF A;  2OTJ 3;  3PCR A;  1JB5 A;  1IQX A;  3FZW A;  3CCL 3;  2H0I A;  2UUG C;  5BIR A;  3CC2 3;  4HKV B;  4LMI A;  3LT8 A;  1IU7 A;  4AKZ A;  3CXC 2;  1M90 4;  3LTC A;  4K90 B;  3T8N A;  3F9S A;  1BRI A;  2E2T A;  5AIH A;  3WOE B;  1BSB A;  1IVV A;  1W6G A;  5HOH A;  2YFL B;  1VQN 3;  2BMO B;  1OH0 A;  1RCK A;  3LOY A;  2STD A;  1DMQ A;  1B2X A;  1OAC A;  3MHE A;  2CFK A;  2Y74 A;  3H51 A;  3DGO A;  5IEO A;  1UCI A;  2W9P A;  2W04 A;  1A2V A;  1O7P B;  2YFJ B;  1DVC A;  1TIJ A;  3NV0 B;  1W02 A;  1S72 3;  3WR2 A;  1SIH A;  2CK3 H;  1YIJ 3;  1BUQ A;  1O7H B;  5CF2 A;  4OK0 A;  2AAD A;  3AHS A;  4N6M A;  3CCM 3;  1GYB A;  3EJV A;  8CHO A;  3STD A;  1JRQ A;  1S5A A;  4H61 A;  4ILF A;  1CYU A;  3RGR A;  4EV5 A;  2CG0 A;  5CK6 A;  1D6Z A;  1VQL 3;  1BRS A;  3PXM A;  1GMP A;  2CX1 A;  2OQE A;  1YGE A;  2CFD A;  3G16 A;  1CQS A;  3JUO A;  1BRN L;  3AMO A;  1OUN A;  3MYT A;  1RKY A;  5IER A;  1IT7 A;  3FCS B;  1DET A;  1LNI A;  2K0M A;  4JF8 A;  2QIY A;  4HM8 B;  1ULI B;  1OF5 A;  3LTB A;  2BNG A;  1I3I A;  1QAK A;  3L0R A;  3EHC A;  3HX8 A;  3JUN A;  1JJ2 2;  3DXO A;  3SED A;  1HYF A;  4N6O B;  1DMN A;  1W4N A;  4CPK A;  3GZB A;  1PY3 A;  1Q7H A;  1QJG A;  1TFO A;  3Q2P A;  3NQZ A;  4WP5 A;  5G2G A;  1STF I;  4BTW A;  5IEN A;  1AVL A;  1PU4 A;  1BOX A;  1YNV X;  1TRQ A;  1AR0 A;  1I8V A;  2IMJ A;  1BSD A;  1A2K A;  3WDG B;  7STD A;  4O2H A;  2LQV A;  4N3V A;  2CWT A;  1N5P A;  3UL5 A;  3KE7 A;  1FA3 A;  4RNT A;  1VQ7 3;  2BMR B;  2UX0 A;  1GS3 A;  3RGA A;  2K3D A;  1Q81 4;  1V58 A;  3DUK A;  1A67 A;  2Z6B A;  1RN4 A;  4K1U A;  4O8S A;  4O02 B;  4N6U A;  4BL2 A;  3MKI A;  1BRH A;  1GY7 A;  3GWR A;  1X1W A;  3NBJ A;  1Q7Y 4;  5LC6 A;  3V92 A;  4EXR A;  3EQQ B;  1MGW A;  3NBB A;  3NX0 A;  3FKA A;  5EQL A;  4MMY B;  2IY2 A;  2HMM B;  1BNJ A;  2XGL A;  1K73 4;  2XR8 B;  4R1K A;  5AEU B;  2CH9 A;  1EUI C;  1TRP A;  1F8N A;  2XFT A;  3F7X A;  2D1W A;  3SX1 A;  4HM7 B;  3G4S 3;  2W56 B;  1KC8 4;  1OHS A;  1M1X B;  3EN1 B;  1D6Y A;  3M8C A;  4CDL A;  3UB1 A;  2RNT A;  1RGL A;  1IVW A;  1UUV B;  3MG1 A;  4PEJ A;  3CNX A;  2GXF