3NQYA

Crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
174
Chain Sequence
ANKKYLNQQPTINNMVQSNVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 33
structure length 174
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqyA01
2CWVA 4KFEA 1A2VA 1N9EA 3KIIA 1WMPA 2WOHA 2IA7A 1SIHA 1SIIA 3K5TA 3NQZA 1W6CA 3NBJA 1IQXA 1D6ZA 4KFDA 1OACA 3T0UA 3WA3A 3MPHA 1IQYA 4EV2A 1AVLA 2CFLA 1QAKA 1KSIA 1EKMA 3KN4A 3X3ZA 1IVVA 1AV4A 1IVUA 3X42A 4BTXA 1UI7A 2WGQA 3AMOA 4KFFA 1IU7A 1QAFA 1PU4A 1IVXA 3HIIA 1JRQA 2CFGA 4BTYA 1WMOA 2C10A 3NQYA 3N9HA 3ALAA 1WMNA 2CWTA 2GU3A 1RJOA 2OQEC 3AMOB 5IW9A 2E2VA 1D6UA 1US1A 2K0MA 2E2UA 1W6GA 2WO0A 4BTWA 1RKYA 1W5ZA 2YX9A 2CG0A 3HI7A 3HIGA 3X3YA 2CWUA 3WA2X 2Y74A 2C11A 3SX1A 1SPUA 3LOYA 1LVNA 3X3XA 3NBBA 2ZL8A 3SXXA 4EXRA 3X40A 1W4NA 4K90B 1AVKA 2BT3A 2E2TA 2PNCA 1D6YA 2D1WA 1IVWA 2Y73A 1UI8A 3X41A 2OQEA 1TU5A 1W2ZA 1QALA 1DYUA 2CFDA 2WOFA 2CFKA 2W0QA 2OOVC 2CFWA 4EV5A 2CG1A 1W7CA 2OOVA 3PGBA
chains in the Genus database with same CATH superfamily
2CWVA 2P0MA 1NU3A 2GBXB 5JPPA 4KFEA 1A2VA 1N9EA 2BMOB 5BXQA 1KQS2 1F8NA 1JB5A 4J9AA 1MOLA 3EBYA 2WOHA 3I0YA 2IA7A 4K1UA 3I553 3O8YA 3CNMA 2GSPA 1IV9A 2GEYA 2CH9A 1ZGXA 1HKXA 3K5TA 4N6TA 3HZPA 3IPTA 2HMNB 1SJWA 5EQLA 3PCSA 1NO3A 2RCDA 5AYRB 3JVCA 3LTCA 5AI1A 4FCJA 3B7CA 1D6ZA 2Z77A 4LZIA 5AYSC 4CJNA 1TJDA 2XF3A 3MKIA 1IQYA 2XRXB 1ZS7A 1OUNA 1V57A 3QK9A 2ML6A 3Q90A 1TRQA 3G16A 3KKGA 4OK0A 1T3BA 4EBGA 2CFLA 2C4BA 2XFTA 7RNTA 1KSIA 3OXAA 1HYFA 1LQMB 2FNQA 3U1WA 1TFKA 3G713 1RCLA 4JRFA 4HVNA 1YJW3 1IVUA 2L1SA 3TDGA 3X42A 3MG3A 1I3IA 1AY7A 1RTUA 1RSNA 3HK4A 2WGQA 1RGEA 1Q9EA 3AMOA 3CME3 1QAFA 1PU4A 1O7WB 1I0VA 4HZ9B 3HIIA 1JRQA 2Z76A 4ZM8A 3DH2A 4XBTA 1DE3A 4BTYA 3NQYA 2C10A 5JPUA 1EQKA 2CWTA 3UB1A 5DREA 2GU3A 1YNVX 3IJEB 2K3DA 1RJOA 5FGOA 3BNEA 2OQEC 3H51A 3AMOB 3EBTA 1BRSA 1CQSA 2H0HA 2BIRA 2LQVA 4LSOA 1B2ZA 1W6GA 1NJI4 1B21A 1RNTA 2KF4A 3NUVA 4J8TA 1TP6A 3D5GA 3DGLA 3S5CA 2FXTA 1W5ZA 1UUVB 2YX9A 4BU4A 2CG0A 3AGOA 1ROAA 4U13A 1CH0A 3FG4A 1Y4KA 1O7MB 1ZO2A 1IYYA 1O7GB 1GOVA 3S28A 3WHOA 4R9KA 3SX1A 1I2GA 1EG9B 3FKAA 1KWIA 2ZL8A 1YJ93 1QVF2 3S67A 3JUPA 1W00A 4CDLA 2CKFB 1IT8A 1W4NA 2IYJA 3OWYA 4MMYB 2MF7A 3CU3A 4L8OA 1T2IA 4LYLB 1LOWA 4R9LA 2E2TA 1GY7A 4CCVA 2D1WA 2HMOB 2L4VA 2P05A 3LTBA 1IVWA 1RGCA 1YGEA 1BRGA 3G6E3 2YFLB 1IV7A 1N8R4 3F14A 3A76A 1T2HA 1V74A 4QWTA 1M904 5CXOA 2Z7AA 3KE7A 1W2ZA 1FUTA 3LT9A 3S29A 5BVBA 1ASKA 1RRLA 3EQQB 1JJ22 1AQZA 4KT3B 1Q814 1PFPA 3VGNA 3ECFA 2IUKA 3CCM3 3BB9A 3OV4A 4N6NB 2OOVC 1B20A 1MWTA 3LTAA 2LYXA 4LEHA 1DVCA 1Q824 1B2UA 1GY6A 3LTDA 3CCQ3 4IT7A 1YIT3 1LQGC 1A90A 1MWRA 1RGKA 2KAAA 4RBNA 5BIRA 3CCR3 3FCSB 1R4CA 3PGBA 2BMQB 1MNLA 3MWZA 7STDA 2CIUA 2XFSA 3MHEA 3KFQC 2O9UX 5FW5A 1MWSA 3SEDA 3ZFZA 3KIIA 1FGMA 1VQP3 1WMPA 3DGNA 1KD14 1S723 3JUMA 3DGYA 3SOAA 1A2PA 1SIIA 4R1KA 1BSEA 1LNHA 2KF6A 3EN8A 3KCHA 4NPBA 1MGWA 2F5MA 2OTL3 5AIGA 3SVAA 1EUIC 1YJN3 1OACA 3T0UA 1A67A 3F40A 2D42A 1JZOA 4HBRA 1IK3A 1RNBA 5D81A 1RGGA 4EV2A 4XBYA 1RGFA 3KZTA 1E3VA 1EKMA 3V99A 2KRTA 3LZAA 2HMMB 4GB5A 3PCRA 3CC73 3K9MC 1JBSA 1VQ93 4OUQA 1RGAA 4HAAA 1BNIA 2W9QA 4HZBB 1STFI 3GZXB 5IERA 5DRVA 1C54A 1GOUA 4HM4B 1YGWA 2RNTA 3DZLA 2H0GA 4LGQA 3UNLA 3MG2A 2CX1A 5IEOA 1YI23 3CD63 1R4YA 3N9HA 3ALAA 5IG4A 1VZZA 4NREA 3B8LA 1JV2B 4DKIA 3GZBA 3NXJA 4J5KA 3STDA 3G4S3 4O3VA 2H0IA 1UGIA 8CHOA 2AAEA 2CW9A 2GBWB 1D6UA 1JZDA 3AGNA 1VQO3 1B2MA 3LYGA 3SOYA 1BUJA 