3NQYA

Crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
174
Chain Sequence
ANKKYLNQQPTINNMVQSNVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
total genus 33
structure length 174
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA01
2GU3A 1JRQA 1D6UA 1W6GA 3T0UA 2D1WA 2K0MA 1QAFA 3X40A 1UI8A 3NQZA 2CFWA 1W2ZA 2YX9A 1KSIA 2CFGA 1D6ZA 2Y74A 3X41A 2CFLA 2CWTA 1OACA 3HIGA 2OOVA 2WOFA 2C11A 3X3ZA 4KFDA 1SIHA 1TU5A 4BTYA 1IVUA 2OOVC 4EV2A 2E2VA 1SIIA 1SPUA 1IVVA 3HIIA 1A2VA 1AVKA 1WMPA 1WMNA 1D6YA 3WA2X 1W4NA 3HI7A 1AV4A 3SX1A 4BTXA 1PU4A 3X3YA 3X3XA 4BTWA 2CWVA 4KFEA 3AMOA 2E2TA 1LVNA 2CFDA 3X42A 2Y73A 1IVWA 2BT3A 3K5TA 2CFKA 2WGQA 5IW9A 3MPHA 2CG1A 4KFFA 4EXRA 1EKMA 2WOHA 3SXXA 1QALA 3ALAA 1WMOA 1N9EA 1RKYA 2OQEA 2ZL8A 3KN4A 3KIIA 3AMOB 1AVLA 2CWUA 1DYUA 1IQYA 2OQEC 2PNCA 1US1A 2W0QA 4K90B 1W6CA 2IA7A 1IQXA 1IU7A 3NBJA 1W7CA 1UI7A 3LOYA 2WO0A 2C10A 3PGBA 4EV5A 1QAKA 1W5ZA 1RJOA 3WA3A 1IVXA 3N9HA 2E2UA 3NBBA 2CG0A 3NQYA
chains in the Genus database with same CATH superfamily
3N54B 3CC43 1W6GA 3T0UA 2W03A 1IV9A 2XGLA 1BANA 2R41A 4Q53A 3LTDA 1UI8A 3GAXA 1GMPA 2CKFB 3EC9A 1I70A 2CG0A 3NV0A 4N6V0 1N8QA 4TX4A 3UNLA 1VQO3 2CFWA 3AGNA 1RGAA 2A15A 4J9AA 1A2KA 4R80A 5CLKA 5LC6A 4BU4A 1RGFA 2CX1A 1BAOA 2W04A 1MGWA 1UCJA 2CIUA 3S5CA 1ULJB 1JNQA 1VQQA 4GSPA 1L5GB 1W6YA 1DE3A 4FCJA 1FUWA 4O3VA 2XR8B 1PYLA 1YIT3 1IT8A 5I97A 1BSEA 3EN8A 4KT3B 3A5EA 2OOVC 2Q07A 2FGTA 2E2VA 4G1MB 2P09A 3VSYA 1M1K4 1SIIA 3FZWA 4RNZA 4RBNA 1RTUA 3A76A 3FSDA 3MWZA 3D3LA 9RNTA 1BNRA 1OCVA 3GZBA 3CCV3 1TP6A 4J5GA 2XFTA 1D6YA 4O02B 4OK0A 5EQLA 5AIIA 1OH0A 3G4S3 6STDA 2QIYA 3DZLA 3PS8A 1MGRA 2O9UX 1TRPA 1E3VA 3GZXB 1K41A 1B2ZA 1IDPA 3KE7A 1TIJA 2KRTA 3SX1A 4MMYB 1UW1A 3DH2A 3F14A 1VQP3 3CCM3 1IYYA 2P0XA 3X3YA 1B21A 1BSCA 3S27A 4FR9A 1VQ43 5BVBA 2QGUA 3RGRA 2WGOA 3T8UA 1NNVA 3EBTA 2RBIA 5FW5A 3WOEB 3NM7A 1NWWA 1KC84 4WP5A 1I2EA 2CK3H 1EUIC 3X42A 2BNGA 2Y73A 1IVWA 2CHCA 4MEIA 4R4KA 1BNGA 4LSOA 4HYZA 1CEWI 1RRLA 3PCSA 2F56A 5CF2A 3OWUA 3GRDA 4K61A 2ML6A 4HVNA 3EB8A 3BIRA 1EEJA 1FYSA 4WWUC 3J7Yd 2GSPA 1RNBA 1GYBA 1UCKA 5GSPA 3JUOA 4O2HA 5KP3A 3URPA 2YFJB 3CXC2 5HOHA 4PEJA 1KWIA 1QALA 1X1WA 3DXOA 3EF8A 7STDA 2XEPA 1SQWA 3ALAA 1G96A 3CD63 1BUQA 1Q7Y4 1RKYA 4N6OB 3WOFB 3B4OA 1F8NA 3KSPA 2HMLB 2H0HA 1RN1A 4XBXA 5CF1A 4WYKB 3L0RA 1O7WB 1EA2A 1I0XA 5A0OB 1JV2B 1QJGA 4HZBB 4WHAA 1US1A 3F9SA 2AADA 2ML5A 1W6CA 5KP1A 3MHEA 4HM5B 1PY3A 2XFSA 3AGOA 3D5IA 3CC23 1MOLA 1J2BA 1T2HA 1W7CA 1BU4A 1UCLA 1SARA 1UI7A 3KCHA 3LZAA 4AKZA 1FW7A 4X2OA 1BNSA 1CYVA 2W9PA 2C10A 3WHOA 2XF3A 1KD14 1N9JA 3BU4A 1PFPA 1BNEA 5IENA 1VQ93 3KZTA 1FUSA 3CNMA 1LXEA 4L7KA 1ZO2A 1W02A 3ZG0A 3NBBA 3WA3A 1YVSA 5LC7A 2KF6A 1VQ83 2GU3A 4LEHA 2R4IA 1JRQA 3MG3A 1BRSA 2LYXA 5CK6A 1I3IA 3DGOA 4FCZA 3HOHA 3DGYA 1OF5B 5IERA 5ELJA 2P05A 1QAFA 1GOYA 3NQZA 1MWRA 2F5MA 3SEDA 1GY6A 1VZZA 3DGMA 1LQMB 1JN5A 3S28A 5M18A 1IQ8A 1MWTA 1VQN3 3NXJA 3LYGA 4K1UA 2CFLA 2CWTA 5D82A 1BRKA 2WOFA 1R4YA 3X3ZA 4KFDA 3ER7A 3PCRA 2SBLA 1TFKA 2LQVA 4LMIA 5BXQA 3S67A 4BL2A 5KP4A 3I553 1ROAA 1ZS7A 1IVUA 1BRGA 1UCIA 2GBWB 2UX0A 4LYLB 1JBTA 4L8OA 3M8CA 1I2GA 3OXAA 2GBXB 5EVHA 1ULIB 3OWYA 3HIIA 2RSXA 1N8R4 3JUNA 1YJN3 1Q864 3MKIA 1WQLB 4LGQA 1WMPA 5AIHA 1WMNA 2ZA4A 3SYUA 1UUVB 2SARA 3UJMA 1VQL3 4WFOA 4AEQA 4H61A 1LNIA 1YNVX 3WMDA 3WA2X 2W56A 1M9GA 1ROVA 2IUKA 3IPTA 3N8BA 4IPBA 4N3VA 3HI7A 4EW5A 2IYJA 2P0MA 5JPPA 1TTOA 5DREA 2RGQA 3CCR3 1GMRA 3EHCA 2HMMB 4RNTA 3JUQA 1PU4A 1NB3I 1YI23 1MNLA 3F8XA 5D83A 1RMSA 1B20A 1W01A 1HYFA 3ZG5A 1LNHA 4BTWA 3U97A 1GD4A 1V58A 1JB2A 2E2TA 1LVNA 6RNTA 2CFDA 3FG1A 1HU9A 4CCVA 4MMZB 2BT3A 3ZFZA 1NB5I 1QMAA 3K5TA 4EBGA 5M19A 3NV0B 4ZM8A 1M1XB 3GSPA 2CFKA 2XSHB 3GZRA 1OUNA 1LRAA 3MPHA 1JZDA 3F40A 2KXGA 4FMCA 4XB5A 3UL6A 1Q9EA 3F7SA 5M1AA 3BLZA 1ZX2A 1T5YA 4EXRA 