3NQYA

Crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
174
Chain Sequence
ANKKYLNQQPTINNMVQSNVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 33
structure length 174
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA01
1LVNA 1D6ZA 2CFWA 4EV2A 1SIHA 3NQYA 3WA2X 1IQXA 3N9HA 3X41A 2OQEA 3X3XA 1A2VA 1IVXA 3X42A 3NBJA 4BTXA 1IQYA 1US1A 3X3ZA 1AV4A 4K90B 2WOFA 1IVVA 1AVKA 2C11A 2CFKA 1WMOA 3T0UA 3WA3A 1TU5A 3ALAA 2OOVA 1QALA 1OACA 1IVUA 2E2VA 1W7CA 1W6CA 2YX9A 4EV5A 2WGQA 3AMOA 1KSIA 2WOHA 4BTWA 2ZL8A 3K5TA 3HIIA 1DYUA 2CWUA 2OQEC 3HI7A 1W5ZA 2CG1A 4KFDA 2CFDA 3SXXA 1RJOA 2C10A 1N9EA 2IA7A 1IVWA 3SX1A 2PNCA 1PU4A 2CWTA 3HIGA 1QAKA 3MPHA 3X40A 1UI8A 3NQZA 4BTYA 1W2ZA 3PGBA 1D6YA 1JRQA 2E2TA 1D6UA 1UI7A 2OOVC 1WMNA 2W0QA 4EXRA 1W4NA 2Y74A 1EKMA 2D1WA 2CWVA 3NBBA 1IU7A 2BT3A 4KFEA 1W6GA 1QAFA 2CG0A 2GU3A 2CFGA 1WMPA 2E2UA 2WO0A 2Y73A 3AMOB 5IW9A 1AVLA 3KIIA 4KFFA 1SPUA 2CFLA 2K0MA 1SIIA 1RKYA 3X3YA 3KN4A 3LOYA
chains in the Genus database with same CATH superfamily
1V74A 1LVNA 1VQM3 1GS3A 3GZXB 1MGWA 2L1SA 4XM4A 3U1WA 4MJDA 1IQXA 1GMQA 2GEYA 4HKVB 1GYBA 1GOUA 2CW9A 1HKXA 4R9KA 1E97A 3CNXA 3LTDA 3LMLA 5KP3A 1O7GB 3RGRA 3V98A 1RRHA 3LH4A 1IK3A 2P05A 1Q814 1T5YA 1I0VA 3BIRA 1FGRA 1JZOA 1B2UA 3KCHA 4K1UA 1AV4A 3IJEB 5LC7A 1CYUA 1IVVA 1MWRA 2J8XB 4HBRA 4TX4A 3SEDA 2BMOB 1VQO3 1TU5A 3MWZA 1UDII 2GU1A 1IV9A 2D42A 4XDWA 2HMMB 1GY5A 4OVMA 1UCKA 3D79A 4O3VA 1YJW3 3KSED 1OACA 4NHFA 7RNTA 4MMZB 1W6CA 4HM7B 3AHSA 3KE7A 2YX9A 2RNTA 2YFLB 3GRDA 3S27A 1RGCA 2KF6A 4I5QA 2K3DA 5M1AA 2ZL8A 3D5IA 1ULIB 3STDA 2XSHB 4ZM8A 1RN1A 6GSPA 1N5PA 4GL6A 2OQEC 1ZX2A 1BSBA 3FG4A 3ROBA 1W5ZA 5IEOA 2OTJ3 4N6MA 2QIYA 3NXJA 8CHOA 3SXXA 3CCV3 1RJOA 1QVF2 1BRHA 1RGEA 3FKAA 4WWUC 1TP6A 3CCJ3 1J2BA 1GD4A 3D5GA 1RSNA 4L8PA 3G0KA 3GSPA 2O9UX 3HIGA 1G96A 1E3RA 1B2MA 3NQZA 3VSYA 1V57A 1PFPA 1CEWI 1RGLA 4IT7A 1LXEA 1YNVX 4HYZA 5ELJA 3EB8A 3PGBA 2BU4A 1LOWA 1PYLA 3UNLA 3RDEA 1X1XA 4RNZA 1JRQA 4GHOA 1IV7A 1RNTA 3O8YA 2W0QA 4HJLB 5AEWB 1BGSA 3HX8A 3B7CA 1EEJA 1BNEA 1M1K4 1FYSA 3F8HA 3JVCA 1U8CB 3WODG 3ZFZA 1TRPA 1I0XA 3HK4A 1R4YA 1B3SA 2CK3H 3N54B 2W6JH 1MWSA 2XSOB 5AIGA 2CWVA 2XGNA 1LOYA 1IU7A 1T2HA 4N6LA 2GBXB 4N3VA 1W6GA 1QAFA 3URPA 2RGQA 3BNBA 2XH9A 1EUIC 2CG0A 2GU3A 1LNIA 2CFGA 1WMPA 2ML5A 4WHAA 5BVBA 4R1KA 5IEPA 5AIFA 4LGQA 3CCE3 1O7MB 1IDPA 5LC6A 1WTHA 3F8XA 4BU4A 3OWYA 1BUQA 2IUJA 2R4IA 3BU4A 1SPUA 1RDSA 1TIJA 2CIUA 2CFLA 2K0MA 1DMNA 1BSEA 2MF7A 4ORLA 2KCDA 4AEQA 2XEPA 3ZG0A 1I70A 1N5HA 4KVHA 2FGTA 1BNFA 1VQK3 1DVDA 1YGEA 1DE3A 3LTAA 5AYSC 1OGZA 2CFWA 3G713 3FG3A 2STDA 2CHCA 1I3IA 1TUHA 3BNCA 3GZYB 2V1LA 3FG1A 4GSPA 5DRVA 2OQEA 4O2HA 3X3XA 3MSOA 3BNEA 3LYGA 3NV0B 3AGNA 5CF1A 3MG3A 4H61A 1IT8A 4HOHA 3X42A 3CCM3 1IQYA 1B20A 1RNBA 1WNHA 1G02A 3V99A 4WYKB 1YGWA 3PS8A 1RMSA 5G2GA 1O7PB 1O7WB 3CU3A 5CK6A 3I563 2XGLA 1R4CA 2XFTA 2CX1A 2WGOA 1BNJA 3U97A 4HM6B 2ZDJA 3K0ZA 4K90B 2WOFA 2W04A 4QWTA 3G4S3 2C11A 1YJ93 1N8QA 2CFKA 1RGAA 1RTUA 1UCLA 5AIIA 4AKYA 3LXUX 6STDA 1OF5B 1NNVA 1FZUA 1W00A 2SARA 3OWUA 3NM7A 4FCZA 1C54A 1ROVA 4ILFA 3F14A 1K41A 5EEOA 1RCLA 1ZO2A 1I2GA 1QALA 3KFQC 3QRDA 5JPPA 1UCJA 4X2HA 2W03A 3S28A 1VQL3 1K734 4HM4B 1IVUA 2LQVA 4LZIA 1RGKA 5AEUB 3Q2PA 4EV5A 3WOFB 1MWTA 3WMDA 1I8VA 1TJDA 2XR8B 1STDA 1MNLA 1JKGA 4LEHA 1BSAA 3JUMA 3K5TA 3EJVA 2JDIH 4O02B 1Q864 1RGHA 2CWUA 3ER7A 5FW5A 1VQ53 4BL3A 3M8CA 3T8NA 1BU4A 3FGYA 7STDA 2KF4A 2W2CA 3DUKA 4XBXA 1BRKA 1FGTA 2H0IA 5FGOA 3S5CA 3A76A 3DY5A 2HMKB 3RGAA 4MMYB 3DM8A 1IVWA 3SX1A 2PNCA 3Q3FA 1TFKA 3CCQ3 2HMOB 1FUWA 3FF2A 4HM1B 1NDOB 5ELUA 1AQZA 3E99A 2W9QA 3JUQA 3X40A 1S5AA 3F7XA 2UX0A 5IG3A 1YIT3 5KP1A 3ZG5A 4BTYA 1W2ZA 4CDLA 1OPYA 1Q42A 3CNMA 1D6YA 4G1MB 1BNGA 5IG0A 1IYYA 4AKZA 1NO3A 3I0YA 4HM3B 1YI23 1AY7A 1BSDA 1I3FA 1BNRA 1N8R4 3KZTA 5EQLA 1VZZA 5D83A 