4RZMA 5CK6A 4N6OB 1HZ1A 3OW22 1Q7Y4 3JUNA 3L0RA 1BVIA 1G96A 5IG0A 1CEWI 1BANA 4I4KA 1I2EA 2KF3A 2CC3A 3URPA 1VQQA 4HKVB 3X3YA 1O7HB 2CWUA 3CPW2 1GMQA 1K734 3S27A 1VQ83 1I3FA 2RFRA 3GAXA 3V92A 1JBTA 2ZHXB 3PYJA 1GYBA 1QMAA 3SXXA 4BIRA 4XB5A 1CYUA 1N5PA 2SARA 3F7XA 1FUWA 1DMQA 1BNJA 3B4OA 4K90B 3WMDA 2W2CA 3WODG 2MC8A 3JUQA 1WTHA 1I8VA 2RBIA 3NV0A 3RGRA 1W01A 2QEX3 3OX9A 5KP4A 5IG3A 4KVHA 3K0ZA 1RGHA 6STDA 1Z1SA 2BU4A 1LRAA 2Y73A 1SQWA 5G2GA 4FMAA 3OWSA 4XM4A 1UW1A 1OHSA 4MMXB 3N54B 1FGTA 3FF2A 1W02A 3NM7A 4XBXA 5EVHA 3WOEB 3CCV3 3MYTA 2UX0A 1BNGA 1OGXA 3EX9A 3FZWA 4JF8A 3AHSA 3NV0B 1K41A 5AIHA 2HMLB 3EJVA 1TTOA 1UCKA 3UL6A 3CCU3 1FW7A 3D9RA 1JNQA 5AIFA 5ELUA 1N5HA 1X1YA 1BNSA 4J5GA 1VQ53 1G02A 4GSPA 3DY5A 2OTJ3 1I2FA 3GRDA 3NX0A 1QVG2 4K1VA 2KXGA 1RLSA 2PZVA 3F8XA 3GWRA 1OCVA 2OWPA 1X1WA 1JN5A 2A15A 2CG1A 1TFOA 4RNYA 3JUOA 3LXUX 3VSYA 5JBSA 3DM8A 3F9SA 8RNTA 1E97A 3U97A 5ELJA 1LXEA 4EW5A 1GD3A 1OF5A 1GOYA 1UCJA 2F99A 3SLUA 4WWUC 2F5WA 4STDA 1EA2A 3FLJA 1LNIA 1JN5B 2F98A 1SIHA 3K63A 1LOXA 4L7KA 1VQN3 3D4AA 3NQZA 3E99A 1OPYA 1GY5A 4HM3B 1RRHA 2ZA4A 4K61A 1N9JA 1OF5B 3NBJA 2W03A 5BU4A 2CK3H 3I563 1FGRA 1GSPA 4N6MA 4NHFA 3T8NA 3WA3A 3MPHA 1DMMA 3F8HA 4EYCA 2J8XB 2W6JH 4HM1B 1RN4A 1UUWB 5A0OB 1QAKA 3FG1A 3N8BA 3FH1A 3X3ZA 3KN4A 1VQM3 2V1LA 5G1LA 3ZG0A 1AV4A 2GXFA 2QA43 1UCIA 1ULJB 2BMRB 5TGNA 4O8SA 1YIJ3 4HM2B 4BTXA 1TRPA 2P0XA 4FR9A 4AEQA 1IVXA 4OVMA 2BHMA 1BNFA 1Q40A 3HX8A 5M1AA 3VF1A 3DXOA 1WNHA 3D3LA 2GU1A 4FMCA 1HU9A 1YVSA 5I97A 5AEUB 1WMOA 3F7SA 4KZ1A 4AKZA 2UUGC 3FG3A 1BRJA 1VQL3 3UJMA 2B1XB 3EF8A 5IW9A 2E2VA 1BGSA 3CPOA 1Q40B 1US1A 1FGQA 2K0MA 1RGLA 2E2UA 1BNRA 2GEXA 3BNCA 2WO0A 2ZDJA 3CNXA 5M18A 2R4IA 4GHOA 5CF1A 3CCL3 1VQ73 3FGYA 2STDA 2INXA 3HI7A 1X1UA 2F56A 3D79A 5HOHA 5CF2A 2AADA 2C11A 3GSPA 2RSXA 3PXMA 4XDWA 5IEPA 1K8A4 1SPUA 3AHWA 3LOYA 1LVNA 3X3XA 3NBBA 1G0TA 1K28A 3EC9A 4EXRA 1VQ43 1JB2A 5CLKA 3NHXA 1V58A 5M19A 1X1XA 1QJGA 2IY2A 2PNCA 4HM5B 1D6YA 4FMBA 4TX4A 2FGTA 3CC43 4GL6A 4N6V0 1UI8A 4AKYA 4R80A 1T5YA 2IUJA 1Q42A 3X41A 1W6YA 2Z6BA 1IQ8A 5G1KA 1TU5A 1A2KA 3GZRA 3BLZA 3ZG5A 3Q3FA 1FYSA 3OWUA 1B2XA 1DETA 2XGLA 1DYUA 3RGAA 2K54A 1UDII 2ML5A 1JKGA 2WOFA 1NNVA 2QGUA 3ROBA 1NWWA 3PZWA 4Q53A 5GSPA 1I0XA 1B3SA 1E3RA 4XDVA 1TUHA 6RNTA 6GSPA 5KP3A 5LC7A 2WGOA 4MJDA 3CCJ3 1CYVA 1OH0A 4N6UA 1PY3A 3EN1B 5D82A 4BL3A 2OOVA 1JKGB 4X2HA 3ER7A 4FCMA 4RNTA 1KC84 1BUQA 2W56A 1S5AA 1UUGB 2O3OA 3G0KA 5LC6A 1LOYA 5IENA 3CCE3 1FA3A 3RNTA 3BNDA 3IMAB 1VQK3 1VQ63 1SARA 1GMRA 1GMPA 4MEIA 3FF0A 1O7NB 4HM6B 3BNBA 2M7OA 3Q1CA 3NM2A 1W6CA 4L8PA 1WQLB 3EHCA 1IDPA 1DMNA 3A5EA 4HM0B 2IMJA 2W56B 1B2SA 1BSAA 1U8CB 1IQXA 1GD4A 2W04A 3M8CA 4KFDA 4H3UA 1IT7A 2YFJB 4G1MB 4HYZA 4I5QA 3SYUA 1AVLA 5AIIA 2JDIH 2KCDA 1K9M4 1BSBA 1IVVA 1BSCA 3EB8A 4HOHA 5STDA 1ZX2A 2XH9A 1UGHI 2QIYA 3B4PA 1UI7A 1BRNL 1BOXA 1GS3A 1RCKA 1NB3I 4HJLB 1IU7A 4KFFA 1Q864 1DVDA 7GSPA 1RMSA 2XSHB 1YHQ3 2JQ5A 3MSOA 3GZYB 2CFGA 1NB5I 1C7HA 3LMLA 1J2BA 1O7PB 1OHOA 2HOHA 4R4KA 1WMNA 2CHCA 3DGMA 5HGRA 1BIRA 3DMCA 4ILFA 2XGNA 4H61A 2I9WA 3WDGB 5D83A 4HM7B 2KF5A 9RNTA 4PEJA 1U5OA 5EEOA 3WOFB 1FGOA 1EEJA 3UL5A 1BNEA 4N3VA 2SBLA 3H3HA 3CMA3 4BTWA 4LMIA 1RKYA 2XR8B 3BU4A 1ISKA 4IPBA 1M9GA 3K7CA 5IG5A 3EE1A 3BIRA 3HIGA 2B24B 4WP5A 3PS8A 3WA2X 1FZUA 2Y74A 3LH4A 4N6LA 3T8UA 1JBRA 2RGQA 1BSDA 3MG1A 4ORLA 1RDSA 1N8QA 1JB4A 4BL2A 3DUKA 3CC23 3X40A 1NDOB 1RN7A 3FSDA 4CPKA 1STDA 1AVKA 1RHLA 