3BNEA 1JJ22 4HKVB 3SXXA 1LOVA 2MF7A 1BGSA 3STDA 1U5OA 2B24B 3H3HA 1Q814 1RGLA 5ELUA 4RZMA 1DETA 2Z76A 1LOYA 1U8CB 1B2XA 3OWSA 1K8A4 2IMJA 1RRHA 1W00A 3ECFA 3LH4A 3NBRA 2OQEA 1JB4A 5IEPA 2CX0A 1Z1SA 3UB1A 2OTL3 3KN4A 2UGIA 4CDLA 1DVDA 1DYUA 1K734 1IQYA 4FCMA 3Q3FA 4HOHA 5AYSC 2OWPA 2PNCA 2FXTA 2KF3A 2W0QA 1VQK3 1IQXA 3CCQ3 3UL5A 1K9M4 3V99A 1RGGA 4HM8B 1AY7A 1DMMA 4KVHA 4N6MA 3LTBA 2XGNA 3CCL3 5G2GA 1NJI4 1QAKA 4QWTA 4J8TA 3K63A 1ISKA 1BNIA 1IVXA 1O7GB 3T8NA 5IG3A 3Q90A 1RCKA 1YGWA 1D6UA 1MWUA 2K54A 2KCDA 3BNDA 3SOYA 2CH9A 3D4AA 1TJDA 4HM0B 3X40A 5D81A 3GZYB 1FUTA 2INXA 1W2ZA 2YX9A 1X1UA 2BO9B 4HBRA 4HM1B 1BSBA 1D6ZA 1OPYA 2Y74A 1FGTA 3VGNA 2CC3A 1OACA 4U13A 3IJEB 1YIJ3 3BNBA 5G1LA 2JQ5A 3BNCA 1UUGB 2OOVA 2W2CA 3PZWA 7RNTA 1O7PB 1B27A 3I563 5AEWB 1IT7A 1Q824 3OX9A 1TU5A 4BTYA 3AHWA 2UUGC 2RFRA 4O8SA 1GY5A 4R1KA 1SPUA 2YFIB 3CME3 1A67A 2V1LA 2L4VA 2BMOB 3K7CA 3CPW2 3ROBA 1VQ53 1A2VA 1BIRA 1RSNA 1AVKA 4BIRA 1YHQ3 1OGZA 1EG9B 3I0YA 4IT7A 3CCJ3 3CCS3 1FA3A 4XM4A 3FH1A 8RNTA 1RHLA 1AV4A 1FZUA 3G0KA 3O8YA 3JUPA 3DM8A 1TFOA 3FLJA 4BTXA 2STDA 1STFI 3DUKA 3U1WA 3D79A 3RNTA 3MYTA 5AI1A 3X3XA 1JB5A 3G6E3 1E3RA 2HMNB 2CWVA 3AMOA 3FG4A 1CQSA 2XRXB 1I3FA 3HX8A 3K9MC 3G16A 2Z77A 1BRNL 4XDVA 4L8PA 1GOUA 4HM4B 3LTCA 1RN4A 5IEOA 5IW9A 4MJDA 2QEX3 4IIAA 1JN5B 1FGOA 1FGQA 2XSOB 3LMLA 2YFLB 2W9QA 1LOWA 3D9RA 3FCSB 4HM7B 4KFFA 1EKMA 2WOHA 5IG0A 1CH0A 4GL6A 1STDA 5G1KA 1R4CA 3SOAA 2KF4A 4EC6A 1KQS2 4NREA 1RDSA 2Z6BA 1SJWA 3FF2A 3CPOA 3EQQB 3CC73 5JBSA 1RCLA 2HMJB 3AMOB 1BRJA 1QVF2 2IUJA 4HM6B 1BVIA 2GEXA 2JDIH 1HKXA 1A90A 1JBSA 1GMQA 1RN7A 3TDGA 3PYJA 1BNFA 2L1SA 4JF8A 3V98A 3HZPA 3PXMA 4XBTA 5RNTA 3WODG 1K28A 1IU7A 3NBJA 3QRDA 3NM2A 2W56B 1TRQA 4NPBA 3CMA3 1UDII 3H51A 2WO0A 5AEUB 3PGBA 3Q1CA 1GSPA 1RGHA 3CCE3 3MG2A 2FNQA 3KFQC 5IF6A 4OVMA 1M904 2J8XB 1B2SA 2BMRB 3JUMA 1RNTA 1ASKA 2F4YA 3FF0A 6GSPA 1S5AA 2D1WA 2K0MA 3DY5A 2B1XB 1I8VA 4CJNA 3SVAA 1T3BA 2HMOB 1IV7A 3D5GA 4J5KA 2Z7AA 4XBYA 3S29A 1YJ93 2M7OA 1LOXA 3B7CA 1OHPA 4R9KA 3RDEA 3V92A 1W2B2 5CXOA 3E99A 1MWSA 3KSED 4ILFA 5BIRA 1KSIA 2W6JH 3NX0A 1OHOA 1C7HA 1RGKA 2CFGA 3X41A 3AHSA 4RNYA 5AIFA 7GSPA 4GB5A 2KAAA 1AQZA 4N6TA 1I0VA 3KKGA 3HIGA 4XDWA 5STDA 1WTHA 2CW9A 1IK3A 3Q2PA 2C11A 2KF5A 1SIHA 1UUWB 4HM2B 4FMAA 5FGOA 4R9LA 1VQ63 1BSAA 1E97A 3K0ZA 4EV2A 5BU4A 4H3UA 2F99A 4HJLB 1BSDA 4WYKA 1IVVA 4I4KA 3QK9A 2I9WA 3EJVA 1N5PA 1DMQA 3DMCA 4HZ9B 4CPKA 2XH9A 4OUQA 2PZVA 5DRVA 1VQ73 2RNTA 4EYCA 1BNJA 1RLSA 1FGMA 2MC8A 8CHOA 1W4NA 1BUJA 4N6NB 2K3DA 1C54A 1UGHI 1NU3A 2GXFA 3LTAA 1BOXA 5IG4A 1O7HB 1Q40A 4LZIA 3LXUX 2ZDJA 2P38A 4DKIA 1WNHA 3NQYA 3G713 3CU3A 3EN1B 4ORLA 5JPUA 1GD3A 1I2FA 1V74A 1QVG2 3G8ZA 4N6LA 4STDA 2C4BA 1BRHA 4FMDA 1V57A 1OF5A 3RGAA 1UGIA 5AIGA 4X2HA 2F98A 4KFEA 3NUVA 3GWRA 3IMAB 3B4PA 4K1VA 1GY7A 3EX9A 3FGYA 1Q7HA 2GU1A 3MG1A 1T2IA 1LQGC 1N5HA 2GEYA 2BIRA 4JRFA 1YJW3 1NO3A 2WGQA 1O7NB 2ZHXB 2F86B 4BL3A 1Y4KA 3JVCA 2RCDA 1S723 1GS3A 1RGEA 2O3OA 3CNXA 1OHSA 2BMQB 2HOHA 2CG1A 1YVBI 3B8LA 4MMXB 3FG3A 1DVCA 2H0GA 1CYUA 1Q40B 1B2MA 1X1XA 1JZOA 1JKGA 2BHMA 4NHFA 1A2PA 1TUHA 3F7XA 4N6UA 2BU4A 1WMOA 3DGLA 3F8HA 1N9EA 4HM3B 3WR2A 3BB9A 1B2UA 2ZL8A 3HK4A 1G0TA 5AYRB 1DMNA 1HZ1A 1OGXA 1AVLA 1RGCA 2CWUA 3FKAA 3KIIA 2OTJ3 2F5WA 2OQEC 3NHXA 3SLUA 5HGRA 1Q42A 3LT9A 4K90B 3WDGB 3EBYA 2IA7A 1X1YA 4FMBA 3LT8A 1GOVA 3MSOA 1JBRA 1NDOB 4HAAA 1YGEA 1ZGXA 5EEOA 3OV4A 3DGNA 2IY2A 1FGRA 1AR0A 3EE1A 5IG5A 3LOYA 2QA43 4EV5A 2D42A 1EQKA 1G02A 3OW22 2HMKB 1VQM3 4KZ1A 1W5ZA 2AAEA 1RJOA 2H0IA 4AKYA 5TGNA 1B3SA 4I5QA 1JKGB 2E2UA 3N9HA 3VF1A 3CCU3 1O7MB 4GHOA 2OCTA 1BRIA
chains in the Genus database with same CATH topology