A;  1BNG A;  1FGM A;  3HOH A;  4HYZ A;  1YJN 3;  3FSD A;  4O3V A;  4XM4 A;  4R9K A;  1RGG A;  4FCZ A;  1Q82 4;  1FGO A;  2IUK A;  1NB5 I;  3MSO A;  2O9U X;  3CCQ 3;  3BNB A;  1N8R 4;  1N8Q A;  1RGA A;  2C11 A;  3TDG A;  3JUM A;  3S27 A;  3EF8 A;  1U5O A;  3HZP A;  1YJ9 3;  3CCU 3;  5STD A;  1O7N B;  4WYK B;  1LNH A;  2KF3 A;  5CF1 A;  4WHA A;  1KWI A;  1RGF A;  2CKF B;  3E99 A;  1RSN A;  3G0K A;  1UUG B;  3K9M C;  4J5K A;  2W9Q A;  4LSO A;  5G1L A;  2P09 A;  3HK4 A;  3BIR A;  3JUP A;  1I70 A;  3RDE A;  3UL6 A;  3X3Y A;  3F8X A;  5M18 A;  2FGT A;  3SOA A;  3VSY A;  2HMK B;  1EA2 A;  5M19 A;  2XGN A;  3QK9 A;  1RMS A;  3D5G A;  1BNR A;  2W2C A;  1KD1 4;  1AVK A;  2OOV A;  3ROB A;  1JB2 A;  4IIA A;  4MEI A;  5RNT A;  1BRK A;  2J8X B;  3EC9 A;  1OHP A;  1IDP A;  3K5T A;  3MPH A;  2BU4 A;  5FGO A;  1GMR A;  1IVU A;  3EBT A;  4GB5 A;  5D83 A;  4X2H A;  1LXE A;  2IYJ A;  1WQL B;  1T5Y A;  5EVH A;  2H0H A;  4J8T A;  3J7Y d;  1I2G A;  5TGN A;  3KSE D;  3LTD A;  1L5G B;  3MWZ A;  3V98 A;  3BLZ A;  1W01 A;  2RFR A;  3FGY A;  1Z1S A;  3EE1 A;  3OXA A;  1SII A;  3DH2 A;  3DGM A;  3F8H A;  2UGI A;  3LYG A;  1K9M 4;  2OTL 3;  3N8B A;  1W2Z A;  3WA2 X;  1IK3 A;  1WTH A;  1N9E A;  5ELJ A;  3ALA A;  3CME 3;  2F4Y A;  3DGY A;  5DRE A;  5IG0 A;  7RNT A;  1I0V A;  1GD3 A;  2R4I A;  1ROA A;  1FGT A;  1MWS A;  2RBI A;  1MOL A;  2ZA4 A;  2SBL A;  1ZO2 A;  1BNS A;  2WO0 A;  3G8Z A;  3PYJ A;  4J5G A;  4RBN A;  2GU1 A;  5AYS C;  4EW5 A;  3G6E 3;  2R41 A;  3N9H A;  1I2E A;  1CEW I;  1I2F A;  5KP1 A;  1VQK 3;  1RN7 A;  2F56 A;  3BNE A;  2E2V A;  1W7C A;  5IEP A;  3UNL A;  1BRG A;  1NDO B;  1RGK A;  1Q86 4;  3NUV A;  3NBR A;  5G1K A;  3X3Z A;  1Q40 B;  1BSC A;  1UW1 A;  3I55 3;  5I97 A;  2MF7 A;  3WMD A;  1TUH A;  3A76 A;  1GOV A;  2OQE C;  4FMC A;  4U13 A;  3OV4 A;  2JDI H;  3OX9 A;  1A2P A;  1BGS A;  4HJL B;  3DM8 A;  3G71 3;  2L1S A;  5BU4 A;  2ML5 A;  1N9J A;  4JRF A;  1VQO 3;  1HZ1 A;  1KQS 2;  1IV9 A;  3T0U A;  4ZM8 A;  3BND A;  4MMX B;  1V57 A;  2SAR A;  2F5M A;  1ISK A;  1B2U A;  3H3H A;  1ZS7 A;  2XRX B;  4FMA A;  3B7C A;  5AIG