1LOVA 2BO9B 1PYLA 1UCLA 2BT3A 2R41A 4IIAA 1MGRA 1M1K4 4WFOA 3Q2PA 1Q7HA 2HMJB 3NBRA 4HM8B 4O02B 2BNGA 3KSED 3KSPA 3V98A 5AEWB 5KP1A 1ROVA 3CXC2 4WYKA 2XSOB 1OHPA 3G8ZA 2OQEA 1BRHA 1L5GB 2UGIA 2F4YA 1AR0A 3LT8A 1BAOA 1QALA 2P38A 1MWUA 1OGZA 2W9PA 3QRDA 2HMKB 5RNTA 1FUSA 1B27A 2CFDA 4FCZA 3HOHA 5IF6A 1BRIA 4FMDA 4O2HA 2CFKA 4WYKB 2OCTA 2W0QA 1ULIB 1M1XB 1TIJA 4EC6A 2XEPA 1I70A 2CX0A 4WHAA 3RDEA 3WR2A 3CCS3 2CFWA 2F86B 2YFIB 4EV5A 1W2B2 1YVBI 1W7CA 3DGOA 4X2OA 3J7Yd 4MMZB 2P09A 1BU4A 2Q07A 1BRKA 1RN1A 4RNZA 3D5IA
chains in the Genus database with same CATH topology
2CWVA 2P0MA 1NU3A 2GBXB 5JPPA 4KFEA 1A2VA 1N9EA 2BMOB 5BXQA 1KQS2 1F8NA 1JB5A 4J9AA 1MOLA 3EBYA 2WOHA 3I0YA 2IA7A 4K1UA 3I553 3O8YA 3CNMA 4N6TA 1IV9A 2GEYA 2CH9A 3K5TA 1HKXA 5EQLA 1YI23 3HZPA 3IPTA 2HMNB 1SJWA 3PCSA 1NO3A 2RCDA 5AYRB 3JVCA 3LTCA 5AI1A 4FCJA 3B7CA 1D6ZA 2Z77A 4LZIA 5AYSC 2XF3A 3MKIA 1IQYA 2XRXB 1OUNA 3QK9A 2ML6A 3Q90A 3G16A 3KKGA 4OK0A 4EBGA 2CFLA 2XFTA 1KSIA 3OXAA 2FNQA 3U1WA 1TFKA 3G713 4JRFA 4HVNA 1YJW3 1IVUA 3TDGA 3X42A 3MG3A 3HK4A 2WGQA 3AMOA 3CME3 1QAFA 1PU4A 1O7WB 4HZ9B 3HIIA 1JRQA 2Z76A 4ZM8A 4XBTA 4BTYA 3NQYA 2C10A 5JPUA 1EQKA 2CWTA 3UB1A 5DREA 2GU3A 3IJEB 1RJOA 5FGOA 3BNEA 2OQEC 3H51A 3AMOB 3EBTA 1CQSA 2LQVA 4LSOA 1W6GA 1NJI4 3NUVA 4J8TA 1TP6A 3DGLA 3S5CA 2FXTA 1W5ZA 1UUVB 2YX9A 2CG0A 1ROAA 4U13A 3FG4A 1Y4KA 1O7MB 1ZO2A 1O7GB 3S28A 4R9KA 3SX1A 1EG9B 3FKAA 1KWIA 2ZL8A 1YJ93 1QVF2 3S67A 3JUPA 1W00A 4CDLA 2CKFB 1IT8A 1W4NA 3OWYA 4MMYB 2MF7A 3CU3A 4L8OA 4R9LA 2E2TA 1GY7A 4CCVA 2D1WA 2HMOB 2L4VA 2P05A 3LTBA 1IVWA 1YGEA 3G6E3 2YFLB 1IV7A 1N8R4 3F14A 3A76A 4QWTA 1V74A 1M904 5CXOA 2Z7AA 3KE7A 1W2ZA 3LT9A 3S29A 5BVBA 1ASKA 1RRLA 3EQQB 1JJ22 1Q814 1PFPA 3VGNA 3ECFA 2IUKA 3CCM3 3BB9A 3OV4A 4N6NB 2OOVC 3LTAA 2LYXA 4LEHA 1DVCA 1Q824 1GY6A 3LTDA 3CCQ3 4IT7A 1YIT3 1A90A 3CCR3 4RBNA 3FCSB 1R4CA 3PGBA 2BMQB 1MNLA 3MWZA 7STDA 2CIUA 2XFSA 3MHEA 3KFQC 2O9UX 5FW5A 3SEDA 1VQP3 3KIIA 1FGMA 1WMPA 3DGNA 1KD14 1S723 3JUMA 3SOAA 1SIIA 4R1KA 1LNHA 3EN8A 2OTL3 5AIGA 3SVAA 1YJN3 1OACA 3T0UA 1A67A 3F40A 2D42A 4HBRA 1IK3A 5D81A 4EV2A 4XBYA 3KZTA 1E3VA 1EKMA 3V99A 2KRTA 3LZAA 2HMMB 4GB5A 3PCRA 3CC73 3K9MC 1VQ93 4OUQA 2W9QA 4HZBB 1STFI 3GZXB 5IERA 5DRVA 4HM4B 3DZLA 4LGQA 3UNLA 3CD63 3MG2A 5IEOA 3N9HA 3ALAA 5IG4A 1VZZA 4NREA 3B8LA 1JV2B 3GZBA 3NXJA 3STDA 3G4S3 4O3VA 8CHOA 2CW9A 2GBWB 1D6UA 1VQO3 3LYGA 3SOYA 4RZMA 5CK6A 4N6OB 3OW22 1Q7Y4 3JUNA 3L0RA 1G96A 5IG0A 1CEWI 4I4KA 2CC3A 4HKVB 3X3YA 1O7HB 2CWUA 3CPW2 1VQ83 1K734 3S27A 2RFRA 3GAXA 3V92A 3PYJA 1GYBA 1QMAA 3SXXA 4XB5A 1CYUA 1N5PA 3F7XA 1FUWA 1DMQA 3B4OA 4K90B 3WMDA 2W2CA 3WODG 2MC8A 3JUQA 1WTHA 3RGRA 3NV0A 1W01A 2QEX3 3OX9A 5KP4A 5IG3A 4KVHA 3K0ZA 6STDA 1Z1SA 2Y73A 1SQWA 5G2GA 4FMAA 3OWSA 4XM4A 1UW1A 1OHSA 4MMXB 3N54B 1FGTA 3FF2A 1W02A 3NM7A 4XBXA 5EVHA 3WOEB 3CCV3 3MYTA 2UX0A 4JF8A 1OGXA 3EX9A 3FZWA 3NV0B 1K41A 5AIHA 2HMLB 3EJVA 3CCU3 3UL6A 3D9RA 1JNQA 5AIFA 5ELUA 1N5HA 1VQ53 3DY5A 2OTJ3 3NX0A 3GRDA 1QVG2 4K1VA 2KXGA 2PZVA 3F8XA 3GWRA 1OCVA 2OWPA 2A15A 1JN5A 2CG1A 1TFOA 4RNYA 3JUOA 3LXUX 3VSYA 5JBSA 3DM8A 3F9SA 1E97A 3U97A 5ELJA 1LXEA 1GD3A 1OF5A 2F99A 3SLUA 4WWUC 4STDA 1EA2A 3FLJA 2F98A 1JN5B 3K63A 1SIHA 1LOXA 4L7KA 1VQN3 3NQZA 3E99A 1OPYA 1GY5A 4HM3B 1RRHA 4K61A 1N9JA 1OF5B 3NBJA 2W03A 2CK3H 3I563 1FGRA 4N6MA 4NHFA 3T8NA 3WA3A 3MPHA 1DMMA 3F8HA 4EYCA 2W6JH 4HM1B 1UUWB 5A0OB 1QAKA 3FG1A 3N8BA 3FH1A 3X3ZA 3KN4A 