3N54B 3CC43 1W6GA 3T0UA 2W03A 1IV9A 2XGLA 4Q53A 3LTDA 1UI8A 3GAXA 5IG5A 2CKFB 3EC9A 3NV0A 4N6V0 4TX4A 3UNLA 1N8QA 1VQO3 2CFWA 4R80A 2A15A 4J9AA 5CLKA 1A2KA 5LC6A 2W04A 2CIUA 3S5CA 1ULJB 1JNQA 1L5GB 1W6YA 1FUWA 4FCJA 4O3VA 2XR8B 1YIT3 1IT8A 5I97A 3EN8A 2OOVC 2Q07A 2FGTA 2E2VA 4G1MB 2P09A 3VSYA 1M1K4 1SIIA 3FZWA 4RNZA 4RBNA 3A76A 3FSDA 3MWZA 3D3LA 1OCVA 3GZBA 3CCV3 1TP6A 2XFTA 1D6YA 4O02B 4OK0A 5EQLA 5AIIA 1OH0A 3G4S3 6STDA 2QIYA 3DZLA 3PS8A 2O9UX 1E3VA 3GZXB 1K41A 1IDPA 3KE7A 1TIJA 2KRTA 3SX1A 4MMYB 1UW1A 3F14A 3CCM3 2P0XA 3X3YA 3S27A 1VQ43 4FR9A 5BVBA 2QGUA 3RGRA 2WGOA 3T8UA 3EBTA 5FW5A 3WOEB 3NM7A 1NWWA 1KC84 4WP5A 2CK3H 3X42A 2BNGA 2Y73A 1IVWA 2CHCA 4MEIA 4R4KA 4LSOA 4HYZA 1CEWI 1RRLA 3PCSA 5CF2A 3OWUA 3GRDA 4K61A 2ML6A 4HVNA 3EB8A 4WWUC 3J7Yd 1GYBA 3CXC2 3JUOA 4O2HA 5KP3A 2YFJB 4PEJA 1KWIA 1QALA 3DXOA 3EF8A 7STDA 2XEPA 1SQWA 3ALAA 1G96A 3CD63 1BUQA 1Q7Y4 1RKYA 4N6OB 3WOFB 3B4OA 1F8NA 3KSPA 2HMLB 4XBXA 5CF1A 4WYKB 3L0RA 1O7WB 1EA2A 5A0OB 1JV2B 1QJGA 4HZBB 4WHAA 1US1A 3F9SA 2ML5A 1W6CA 5KP1A 3MHEA 4HM5B 2XFSA 3CC23 1MOLA 1J2BA 1W7CA 1UI7A 4AKZA 3LZAA 4X2OA 1CYVA 2W9PA 2C10A 2XF3A 1KD14 1N9JA 1PFPA 1VQ93 3KZTA 3CNMA 4L7KA 1LXEA 3WA3A 1ZO2A 1W02A 3NBBA 5LC7A 1VQ83 2GU3A 4LEHA 2R4IA 1JRQA 3MG3A 2LYXA 5CK6A 5IERA 4FCZA 3DGOA 1VQP3 1OF5B 5ELJA 2P05A 1QAFA 3NQZA 3SEDA 1GY6A 1VZZA 3DGMA 1JN5A 3S28A 1IQ8A 1VQN3 3NXJA 3LYGA 4K1UA 2CFLA 2CWTA 5D82A 2WOFA 3X3ZA 4KFDA 3ER7A 3PCRA 2SBLA 1TFKA 2LQVA 4LMIA 5BXQA 3S67A 5KP4A 3I553 1ROAA 1IVUA 2GBWB 2UX0A 4L8OA 3M8CA 3OXAA 2GBXB 5EVHA 1ULIB 3OWYA 3HIIA 2RSXA 1N8R4 3JUNA 1YJN3 1Q864 3MKIA 1WQLB 4LGQA 1WMPA 5AIHA 1WMNA 1UUVB 3UJMA 1VQL3 4WFOA 4AEQA 4H61A 3WMDA 3WA2X 2W56A 1M9GA 1ROVA 2IUKA 3IPTA 3N8BA 4IPBA 4N3VA 3HI7A 2P0MA 5JPPA 5DREA 2RGQA 3CCR3 3EHCA 2HMMB 3JUQA 1PU4A 1NB3I 1YI23 1MNLA 3F8XA 5D83A 1W01A 1LNHA 4BTWA 3U97A 1GD4A 1JB2A 2E2TA 1LVNA 2CFDA 3FG1A 1HU9A 4CCVA 4MMZB 2BT3A 1NB5I 1QMAA 3K5TA 4EBGA 3NV0B 4ZM8A 1M1XB 3GZRA 2CFKA 2XSHB 5IG0A 1OUNA 3UL6A 3MPHA 3F40A 4FMCA 2KXGA 4XB5A 3F7SA 3BLZA 1ZX2A 1T5YA 4EXRA 3BNEA 1JJ22 4HKVB 3SXXA 2MF7A 3STDA 1U5OA 2B24B 3H3HA 1Q814 5ELUA 4RZMA 2Z76A 1U8CB 3OWSA 1K8A4 2IMJA 1RRHA 1W00A 3ECFA 3LH4A 3NBRA 2OQEA 1JB4A 5IEPA 1Z1SA 3UB1A 2OTL3 3KN4A 4CDLA 1DVDA 1DYUA 1K734 1IQYA 4FCMA 5AYSC 2OWPA 2PNCA 2FXTA 2W0QA 1VQK3 1IQXA 3CCQ3 3UL5A 1K9M4 3V99A 4HM8B 4KVHA 1DMMA 4N6MA 3LTBA 2XGNA 3CCL3 5G2GA 1NJI4 1QAKA 1O7MB 4QWTA 4J8TA 3K63A 1ISKA 1IVXA 1O7GB 3T8NA 5IG3A 3Q90A 2K54A 1D6UA 3SOYA 2KCDA 3BNDA 2CH9A 4HM0B 3X40A 5D81A 3GZYB 2INXA 1W2ZA 2YX9A 2BO9B 4HBRA 4HM1B 1D6ZA 1OPYA 2Y74A 1FGTA 3VGNA 2CC3A 1OACA 4U13A 3IJEB 1YIJ3 3BNBA 2JQ5A 3BNCA 2OOVA 2W2CA 3PZWA 1O7PB 3I563 5AEWB 1IT7A 1Q824 3OX9A 1TU5A 4BTYA 2RFRA 4O8SA 1GY5A 4R1KA 1SPUA 2YFIB 3CME3 1A67A 2V1LA 2L4VA 2BMOB 3K7CA 3CPW2 3ROBA 1VQ53 1A2VA 1AVKA 1YHQ3 1OGZA 1EG9B 3I0YA 4IT7A 3CCJ3 3CCS3 1FA3A 4XM4A 3FH1A 1AV4A 3G0KA 3O8YA 3JUPA 3DM8A 1TFOA 3FLJA 4BTXA 2STDA 1STFI 3DUKA 3U1WA 3MYTA 5AI1A 3X3XA 1JB5A 3G6E3 1E3RA 2HMNB 2CWVA 3AMOA 3FG4A 1CQSA 2XRXB 3HX8A 3K9MC 3G16A 2Z77A 4XDVA 4L8PA 5IEOA 4HM4B 3LTCA 5IW9A 4MJDA 2QEX3 4IIAA 1JN5B 1FGOA 1FGQA 2XSOB 3LMLA 2YFLB 2W9QA 3D9RA 3FCSB 4HM7B 4KFFA 1EKMA 2WOHA 4GL6A 1STDA 1R4CA 3SOAA 4EC6A 1KQS2 4NREA 2Z6BA 1SJWA 3FF2A 3CPOA 3EQQB 3CC73 5JBSA 2HMJB 3AMOB 1QVF2 2IUJA 4HM6B 2GEXA 2JDIH 1HKXA 1A90A 1RN7A 3TDGA 3PYJA 4JF8A 3V98A 3HZPA 3PXMA 4XBTA 3WODG 1K28A 1IU7A 3NBJA 3QRDA 3NM2A 2W56B 3CMA3 3H51A 2WO0A 5AEUB 3PGBA 3Q1CA 3CCE3 3MG2A 2FNQA 3KFQC 5IF6A 4OVMA 1M904 2BMRB 3JUMA 1ASKA 3FF0A 1S5AA 2D1WA 2K0MA 3DY5A 2B1XB 3SVAA 2HMOB 1IV7A 4XBYA 3S29A 2Z7AA 1YJ93 2M7OA 1LOXA 3B7CA 1OHPA 4R9KA 3RDEA 3V92A 1W2B2 5CXOA 3E99A 3KSED 1KSIA 2W6JH 3NX0A 1OHOA 1C7HA 2CFGA 3X41A 4RNYA 5AIFA 4GB5A 5IENA 4XDWA 4N6TA 5STDA 3KKGA 3HIGA 1IK3A 1WTHA 2CW9A 3Q2PA 2C11A 1SIHA 1UUWB 4HM2B 4FMAA 5FGOA 4R9LA 1VQ63 1E97A 3K0ZA 4EV2A 4H3UA 2F99A 4HJLB 4WYKA 1IVVA 4I4KA 3QK9A 2I9WA 3EJVA 