4FCMA 1MOLA 4R9LA 1STFI 1K28A 1YJN3 1Q7HA 3NBBA 1VQP3 3Q90A 3SYUA 3EE1A 1UUGB 2FNQA 4HM2B 2XFSA 4NPBA 1VQQA 1X1WA 3SLUA 2IYJA 2OCTA 4FMCA 4XB5A 2WO0A 3AMOB 3DH2A 3EHCA 3SOAA 4EBGA 5IW9A 1T3BA 2C4BA 3H51A 4KZ1A 2SBLA 3MG1A 3G16A 2QGUA 3CPW2 1SIIA 1YIJ3 1HYFA 1LRAA 3LOYA 1HU9A 2IMJA 2YFIB 3GWRA 1ULJB 5CXOA 2AADA 4EV2A 3SVAA 1SIHA 1F8NA 5AIHA 1BAOA 1VQN3 2P09A 3EN8A 2GXFA 1UCIA 1RCKA 3UB1A 6RNTA 3L0RA 1A2VA 3A5EA 4WFOA 1IVXA 1PY3A 3DXOA 4HM0B 1JN5B 3NBJA 4BTXA 4J5GA 1RHLA 3F7SA 2GSPA 1JBTA 1SARA 3JUOA 1BRIA 1UUWB 2F98A 5TGNA 2P0XA 1OHOA 1US1A 1NB5I 2HMNB 3WDGB 1K9M4 2R41A 1FGOA 1M904 1VQ83 3S67A 4RNYA 1OHPA 3OV4A 4LSOA 1AVKA 5CF2A 1I2EA 3FCSB 2KXGA 3T0UA 4HM5B 1BRJA 3EBTA 4JF8A 3WA3A 1OUNA 5EVHA 5IENA 1RRLA 1UW1A 3FF0A 1RN7A 3OXAA 3PZWA 1N9JA 4CPKA 8RNTA 2BHMA 1W02A 1GMRA 3ALAA 2L4VA 1Q40B 1CQSA 2FXTA 3CPOA 1S723 1ISKA 2E2VA 1FGQA 1ROAA 4HZBB 4EYCA 1CH0A 1KQS2 4N6NB 2KRTA 3GZBA 2WOHA 3DGNA 4FMDA 3WR2A 1LOXA 1BNSA 2RSXA 4OK0A 3J7Yd 5RNTA 2UGIA 4L7KA 1FW7A 2F4YA 1FGMA 2CG1A 3OW22 4KFDA 4U13A 2CFDA 5IF6A 1OGXA 3B8LA 2I9WA 1GMPA 4N6V0 2C10A 1W01A 1N9EA 2Z7AA 4Q53A 3G8ZA 1KC84 2IA7A 3EBYA 1BRNL 1UUVB 2CWTA 3N8BA 4N6OB 3SOYA 4HZ9B 3NX0A 4X2OA 1O7HB 1QJGA 3MPHA 1T2IA 3MYTA 1UI8A 3LTCA 3NV0A 1B2ZA 1X1UA 2RFRA 2RBIA 2B1XB 1RGGA 3BNDA 1FA3A 3PYJA 4WYKA 4K61A 1GY7A 2E2TA 4J8TA 1JBSA 2OOVC 3UJMA 1EA2A 1WMNA 4N6UA 1A90A 4XBTA 5D82A 1GSPA 3WOEB 1WQLB 1Z1SA 4EXRA 1KD14 3AGOA 2Z76A 1EKMA 5M18A 2D1WA 1E3VA 4L8OA 1A67A 3RNTA 4JRFA 2Q07A 3CCU3 4FMBA 1OF5A 1TRQA 1UGIA 4FMAA 4KFEA 5KP4A 1K8A4 3DZLA 2B24B 2HMLB 9RNTA 2ZHXB 5GSPA 3UL5A 1FUTA 1VQ63 3FLJA 1BOXA 1BRSA 3OWSA 2E2UA 1YVBI 1NJI4 1X1YA 2ML6A 4GB5A 5DREA 2Y73A 2F86B 1AVLA 3EC9A 3NHXA 1W2B2 4CCVA 2CX0A 1YHQ3 2HOHA 3ECFA 3CC23 3KKGA 3IPTA 1VQ93 3QK9A 2XF3A 3VF1A 5I97A 3EN1B 3AHWA 1W6YA 3DGOA 3K7CA 3EQQB 1D6ZA 4LMIA 3CC73 3NQYA 1V58A 2XRXB 3WA2X 1EG9B 3WHOA 4BL2A 3N9HA 4H3UA 4CJNA 1IT7A 4DKIA 1LQMB 3S29A 2IY2A 1FUSA 4R80A 2HMJB 4OUQA 3X41A 3B4PA 2UUGC 2CH9A 2BNGA 2K54A 4EW5A 5BXQA 1JBRA 3DMCA 1NU3A 4K1VA 2BO9B 5G1KA 3JUPA 2KF5A 3FH1A 2OTL3 2F5MA 3NUVA 4XBYA 5IERA 3CD63 1GD3A 3X3ZA 3MG2A 1MWUA 3Q1CA 2CKFB 3IMAB 4IIAA 1BIRA 1BANA 4EC6A 4MMXB 1OCVA 5STDA 1QMAA 2W56B 3EF8A 5BIRA 1WMOA 2Z77A 3MHEA 1DVCA 1JV2B 4KT3B 2H0HA 4MEIA 3LTBA 4RNTA 1I2FA 3CMA3 3NBRA 4XDVA 5A0OB 2H0GA 1B21A 3JUNA 2F56A 5CLKA 2OOVA 1OHSA 3LZAA 3DGYA 4BIRA 1TTOA 3G6E3 2KAAA 1YVSA 1W7CA 3F40A 3F9SA 1VQ73 3HZPA 1JJ22 3I553 1BRGA 5HGRA 1L5GB 5JBSA 4FCJA 2WGQA 3FZWA 3KSPA 1UGHI 1KSIA 3AMOA 3FSDA 1RGFA 2P38A 4BTWA 1LQGC 4N6TA 2GBWB 1ASKA 1ZGXA 3EX9A 4J9AA 4R4KA 2F5WA 2BIRA 1KWIA 1DYUA 2LYXA 2ZA4A 1AR0A 3HIIA 2MC8A 5M19A 1U5OA 2QEX3 3HI7A 2W56A 1JB2A 3HOHA 1TFOA 1GY6A 5IG5A 3D3LA 3T8UA 3CCS3 2O3OA 7GSPA 3NM2A 1JB4A 2INXA 1PU4A 1LOVA 1MGRA 1QAKA 1SJWA 2CC3A 3VGNA 2BMRB 5AYRB 3DGMA 1A2PA 4HVNA 1A2KA 1BSCA 3PCSA 5IG4A 3GAXA 1JN5A 4I4KA 2Z6BA 1C7HA 3LT8A 4LYLB 1VQ43 1RLSA 1BUJA 2M7OA 1OH0A 2RCDA 1BVIA 5AI1A 1D6UA 2QA43 1UI7A 5BU4A 3D4AA 2A15A 3BB9A 1QVG2 1Q9EA 1O7NB 3BLZA 1DETA 3D9RA 5HOHA 1GOVA 1W4NA 3MKIA 4HAAA 3CCR3 1Q824 1NB3I 2Y74A 4WP5A 3CCL3 2OWPA 1CYVA 1DMMA 4NREA 3V92A 3B4OA 2BT3A 1EQKA 3H3HA 3OX9A 2P0MA 1RN4A 1HZ1A 4J5KA 1B2SA 3GZRA 3CXC2 2YFJB 1SQWA 1Q40A 4IPBA 1G0TA 3K63A 2PZVA 1NWWA 1JB5A 1JZDA 1JNQA 5JPUA 4HM8B 3K9MC 3UL6A 1GOYA 1BNIA 3LT9A 1DMQA 3PCRA 2AAEA 1JKGB 1Q7Y4 4FR9A 3DGLA 4O8SA 3KIIA 3PXMA 2KF3A 4KFFA 1M1XB 4RZMA 2BMQB 1Y4KA 2GEXA 2W9PA 3CME3 2JQ5A 1B27A 1LNHA 5G1LA 4STDA 5D81A 4PEJA 1ZS7A 1RKYA 3X3YA 3KN4A 1IQ8A 1B2XA 2IUKA 1M9GA 3CC43 4RBNA 3TDGA 2F99A
chains in the Genus database with same CATH topology