1VQM3 2V1LA 1AV4A 2GXFA 2QA43 1ULJB 2BMRB 5TGNA 4O8SA 1YIJ3 4HM2B 4BTXA 2P0XA 4FR9A 4AEQA 1IVXA 4OVMA 2BHMA 1Q40A 3HX8A 3VF1A 3DXOA 1WNHA 3D3LA 2GU1A 4FMCA 1HU9A 5I97A 5AEUB 1WMOA 3F7SA 4KZ1A 4AKZA 3FG3A 1VQL3 3UJMA 2B1XB 3EF8A 5IW9A 2E2VA 3CPOA 1Q40B 1US1A 1FGQA 2K0MA 2E2UA 2GEXA 3BNCA 2WO0A 2ZDJA 3CNXA 2R4IA 5CF1A 3CCL3 1VQ73 3FGYA 2STDA 2INXA 3HI7A 5CF2A 2C11A 4XDWA 2RSXA 3PXMA 5IEPA 1K8A4 1SPUA 3LOYA 1LVNA 3X3XA 3NBBA 1K28A 3EC9A 4EXRA 1VQ43 1JB2A 5CLKA 3NHXA 4HM5B 1QJGA 2PNCA 4TX4A 1D6YA 4FMBA 2FGTA 3CC43 4GL6A 4N6V0 1UI8A 4AKYA 4R80A 1T5YA 2IUJA 1Q42A 3X41A 1W6YA 2Z6BA 1IQ8A 1TU5A 1A2KA 3GZRA 3BLZA 3OWUA 3RGAA 2XGLA 1DYUA 2K54A 2ML5A 1JKGA 2WOFA 2QGUA 3ROBA 1NWWA 3PZWA 4Q53A 1E3RA 4XDVA 1TUHA 3CCJ3 5KP3A 5LC7A 2WGOA 4MJDA 1CYVA 1OH0A 4N6UA 3EN1B 5D82A 2OOVA 1JKGB 4X2HA 3ER7A 4FCMA 1KC84 1BUQA 2W56A 1S5AA 2O3OA 3G0KA 5LC6A 5IENA 3CCE3 1FA3A 1VQ63 3BNDA 3IMAB 1VQK3 4MEIA 3FF0A 1O7NB 4HM6B 3BNBA 2M7OA 3Q1CA 3NM2A 1W6CA 4L8PA 1WQLB 3EHCA 1IDPA 1DMNA 4HM0B 2IMJA 2W56B 1U8CB 1IQXA 1GD4A 2W04A 3M8CA 4KFDA 4H3UA 1IT7A 2YFJB 4G1MB 4HYZA 1AVLA 5AIIA 2JDIH 2KCDA 1K9M4 1IVVA 3EB8A 5STDA 1ZX2A 2XH9A 2QIYA 3B4PA 1UI7A 1GS3A 4HJLB 4KFFA 1NB3I 1Q864 1IU7A 1DVDA 2XSHB 1YHQ3 2JQ5A 3MSOA 3GZYB 2CFGA 1NB5I 1C7HA 3LMLA 1J2BA 1O7PB 1OHOA 4R4KA 1WMNA 2CHCA 3DGMA 5HGRA 3DMCA 2XGNA 4H61A 2I9WA 3WDGB 5D83A 4HM7B 4PEJA 1U5OA 5EEOA 3WOFB 1FGOA 3UL5A 4N3VA 2SBLA 3H3HA 3CMA3 4BTWA 4LMIA 1RKYA 2XR8B 1ISKA 4IPBA 1M9GA 3K7CA 5IG5A 3EE1A 3HIGA 2B24B 4WP5A 3PS8A 3WA2X 2Y74A 3LH4A 4N6LA 3T8UA 2RGQA 3MG1A 4ORLA 1N8QA 1JB4A 3CC23 3DUKA 3X40A 1NDOB 1RN7A 3FSDA 1STDA 1AVKA 2BO9B 2BT3A 4IIAA 1M1K4 4WFOA 3Q2PA 2HMJB 5KP1A 3NBRA 4HM8B 4O02B 2BNGA 3KSED 3KSPA 3V98A 5AEWB 1ROVA 3CXC2 4WYKA 2XSOB 1OHPA 3G8ZA 2OQEA 1L5GB 1AR0A 3LT8A 1QALA 2P38A 1OGZA 2W9PA 3QRDA 2HMKB 2CFDA 4FCZA 5IF6A 4O2HA 4FMDA 2CFKA 4WYKB 2OCTA 2W0QA 1ULIB 1M1XB 1TIJA 4EC6A 2XEPA 3RDEA 4WHAA 3CCS3 2CFWA 2F86B 2YFIB 4EV5A 1W2B2 1YVBI 1W7CA 3DGOA 4X2OA 3J7Yd 4MMZB 2P09A 2Q07A 4RNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWV A;  4KFE A;  1A2V A;  1N9E A;  3KII A;  1WMP A;  2WOH A;  2IA7 A;  1SIH A;  1SII A;  3K5T A;  3NQZ A;  1W6C A;  3NBJ A;  1IQX A;  1D6Z A;  4KFD A;  1OAC A;  3T0U A;  3WA3 A;  3MPH A;  1IQY A;  4EV2 A;  1AVL A;  2CFL A;  1QAK A;  1KSI A;  1EKM A;  3KN4 A;  3X3Z A;  1IVV A;  1AV4 A;  1IVU A;  3X42 A;  4BTX A;  1UI7 A;  2WGQ A;  3AMO A;  4KFF A;  1IU7 A;  1QAF A;  1PU4 A;  1IVX A;  3HII A;  1JRQ A;  2CFG A;  4BTY A;  1WMO A;  2C10 A;  3NQY A;  3N9H A;  3ALA A;  1WMN A;  2CWT A;  2GU3 A;  1RJO A;  2OQE C;  3AMO B;  5IW9 A;  2E2V A;  1D6U A;  1US1 A;  2K0M A;  2E2U A;  1W6G A;  2WO0 A;  4BTW A;  1RKY A;  1W5Z A;  2YX9 A;  2CG0 A;  3HI7 A;  3HIG A;  3X3Y A;  2CWU A;  3WA2 X;  2Y74 A;  2C11 A;  3SX1 A;  1SPU A;  3LOY A;  1LVN A;  3X3X A;  3NBB A;  2ZL8 A;  3SXX A;  4EXR A;  3X40 A;  1W4N A;  4K90 B;  1AVK A;  2BT3 A;  2E2T A;  2PNC A;  1D6Y A;  2D1W A;  1IVW A;  2Y73 A;  1UI8 A;  3X41 A;  2OQE A;  1TU5 A;  1W2Z A;  1QAL A;  1DYU A;  2CFD A;  2WOF A;  2CFK A;  2W0Q A;  2OOV C;  2CFW A;  4EV5 A;  2CG1 A;  1W7C A;  2OOV A;  3PGB A; 
#chains in the Genus database with same CATH topology