1N5PA 1DMQA 3DMCA 4HZ9B 2XH9A 4OUQA 2PZVA 5DRVA 1VQ73 4EYCA 1FGMA 2MC8A 8CHOA 1W4NA 4N6NB 1NU3A 2GXFA 3LTAA 5IG4A 1O7HB 1Q40A 4LZIA 3LXUX 2ZDJA 2P38A 1WNHA 3NQYA 3G713 3CU3A 3EN1B 4ORLA 5JPUA 1GD3A 1V74A 1QVG2 3G8ZA 4N6LA 4STDA 4FMDA 1OF5A 3RGAA 5AIGA 4X2HA 2F98A 4KFEA 3NUVA 3GWRA 3IMAB 3B4PA 4K1VA 1GY7A 3EX9A 3FGYA 2GU1A 3MG1A 2GEYA 1N5HA 4JRFA 1YJW3 1NO3A 2WGQA 1O7NB 2F86B 1Y4KA 3JVCA 2RCDA 1S723 1GS3A 2O3OA 3CNXA 1OHSA 2BMQB 2CG1A 1YVBI 3B8LA 4MMXB 3FG3A 1DVCA 1CYUA 1Q40B 1JKGA 2BHMA 4NHFA 1TUHA 3F7XA 4N6UA 1WMOA 3DGLA 3F8HA 1N9EA 4HM3B 3BB9A 2ZL8A 3HK4A 5AYRB 1DMNA 1OGXA 3KIIA 1AVLA 2CWUA 3FKAA 2OTJ3 2OQEC 3NHXA 3SLUA 5HGRA 1Q42A 3LT9A 4K90B 3WDGB 3EBYA 2IA7A 4FMBA 3LT8A 3MSOA 1NDOB 1YGEA 5EEOA 3OV4A 3DGNA 1FGRA 1AR0A 3EE1A 3LOYA 2QA43 4EV5A 2D42A 1EQKA 3OW22 2HMKB 1VQM3 4KZ1A 1W5ZA 1RJOA 4AKYA 5TGNA 3VF1A 3CCU3 1JKGB 2E2UA 3N9HA 2CG0A 2OCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU3 A;  1JRQ A;  1D6U A;  1W6G A;  3T0U A;  2D1W A;  2K0M A;  1QAF A;  3X40 A;  1UI8 A;  3NQZ A;  2CFW A;  1W2Z A;  2YX9 A;  1KSI A;  2CFG A;  1D6Z A;  2Y74 A;  3X41 A;  2CFL A;  2CWT A;  1OAC A;  3HIG A;  2OOV A;  2WOF A;  2C11 A;  3X3Z A;  4KFD A;  1SIH A;  1TU5 A;  4BTY A;  1IVU A;  2OOV C;  4EV2 A;  2E2V A;  1SII A;  1SPU A;  1IVV A;  3HII A;  1A2V A;  1AVK A;  1WMP A;  1WMN A;  1D6Y A;  3WA2 X;  1W4N A;  3HI7 A;  1AV4 A;  3SX1 A;  4BTX A;  1PU4 A;  3X3Y A;  3X3X A;  4BTW A;  2CWV A;  4KFE A;  3AMO A;  2E2T A;  1LVN A;  2CFD A;  3X42 A;  2Y73 A;  1IVW A;  2BT3 A;  3K5T A;  2CFK A;  2WGQ A;  5IW9 A;  3MPH A;  2CG1 A;  4KFF A;  4EXR A;  1EKM A;  2WOH A;  3SXX A;  1QAL A;  3ALA A;  1WMO A;  1N9E A;  1RKY A;  2OQE A;  2ZL8 A;  3KN4 A;  3KII A;  3AMO B;  1AVL A;  2CWU A;  1DYU A;  1IQY A;  2OQE C;  2PNC A;  1US1 A;  2W0Q A;  4K90 B;  1W6C A;  2IA7 A;  1IQX A;  1IU7 A;  3NBJ A;  1W7C A;  1UI7 A;  3LOY A;  2WO0 A;  2C10 A;  3PGB A;  4EV5 A;  1QAK A;  1W5Z A;  1RJO A;  3WA3 A;  1IVX A;  3N9H A;  2E2U A;  3NBB A;  2CG0 A;  3NQY A; 
#chains in the Genus database with same CATH topology
 3N54 B;  3CC4 3;  1W6G A;  3T0U A;  2W03 A;  1IV9 A;  2XGL A;  1BAN A;  2R41 A;  4Q53 A;  3LTD A;  1UI8 A;  3GAX A;  1GMP A;  2CKF B;  3EC9 A;  1I70 A;  2CG0 A;  3NV0 A;  4N6V 0;  1N8Q A;  4TX4 A;  3UNL A;  1VQO 3;  2CFW A;  3AGN A;  1RGA A;  2A15 A;  4J9A A;  1A2K A;  4R80 A;  5CLK A;  5LC6 A;  4BU4 A;  1RGF A;  2CX1 A;  1BAO A;  2W04 A;  1MGW A;  1UCJ A;  2CIU A;  3S5C A;  1ULJ B;  1JNQ A;  1VQQ A;  4GSP A;  1L5G B;  1W6Y A;  1DE3 A;  4FCJ A;  1FUW A;  4O3V A;  2XR8 B;  1PYL A;  1YIT 3;  1IT8 A;  5I97 A;  1BSE A;  3EN8 A;  4KT3 B;  3A5E A;  2OOV C;  2Q07 A;  2FGT A;  2E2V A;  4G1M B;  2P09 A;  3VSY A;  1M1K 4;  1SII A;  3FZW A;  4RNZ A;  4RBN A;  1RTU A;  3A76 A;  3FSD A;  3MWZ A;  3D3L A;  9RNT A;  1BNR A;  1OCV A;  3GZB A;  3CCV 3;  1TP6 A;  4J5G A;  2XFT A;  1D6Y A;  4O02 B;  4OK0 A;  5EQL A;  5AII A;  1OH0 A;  3G4S 3;  6STD A;  2QIY A;  3DZL A;  3PS8 A;  1MGR A;  2O9U X;  1TRP A;  1E3V A;  3GZX B;  1K41 A;  1B2Z A;  1IDP A;  3KE7 A;  1TIJ A;  2KRT A;  3SX1 A;  4MMY B;  1UW1 A;  3DH2 A;  3F14 A;  1VQP 3;  3CCM 3;  1IYY A;  2P0X A;  3X3Y A;  1B21 A;  1BSC A;  3S27 A;  4FR9 A;  1VQ4 3;  5BVB A;  2QGU A;  3RGR A;  2WGO A;  3T8U A;  1NNV A;  3EBT A;  2RBI A;  5FW5 A;  3WOE B;  3NM7 A;  1NWW A;  1KC8 4;  4WP5 A;  1I2E A;  2CK3 H;  1EUI C;  3X42 A;  2BNG A;  2Y73 A;  1IVW A;  2CHC A;  4MEI A;  4R4K A;  1BNG A;  4LSO A;  4HYZ A;  1CEW I;  1RRL A;  3PCS A;  2F56 A;  5CF2 A;  3OWU A;  3GRD A;  4K61 A;  2ML6 A;  4HVN A;  3EB8 A;  3BIR A;  1EEJ A;  1FYS A;  4WWU C;  3J7Y d;  2GSP A;  1RNB A;  1GYB A;  1UCK A;  5GSP A;  3JUO A;  4O2H A;  5KP3 A;  3URP A;  2YFJ B;  3CXC 2;  5HOH A;  4PEJ A;  1KWI A;  1QAL A;  1X1W