1V74A 1LVNA 1VQM3 1GS3A 3GZXB 4XM4A 3U1WA 4MJDA 1IQXA 2GEYA 4HKVB 1GYBA 2CW9A 1HKXA 4R9KA 1E97A 3CNXA 3LTDA 3LMLA 5KP3A 1O7GB 3RGRA 3V98A 1RRHA 3LH4A 1IK3A 2P05A 1Q814 1T5YA 1FGRA 4K1UA 1AV4A 3IJEB 5LC7A 1CYUA 1IVVA 4HBRA 4TX4A 3SEDA 2BMOB 1VQO3 1TU5A 3MWZA 2GU1A 1IV9A 2D42A 4XDWA 2HMMB 1GY5A 4OVMA 1YJW3 4O3VA 3KSED 1OACA 4NHFA 4MMZB 1W6CA 4HM7B 3KE7A 2YX9A 2YFLB 3GRDA 3S27A 2ZL8A 4ZM8A 1ULIB 3STDA 2XSHB 1N5PA 4GL6A 2OQEC 1ZX2A 3ROBA 3FG4A 1W5ZA 5IEOA 2OTJ3 4N6MA 2QIYA 3NXJA 8CHOA 3SXXA 3CCV3 1RJOA 1QVF2 3FKAA 4WWUC 1TP6A 3CCJ3 1J2BA 1GD4A 4L8PA 3G0KA 3HIGA 2O9UX 1G96A 1E3RA 3NQZA 3VSYA 1PFPA 1CEWI 4IT7A 1LXEA 4HYZA 5ELJA 3EB8A 3PGBA 3UNLA 3RDEA 4RNZA 1JRQA 1IV7A 3O8YA 2W0QA 4HJLB 5AEWB 3HX8A 3B7CA 1M1K4 3JVCA 3F8HA 3WODG 1U8CB 3HK4A 2CK3H 3N54B 2W6JH 2XSOB 5AIGA 2CWVA 2XGNA 1IU7A 4N6LA 2GBXB 4N3VA 1W6GA 1QAFA 2RGQA 3BNBA 2XH9A 2CG0A 2GU3A 2CFGA 1WMPA 2ML5A 4WHAA 5BVBA 4R1KA 5IEPA 5AIFA 4LGQA 3CCE3 1O7MB 1IDPA 5LC6A 1WTHA 3F8XA 3OWYA 1BUQA 2IUJA 2R4IA 1SPUA 2CIUA 1TIJA 2CFLA 2K0MA 1DMNA 2MF7A 4ORLA 2KCDA 4AEQA 2XEPA 1N5HA 4KVHA 2FGTA 1VQK3 1DVDA 1YGEA 3LTAA 5AYSC 1OGZA 2CFWA 3G713 3FG3A 2STDA 2CHCA 1TUHA 3BNCA 3GZYB 2V1LA 3FG1A 5DRVA 2OQEA 4O2HA 3X3XA 3MSOA 3BNEA 3LYGA 3NV0B 5CF1A 3MG3A 4H61A 1IT8A 3X42A 3CCM3 1IQYA 1WNHA 3V99A 4WYKB 3PS8A 5G2GA 1O7PB 1O7WB 3CU3A 5CK6A 3I563 2XGLA 1R4CA 2XFTA 2WGOA 3U97A 4HM6B 2ZDJA 3K0ZA 4K90B 2WOFA 2W04A 4QWTA 3G4S3 2C11A 1YJ93 1N8QA 2CFKA 5AIIA 4AKYA 3LXUX 6STDA 1OF5B 1W00A 3OWUA 3NM7A 4FCZA 1ROVA 3F14A 1K41A 5EEOA 3KFQC 1ZO2A 1QALA 3QRDA 5JPPA 4X2HA 3S28A 2W03A 1VQL3 1K734 4HM4B 1IVUA 2LQVA 4LZIA 5AEUB 3Q2PA 4EV5A 3WOFB 3WMDA 2XR8B 1STDA 1MNLA 1JKGA 4LEHA 3JUMA 3K5TA 3EJVA 2JDIH 4O02B 1Q864 2CWUA 3ER7A 5FW5A 1VQ53 3M8CA 3T8NA 3FGYA 7STDA 2W2CA 3DUKA 4XBXA 3S5CA 1FGTA 5FGOA 3A76A 3DY5A 2HMKB 3RGAA 4MMYB 3DM8A 1IVWA 3SX1A 2PNCA 3CCQ3 1TFKA 2HMOB 1FUWA 3FF2A 4HM1B 1NDOB 5ELUA 3E99A 2W9QA 3JUQA 3X40A 1S5AA 3F7XA 2UX0A 5IG3A 1YIT3 5KP1A 4BTYA 1W2ZA 4CDLA 1OPYA 1Q42A 3CNMA 1D6YA 4G1MB 5IG0A 4AKZA 1NO3A 3I0YA 4HM3B 1YI23 1N8R4 3KZTA 5EQLA 1VZZA 5D83A 4FCMA 1MOLA 4R9LA 1STFI 1K28A 1YJN3 3NBBA 1VQP3 3Q90A 3EE1A 2FNQA 4HM2B 2XFSA 3SLUA 2OCTA 4FMCA 4XB5A 2WO0A 3AMOB 3EHCA 3SOAA 4EBGA 5IW9A 3H51A 4KZ1A 2SBLA 3MG1A 3G16A 2QGUA 3CPW2 1SIIA 1YIJ3 3LOYA 1HU9A 2IMJA 2YFIB 3GWRA 1ULJB 5CXOA 4EV2A 3SVAA 1SIHA 1F8NA 5AIHA 1VQN3 2P09A 3EN8A 2GXFA 3UB1A 3L0RA 1A2VA 4WFOA 1IVXA 3DXOA 4HM0B 1JN5B 3NBJA 4BTXA 3F7SA 3JUOA 1UUWB 2F98A 5TGNA 2P0XA 1OHOA 1US1A 1NB5I 2HMNB 3WDGB 1K9M4 1FGOA 1M904 1VQ83 3S67A 4RNYA 1OHPA 3OV4A 4LSOA 1AVKA 5CF2A 3FCSB 2KXGA 3T0UA 4HM5B 3WA3A 3EBTA 4JF8A 1OUNA 5EVHA 5IENA 1RRLA 1UW1A 3FF0A 1RN7A 3OXAA 3PZWA 1N9JA 2BHMA 1W02A 3ALAA 2L4VA 1Q40B 1CQSA 2FXTA 3CPOA 1S723 1ISKA 2E2VA 1FGQA 1ROAA 4HZBB 4EYCA 1KQS2 4N6NB 2KRTA 3GZBA 2WOHA 3DGNA 4FMDA 1LOXA 2RSXA 4OK0A 3J7Yd 4L7KA 1FGMA 2CG1A 3OW22 4KFDA 4U13A 2CFDA 5IF6A 1OGXA 3B8LA 2I9WA 4N6V0 2C10A 1W01A 1N9EA 2Z7AA 4Q53A 3G8ZA 1KC84 2IA7A 3EBYA 1UUVB 2CWTA 3N8BA 4N6OB 3SOYA 4HZ9B 3NX0A 4X2OA 1O7HB 1QJGA 3MPHA 3MYTA 1UI8A 3LTCA 3NV0A 2RFRA 2B1XB 3BNDA 1FA3A 3PYJA 4WYKA 4K61A 1GY7A 2E2TA 4J8TA 2OOVC 3UJMA 1EA2A 1WMNA 4N6UA 1A90A 4XBTA 5D82A 3WOEB 1WQLB 1Z1SA 4EXRA 1KD14 2Z76A 1EKMA 1A67A 2D1WA 1E3VA 4L8OA 3CCU3 4JRFA 2Q07A 4FMBA 1OF5A 4FMAA 4KFEA 5KP4A 1K8A4 3DZLA 2B24B 2HMLB 3UL5A 1VQ63 3FLJA 3OWSA 2E2UA 1YVBI 1NJI4 2ML6A 4GB5A 5DREA 2Y73A 2F86B 1AVLA 3EC9A 3NHXA 1W2B2 4CCVA 1YHQ3 3ECFA 3CC23 3KKGA 3IPTA 1VQ93 3QK9A 2XF3A 3VF1A 5I97A 3EN1B 1W6YA 3DGOA 3K7CA 3EQQB 1D6ZA 4LMIA 3CC73 3NQYA 2XRXB 3WA2X 1EG9B 3N9HA 4H3UA 1IT7A 3S29A 4R80A 2HMJB 4OUQA 3X41A 3B4PA 2CH9A 2BNGA 2K54A 5BXQA 3DMCA 1NU3A 4K1VA 2BO9B 3JUPA 3FH1A 2OTL3 3CD63 3NUVA 4XBYA 5IERA 1GD3A 3X3ZA 3MG2A 4IIAA 3Q1CA 2CKFB 3IMAB 4EC6A 4MMXB 1OCVA 5STDA 1QMAA 2W56B 3EF8A 1WMOA 2Z77A 3MHEA 1DVCA 1JV2B 4MEIA 3LTBA 3CMA3 3NBRA 4XDVA 5A0OB 3JUNA 2OOVA 5CLKA 1OHSA 3LZAA 3G6E3 1W7CA 3F40A 3F9SA 