 2CWV A;  2P0M A;  1NU3 A;  2GBX B;  5JPP A;  4KFE A;  1A2V A;  1N9E A;  2BMO B;  5BXQ A;  1KQS 2;  1F8N A;  1JB5 A;  4J9A A;  1MOL A;  3EBY A;  2WOH A;  3I0Y A;  2IA7 A;  4K1U A;  3I55 3;  3O8Y A;  3CNM A;  2GSP A;  1IV9 A;  2GEY A;  2CH9 A;  1ZGX A;  1HKX A;  3K5T A;  4N6T A;  3HZP A;  3IPT A;  2HMN B;  1SJW A;  5EQL A;  3PCS A;  1NO3 A;  2RCD A;  5AYR B;  3JVC A;  3LTC A;  5AI1 A;  4FCJ A;  3B7C A;  1D6Z A;  2Z77 A;  4LZI A;  5AYS C;  4CJN A;  1TJD A;  2XF3 A;  3MKI A;  1IQY A;  2XRX B;  1ZS7 A;  1OUN A;  1V57 A;  3QK9 A;  2ML6 A;  3Q90 A;  1TRQ A;  3G16 A;  3KKG A;  4OK0 A;  1T3B A;  4EBG A;  2CFL A;  2C4B A;  2XFT A;  7RNT A;  1KSI A;  3OXA A;  1HYF A;  1LQM B;  2FNQ A;  3U1W A;  1TFK A;  3G71 3;  1RCL A;  4JRF A;  4HVN A;  1YJW 3;  1IVU A;  2L1S A;  3TDG A;  3X42 A;  3MG3 A;  1I3I A;  1AY7 A;  1RTU A;  1RSN A;  3HK4 A;  2WGQ A;  1RGE A;  1Q9E A;  3AMO A;  3CME 3;  1QAF A;  1PU4 A;  1O7W B;  1I0V A;  4HZ9 B;  3HII A;  1JRQ A;  2Z76 A;  4ZM8 A;  3DH2 A;  4XBT A;  1DE3 A;  4BTY A;  3NQY A;  2C10 A;  5JPU A;  1EQK A;  2CWT A;  3UB1 A;  5DRE A;  2GU3 A;  1YNV X;  3IJE B;  2K3D A;  1RJO A;  5FGO A;  3BNE A;  2OQE C;  3H51 A;  3AMO B;  3EBT A;  1BRS A;  1CQS A;  2H0H A;  2BIR A;  2LQV A;  4LSO A;  1B2Z A;  1W6G A;  1NJI 4;  1B21 A;  1RNT A;  2KF4 A;  3NUV A;  4J8T A;  1TP6 A;  3D5G A;  3DGL A;  3S5C A;  2FXT A;  1W5Z A;  1UUV B;  2YX9 A;  4BU4 A;  2CG0 A;  3AGO A;  1ROA A;  4U13 A;  1CH0 A;  3FG4 A;  1Y4K A;  1O7M B;  1ZO2 A;  1IYY A;  1O7G B;  1GOV A;  3S28 A;  3WHO A;  4R9K A;  3SX1 A;  1I2G A;  1EG9 B;  3FKA A;  1KWI A;  2ZL8 A;  1YJ9 3;  1QVF 2;  3S67 A;  3JUP A;  1W00 A;  4CDL A;  2CKF B;  1IT8 A;  1W4N A;  2IYJ A;  3OWY A;  4MMY B;  2MF7 A;  3CU3 A;  4L8O A;  1T2I A;  4LYL B;  1LOW A;  4R9L A;  2E2T A;  1GY7 A;  4CCV A;  2D1W A;  2HMO B;  2L4V A;  2P05 A;  3LTB A;  1IVW A;  1RGC A;  1YGE A;  1BRG A;  3G6E 3;  2YFL B;  1IV7 A;  1N8R 4;  3F14 A;  3A76 A;  1T2H A;  1V74 A;  4QWT A;  1M90 4;  5CXO A;  2Z7A A;  3KE7 A;  1W2Z A;  1FUT A;  3LT9 A;  3S29 A;  5BVB A;  1ASK A;  1RRL A;  3EQQ B;  1JJ2 2;  1AQZ A;  4KT3 B;  1Q81 4;  1PFP A;  3VGN A;  3ECF A;  2IUK A;  3CCM 3;  3BB9 A;  3OV4 A;  4N6N B;  2OOV C;  1B20 A;  1MWT A;  3LTA A;  2LYX A;  4LEH A;  1DVC A;  1Q82 4;  1B2U A;  1GY6 A;  3LTD A;  3CCQ 3;  4IT7 A;  1YIT 3;  1LQG C;  1A90 A;  1MWR A;  1RGK A;  2KAA A;  4RBN A;  5BIR A;  3CCR 3;  3FCS B;  1R4C A;  3PGB A;  2BMQ B;  1MNL A;  3MWZ A;  7STD A;  2CIU A;  2XFS A;  3MHE A;  3KFQ C;  2O9U X;  5FW5 A;  1MWS A;  3SED A;  3ZFZ A;  3KII A;  1FGM A;  1VQP 3;  1WMP A;  3DGN A;  1KD1 4;  1S72 3;  3JUM A;  3DGY A;  3SOA A;  1A2P A;  1SII A;  4R1K A;  1BSE A;  1LNH A;  2KF6 A;  3EN8 A;  3KCH A;  4NPB A;  1MGW A;  2F5M A;  2OTL 3;  5AIG A;  3SVA A;  1EUI C;  1YJN 3;  1OAC A;  3T0U A;  1A67 A;  3F40 A;  2D42 A;  1JZO A;  4HBR A;  1IK3 A;  1RNB A;  5D81 A;  1RGG A;  4EV2 A;  4XBY A;  1RGF A;  3KZT A;  1E3V A;  1EKM A;  3V99 A;  2KRT A;  3LZA A;  2HMM B;  4GB5 A;  3PCR A;  3CC7 3;  3K9M C;  1JBS A;  1VQ9 3;  4OUQ A;  1RGA A;  4HAA A;  1BNI A;  2W9Q A;  4HZB B;  1STF I;  3GZX B;  5IER A;  5DRV A;  1C54 A;  1GOU A;  4HM4 B;  1YGW A;  2RNT A;  3DZL A;  2H0G A;  4LGQ A;  3UNL A;  3MG2 A;  2CX1 A;  5IEO A;  1YI2 3;  3CD6 3;  1R4Y A;  3N9H A;  3ALA A;  5IG4 A;  1VZZ A;  4NRE A;  3B8L A;  1JV2 B;  4DKI A;  3GZB A;  3NXJ A;  4J5K A;  3STD A;  3G4S 3;  4O3V A;  2H0I A;  1UGI A;  8CHO A;  2AAE A;  2CW9 A;  2GBW B;  1D6U A;  1JZD A;  3AGN A;  1VQO 3;  1B2M A;  3LYG A;  3SOY A;  1BUJ A;  4RZM A;  5CK6 A;  4N6O B;  