A;  3DXO A;  3EF8 A;  7STD A;  2XEP A;  1SQW A;  3ALA A;  1G96 A;  3CD6 3;  1BUQ A;  1Q7Y 4;  1RKY A;  4N6O B;  3WOF B;  3B4O A;  1F8N A;  3KSP A;  2HML B;  2H0H A;  1RN1 A;  4XBX A;  5CF1 A;  4WYK B;  3L0R A;  1O7W B;  1EA2 A;  1I0X A;  5A0O B;  1JV2 B;  1QJG A;  4HZB B;  4WHA A;  1US1 A;  3F9S A;  2AAD A;  2ML5 A;  1W6C A;  5KP1 A;  3MHE A;  4HM5 B;  1PY3 A;  2XFS A;  3AGO A;  3D5I A;  3CC2 3;  1MOL A;  1J2B A;  1T2H A;  1W7C A;  1BU4 A;  1UCL A;  1SAR A;  1UI7 A;  3KCH A;  3LZA A;  4AKZ A;  1FW7 A;  4X2O A;  1BNS A;  1CYV A;  2W9P A;  2C10 A;  3WHO A;  2XF3 A;  1KD1 4;  1N9J A;  3BU4 A;  1PFP A;  1BNE A;  5IEN A;  1VQ9 3;  3KZT A;  1FUS A;  3CNM A;  1LXE A;  4L7K A;  1ZO2 A;  1W02 A;  3ZG0 A;  3NBB A;  3WA3 A;  1YVS A;  5LC7 A;  2KF6 A;  1VQ8 3;  2GU3 A;  4LEH A;  2R4I A;  1JRQ A;  3MG3 A;  1BRS A;  2LYX A;  5CK6 A;  1I3I A;  3DGO A;  4FCZ A;  3HOH A;  3DGY A;  1OF5 B;  5IER A;  5ELJ A;  2P05 A;  1QAF A;  1GOY A;  3NQZ A;  1MWR A;  2F5M A;  3SED A;  1GY6 A;  1VZZ A;  3DGM A;  1LQM B;  1JN5 A;  3S28 A;  5M18 A;  1IQ8 A;  1MWT A;  1VQN 3;  3NXJ A;  3LYG A;  4K1U A;  2CFL A;  2CWT A;  5D82 A;  1BRK A;  2WOF A;  1R4Y A;  3X3Z A;  4KFD A;  3ER7 A;  3PCR A;  2SBL A;  1TFK A;  2LQV A;  4LMI A;  5BXQ A;  3S67 A;  4BL2 A;  5KP4 A;  3I55 3;  1ROA A;  1ZS7 A;  1IVU A;  1BRG A;  1UCI A;  2GBW B;  2UX0 A;  4LYL B;  1JBT A;  4L8O A;  3M8C A;  1I2G A;  3OXA A;  2GBX B;  5EVH A;  1ULI B;  3OWY A;  3HII A;  2RSX A;  1N8R 4;  3JUN A;  1YJN 3;  1Q86 4;  3MKI A;  1WQL B;  4LGQ A;  1WMP A;  5AIH A;  1WMN A;  2ZA4 A;  3SYU A;  1UUV B;  2SAR A;  3UJM A;  1VQL 3;  4WFO A;  4AEQ A;  4H61 A;  1LNI A;  1YNV X;  3WMD A;  3WA2 X;  2W56 A;  1M9G A;  1ROV A;  2IUK A;  3IPT A;  3N8B A;  4IPB A;  4N3V A;  3HI7 A;  4EW5 A;  2IYJ A;  2P0M A;  5JPP A;  1TTO A;  5DRE A;  2RGQ A;  3CCR 3;  1GMR A;  3EHC A;  2HMM B;  4RNT A;  3JUQ A;  1PU4 A;  1NB3 I;  1YI2 3;  1MNL A;  3F8X A;  5D83 A;  1RMS A;  1B20 A;  1W01 A;  1HYF A;  3ZG5 A;  1LNH A;  4BTW A;  3U97 A;  1GD4 A;  1V58 A;  1JB2 A;  2E2T A;  1LVN A;  6RNT A;  2CFD A;  3FG1 A;  1HU9 A;  4CCV A;  4MMZ B;  2BT3 A;  3ZFZ A;  1NB5 I;  1QMA A;  3K5T A;  4EBG A;  5M19 A;  3NV0 B;  4ZM8 A;  1M1X B;  3GSP A;  2CFK A;  2XSH B;  3GZR A;  1OUN A;  1LRA A;  3MPH A;  1JZD A;  3F40 A;  2KXG A;  4FMC A;  4XB5 A;  3UL6 A;  1Q9E A;  3F7S A;  5M1A A;  3BLZ A;  1ZX2 A;  1T5Y A;  4EXR A;  3BNE A;  1JJ2 2;  4HKV B;  3SXX A;  1LOV A;  2MF7 A;  1BGS A;  3STD A;  1U5O A;  2B24 B;  3H3H A;  1Q81 4;  1RGL A;  5ELU A;  4RZM A;  1DET A;  2Z76 A;  1LOY A;  1U8C B;  1B2X A;  3OWS A;  1K8A 4;  2IMJ A;  1RRH A;  1W00 A;  3ECF A;  3LH4 A;  3NBR A;  2OQE A;  1JB4 A;  5IEP A;  2CX0 A;  1Z1S A;  3UB1 A;  2OTL 3;  3KN4 A;  2UGI A;  4CDL A;  1DVD A;  1DYU A;  1K73 4;  1IQY A;  4FCM A;  3Q3F A;  4HOH A;  5AYS C;  2OWP A;  2PNC A;  2FXT A;  2KF3 A;  2W0Q A;  1VQK 3;  1IQX A;  3CCQ 3;  3UL5 A;  1K9M 4;  3V99 A;  1RGG A;  4HM8 B;  1AY7 A;  1DMM A;  4KVH A;  4N6M A;  3LTB A;  2XGN A;  3CCL 3;  5G2G A;  1NJI 4;  1QAK A;  4QWT A;  4J8T A;  3K63 A;  1ISK A;  1BNI A;  1IVX A;  1O7G B;  3T8N A;  5IG3 A;  3Q90 A;  1RCK A;  1YGW A;  1D6U A;  1MWU A;  2K54 A;  2KCD A;  3BND A;  3SOY A;  2CH9 A;  3D4A A;  1TJD A;  4HM0 B;  3X40 A;  5D81 A;  3GZY B;  1FUT A;  2INX A;  1W2Z A;  2YX9 A;  1X1U A;  2BO9 B;  4HBR A;  4HM1 B;  1BSB A;  1D6Z A;  1OPY A;  2Y74 A;  1FGT A;  3VGN A;  2CC3 A;  1OAC A;  4U13 A;  3IJE B;  1YIJ 3;  3BNB A;  5G1L A;  2JQ5 A;  3BNC A;  1UUG B;  2OOV A;  2W2C A;  3PZW A;  7RNT A;  1O7P B;  1B27 A;  3I56 3;  5AEW B;  1IT7 A;  1Q82 4;  3OX9 A;  1TU5 A;  4BTY A;  3AHW A;  2UUG C;  2RFR A;  4O8S A;  1GY5 A;  4R1K A;  1SPU A;  2YFI B;  3CME 3;  1A67 A;  2V1L A;  2L4V A;  2BMO B;  3K7C A;  3CPW 2;  