1VQ73 3HZPA 1JJ22 3I553 5HGRA 1L5GB 5JBSA 4FCJA 2WGQA 3FZWA 3KSPA 3AMOA 1KSIA 3FSDA 4BTWA 2P38A 4N6TA 2GBWB 1ASKA 3EX9A 4J9AA 4R4KA 3HIIA 1KWIA 1DYUA 2LYXA 2MC8A 1AR0A 1U5OA 2QEX3 3HI7A 2W56A 1JB2A 1TFOA 1GY6A 5IG5A 3D3LA 3T8UA 3CCS3 2O3OA 3NM2A 1JB4A 2INXA 1PU4A 1SJWA 1QAKA 2CC3A 3VGNA 2BMRB 5AYRB 3DGMA 4HVNA 1A2KA 3PCSA 5IG4A 3GAXA 1JN5A 4I4KA 2Z6BA 1C7HA 3LT8A 1VQ43 2M7OA 1OH0A 2RCDA 5AI1A 1D6UA 2QA43 1UI7A 2A15A 3BB9A 1QVG2 1O7NB 3BLZA 3D9RA 1Q824 1W4NA 3MKIA 3CCR3 1NB3I 2Y74A 4WP5A 3CCL3 2OWPA 1CYVA 1DMMA 4NREA 3V92A 3B4OA 2BT3A 1EQKA 3H3HA 3OX9A 2P0MA 3GZRA 3CXC2 2YFJB 1SQWA 1Q40A 4IPBA 3K63A 2PZVA 1NWWA 1JB5A 5JPUA 1JNQA 4HM8B 3K9MC 3UL6A 3LT9A 1DMQA 3PCRA 1Q7Y4 1JKGB 4FR9A 3DGLA 4O8SA 3KIIA 3PXMA 4KFFA 1M1XB 4RZMA 2BMQB 2W9PA 1Y4KA 2GEXA 3CME3 2JQ5A 1LNHA 4STDA 5D81A 4PEJA 1RKYA 3X3YA 3KN4A 1IQ8A 2IUKA 3CC43 1M9GA 4RBNA 3TDGA 2F99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVN A;  1D6Z A;  2CFW A;  4EV2 A;  1SIH A;  3NQY A;  3WA2 X;  1IQX A;  3N9H A;  3X41 A;  2OQE A;  3X3X A;  1A2V A;  1IVX A;  3X42 A;  3NBJ A;  4BTX A;  1IQY A;  1US1 A;  3X3Z A;  1AV4 A;  4K90 B;  2WOF A;  1IVV A;  1AVK A;  2C11 A;  2CFK A;  1WMO A;  3T0U A;  3WA3 A;  1TU5 A;  3ALA A;  2OOV A;  1QAL A;  1OAC A;  1IVU A;  2E2V A;  1W7C A;  1W6C A;  2YX9 A;  4EV5 A;  2WGQ A;  3AMO A;  1KSI A;  2WOH A;  4BTW A;  2ZL8 A;  3K5T A;  3HII A;  1DYU A;  2CWU A;  2OQE C;  3HI7 A;  1W5Z A;  2CG1 A;  4KFD A;  2CFD A;  3SXX A;  1RJO A;  2C10 A;  1N9E A;  2IA7 A;  1IVW A;  3SX1 A;  2PNC A;  1PU4 A;  2CWT A;  3HIG A;  1QAK A;  3MPH A;  3X40 A;  1UI8 A;  3NQZ A;  4BTY A;  1W2Z A;  3PGB A;  1D6Y A;  1JRQ A;  2E2T A;  1D6U A;  1UI7 A;  2OOV C;  1WMN A;  2W0Q A;  4EXR A;  1W4N A;  2Y74 A;  1EKM A;  2D1W A;  2CWV A;  3NBB A;  1IU7 A;  2BT3 A;  4KFE A;  1W6G A;  1QAF A;  2CG0 A;  2GU3 A;  2CFG A;  1WMP A;  2E2U A;  2WO0 A;  2Y73 A;  3AMO B;  5IW9 A;  1AVL A;  3KII A;  4KFF A;  1SPU A;  2CFL A;  2K0M A;  1SII A;  1RKY A;  3X3Y A;  3KN4 A;  3LOY A; 
#chains in the Genus database with same CATH topology
 1V74 A;  1LVN A;  1VQM 3;  1GS3 A;  3GZX B;  1MGW A;  2L1S A;  4XM4 A;  3U1W A;  4MJD A;  1IQX A;  1GMQ A;  2GEY A;  4HKV B;  1GYB A;  1GOU A;  2CW9 A;  1HKX A;  4R9K A;  1E97 A;  3CNX A;  3LTD A;  3LML A;  5KP3 A;  1O7G B;  3RGR A;  3V98 A;  1RRH A;  3LH4 A;  1IK3 A;  2P05 A;  1Q81 4;  1T5Y A;  1I0V A;  3BIR A;  1FGR A;  1JZO A;  1B2U A;  3KCH A;  4K1U A;  1AV4 A;  3IJE B;  5LC7 A;  1CYU A;  1IVV A;  1MWR A;  2J8X B;  4HBR A;  4TX4 A;  3SED A;  2BMO B;  1VQO 3;  1TU5 A;  3MWZ A;  1UDI I;  2GU1 A;  1IV9 A;  2D42 A;  4XDW A;  2HMM B;  1GY5 A;  4OVM A;  1UCK A;  3D79 A;  4O3V A;  1YJW 3;  3KSE D;  1OAC A;  4NHF A;  7RNT A;  4MMZ B;  1W6C A;  4HM7 B;  3AHS A;  3KE7 A;  2YX9 A;  2RNT A;  2YFL B;  3GRD A;  3S27 A;  1RGC A;  2KF6 A;  4I5Q A;  2K3D A;  5M1A A;  2ZL8 A;  3D5I A;  1ULI B;  3STD A;  2XSH B;  4ZM8 A;  1RN1 A;  6GSP A;  1N5P A;  4GL6 A;  2OQE C;  1ZX2 A;  1BSB A;  3FG4 A;  3ROB A;  1W5Z A;  5IEO A;  2OTJ 3;  4N6M A;  2QIY A;  3NXJ A;  8CHO A;  3SXX A;  3CCV 3;  1RJO A;  1QVF 2;  1BRH A;  1RGE A;  3FKA A;  4WWU C;  1TP6 A;  3CCJ 3;  1J2B A;  1GD4 A;  3D5G A;  1RSN A;  4L8P A;  3G0K A;  3GSP A;  2O9U X;  3HIG A;  1G96 A;  1E3R A;  1B2M A;  3NQZ A;  3VSY A;  1V57 A;  1PFP A;  1CEW I;  1RGL A;  4IT7 A;  1LXE A;  1YNV X;  4HYZ A;  5ELJ A;  3EB8 A;  3PGB A;  2BU4 A;  1LOW A;  1PYL A;  3UNL A;  3RDE A;  1X1X A;  4RNZ A;  1JRQ A;  4GHO A;  1IV7 A;  1RNT A;  3O8Y A;  2W0Q A;  4HJL B;  5AEW B;  1BGS A;  3HX8 A;  3B7C A;  1EEJ A;  1BNE A;  1M1K 4;  1FYS A;  3F8H A;  3JVC A;  1U8C B;  3WOD G;  3ZFZ A;  1TRP A;  1I0X A;  3HK4 A;  1R4Y A;  1B3S A;  2CK3 H;  3N54 B;  2W6J H;  1MWS A;  2XSO B;  5AIG A;  2CWV A;  2XGN A;  