1HZ1 A;  3OW2 2;  1Q7Y 4;  3JUN A;  3L0R A;  1BVI A;  1G96 A;  5IG0 A;  1CEW I;  1BAN A;  4I4K A;  1I2E A;  2KF3 A;  2CC3 A;  3URP A;  1VQQ A;  4HKV B;  3X3Y A;  1O7H B;  2CWU A;  3CPW 2;  1GMQ A;  1K73 4;  3S27 A;  1VQ8 3;  1I3F A;  2RFR A;  3GAX A;  3V92 A;  1JBT A;  2ZHX B;  3PYJ A;  1GYB A;  1QMA A;  3SXX A;  4BIR A;  4XB5 A;  1CYU A;  1N5P A;  2SAR A;  3F7X A;  1FUW A;  1DMQ A;  1BNJ A;  3B4O A;  4K90 B;  3WMD A;  2W2C A;  3WOD G;  2MC8 A;  3JUQ A;  1WTH A;  1I8V A;  2RBI A;  3NV0 A;  3RGR A;  1W01 A;  2QEX 3;  3OX9 A;  5KP4 A;  5IG3 A;  4KVH A;  3K0Z A;  1RGH A;  6STD A;  1Z1S A;  2BU4 A;  1LRA A;  2Y73 A;  1SQW A;  5G2G A;  4FMA A;  3OWS A;  4XM4 A;  1UW1 A;  1OHS A;  4MMX B;  3N54 B;  1FGT A;  3FF2 A;  1W02 A;  3NM7 A;  4XBX A;  5EVH A;  3WOE B;  3CCV 3;  3MYT A;  2UX0 A;  1BNG A;  1OGX A;  3EX9 A;  3FZW A;  4JF8 A;  3AHS A;  3NV0 B;  1K41 A;  5AIH A;  2HML B;  3EJV A;  1TTO A;  1UCK A;  3UL6 A;  3CCU 3;  1FW7 A;  3D9R A;  1JNQ A;  5AIF A;  5ELU A;  1N5H A;  1X1Y A;  1BNS A;  4J5G A;  1VQ5 3;  1G02 A;  4GSP A;  3DY5 A;  2OTJ 3;  1I2F A;  3GRD A;  3NX0 A;  1QVG 2;  4K1V A;  2KXG A;  1RLS A;  2PZV A;  3F8X A;  3GWR A;  1OCV A;  2OWP A;  1X1W A;  1JN5 A;  2A15 A;  2CG1 A;  1TFO A;  4RNY A;  3JUO A;  3LXU X;  3VSY A;  5JBS A;  3DM8 A;  3F9S A;  8RNT A;  1E97 A;  3U97 A;  5ELJ A;  1LXE A;  4EW5 A;  1GD3 A;  1OF5 A;  1GOY A;  1UCJ A;  2F99 A;  3SLU A;  4WWU C;  2F5W A;  4STD A;  1EA2 A;  3FLJ A;  1LNI A;  1JN5 B;  2F98 A;  1SIH A;  3K63 A;  1LOX A;  4L7K A;  1VQN 3;  3D4A A;  3NQZ A;  3E99 A;  1OPY A;  1GY5 A;  4HM3 B;  1RRH A;  2ZA4 A;  4K61 A;  1N9J A;  1OF5 B;  3NBJ A;  2W03 A;  5BU4 A;  2CK3 H;  3I56 3;  1FGR A;  1GSP A;  4N6M A;  4NHF A;  3T8N A;  3WA3 A;  3MPH A;  1DMM A;  3F8H A;  4EYC A;  2J8X B;  2W6J H;  4HM1 B;  1RN4 A;  1UUW B;  5A0O B;  1QAK A;  3FG1 A;  3N8B A;  3FH1 A;  3X3Z A;  3KN4 A;  1VQM 3;  2V1L A;  5G1L A;  3ZG0 A;  1AV4 A;  2GXF A;  2QA4 3;  1UCI A;  1ULJ B;  2BMR B;  5TGN A;  4O8S A;  1YIJ 3;  4HM2 B;  4BTX A;  1TRP A;  2P0X A;  4FR9 A;  4AEQ A;  1IVX A;  4OVM A;  2BHM A;  1BNF A;  1Q40 A;  3HX8 A;  5M1A A;  3VF1 A;  3DXO A;  1WNH A;  3D3L A;  2GU1 A;  4FMC A;  1HU9 A;  1YVS A;  5I97 A;  5AEU B;  1WMO A;  3F7S A;  4KZ1 A;  4AKZ A;  2UUG C;  3FG3 A;  1BRJ A;  1VQL 3;  3UJM A;  2B1X B;  3EF8 A;  5IW9 A;  2E2V A;  1BGS A;  3CPO A;  1Q40 B;  1US1 A;  1FGQ A;  2K0M A;  1RGL A;  2E2U A;  1BNR A;  2GEX A;  3BNC A;  2WO0 A;  2ZDJ A;  3CNX A;  5M18 A;  2R4I A;  4GHO A;  5CF1 A;  3CCL 3;  1VQ7 3;  3FGY A;  2STD A;  2INX A;  3HI7 A;  1X1U A;  2F56 A;  3D79 A;  5HOH A;  5CF2 A;  2AAD A;  2C11 A;  3GSP A;  2RSX A;  3PXM A;  4XDW A;  5IEP A;  1K8A 4;  1SPU A;  3AHW A;  3LOY A;  1LVN A;  3X3X A;  3NBB A;  1G0T A;  1K28 A;  3EC9 A;  4EXR A;  1VQ4 3;  1JB2 A;  5CLK A;  3NHX A;  1V58 A;  5M19 A;  1X1X A;  1QJG A;  2IY2 A;  2PNC A;  4HM5 B;  1D6Y A;  4FMB A;  4TX4 A;  2FGT A;  3CC4 3;  4GL6 A;  4N6V 0;  1UI8 A;  4AKY A;  4R80 A;  1T5Y A;  2IUJ A;  1Q42 A;  3X41 A;  1W6Y A;  2Z6B A;  1IQ8 A;  5G1K A;  1TU5 A;  1A2K A;  3GZR A;  3BLZ A;  3ZG5 A;  3Q3F A;  1FYS A;  3OWU A;  1B2X A;  1DET A;  2XGL A;  1DYU A;  3RGA A;  2K54 A;  1UDI I;  2ML5 A;  1JKG A;  2WOF A;  1NNV A;  2QGU A;  3ROB A;  1NWW A;  3PZW A;  4Q53 A;  5GSP A;  1I0X A;  1B3S A;  1E3R A;  4XDV A;  1TUH A;  6RNT A;  6GSP A;  5KP3 A;  5LC7 A;  2WGO A;  