A;  7GSP A;  1YI2 3;  1A90 A;  3GZY B;  3T8U A;  3CCV 3;  3FLJ A;  1T3B A;  3EB8 A;  3OWU A;  1AY7 A;  3FF2 A;  3OWY A;  1GY6 A;  3CCS 3;  4N6V 0;  3N54 B;  1JZD A;  1X1U A;  3X40 A;  1J2B A;  1JBT A;  2I9W A;  1TJD A;  1B20 A;  1RLS A;  1E3R A;  3OWS A;  2ZDJ A;  1JN5 B;  1QMA A;  2CHC A;  2F98 A;  1YGW A;  2OWP A;  3WHO A;  1U8C B;  5IG4 A;  2XFS A;  3GZX B;  3NV0 A;  1T2I A;  1TU5 A;  1BRJ A;  1VQ8 3;  1SAR A;  3K0Z A;  4Q53 A;  3KII A;  2C10 A;  1NB3 I;  3K63 A;  3UJM A;  1JBR A;  1EKM A;  1JV2 B;  2XSO B;  4OVM A;  4IT7 A;  3IPT A;  4NHF A;  1DYU A;  3BU4 A;  3EN8 A;  2CW9 A;  1GMQ A;  1K41 A;  1IT8 A;  4LYL B;  1RN1 A;  1QAF A;  4MMZ B;  5CXO A;  3EX9 A;  2D42 A;  2XH9 A;  1US1 A;  1GOU A;  5AI1 A;  3KZT A;  2QEX 3;  4EYC A;  2CWV A;  1LQM B;  4HVN A;  4HM4 B;  3X41 A;  1B2M A;  1RGH A;  2XSH B;  3LT9 A;  2P38 A;  3AMO B;  4EV2 A;  5KP4 A;  2BO9 B;  1LQG C;  2JQ5 A;  2WGO A;  3D79 A;  3I0Y A;  2KXG A;  1MNL A;  2KF5 A;  1FYS A;  1OGZ A;  2HMN B;  4BL3 A;  1BNI A;  5JBS A;  1FUT A;  4LZI A;  2MC8 A;  1BUJ A;  2GEX A;  2GEY A;  1MWU A;  1BVI A;  1VQ9 3;  3CD6 3;  1W5Z A;  3WOD G;  3IMA B;  1FUW A;  1B2Z A;  1SPU A;  2BMQ B;  4H3U A;  1VQ6 3;  5M1A A;  1QAL A;  2CC3 A;  1B3S A;  2Z76 A;  1NWW A;  1JB4 A;  1IV7 A;  3CCR 3;  3OW2 2;  1PFP A;  1G96 A;  3LTA A;  1EQK A;  1LRA A;  2W6J H;  1UDI I;  2OCT A;  1YHQ 3;  3A5E A;  4I4K A;  1BSE A;  3DMC A;  1BAO A;  5BVB A;  5IW9 A;  4HZB B;  4R9L A;  5BXQ A;  3D3L A;  3IJE B;  4XBT A;  3VF1 A;  4KVH A;  2KCD A;  1B21 A;  3SVA A;  1NNV A;  3CPO A;  4HM6 B;  1IVX A;  4GSP A;  1SQW A;  2PNC A;  1PYL A;  2B24 B;  1RTU A;  5IG5 A;  1FW7 A;  2RGQ A;  4G1M B;  2YFI B;  3HII A;  3QRD A;  2GBX B;  1Q42 A;  1R4Y A;  3JUQ A;  3NM7 A;  4XBY A;  2Q07 A;  1VQP 3;  2HMJ B;  2ZHX B;  5AEW B;  3Q3F A;  1CH0 A;  3X3X A;  2CWU A;  2CFL A;  2BIR A;  2P0M A;  2K54 A;  1VZZ A;  5EEO A;  2E2U A;  3FG1 A;  1JKG A;  4FCJ A;  4IPB A;  4AEQ A;  4HM0 B;  5LC7 A;  3WA3 A;  3X42 A;  1RCL A;  4HM1 B;  1UI7 A;  1HKX A;  4L8O A;  1ZX2 A;  2KRT A;  1YVS A;  4N6T A;  4RNZ A;  4QWT A;  1FGQ A;  4KZ1 A;  