3ROB A;  1VQ5 3;  1A2V A;  1BIR A;  1RSN A;  1AVK A;  4BIR A;  1YHQ 3;  1OGZ A;  1EG9 B;  3I0Y A;  4IT7 A;  3CCJ 3;  3CCS 3;  1FA3 A;  4XM4 A;  3FH1 A;  8RNT A;  1RHL A;  1AV4 A;  1FZU A;  3G0K A;  3O8Y A;  3JUP A;  3DM8 A;  1TFO A;  3FLJ A;  4BTX A;  2STD A;  1STF I;  3DUK A;  3U1W A;  3D79 A;  3RNT A;  3MYT A;  5AI1 A;  3X3X A;  1JB5 A;  3G6E 3;  1E3R A;  2HMN B;  2CWV A;  3AMO A;  3FG4 A;  1CQS A;  2XRX B;  1I3F A;  3HX8 A;  3K9M C;  3G16 A;  2Z77 A;  1BRN L;  4XDV A;  4L8P A;  1GOU A;  4HM4 B;  3LTC A;  1RN4 A;  5IEO A;  5IW9 A;  4MJD A;  2QEX 3;  4IIA A;  1JN5 B;  1FGO A;  1FGQ A;  2XSO B;  3LML A;  2YFL B;  2W9Q A;  1LOW A;  3D9R A;  3FCS B;  4HM7 B;  4KFF A;  1EKM A;  2WOH A;  5IG0 A;  1CH0 A;  4GL6 A;  1STD A;  5G1K A;  1R4C A;  3SOA A;  2KF4 A;  4EC6 A;  1KQS 2;  4NRE A;  1RDS A;  2Z6B A;  1SJW A;  3FF2 A;  3CPO A;  3EQQ B;  3CC7 3;  5JBS A;  1RCL A;  2HMJ B;  3AMO B;  1BRJ A;  1QVF 2;  2IUJ A;  4HM6 B;  1BVI A;  2GEX A;  2JDI H;  1HKX A;  1A90 A;  1JBS A;  1GMQ A;  1RN7 A;  3TDG A;  3PYJ A;  1BNF A;  2L1S A;  4JF8 A;  3V98 A;  3HZP A;  3PXM A;  4XBT A;  5RNT A;  3WOD G;  1K28 A;  1IU7 A;  3NBJ A;  3QRD A;  3NM2 A;  2W56 B;  1TRQ A;  4NPB A;  3CMA 3;  1UDI I;  3H51 A;  2WO0 A;  5AEU B;  3PGB A;  3Q1C A;  1GSP A;  1RGH A;  3CCE 3;  3MG2 A;  2FNQ A;  3KFQ C;  5IF6 A;  4OVM A;  1M90 4;  2J8X B;  1B2S A;  2BMR B;  3JUM A;  1RNT A;  1ASK A;  2F4Y A;  3FF0 A;  6GSP A;  1S5A A;  2D1W A;  2K0M A;  3DY5 A;  2B1X B;  1I8V A;  4CJN A;  3SVA A;  1T3B A;  2HMO B;  1IV7 A;  3D5G A;  4J5K A;  2Z7A A;  4XBY A;  3S29 A;  1YJ9 3;  2M7O A;  1LOX A;  3B7C A;  1OHP A;  4R9K A;  3RDE A;  3V92 A;  1W2B 2;  5CXO A;  3E99 A;  1MWS A;  3KSE D;  4ILF A;  5BIR A;  1KSI A;  2W6J H;  3NX0 A;  1OHO A;  1C7H A;  1RGK A;  2CFG A;  3X41 A;  3AHS A;  4RNY A;  5AIF A;  7GSP A;  4GB5 A;  2KAA A;  1AQZ A;  4N6T A;  1I0V A;  3KKG A;  3HIG A;  4XDW A;  5STD A;  1WTH A;  2CW9 A;  1IK3 A;  3Q2P A;  2C11 A;  2KF5 A;  1SIH A;  1UUW B;  4HM2 B;  4FMA A;  5FGO A;  4R9L A;  1VQ6 3;  1BSA A;  1E97 A;  3K0Z A;  4EV2 A;  5BU4 A;  4H3U A;  2F99 A;  4HJL B;  1BSD A;  4WYK A;  1IVV A;  4I4K A;  3QK9 A;  2I9W A;  3EJV A;  1N5P A;  1DMQ A;  3DMC A;  4HZ9 B;  4CPK A;  2XH9 A;  4OUQ A;  2PZV A;  5DRV A;  1VQ7 3;  2RNT A;  4EYC A;  1BNJ A;  1RLS A;  1FGM A;  2MC8 A;  8CHO A;  1W4N A;  1BUJ A;  4N6N B;  2K3D A;  1C54 A;  1UGH I;  1NU3 A;  2GXF A;  3LTA A;  1BOX A;  5IG4 A;  1O7H B;  1Q40 A;  4LZI A;  3LXU X;  2ZDJ A;  2P38 A;  4DKI A;  1WNH A;  3NQY A;  3G71 3;  3CU3 A;  3EN1 B;  4ORL A;  5JPU A;  1GD3 A;  1I2F A;  1V74 A;  1QVG 2;  3G8Z A;  4N6L A;  4STD A;  2C4B A;  1BRH A;  4FMD A;  1V57 A;  1OF5 A;  3RGA A;  1UGI A;  5AIG A;  4X2H A;  2F98 A;  4KFE A;  3NUV A;  3GWR A;  3IMA B;  3B4P A;  4K1V A;  1GY7 A;  3EX9 A;  3FGY A;  1Q7H A;  2GU1 A;  3MG1 A;  1T2I A;  1LQG C;  1N5H A;  2GEY A;  2BIR A;  4JRF A;  1YJW 3;  1NO3 A;  2WGQ A;  1O7N B;  2ZHX B;  2F86 B;  4BL3 A;  1Y4K A;  3JVC A;  2RCD A;  1S72 3;  1GS3 A;  1RGE A;  2O3O A;  3CNX A;  1OHS A;  2BMQ B;  2HOH A;  2CG1 A;  1YVB I;  3B8L A;  4MMX B;  3FG3 A;  1DVC A;  2H0G A;  1CYU A;  1Q40 B;  1B2M A;  1X1X A;  1JZO A;  1JKG A;  2BHM A;  4NHF A;  1A2P A;  1TUH A;  3F7X A;  4N6U A;  2BU4 A;  1WMO A;  3DGL A;  3F8H A;  1N9E A;  4HM3 B;  3WR2 A;  3BB9 A;  1B2U A;  2ZL8 A;  3HK4 A;  1G0T A;  5AYR B;  1DMN A;  1HZ1 A;  1OGX A;  1AVL A;  1RGC A;  2CWU A;  3FKA A;  3KII A;  2OTJ 3;  2F5W A;  2OQE C;  3NHX A;  3SLU A;  5HGR A;  1Q42 A;  3LT9 A;  4K90 B;  3WDG B;  3EBY A;  2IA7 A;  1X1Y A;  4FMB A;  3LT8 A;  1GOV A;  3MSO A;  1JBR A;  1NDO B;  4HAA A;  1YGE A;  1ZGX A;  5EEO A;  3OV4 A;  3DGN A;  2IY2 A;  1FGR A;  1AR0 A;  3EE1 A;  5IG5 A;  3LOY A;  2QA4 3;  4EV5 A;  2D42 A;  1EQK A;  1G02 A;  3OW2 2;  2HMK B;  1VQM 3;  4KZ1 A;  1W5Z A;  2AAE A;  1RJO A;  2H0I A;  4AKY A;  5TGN A;  1B3S A;  4I5Q A;  1JKG B;  2E2U A;  3N9H A;  3VF1 A;  3CCU 3;  1O7M B;  4GHO A;  2OCT A;  1BRI A; 