4MJD A;  3CCJ 3;  1CYV A;  1OH0 A;  4N6U A;  1PY3 A;  3EN1 B;  5D82 A;  4BL3 A;  2OOV A;  1JKG B;  4X2H A;  3ER7 A;  4FCM A;  4RNT A;  1KC8 4;  1BUQ A;  2W56 A;  1S5A A;  1UUG B;  2O3O A;  3G0K A;  5LC6 A;  1LOY A;  5IEN A;  3CCE 3;  1FA3 A;  3RNT A;  3BND A;  3IMA B;  1VQK 3;  1VQ6 3;  1SAR A;  1GMR A;  1GMP A;  4MEI A;  3FF0 A;  1O7N B;  4HM6 B;  3BNB A;  2M7O A;  3Q1C A;  3NM2 A;  1W6C A;  4L8P A;  1WQL B;  3EHC A;  1IDP A;  1DMN A;  3A5E A;  4HM0 B;  2IMJ A;  2W56 B;  1B2S A;  1BSA A;  1U8C B;  1IQX A;  1GD4 A;  2W04 A;  3M8C A;  4KFD A;  4H3U A;  1IT7 A;  2YFJ B;  4G1M B;  4HYZ A;  4I5Q A;  3SYU A;  1AVL A;  5AII A;  2JDI H;  2KCD A;  1K9M 4;  1BSB A;  1IVV A;  1BSC A;  3EB8 A;  4HOH A;  5STD A;  1ZX2 A;  2XH9 A;  1UGH I;  2QIY A;  3B4P A;  1UI7 A;  1BRN L;  1BOX A;  1GS3 A;  1RCK A;  1NB3 I;  4HJL B;  1IU7 A;  4KFF A;  1Q86 4;  1DVD A;  7GSP A;  1RMS A;  2XSH B;  1YHQ 3;  2JQ5 A;  3MSO A;  3GZY B;  2CFG A;  1NB5 I;  1C7H A;  3LML A;  1J2B A;  1O7P B;  1OHO A;  2HOH A;  4R4K A;  1WMN A;  2CHC A;  3DGM A;  5HGR A;  1BIR A;  3DMC A;  4ILF A;  2XGN A;  4H61 A;  2I9W A;  3WDG B;  5D83 A;  4HM7 B;  2KF5 A;  9RNT A;  4PEJ A;  1U5O A;  5EEO A;  3WOF B;  1FGO A;  1EEJ A;  3UL5 A;  1BNE A;  4N3V A;  2SBL A;  3H3H A;  3CMA 3;  4BTW A;  4LMI A;  1RKY A;  2XR8 B;  3BU4 A;  1ISK A;  4IPB A;  1M9G A;  3K7C A;  5IG5 A;  3EE1 A;  3BIR A;  3HIG A;  2B24 B;  4WP5 A;  3PS8 A;  3WA2 X;  1FZU A;  2Y74 A;  3LH4 A;  4N6L A;  3T8U A;  1JBR A;  2RGQ A;  1BSD A;  3MG1 A;  4ORL A;  1RDS A;  1N8Q A;  1JB4 A;  4BL2 A;  3DUK A;  3CC2 3;  3X40 A;  1NDO B;  1RN7 A;  3FSD A;  4CPK A;  1STD A;  1AVK A;  1RHL A;  1LOV A;  2BO9 B;  1PYL A;  1UCL A;  2BT3 A;  2R41 A;  4IIA A;  1MGR A;  1M1K 4;  4WFO A;  3Q2P A;  1Q7H A;  2HMJ B;  3NBR A;  4HM8 B;  4O02 B;  2BNG A;  3KSE D;  3KSP A;  3V98 A;  5AEW B;  5KP1 A;  1ROV A;  3CXC 2;  4WYK A;  2XSO B;  1OHP A;  3G8Z A;  2OQE A;  1BRH A;  1L5G B;  2UGI A;  2F4Y A;  1AR0 A;  3LT8 A;  1BAO A;  1QAL A;  2P38 A;  1MWU A;  1OGZ A;  2W9P A;  3QRD A;  2HMK B;  5RNT A;  1FUS A;  1B27 A;  2CFD A;  4FCZ A;  3HOH A;  5IF6 A;  1BRI A;  4FMD A;  4O2H A;  2CFK A;  4WYK B;  2OCT A;  2W0Q A;  1ULI B;  1M1X B;  1TIJ A;  4EC6 A;  2XEP A;  1I70 A;  2CX0 A;  4WHA A;  3RDE A;  3WR2 A;  3CCS 3;  2CFW A;  2F86 B;  2YFI B;  4EV5 A;  1W2B 2;  1YVB I;  1W7C A;  3DGO A;  4X2O A;  3J7Y d;  4MMZ B;  2P09 A;  1BU4 A;  2Q07 A;  1BRK A;  1RN1 A;  4RNZ A;  3D5I A; 
#chains in the Genus database with same CATH homology
 2CWV A;  2P0M A;  1NU3 A;  2GBX B;  5JPP A;  4KFE A;  1A2V A;  1N9E A;  2BMO B;  5BXQ A;  1KQS 2;  1F8N A;  1JB5 A;  4J9A A;  1MOL A;  3EBY A;  2WOH A;  3I0Y A;  2IA7 A;  4K1U A;  3I55 3;  3O8Y A;  3CNM A;  4N6T A;  1IV9 A;  2GEY A;  2CH9 A;  3K5T A;  1HKX A;  5EQL A;  1YI2 3;  3HZP A;  3IPT A;  2HMN B;  1SJW A;  3PCS A;  1NO3 A;  2RCD A;  5AYR B;  3JVC A;  3LTC A;  5AI1 A;  4FCJ A;  3B7C A;  1D6Z A;  2Z77 A;  4LZI A;  5AYS C;  2XF3 A;  3MKI A;  1IQY A;  2XRX B;  1OUN A;  3QK9 A;  2ML6 A;  3Q90 A;  3G16 A;  3KKG A;  4OK0 A;  4EBG A;  2CFL A;  2XFT A;  1KSI A;  3OXA A;  2FNQ A;  3U1W A;  1TFK A;  3G71 3;  4JRF A;  4HVN A;  1YJW 3;  1IVU A;  3TDG A;  3X42 A;  3MG3 A;  3HK4 A;  2WGQ A;  3AMO A;  3CME 3;  1QAF A;  1PU4 A;  1O7W B;  4HZ9 B;  3HII A;  1JRQ A;  2Z76 A;  4ZM8 A;  4XBT A;  4BTY A;  3NQY A;  2C10 A;  5JPU A;  1EQK A;  