1UUW B;  1GY5 A;  3FF0 A;  2W56 A;  4NRE A;  4R4K A;  1GSP A;  5FW5 A;  1ULJ B;  4WYK A;  3KKG A;  2FXT A;  3S67 A;  1HU9 A;  6STD A;  4WWU C;  1RNT A;  3AGO A;  4KFF A;  9RNT A;  3LZA A;  4HAA A;  1Q40 A;  2OOV C;  2Z77 A;  3BB9 A;  4OUQ A;  3VGN A;  1EEJ A;  3D4A A;  1YJW 3;  1DMM A;  1E97 A;  4N6L A;  1BAN A;  1T2H A;  2WGQ A;  1YIT 3;  1NO3 A;  3ZG0 A;  1W6C A;  3SLU A;  5IG3 A;  1IQ8 A;  1UGH I;  2HML B;  2Y73 A;  1TTO A;  5AYR B;  3PS8 A;  2CFW A;  4BIR A;  2CX0 A;  6GSP A;  1OCV A;  4EBG A;  4FMD A;  2BT3 A;  4KFE A;  1OPY A;  3FG3 A;  2KAA A;  1O7W B;  2XEP A;  5D82 A;  1X1Y A;  2Z7A A;  3AGN A;  1Q9E A;  5DRV A;  3D9R A;  4I5Q A;  4N6N B;  1R4C A;  3WOF B;  4HZ9 B;  1B2S A;  1C7H A;  3GSP A;  1BNF A;  3I56 3;  3NXJ A;  3U97 A;  4X2O A;  1YVB I;  3SXX A;  3D5I A;  1W2B 2;  1AQZ A;  2F5W A;  3GZR A;  1AV4 A;  1GD4 A;  3PZW A;  4RNY A;  4RZM A;  4TX4 A;  1WMN A;  2W0Q A;  1UCJ A;  2INX A;  2RSX A;  4LGQ A;  1W00 A;  1STD A;  4KT3 B;  1OF5 B;  2HMO B;  3F40 A;  3NM2 A;  2B1X B;  1WMO A;  2H0G A;  2O3O A;  1SJW A;  1D6U A;  1Y4K A;  3MG3 A;  1C54 A;  3DGL A;  4HM3 B;  1GOY A; 
#chains in the Genus database with same CATH homology
 2F86 B;  4L8P A;  1JN5 A;  2XF3 A;  2GBW B;  4STD A;  4K1V A;  1ASK A;  2F99 A;  4XDW A;  4BTX A;  2FNQ A;  1FGR A;  2RCD A;  3K7C A;  3V99 A;  4EC6 A;  3NHX A;  3CC4 3;  4HBR A;  3KFQ C;  1VQ4 3;  3MG2 A;  4FCM A;  2A15 A;  1RRL A;  3S28 A;  3S29 A;  2P0X A;  1UI8 A;  1RRH A;  3F14 A;  1LVN A;  4HM2 B;  5ELU A;  3U1W A;  4R80 A;  1QVF 2;  2QA4 3;  5KP3 A;  5IF6 A;  2W03 A;  3CMA 3;  1IQY A;  2WOH A;  2QGU A;  1VQ5 3;  4J9A A;  4XBX A;  5A0O B;  4CCV A;  1VQM 3;  3Q90 A;  2LYX A;  4L7K A;  3CCJ 3;  3CPW 2;  2BHM A;  4GL6 A;  1JNQ A;  1O7G B;  2CG1 A;  1WNH A;  4WFO A;  2WOF A;  3KN4 A;  4ORL A;  1QVG 2;  5HGR A;  1E3V A;  1CYV A;  3LH4 A;  2GU3 A;  1NU3 A;  3HIG A;  3CXC 2;  4FR9 A;  3EBY A;  3DGN A;  5JPP A;  1N5H A;  3GRD A;  3SOY A;  1K28 A;  2YX9 A;  3CNM A;  4HM5 B;  1KSI A;  4LEH A;  1OGX A;  1WMP A;  3O8Y A;  4IIA A;  2P05 A;  3JVC A;  1TP6 A;  2PZV A;  3FG4 A;  4FMB A;  