#chains in the Genus database with same CATH homology
 3N54 B;  3CC4 3;  1W6G A;  3T0U A;  2W03 A;  1IV9 A;  2XGL A;  4Q53 A;  3LTD A;  1UI8 A;  3GAX A;  5IG5 A;  2CKF B;  3EC9 A;  3NV0 A;  4N6V 0;  4TX4 A;  3UNL A;  1N8Q A;  1VQO 3;  2CFW A;  4R80 A;  2A15 A;  4J9A A;  5CLK A;  1A2K A;  5LC6 A;  2W04 A;  2CIU A;  3S5C A;  1ULJ B;  1JNQ A;  1L5G B;  1W6Y A;  1FUW A;  4FCJ A;  4O3V A;  2XR8 B;  1YIT 3;  1IT8 A;  5I97 A;  3EN8 A;  2OOV C;  2Q07 A;  2FGT A;  2E2V A;  4G1M B;  2P09 A;  3VSY A;  1M1K 4;  1SII A;  3FZW A;  4RNZ A;  4RBN A;  3A76 A;  3FSD A;  3MWZ A;  3D3L A;  1OCV A;  3GZB A;  3CCV 3;  1TP6 A;  2XFT A;  1D6Y A;  4O02 B;  4OK0 A;  5EQL A;  5AII A;  1OH0 A;  3G4S 3;  6STD A;  2QIY A;  3DZL A;  3PS8 A;  2O9U X;  1E3V A;  3GZX B;  1K41 A;  1IDP A;  3KE7 A;  1TIJ A;  2KRT A;  3SX1 A;  4MMY B;  1UW1 A;  3F14 A;  3CCM 3;  2P0X A;  3X3Y A;  3S27 A;  1VQ4 3;  4FR9 A;  5BVB A;  2QGU A;  3RGR A;  2WGO A;  3T8U A;  3EBT A;  5FW5 A;  3WOE B;  3NM7 A;  1NWW A;  1KC8 4;  4WP5 A;  2CK3 H;  3X42 A;  2BNG A;  2Y73 A;  1IVW A;  2CHC A;  4MEI A;  4R4K A;  4LSO A;  4HYZ A;  1CEW I;  1RRL A;  3PCS A;  5CF2 A;  3OWU A;  3GRD A;  4K61 A;  2ML6 A;  4HVN A;  3EB8 A;  4WWU C;  3J7Y d;  1GYB A;  3CXC 2;  3JUO A;  4O2H A;  5KP3 A;  2YFJ B;  4PEJ A;  1KWI A;  1QAL A;  3DXO A;  3EF8 A;  7STD A;  2XEP A;  1SQW A;  3ALA A;  1G96 A;  3CD6 3;  1BUQ A;  1Q7Y 4;  1RKY A;  4N6O B;  3WOF B;  3B4O A;  1F8N A;  3KSP A;  2HML B;  4XBX A;  5CF1 A;  4WYK B;  3L0R A;  1O7W B;  1EA2 A;  5A0O B;  1JV2 B;  1QJG A;  4HZB B;  4WHA A;  1US1 A;  3F9S A;  2ML5 A;  1W6C A;  5KP1 A;  3MHE A;  4HM5 B;  2XFS A;  3CC2 3;  1MOL A;  1J2B A;  1W7C A;  1UI7 A;  4AKZ A;  3LZA A;  4X2O A;  1CYV A;  2W9P A;  2C10 A;  2XF3 A;  1KD1 4;  1N9J A;  1PFP A;  1VQ9 3;  3KZT A;  3CNM A;  4L7K A;  1LXE A;  3WA3 A;  1ZO2 A;  1W02 A;  3NBB A;  5LC7 A;  1VQ8 3;  2GU3 A;  4LEH A;  2R4I A;  1JRQ A;  3MG3 A;  2LYX A;  5CK6 A;  5IER A;  4FCZ A;  3DGO A;  1VQP 3;  1OF5 B;  5ELJ A;  2P05 A;  1QAF A;  3NQZ A;  3SED A;  1GY6 A;  1VZZ A;  3DGM A;  1JN5 A;  3S28 A;  1IQ8 A;  1VQN 3;  3NXJ A;  3LYG A;  4K1U A;  2CFL A;  2CWT A;  5D82 A;  2WOF A;  3X3Z A;  4KFD A;  3ER7 A;  3PCR A;  2SBL A;  1TFK A;  2LQV A;  4LMI A;  5BXQ A;  3S67 A;  5KP4 A;  3I55 3;  1ROA A;  1IVU A;  2GBW B;  2UX0 A;  4L8O A;  3M8C A;  3OXA A;  2GBX B;  5EVH A;  1ULI B;  3OWY A;  3HII A;  2RSX A;  1N8R 4;  3JUN A;  1YJN 3;  1Q86 4;  3MKI A;  1WQL B;  4LGQ A;  1WMP A;  5AIH A;  1WMN A;  1UUV B;  3UJM A;  1VQL 3;  4WFO A;  4AEQ A;  4H61 A;  3WMD A;  3WA2 X;  2W56 A;  1M9G A;  1ROV A;  2IUK A;  3IPT A;  3N8B A;  4IPB A;  4N3V A;  3HI7 A;  2P0M A;  5JPP A;  5DRE A;  2RGQ A;  3CCR 3;  3EHC A;  2HMM B;  3JUQ A;  1PU4 A;  1NB3 I;  1YI2 3;  1MNL A;  3F8X A;  5D83 A;  1W01 A;  1LNH A;  4BTW A;  3U97 A;  1GD4 A;  1JB2 A;  2E2T A;  1LVN A;  2CFD A;  3FG1 A;  1HU9 A;  4CCV A;  4MMZ B;  2BT3 A;  1NB5 I;  1QMA A;  3K5T A;  4EBG A;  3NV0 B;  4ZM8 A;  1M1X B;  3GZR A;  2CFK A;  2XSH B;  5IG0 A;  1OUN A;  3UL6 A;  3MPH A;  3F40 A;  4FMC A;  2KXG A;  4XB5 A;  3F7S A;  3BLZ A;  1ZX2 A;  1T5Y A;  4EXR A;  3BNE A;  1JJ2 2;  4HKV B;  3SXX A;  2MF7 A;  3STD A;  1U5O A;  2B24 B;  3H3H A;  1Q81 4;  5ELU A;  4RZM A;  2Z76 A;  1U8C B;  3OWS A;  1K8A 4;  2IMJ A;  1RRH A;  1W00 A;  3ECF A;  3LH4 A;  3NBR A;  2OQE A;  1JB4 A;  5IEP A;  1Z1S A;  3UB1 A;  2OTL 3;  3KN4 A;  4CDL A;  1DVD A;  1DYU A;  1K73 4;  1IQY A;  4FCM A;  5AYS C;  2OWP A;  2PNC A;  2FXT A;  2W0Q A;  1VQK 3;  1IQX A;  3CCQ 3;  3UL5 A;  1K9M 4;  