1LOY A;  1IU7 A;  1T2H A;  4N6L A;  2GBX B;  4N3V A;  1W6G A;  1QAF A;  3URP A;  2RGQ A;  3BNB A;  2XH9 A;  1EUI C;  2CG0 A;  2GU3 A;  1LNI A;  2CFG A;  1WMP A;  2ML5 A;  4WHA A;  5BVB A;  4R1K A;  5IEP A;  5AIF A;  4LGQ A;  3CCE 3;  1O7M B;  1IDP A;  5LC6 A;  1WTH A;  3F8X A;  4BU4 A;  3OWY A;  1BUQ A;  2IUJ A;  2R4I A;  3BU4 A;  1SPU A;  1RDS A;  1TIJ A;  2CIU A;  2CFL A;  2K0M A;  1DMN A;  1BSE A;  2MF7 A;  4ORL A;  2KCD A;  4AEQ A;  2XEP A;  3ZG0 A;  1I70 A;  1N5H A;  4KVH A;  2FGT A;  1BNF A;  1VQK 3;  1DVD A;  1YGE A;  1DE3 A;  3LTA A;  5AYS C;  1OGZ A;  2CFW A;  3G71 3;  3FG3 A;  2STD A;  2CHC A;  1I3I A;  1TUH A;  3BNC A;  3GZY B;  2V1L A;  3FG1 A;  4GSP A;  5DRV A;  2OQE A;  4O2H A;  3X3X A;  3MSO A;  3BNE A;  3LYG A;  3NV0 B;  3AGN A;  5CF1 A;  3MG3 A;  4H61 A;  1IT8 A;  4HOH A;  3X42 A;  3CCM 3;  1IQY A;  1B20 A;  1RNB A;  1WNH A;  1G02 A;  3V99 A;  4WYK B;  1YGW A;  3PS8 A;  1RMS A;  5G2G A;  1O7P B;  1O7W B;  3CU3 A;  5CK6 A;  3I56 3;  2XGL A;  1R4C A;  2XFT A;  2CX1 A;  2WGO A;  1BNJ A;  3U97 A;  4HM6 B;  2ZDJ A;  3K0Z A;  4K90 B;  2WOF A;  2W04 A;  4QWT A;  3G4S 3;  2C11 A;  1YJ9 3;  1N8Q A;  2CFK A;  1RGA A;  1RTU A;  1UCL A;  5AII A;  4AKY A;  3LXU X;  6STD A;  1OF5 B;  1NNV A;  1FZU A;  1W00 A;  2SAR A;  3OWU A;  3NM7 A;  4FCZ A;  1C54 A;  1ROV A;  4ILF A;  3F14 A;  1K41 A;  5EEO A;  1RCL A;  1ZO2 A;  1I2G A;  1QAL A;  3KFQ C;  3QRD A;  5JPP A;  1UCJ A;  4X2H A;  2W03 A;  3S28 A;  1VQL 3;  1K73 4;  4HM4 B;  1IVU A;  2LQV A;  4LZI A;  1RGK A;  5AEU B;  3Q2P A;  4EV5 A;  3WOF B;  1MWT A;  3WMD A;  1I8V A;  1TJD A;  2XR8 B;  1STD A;  1MNL A;  1JKG A;  4LEH A;  1BSA A;  3JUM A;  3K5T A;  3EJV A;  2JDI H;  4O02 B;  1Q86 4;  1RGH A;  2CWU A;  3ER7 A;  5FW5 A;  1VQ5 3;  4BL3 A;  3M8C A;  3T8N A;  1BU4 A;  3FGY A;  7STD A;  2KF4 A;  2W2C A;  3DUK A;  4XBX A;  1BRK A;  1FGT A;  2H0I A;  5FGO A;  3S5C A;  3A76 A;  3DY5 A;  2HMK B;  3RGA A;  4MMY B;  3DM8 A;  1IVW A;  3SX1 A;  2PNC A;  3Q3F A;  1TFK A;  3CCQ 3;  2HMO B;  1FUW A;  3FF2 A;  4HM1 B;  1NDO B;  5ELU A;  1AQZ A;  3E99 A;  2W9Q A;  3JUQ A;  3X40 A;  1S5A A;  3F7X A;  2UX0 A;  5IG3 A;  1YIT 3;  5KP1 A;  3ZG5 A;  4BTY A;  1W2Z A;  4CDL A;  1OPY A;  1Q42 A;  3CNM A;  1D6Y A;  4G1M B;  1BNG A;  5IG0 A;  1IYY A;  4AKZ A;  1NO3 A;  3I0Y A;  4HM3 B;  1YI2 3;  1AY7 A;  1BSD A;  1I3F A;  1BNR A;  1N8R 4;  3KZT A;  5EQL A;  1VZZ A;  5D83 A;  4FCM A;  1MOL A;  4R9L A;  1STF I;  1K28 A;  1YJN 3;  1Q7H A;  3NBB A;  1VQP 3;  3Q90 A;  3SYU A;  3EE1 A;  1UUG B;  2FNQ A;  4HM2 B;  2XFS A;  4NPB A;  1VQQ A;  1X1W A;  3SLU A;  2IYJ A;  2OCT A;  4FMC A;  4XB5 A;  2WO0 A;  3AMO B;  3DH2 A;  3EHC A;  3SOA A;  4EBG A;  5IW9 A;  1T3B A;  2C4B A;  3H51 A;  4KZ1 A;  2SBL A;  3MG1 A;  3G16 A;  2QGU A;  3CPW 2;  1SII A;  1YIJ 3;  1HYF A;  1LRA A;  3LOY A;  1HU9 A;  2IMJ A;  2YFI B;  3GWR A;  1ULJ B;  5CXO A;  2AAD A;  4EV2 A;  3SVA A;  1SIH A;  1F8N A;  5AIH A;  1BAO A;  1VQN 3;  2P09 A;  3EN8 A;  2GXF A;  1UCI A;  1RCK A;  3UB1 A;  6RNT A;  3L0R A;  1A2V A;  3A5E A;  4WFO A;  1IVX A;  1PY3 A;  3DXO A;  4HM0 B;  1JN5 B;  3NBJ A;  4BTX A;  4J5G A;  1RHL A;  3F7S A;  2GSP A;  1JBT A;  1SAR A;  3JUO A;  1BRI A;  1UUW B;  2F98 A;  5TGN A;  2P0X A;  1OHO A;  1US1 A;  1NB5 I;  2HMN B;  3WDG B;  1K9M 4;  2R41 A;  1FGO A;  1M90 4;  1VQ8 3;  3S67 A;  4RNY A;  1OHP A;  3OV4 A;  4LSO A;  1AVK A;  5CF2 A;  1I2E A;  3FCS B;  2KXG A;  3T0U A;  4HM5 B;  1BRJ A;  3EBT A;  4JF8 A;  3WA3 A;  1OUN A;  5EVH A;  5IEN A;  1RRL A;  1UW1 A;  3FF0 A;  1RN7 A;  3OXA A;  3PZW A;  1N9J A;  4CPK A;  8RNT A;  2BHM A;  1W02 A;  1GMR A;  3ALA A;  2L4V A;  1Q40 B;  1CQS A;  2FXT A;  3CPO A;  1S72 3;  1ISK A;  2E2V A;  1FGQ A;  1ROA A;  4HZB B;  4EYC A;  1CH0 A;  1KQS 