3CC7 3;  3KSP A;  3GAX A;  3B4P A;  3DZL A;  2IUJ A;  3CCE 3;  3DY5 A;  2IA7 A;  3LXU X;  1OHO A;  3CU3 A;  3B8L A;  3ECF A;  1ROV A;  1TFK A;  4MJD A;  3NQY A;  1RJO A;  1EG9 B;  1V74 A;  5AII A;  3HI7 A;  1JKG B;  5D81 A;  1DVD A;  3LML A;  3BNC A;  5JPU A;  3PCS A;  2CIU A;  2L4V A;  1O7M B;  1K8A 4;  4K61 A;  1NJI 4;  1M9G A;  5CLK A;  3B4O A;  3PGB A;  2V1L A;  4AKY A;  1M1K 4;  2ML6 A;  1LOX A;  4XDV A;  3FH1 A;  4BTY A;  4KFD A;  3S5C A;  4XB5 A;  2ZL8 A;  3ER7 A;  3F7S A;  2M7O A;  1W6Y A;  2CFG A;  5AIF A;  3Q1C A;  2OTJ 3;  3PCR A;  1JB5 A;  1IQX A;  3FZW A;  3CCL 3;  3CC2 3;  4HKV B;  4LMI A;  3LT8 A;  1IU7 A;  4AKZ A;  1M90 4;  3LTC A;  4K90 B;  3T8N A;  3F9S A;  2E2T A;  5AIH A;  3WOE B;  1IVV A;  1W6G A;  2YFL B;  1VQN 3;  2BMO B;  1OH0 A;  3LOY A;  2STD A;  1DMQ A;  1OAC A;  3MHE A;  2Y74 A;  2CFK A;  3H51 A;  3DGO A;  5IEO A;  2W9P A;  2W04 A;  1A2V A;  1O7P B;  2YFJ B;  1DVC A;  1TIJ A;  3NV0 B;  1W02 A;  1S72 3;  1SIH A;  2CK3 H;  1YIJ 3;  1BUQ A;  1O7H B;  5CF2 A;  4OK0 A;  4N6M A;  3CCM 3;  1GYB A;  3EJV A;  8CHO A;  3STD A;  1JRQ A;  1S5A A;  4H61 A;  1CYU A;  3RGR A;  4EV5 A;  2CG0 A;  5CK6 A;  1D6Z A;  1VQL 3;  3PXM A;  2OQE A;  1YGE A;  2CFD A;  3G16 A;  1CQS A;  3JUO A;  3AMO A;  1OUN A;  3MYT A;  1RKY A;  5IER A;  1IT7 A;  3FCS B;  2K0M A;  4JF8 A;  2QIY A;  4HM8 B;  1ULI B;  1OF5 A;  3LTB A;  2BNG A;  1QAK A;  3L0R A;  3EHC A;  3HX8 A;  3JUN A;  1JJ2 2;  3DXO A;  3SED A;  4N6O B;  1DMN A;  1W4N A;  3GZB A;  1QJG A;  4BTW A;  1TFO A;  3Q2P A;  3NQZ A;  4WP5 A;  5G2G A;  1STF I;  5IEN A;  1PU4 A;  1AVL A;  1AR0 A;  2IMJ A;  1A2K A;  3WDG B;  7STD A;  4O2H A;  2LQV A;  4N3V A;  2CWT A;  1N5P A;  3UL5 A;  3KE7 A;  1FA3 A;  1VQ7 3;  2BMR B;  2UX0 A;  1GS3 A;  3RGA A;  1Q81 4;  3DUK A;  1A67 A;  2Z6B A;  4K1U A;  4O8S A;  4O02 B;  4N6U A;  3MKI A;  3GWR A;  1GY7 A;  3NBJ A;  1Q7Y 4;  5LC6 A;  3V92 A;  4EXR A;  3EQQ B;  3NBB A;  3NX0 A;  3FKA A;  5EQL A;  4MMY B;  2HMM B;  1K73 4;  2XGL A;  2XR8 B;  4R1K A;  5AEU B;  2CH9 A;  2XFT A;  1F8N A;  3F7X A;  3SX1 A;  2D1W A;  4HM7 B;  3G4S 3;  