3V99 A;  4HM8 B;  4KVH A;  1DMM A;  4N6M A;  3LTB A;  2XGN A;  3CCL 3;  5G2G A;  1NJI 4;  1QAK A;  1O7M B;  4QWT A;  4J8T A;  3K63 A;  1ISK A;  1IVX A;  1O7G B;  3T8N A;  5IG3 A;  3Q90 A;  2K54 A;  1D6U A;  3SOY A;  2KCD A;  3BND A;  2CH9 A;  4HM0 B;  3X40 A;  5D81 A;  3GZY B;  2INX A;  1W2Z A;  2YX9 A;  2BO9 B;  4HBR A;  4HM1 B;  1D6Z A;  1OPY A;  2Y74 A;  1FGT A;  3VGN A;  2CC3 A;  1OAC A;  4U13 A;  3IJE B;  1YIJ 3;  3BNB A;  2JQ5 A;  3BNC A;  2OOV A;  2W2C A;  3PZW A;  1O7P B;  3I56 3;  5AEW B;  1IT7 A;  1Q82 4;  3OX9 A;  1TU5 A;  4BTY A;  2RFR A;  4O8S A;  1GY5 A;  4R1K A;  1SPU A;  2YFI B;  3CME 3;  1A67 A;  2V1L A;  2L4V A;  2BMO B;  3K7C A;  3CPW 2;  3ROB A;  1VQ5 3;  1A2V A;  1AVK A;  1YHQ 3;  1OGZ A;  1EG9 B;  3I0Y A;  4IT7 A;  3CCJ 3;  3CCS 3;  1FA3 A;  4XM4 A;  3FH1 A;  1AV4 A;  3G0K A;  3O8Y A;  3JUP A;  3DM8 A;  1TFO A;  3FLJ A;  4BTX A;  2STD A;  1STF I;  3DUK A;  3U1W A;  3MYT A;  5AI1 A;  3X3X A;  1JB5 A;  3G6E 3;  1E3R A;  2HMN B;  2CWV A;  3AMO A;  3FG4 A;  1CQS A;  2XRX B;  3HX8 A;  3K9M C;  3G16 A;  2Z77 A;  4XDV A;  4L8P A;  5IEO A;  4HM4 B;  3LTC A;  5IW9 A;  4MJD A;  2QEX 3;  4IIA A;  1JN5 B;  1FGO A;  1FGQ A;  2XSO B;  3LML A;  2YFL B;  2W9Q A;  3D9R A;  3FCS B;  4HM7 B;  4KFF A;  1EKM A;  2WOH A;  4GL6 A;  1STD A;  1R4C A;  3SOA A;  4EC6 A;  1KQS 2;  4NRE A;  2Z6B A;  1SJW A;  3FF2 A;  3CPO A;  3EQQ B;  3CC7 3;  5JBS A;  2HMJ B;  3AMO B;  1QVF 2;  2IUJ A;  4HM6 B;  2GEX A;  2JDI H;  1HKX A;  1A90 A;  1RN7 A;  3TDG A;  3PYJ A;  4JF8 A;  3V98 A;  3HZP A;  3PXM A;  4XBT A;  3WOD G;  1K28 A;  1IU7 A;  3NBJ A;  3QRD A;  3NM2 A;  2W56 B;  3CMA 3;  3H51 A;  2WO0 A;  5AEU B;  3PGB A;  3Q1C A;  3CCE 3;  3MG2 A;  2FNQ A;  3KFQ C;  5IF6 A;  4OVM A;  1M90 4;  2BMR B;  3JUM A;  1ASK A;  3FF0 A;  1S5A A;  2D1W A;  2K0M A;  3DY5 A;  2B1X B;  3SVA A;  2HMO B;  1IV7 A;  4XBY A;  3S29 A;  2Z7A A;  1YJ9 3;  2M7O A;  1LOX A;  3B7C A;  1OHP A;  4R9K A;  3RDE A;  3V92 A;  1W2B 2;  5CXO A;  3E99 A;  3KSE D;  1KSI A;  2W6J H;  3NX0 A;  1OHO A;  1C7H A;  2CFG A;  3X41 A;  4RNY A;  5AIF A;  4GB5 A;  5IEN A;  4XDW A;  4N6T A;  5STD A;  3KKG A;  3HIG A;  1IK3 A;  1WTH A;  2CW9 A;  3Q2P A;  2C11 A;  1SIH A;  1UUW B;  4HM2 B;  4FMA A;  5FGO A;  4R9L A;  1VQ6 3;  1E97 A;  3K0Z A;  4EV2 A;  4H3U A;  2F99 A;  4HJL B;  4WYK A;  1IVV A;  4I4K A;  3QK9 A;  2I9W A;  3EJV A;  1N5P A;  1DMQ A;  3DMC A;  4HZ9 B;  2XH9 A;  4OUQ A;  2PZV A;  5DRV A;  1VQ7 3;  4EYC A;  1FGM A;  2MC8 A;  8CHO A;  1W4N A;  4N6N B;  1NU3 A;  2GXF A;  3LTA A;  5IG4 A;  1O7H B;  1Q40 A;  4LZI A;  3LXU X;  2ZDJ A;  2P38 A;  1WNH A;  3NQY A;  3G71 3;  3CU3 A;  3EN1 B;  4ORL A;  5JPU A;  1GD3 A;  1V74 A;  1QVG 2;  3G8Z A;  4N6L A;  4STD A;  4FMD A;  1OF5 A;  3RGA A;  5AIG A;  4X2H A;  2F98 A;  4KFE A;  3NUV A;  3GWR A;  3IMA B;  3B4P A;  4K1V A;  1GY7 A;  3EX9 A;  3FGY A;  2GU1 A;  3MG1 A;  2GEY A;  1N5H A;  4JRF A;  1YJW 3;  1NO3 A;  2WGQ A;  1O7N B;  2F86 B;  1Y4K A;  3JVC A;  2RCD A;  1S72 3;  1GS3 A;  2O3O A;  3CNX A;  1OHS A;  2BMQ B;  2CG1 A;  1YVB I;  3B8L A;  4MMX B;  3FG3 A;  1DVC A;  1CYU A;  1Q40 B;  1JKG A;  2BHM A;  4NHF A;  1TUH A;  3F7X A;  4N6U A;  1WMO A;  3DGL A;  3F8H A;  1N9E A;  4HM3 B;  3BB9 A;  2ZL8 A;  3HK4 A;  5AYR B;  1DMN A;  1OGX A;  3KII A;  1AVL A;  2CWU A;  3FKA A;  2OTJ 3;  2OQE C;  3NHX A;  3SLU A;  5HGR A;  1Q42 A;  3LT9 A;  4K90 B;  3WDG B;  3EBY A;  2IA7 A;  4FMB A;  3LT8 A;  3MSO A;  1NDO B;  1YGE A;  5EEO A;  3OV4 A;  3DGN A;  1FGR A;  1AR0 A;  3EE1 A;  3LOY A;  2QA4 3;  4EV5 A;  2D42 A;  1EQK A;  3OW2 2;  2HMK B;  1VQM 3;  4KZ1 A;  1W5Z A;  1RJO A;  4AKY A;  5TGN A;  3VF1 A;  3CCU 3;  1JKG B;  2E2U A;  3N9H A;  2CG0 A;  2OCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...