2;  4N6N B;  2KRT A;  3GZB A;  2WOH A;  3DGN A;  4FMD A;  3WR2 A;  1LOX A;  1BNS A;  2RSX A;  4OK0 A;  3J7Y d;  5RNT A;  2UGI A;  4L7K A;  1FW7 A;  2F4Y A;  1FGM A;  2CG1 A;  3OW2 2;  4KFD A;  4U13 A;  2CFD A;  5IF6 A;  1OGX A;  3B8L A;  2I9W A;  1GMP A;  4N6V 0;  2C10 A;  1W01 A;  1N9E A;  2Z7A A;  4Q53 A;  3G8Z A;  1KC8 4;  2IA7 A;  3EBY A;  1BRN L;  1UUV B;  2CWT A;  3N8B A;  4N6O B;  3SOY A;  4HZ9 B;  3NX0 A;  4X2O A;  1O7H B;  1QJG A;  3MPH A;  1T2I A;  3MYT A;  1UI8 A;  3LTC A;  3NV0 A;  1B2Z A;  1X1U A;  2RFR A;  2RBI A;  2B1X B;  1RGG A;  3BND A;  1FA3 A;  3PYJ A;  4WYK A;  4K61 A;  1GY7 A;  2E2T A;  4J8T A;  1JBS A;  2OOV C;  3UJM A;  1EA2 A;  1WMN A;  4N6U A;  1A90 A;  4XBT A;  5D82 A;  1GSP A;  3WOE B;  1WQL B;  1Z1S A;  4EXR A;  1KD1 4;  3AGO A;  2Z76 A;  1EKM A;  5M18 A;  2D1W A;  1E3V A;  4L8O A;  1A67 A;  3RNT A;  4JRF A;  2Q07 A;  3CCU 3;  4FMB A;  1OF5 A;  1TRQ A;  1UGI A;  4FMA A;  4KFE A;  5KP4 A;  1K8A 4;  3DZL A;  2B24 B;  2HML B;  9RNT A;  2ZHX B;  5GSP A;  3UL5 A;  1FUT A;  1VQ6 3;  3FLJ A;  1BOX A;  1BRS A;  3OWS A;  2E2U A;  1YVB I;  1NJI 4;  1X1Y A;  2ML6 A;  4GB5 A;  5DRE A;  2Y73 A;  2F86 B;  1AVL A;  3EC9 A;  3NHX A;  1W2B 2;  4CCV A;  2CX0 A;  1YHQ 3;  2HOH A;  3ECF A;  3CC2 3;  3KKG A;  3IPT A;  1VQ9 3;  3QK9 A;  2XF3 A;  3VF1 A;  5I97 A;  3EN1 B;  3AHW A;  1W6Y A;  3DGO A;  3K7C A;  3EQQ B;  1D6Z A;  4LMI A;  3CC7 3;  3NQY A;  1V58 A;  2XRX B;  3WA2 X;  1EG9 B;  3WHO A;  4BL2 A;  3N9H A;  4H3U A;  4CJN A;  1IT7 A;  4DKI A;  1LQM B;  3S29 A;  2IY2 A;  1FUS A;  4R80 A;  2HMJ B;  4OUQ A;  3X41 A;  3B4P A;  2UUG C;  2CH9 A;  2BNG A;  2K54 A;  4EW5 A;  5BXQ A;  1JBR A;  3DMC A;  1NU3 A;  4K1V A;  2BO9 B;  5G1K A;  3JUP A;  2KF5 A;  3FH1 A;  2OTL 3;  2F5M A;  3NUV A;  4XBY A;  5IER A;  3CD6 3;  1GD3 A;  3X3Z A;  3MG2 A;  1MWU A;  3Q1C A;  2CKF B;  3IMA B;  4IIA A;  1BIR A;  1BAN A;  4EC6 A;  4MMX B;  1OCV A;  5STD A;  1QMA A;  2W56 B;  3EF8 A;  5BIR A;  1WMO A;  2Z77 A;  3MHE A;  1DVC A;  1JV2 B;  4KT3 B;  2H0H A;  4MEI A;  3LTB A;  4RNT A;  1I2F A;  3CMA 3;  3NBR A;  4XDV A;  5A0O B;  2H0G A;  1B21 A;  3JUN A;  2F56 A;  5CLK A;  2OOV A;  1OHS A;  3LZA A;  3DGY A;  4BIR A;  1TTO A;  3G6E 3;  2KAA A;  1YVS A;  1W7C A;  3F40 A;  3F9S A;  1VQ7 3;  3HZP A;  1JJ2 2;  3I55 3;  1BRG A;  5HGR A;  1L5G B;  5JBS A;  4FCJ A;  2WGQ A;  3FZW A;  3KSP A;  1UGH I;  1KSI A;  3AMO A;  3FSD A;  1RGF A;  2P38 A;  4BTW A;  1LQG C;  4N6T A;  2GBW B;  1ASK A;  1ZGX A;  3EX9 A;  4J9A A;  4R4K A;  2F5W A;  2BIR A;  1KWI A;  1DYU A;  2LYX A;  2ZA4 A;  1AR0 A;  3HII A;  2MC8 A;  5M19 A;  1U5O A;  2QEX 3;  3HI7 A;  2W56 A;  1JB2 A;  3HOH A;  1TFO A;  1GY6 A;  5IG5 A;  3D3L A;  3T8U A;  3CCS 3;  2O3O A;  7GSP A;  3NM2 A;  1JB4 A;  2INX A;  1PU4 A;  1LOV A;  1MGR A;  1QAK A;  1SJW A;  2CC3 A;  3VGN A;  2BMR B;  5AYR B;  3DGM A;  1A2P A;  4HVN A;  1A2K A;  1BSC A;  3PCS A;  5IG4 A;  3GAX A;  1JN5 A;  4I4K A;  2Z6B A;  1C7H A;  3LT8 A;  4LYL B;  1VQ4 3;  1RLS A;  1BUJ A;  2M7O A;  1OH0 A;  2RCD A;  1BVI A;  5AI1 A;  1D6U A;  2QA4 3;  1UI7 A;  5BU4 A;  3D4A A;  2A15 A;  3BB9 A;  1QVG 2;  1Q9E A;  1O7N B;  3BLZ A;  1DET A;  3D9R A;  5HOH A;  1GOV A;  1W4N A;  3MKI A;  4HAA A;  3CCR 3;  1Q82 4;  1NB3 I;  2Y74 A;  4WP5 A;  3CCL 3;  2OWP A;  1CYV A;  1DMM A;  4NRE A;  3V92 A;  3B4O A;  2BT3 A;  1EQK A;  3H3H A;  3OX9 A;  2P0M A;  1RN4 A;  1HZ1 A;  4J5K A;  1B2S A;  3GZR A;  3CXC 2;  2YFJ B;  1SQW A;  1Q40 A;  4IPB A;  1G0T A;  3K63 A;  2PZV A;  1NWW A;  1JB5 A;  1JZD A;  1JNQ A;  5JPU A;  4HM8 B;  3K9M C;  3UL6 A;  1GOY A;  1BNI A;  3LT9 A;  1DMQ A;  3PCR A;  2AAE A;  1JKG B;  1Q7Y 4;  4FR9 A;  3DGL A;  4O8S A;  3KII A;  3PXM A;  2KF3 A;  4KFF A;  1M1X B;  4RZM A;  2BMQ B;  1Y4K A;  2GEX A;  2W9P A;  3CME 3;  2JQ5 A;  1B27 A;  1LNH A;  5G1L A;  4STD A;  5D81 A;  4PEJ A;  1ZS7 A;  1RKY A;  3X3Y A;  3KN4 A;  1IQ8 A;  1B2X A;  2IUK A;  1M9G A;  3CC4 3;  4RBN A;  3TDG A;  2F99 A; 