2W56 B;  1KC8 4;  1OHS A;  1M1X B;  3EN1 B;  1D6Y A;  3M8C A;  4CDL A;  3UB1 A;  1IVW A;  1UUV B;  3MG1 A;  4PEJ A;  3CNX A;  2GXF A;  1FGM A;  4HYZ A;  1YJN 3;  3FSD A;  4O3V A;  4XM4 A;  4R9K A;  4FCZ A;  1Q82 4;  1FGO A;  2IUK A;  1NB5 I;  3MSO A;  2O9U X;  3CCQ 3;  3BNB A;  1N8R 4;  1N8Q A;  2C11 A;  3TDG A;  3JUM A;  3S27 A;  3EF8 A;  1U5O A;  3HZP A;  1YJ9 3;  3CCU 3;  5STD A;  1O7N B;  4WYK B;  1LNH A;  5CF1 A;  4WHA A;  1KWI A;  2CKF B;  3E99 A;  3G0K A;  3K9M C;  2W9Q A;  4LSO A;  2P09 A;  3HK4 A;  3JUP A;  3RDE A;  3UL6 A;  3X3Y A;  3F8X A;  2FGT A;  3SOA A;  3VSY A;  2HMK B;  1EA2 A;  2XGN A;  3QK9 A;  2W2C A;  1KD1 4;  1AVK A;  2OOV A;  3ROB A;  1JB2 A;  4MEI A;  3EC9 A;  1OHP A;  1IDP A;  3K5T A;  3MPH A;  5FGO A;  1IVU A;  3EBT A;  4GB5 A;  5D83 A;  4X2H A;  1LXE A;  1WQL B;  1T5Y A;  5EVH A;  4J8T A;  3J7Y d;  5TGN A;  3KSE D;  3LTD A;  1L5G B;  3MWZ A;  3V98 A;  3BLZ A;  1W01 A;  2RFR A;  3FGY A;  1Z1S A;  3EE1 A;  3OXA A;  1SII A;  3DGM A;  3F8H A;  3LYG A;  1K9M 4;  2OTL 3;  3N8B A;  1W2Z A;  3WA2 X;  1IK3 A;  1WTH A;  1N9E A;  5ELJ A;  3ALA A;  3CME 3;  5DRE A;  5IG0 A;  1GD3 A;  2R4I A;  1ROA A;  1FGT A;  3PZW A;  1MOL A;  2SBL A;  1ZO2 A;  2WO0 A;  3G8Z A;  3PYJ A;  4RBN A;  2GU1 A;  5AYS C;  3G6E 3;  3N9H A;  1CEW I;  5KP1 A;  1VQK 3;  1RN7 A;  3BNE A;  1Q86 4;  2E2V A;  1W7C A;  5IEP A;  3UNL A;  1NDO B;  3NUV A;  3NBR A;  3X3Z A;  1Q40 B;  1UW1 A;  3I55 3;  5I97 A;  2MF7 A;  3WMD A;  1TUH A;  3A76 A;  4FMC A;  2OQE C;  4U13 A;  3OV4 A;  2JDI H;  3OX9 A;  4HJL B;  3DM8 A;  3G71 3;  1KQS 2;  2ML5 A;  1N9J A;  4JRF A;  1VQO 3;  1IV9 A;  3T0U A;  4ZM8 A;  3BND A;  4MMX B;  1ISK A;  3H3H A;  2XRX B;  4FMA A;  3B7C A;  5AIG A;  1YI2 3;  1A90 A;  3GZY B;  3T8U A;  3CCV 3;  3FLJ A;  3EB8 A;  3OWU A;  3FF2 A;  3OWY A;  1GY6 A;  3CCS 3;  4N6V 0;  3N54 B;  3X40 A;  1J2B A;  2I9W A;  1E3R A;  3OWS A;  2ZDJ A;  1JN5 B;  1QMA A;  2CHC A;  2F98 A;  2OWP A;  5IG4 A;  1U8C B;  2XFS A;  3GZX B;  3NV0 A;  1TU5 A;  1VQ8 3;  3K0Z A;  4Q53 A;  3KII A;  2C10 A;  1NB3 I;  3K63 A;  3UJM A;  1EKM A;  1JV2 B;  2XSO B;  4OVM A;  4IT7 A;  3IPT A;  4NHF A;  1DYU A;  3EN8 A;  2CW9 A;  1K41 A;  1IT8 A;  1QAF A;  4MMZ B;  5CXO A;  3EX9 A;  2D42 A;  2XH9 A;  1US1 A;  5AI1 A;  3KZT A;  2QEX 3;  4EYC A;  2CWV A;  4HVN A;  4HM4 B;  3X41 A;  2XSH B;  3LT9 A;  2P38 A;  3AMO B;  4EV2 A;  5KP4 A;  2BO9 B;  2JQ5 A;  2WGO A;  3I0Y A;  2KXG A;  1MNL A;  5JBS A;  1OGZ A;  2HMN B;  2MC8 A;  4LZI A;  2GEX A;  2GEY A;  1VQ9 3;  3CD6 3;  1W5Z A;  3WOD G;  3IMA B;  1FUW A;  1SPU A;  2BMQ B;  4H3U A;  1VQ6 3;  1QAL A;  2CC3 A;  3OW2 2;  2Z76 A;  1NWW A;  1JB4 A;  1IV7 A;  3CCR 3;  1PFP A;  1G96 A;  3LTA A;  1EQK A;  2W6J H;  2OCT A;  1YHQ 3;  4I4K A;  5BVB A;  3DMC A;  5IW9 A;  4HZB B;  4R9L A;  5BXQ A;  3D3L A;  3IJE B;  4XBT A;  3VF1 A;  4KVH A;  2KCD A;  3SVA A;  3CPO A;  4HM6 B;  1IVX A;  1SQW A;  2PNC A;  2B24 B;  5IG5 A;  2RGQ A;  4G1M B;  2YFI B;  3HII A;  3QRD A;  2GBX B;  1Q42 A;  3NM7 A;  3JUQ A;  4XBY A;  2Q07 A;  1VQP 3;  2HMJ B;  5AEW B;  3X3X A;  2CWU A;  2CFL A;  2P0M A;  2K54 A;  1VZZ A;  5EEO A;  2E2U A;  3FG1 A;  1JKG A;  4FCJ A;  4IPB A;  4AEQ A;  4HM0 B;  5LC7 A;  3WA3 A;  3X42 A;  4HM1 B;  1UI7 A;  1HKX A;  4L8O A;  1ZX2 A;  2KRT A;  4N6T A;  4RNZ A;  4QWT A;  1FGQ A;  4KZ1 A;  1UUW B;  1GY5 A;  3FF0 A;  2W56 A;  4NRE A;  4R4K A;  5FW5 A;  1ULJ B;  4WYK A;  3KKG A;  2FXT A;  3S67 A;  1HU9 A;  6STD A;  4WWU C;  4KFF A;  3LZA A;  1Q40 A;  2OOV C;  2Z77 A;  3BB9 A;  4OUQ A;  3VGN A;  1YJW 3;  1DMM A;  1E97 A;  4N6L A;  2WGQ A;  1YIT 3;  1NO3 A;  1W6C A;  3SLU A;  5IG3 A;  1IQ8 A;  2HML B;  2Y73 A;  5AYR B;  3PS8 A;  2CFW A;  1OCV A;  4EBG A;  4FMD A;  2BT3 A;  4KFE A;  1OPY A;  3FG3 A;  1O7W B;  2XEP A;  5D82 A;  2Z7A A;  5DRV A;  3D9R A;  4N6N B;  1R4C A;  3WOF B;  4HZ9 B;  1C7H A;  3I56 3;  3NXJ A;  3U97 A;  4X2O A;  1YVB I;  3SXX A;  1W2B 2;  3GZR A;  1AV4 A;  1GD4 A;  4RNY A;  4RZM A;  4TX4 A;  1WMN A;  2W0Q A;  2INX A;  2RSX A;  4LGQ A;  1W00 A;  1STD A;  1OF5 B;  2HMO B;  3F40 A;  3NM2 A;  2B1X B;  1WMO A;  2O3O A;  1SJW A;  1D6U A;  1Y4K A;  3MG3 A;  3DGL A;  4HM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...