#chains in the Genus database with same CATH homology
 1V74 A;  1LVN A;  1VQM 3;  1GS3 A;  3GZX B;  4XM4 A;  3U1W A;  4MJD A;  1IQX A;  2GEY A;  4HKV B;  1GYB A;  2CW9 A;  1HKX A;  4R9K A;  1E97 A;  3CNX A;  3LTD A;  3LML A;  5KP3 A;  1O7G B;  3RGR A;  3V98 A;  1RRH A;  3LH4 A;  1IK3 A;  2P05 A;  1Q81 4;  1T5Y A;  1FGR A;  4K1U A;  1AV4 A;  3IJE B;  5LC7 A;  1CYU A;  1IVV A;  4HBR A;  4TX4 A;  3SED A;  2BMO B;  1VQO 3;  1TU5 A;  3MWZ A;  2GU1 A;  1IV9 A;  2D42 A;  4XDW A;  2HMM B;  1GY5 A;  4OVM A;  1YJW 3;  4O3V A;  3KSE D;  1OAC A;  4NHF A;  4MMZ B;  1W6C A;  4HM7 B;  3KE7 A;  2YX9 A;  2YFL B;  3GRD A;  3S27 A;  2ZL8 A;  4ZM8 A;  1ULI B;  3STD A;  2XSH B;  1N5P A;  4GL6 A;  2OQE C;  1ZX2 A;  3ROB A;  3FG4 A;  1W5Z A;  5IEO A;  2OTJ 3;  4N6M A;  2QIY A;  3NXJ A;  8CHO A;  3SXX A;  3CCV 3;  1RJO A;  1QVF 2;  3FKA A;  4WWU C;  1TP6 A;  3CCJ 3;  1J2B A;  1GD4 A;  4L8P A;  3G0K A;  3HIG A;  2O9U X;  1G96 A;  1E3R A;  3NQZ A;  3VSY A;  1PFP A;  1CEW I;  4IT7 A;  1LXE A;  4HYZ A;  5ELJ A;  3EB8 A;  3PGB A;  3UNL A;  3RDE A;  4RNZ A;  1JRQ A;  1IV7 A;  3O8Y A;  2W0Q A;  4HJL B;  5AEW B;  3HX8 A;  3B7C A;  1M1K 4;  3JVC A;  3F8H A;  3WOD G;  1U8C B;  3HK4 A;  2CK3 H;  3N54 B;  2W6J H;  2XSO B;  5AIG A;  2CWV A;  2XGN A;  1IU7 A;  4N6L A;  2GBX B;  4N3V A;  1W6G A;  1QAF A;  2RGQ A;  3BNB A;  2XH9 A;  2CG0 A;  2GU3 A;  2CFG A;  1WMP A;  2ML5 A;  4WHA A;  5BVB A;  4R1K A;  5IEP A;  5AIF A;  4LGQ A;  3CCE 3;  1O7M B;  1IDP A;  5LC6 A;  1WTH A;  3F8X A;  3OWY A;  1BUQ A;  2IUJ A;  2R4I A;  1SPU A;  2CIU A;  1TIJ A;  2CFL A;  2K0M A;  1DMN A;  2MF7 A;  4ORL A;  2KCD A;  4AEQ A;  2XEP A;  1N5H A;  4KVH A;  2FGT A;  1VQK 3;  1DVD A;  1YGE A;  3LTA A;  5AYS C;  1OGZ A;  2CFW A;  3G71 3;  3FG3 A;  2STD A;  2CHC A;  1TUH A;  3BNC A;  3GZY B;  2V1L A;  3FG1 A;  5DRV A;  2OQE A;  4O2H A;  3X3X A;  3MSO A;  3BNE A;  3LYG A;  3NV0 B;  5CF1 A;  3MG3 A;  4H61 A;  1IT8 A;  3X42 A;  3CCM 3;  1IQY A;  1WNH A;  3V99 A;  4WYK B;  3PS8 A;  5G2G A;  1O7P B;  1O7W B;  3CU3 A;  5CK6 A;  3I56 3;  2XGL A;  1R4C A;  2XFT A;  2WGO A;  3U97 A;  4HM6 B;  2ZDJ A;  3K0Z A;  4K90 B;  2WOF A;  2W04 A;  4QWT A;  3G4S 3;  2C11 A;  1YJ9 3;  1N8Q A;  2CFK A;  5AII A;  4AKY A;  3LXU X;  6STD A;  1OF5 B;  1W00 A;  3OWU A;  3NM7 A;  4FCZ A;  1ROV A;  3F14 A;  1K41 A;  5EEO A;  3KFQ C;  1ZO2 A;  1QAL A;  3QRD A;  5JPP A;  4X2H A;  3S28 A;  2W03 A;  1VQL 3;  1K73 4;  4HM4 B;  1IVU A;  2LQV A;  4LZI A;  5AEU B;  3Q2P A;  4EV5 A;  3WOF B;  3WMD A;  2XR8 B;  1STD A;  1MNL A;  1JKG A;  4LEH A;  3JUM A;  3K5T A;  3EJV A;  2JDI H;  4O02 B;  1Q86 4;  2CWU A;  3ER7 A;  5FW5 A;  1VQ5 3;  3M8C A;  3T8N A;  3FGY A;  7STD A;  2W2C A;  3DUK A;  4XBX A;  3S5C A;  1FGT A;  5FGO A;  3A76 A;  3DY5 A;  2HMK B;  3RGA A;  4MMY B;  3DM8 A;  1IVW A;  3SX1 A;  2PNC A;  3CCQ 3;  1TFK A;  2HMO B;  1FUW A;  3FF2 A;  4HM1 B;  1NDO B;  5ELU A;  3E99 A;  2W9Q A;  3JUQ A;  3X40 A;  1S5A A;  3F7X A;  2UX0 A;  5IG3 A;  1YIT 3;  5KP1 A;  4BTY A;  1W2Z A;  4CDL A;  1OPY A;  1Q42 A;  3CNM A;  1D6Y A;  4G1M B;  5IG0 A;  4AKZ A;  1NO3 A;  3I0Y A;  4HM3 B;  1YI2 3;  1N8R 4;  3KZT A;  5EQL A;  1VZZ A;  5D83 A;  4FCM A;  1MOL A;  4R9L A;  1STF I;  1K28 A;  1YJN 3;  3NBB A;  1VQP 3;  3Q90 A;  3EE1 A;  2FNQ A;  4HM2 B;  2XFS A;  3SLU A;  2OCT A;  4FMC A;  4XB5 A;  2WO0 A;  3AMO B;  3EHC A;  3SOA A;  4EBG A;  5IW9 A;  3H51 A;  4KZ1 A;  2SBL A;  3MG1 A;  3G16 A;  2QGU A;  3CPW 2;  1SII A;  1YIJ 3;  3LOY A;  1HU9 A;  2IMJ A;  2YFI B;  3GWR A;  1ULJ B;  5CXO A;  4EV2 A;  3SVA A;  1SIH A;  1F8N A;  5AIH A;  1VQN 3;  2P09 A;  3EN8 A;  2GXF A;  3UB1 A;  3L0R A;  1A2V A;  4WFO A;  1IVX A;  3DXO A;  4HM0 B;  1JN5 B;  3NBJ A;  4BTX A;  3F7S A;  3JUO A;  1UUW B;  2F98 A;  5TGN A;  2P0X A;  1OHO A;  1US1 A;  1NB5 I;  2HMN B;  3WDG B;  1K9M 4;  1FGO A;  1M90 4;  1VQ8 3;  3S67 A;  4RNY A;  1OHP A;  3OV4 A;  4LSO A;  1AVK A;  5CF2 A;  3FCS B;  2KXG A;  3T0U A;  4HM5 B;  3WA3 A;  3EBT A;  4JF8 A;  1OUN A;  5EVH A;  5IEN A;  1RRL A;  1UW1 A;  3FF0 A;  1RN7 A;  3OXA A;  3PZW A;  1N9J A;  2BHM A;  1W02 A;  3ALA A;  2L4V A;  1Q40 B;  1CQS A;  2FXT A;  3CPO A;  1S72 3;  1ISK A;  2E2V A;  1FGQ A;  1ROA A;  4HZB B;  4EYC A;  1KQS 2;  4N6N B;  2KRT A;  3GZB A;  2WOH A;  3DGN A;  4FMD A;  1LOX A;  2RSX A;  4OK0 A;  3J7Y d;  4L7K A;  1FGM A;  2CG1 A;  3OW2 2;  4KFD A;  4U13 A;  2CFD A;  5IF6 A;  1OGX A;  3B8L A;  2I9W A;  4N6V 0;  2C10 A;  1W01 A;  1N9E A;  2Z7A A;  4Q53 A;  3G8Z A;  1KC8 4;  2IA7 A;  3EBY A;  1UUV B;  2CWT A;  3N8B A;  4N6O B;  3SOY A;  4HZ9 B;  3NX0 A;  4X2O A;  1O7H B;  1QJG A;  3MPH A;  3MYT A;  1UI8 A;  3LTC A;  3NV0 A;  2RFR A;  2B1X B;  3BND A;  1FA3 A;  3PYJ A;  4WYK A;  4K61 A;  1GY7 A;  2E2T A;  4J8T A;  2OOV C;  3UJM A;  1EA2 A;  1WMN A;  4N6U A;  1A90 A;  4XBT A;  5D82 A;  3WOE B;  1WQL B;  1Z1S A;  4EXR A;  1KD1 4;  2Z76 A;  1EKM A;  1A67 A;  2D1W A;  1E3V A;  4L8O A;  3CCU 3;  4JRF A;  2Q07 A;  4FMB A;  1OF5 A;  4FMA A;  4KFE A;  5KP4 A;  1K8A 4;  3DZL A;  2B24 B;  2HML B;  3UL5 A;  1VQ6 3;  3FLJ A;  3OWS A;  2E2U A;  1YVB I;  1NJI 4;  2ML6 A;  4GB5 A;  5DRE A;  2Y73 A;  2F86 B;  1AVL A;  3EC9 A;  3NHX A;  1W2B 2;  4CCV A;  1YHQ 3;  3ECF A;  3CC2 3;  3KKG A;  3IPT A;  1VQ9 3;  3QK9 A;  2XF3 A;  3VF1 A;  5I97 A;  3EN1 B;  1W6Y A;  3DGO A;  3K7C A;  3EQQ B;  1D6Z A;  4LMI A;  3CC7 3;  3NQY A;  2XRX B;  3WA2 X;  1EG9 B;  3N9H A;  4H3U A;  1IT7 A;  3S29 A;  4R80 A;  2HMJ B;  4OUQ A;  3X41 A;  3B4P A;  2CH9 A;  2BNG A;  2K54 A;  5BXQ A;  3DMC A;  1NU3 A;  4K1V A;  2BO9 B;  3JUP A;  3FH1 A;  2OTL 3;  3CD6 3;  3NUV A;  4XBY A;  5IER A;  1GD3 A;  3X3Z A;  3MG2 A;  4IIA A;  3Q1C A;  2CKF B;  3IMA B;  4EC6 A;  4MMX B;  1OCV A;  5STD A;  1QMA A;  2W56 B;  3EF8 A;  1WMO A;  2Z77 A;  3MHE A;  1DVC A;  1JV2 B;  4MEI A;  3LTB A;  3CMA 3;  3NBR A;  4XDV A;  5A0O B;  3JUN A;  2OOV A;  5CLK A;  1OHS A;  3LZA A;  3G6E 3;  1W7C A;  3F40 A;  3F9S A;  1VQ7 3;  3HZP A;  1JJ2 2;  3I55 3;  5HGR A;  1L5G B;  5JBS A;  4FCJ A;  2WGQ A;  3FZW A;  3KSP A;  3AMO A;  1KSI A;  3FSD A;  4BTW A;  2P38 A;  4N6T A;  2GBW B;  1ASK A;  3EX9 A;  4J9A A;  4R4K A;  3HII A;  1KWI A;  1DYU A;  2LYX A;  2MC8 A;  1AR0 A;  1U5O A;  2QEX 3;  3HI7 A;  2W56 A;  1JB2 A;  1TFO A;  1GY6 A;  5IG5 A;  3D3L A;  3T8U A;  3CCS 3;  2O3O A;  3NM2 A;  1JB4 A;  2INX A;  1PU4 A;  1SJW A;  1QAK A;  2CC3 A;  3VGN A;  2BMR B;  5AYR B;  3DGM A;  4HVN A;  1A2K A;  3PCS A;  5IG4 A;  3GAX A;  1JN5 A;  4I4K A;  2Z6B A;  1C7H A;  3LT8 A;  1VQ4 3;  2M7O A;  1OH0 A;  2RCD A;  5AI1 A;  1D6U A;  2QA4 3;  1UI7 A;  2A15 A;  3BB9 A;  1QVG 2;  1O7N B;  3BLZ A;  3D9R A;  1Q82 4;  1W4N A;  3MKI A;  3CCR 3;  1NB3 I;  2Y74 A;  4WP5 A;  3CCL 3;  2OWP A;  1CYV A;  1DMM A;  4NRE A;  3V92 A;  3B4O A;  2BT3 A;  1EQK A;  3H3H A;  3OX9 A;  2P0M A;  3GZR A;  3CXC 2;  2YFJ B;  1SQW A;  1Q40 A;  4IPB A;  3K63 A;  2PZV A;  1NWW A;  1JB5 A;  5JPU A;  1JNQ A;  4HM8 B;  3K9M C;  3UL6 A;  3LT9 A;  1DMQ A;  3PCR A;  1Q7Y 4;  1JKG B;  4FR9 A;  3DGL A;  4O8S A;  3KII A;  3PXM A;  4KFF A;  1M1X B;  4RZM A;  2BMQ B;  2W9P A;  1Y4K A;  2GEX A;  3CME 3;  2JQ5 A;  1LNH A;  4STD A;  5D81 A;  4PEJ A;  1RKY A;  3X3Y A;  3KN4 A;  1IQ8 A;  2IUK A;  3CC4 3;  1M9G A;  4RBN A;  3TDG A;  2F99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...