2CWT A;  3UB1 A;  5DRE A;  2GU3 A;  3IJE B;  1RJO A;  5FGO A;  3BNE A;  2OQE C;  3H51 A;  3AMO B;  3EBT A;  1CQS A;  2LQV A;  4LSO A;  1W6G A;  1NJI 4;  3NUV A;  4J8T A;  1TP6 A;  3DGL A;  3S5C A;  2FXT A;  1W5Z A;  1UUV B;  2YX9 A;  2CG0 A;  1ROA A;  4U13 A;  3FG4 A;  1Y4K A;  1O7M B;  1ZO2 A;  1O7G B;  3S28 A;  4R9K A;  3SX1 A;  1EG9 B;  3FKA A;  1KWI A;  2ZL8 A;  1YJ9 3;  1QVF 2;  3S67 A;  3JUP A;  1W00 A;  4CDL A;  2CKF B;  1IT8 A;  1W4N A;  3OWY A;  4MMY B;  2MF7 A;  3CU3 A;  4L8O A;  4R9L A;  2E2T A;  1GY7 A;  4CCV A;  2D1W A;  2HMO B;  2L4V A;  2P05 A;  3LTB A;  1IVW A;  1YGE A;  3G6E 3;  2YFL B;  1IV7 A;  1N8R 4;  3F14 A;  3A76 A;  4QWT A;  1V74 A;  1M90 4;  5CXO A;  2Z7A A;  3KE7 A;  1W2Z A;  3LT9 A;  3S29 A;  5BVB A;  1ASK A;  1RRL A;  3EQQ B;  1JJ2 2;  1Q81 4;  1PFP A;  3VGN A;  3ECF A;  2IUK A;  3CCM 3;  3BB9 A;  3OV4 A;  4N6N B;  2OOV C;  3LTA A;  2LYX A;  4LEH A;  1DVC A;  1Q82 4;  1GY6 A;  3LTD A;  3CCQ 3;  4IT7 A;  1YIT 3;  1A90 A;  3CCR 3;  4RBN A;  3FCS B;  1R4C A;  3PGB A;  2BMQ B;  1MNL A;  3MWZ A;  7STD A;  2CIU A;  2XFS A;  3MHE A;  3KFQ C;  2O9U X;  5FW5 A;  3SED A;  1VQP 3;  3KII A;  1FGM A;  1WMP A;  3DGN A;  1KD1 4;  1S72 3;  3JUM A;  3SOA A;  1SII A;  4R1K A;  1LNH A;  3EN8 A;  2OTL 3;  5AIG A;  3SVA A;  1YJN 3;  1OAC A;  3T0U A;  1A67 A;  3F40 A;  2D42 A;  4HBR A;  1IK3 A;  5D81 A;  4EV2 A;  4XBY A;  3KZT A;  1E3V A;  1EKM A;  3V99 A;  2KRT A;  3LZA A;  2HMM B;  4GB5 A;  3PCR A;  3CC7 3;  3K9M C;  1VQ9 3;  4OUQ A;  2W9Q A;  4HZB B;  1STF I;  3GZX B;  5IER A;  5DRV A;  4HM4 B;  3DZL A;  4LGQ A;  3UNL A;  3CD6 3;  3MG2 A;  5IEO A;  3N9H A;  3ALA A;  5IG4 A;  1VZZ A;  4NRE A;  3B8L A;  1JV2 B;  3GZB A;  3NXJ A;  3STD A;  3G4S 3;  4O3V A;  8CHO A;  2CW9 A;  2GBW B;  1D6U A;  1VQO 3;  3LYG A;  3SOY A;  4RZM A;  5CK6 A;  4N6O B;  3OW2 2;  1Q7Y 4;  3JUN A;  3L0R A;  1G96 A;  5IG0 A;  1CEW I;  4I4K A;  2CC3 A;  4HKV B;  3X3Y A;  1O7H B;  2CWU A;  3CPW 2;  1VQ8 3;  1K73 4;  3S27 A;  2RFR A;  3GAX A;  3V92 A;  3PYJ A;  1GYB A;  1QMA A;  3SXX A;  4XB5 A;  1CYU A;  1N5P A;  3F7X A;  1FUW A;  1DMQ A;  3B4O A;  4K90 B;  3WMD A;  2W2C A;  3WOD G;  2MC8 A;  3JUQ A;  1WTH A;  3RGR A;  3NV0 A;  1W01 A;  2QEX 3;  3OX9 A;  5KP4 A;  5IG3 A;  4KVH A;  3K0Z A;  6STD A;  1Z1S A;  2Y73 A;  1SQW A;  5G2G A;  4FMA A;  3OWS A;  4XM4 A;  1UW1 A;  1OHS A;  4MMX B;  3N54 B;  1FGT A;  3FF2 A;  1W02 A;  3NM7 A;  4XBX A;  5EVH A;  3WOE B;  3CCV 3;  3MYT A;  2UX0 A;  4JF8 A;  1OGX A;  3EX9 A;  3FZW A;  3NV0 B;  1K41 A;  5AIH A;  2HML B;  3EJV A;  3CCU 3;  3UL6 A;  3D9R A;  1JNQ A;  5AIF A;  5ELU A;  1N5H A;  1VQ5 3;  3DY5 A;  2OTJ 3;  3NX0 A;  3GRD A;  1QVG 2;  4K1V A;  2KXG A;  2PZV A;  3F8X A;  3GWR A;  1OCV A;  2OWP A;  2A15 A;  1JN5 A;  2CG1 A;  1TFO A;  4RNY A;  3JUO A;  3LXU X;  3VSY A;  5JBS A;  3DM8 A;  3F9S A;  1E97 A;  3U97 A;  5ELJ A;  1LXE A;  1GD3 A;  1OF5 A;  2F99 A;  3SLU A;  4WWU C;  4STD A;  1EA2 A;  3FLJ A;  2F98 A;  1JN5 B;  3K63 A;  1SIH A;  1LOX A;  4L7K A;  1VQN 3;  3NQZ A;  3E99 A;  1OPY A;  1GY5 A;  4HM3 B;  1RRH A;  4K61 A;  1N9J A;  1OF5 B;  3NBJ A;  2W03 A;  2CK3 H;  3I56 3;  1FGR A;  4N6M A;  4NHF A;  3T8N A;  3WA3 A;  3MPH A;  1DMM A;  3F8H A;  4EYC A;  2W6J H;  4HM1 B;  1UUW B;  5A0O B;  1QAK A;  3FG1 A;  3N8B A;  3FH1 A;  3X3Z A;  3KN4 A;  1VQM 3;  2V1L A;  1AV4 A;  2GXF A;  2QA4 3;  1ULJ B;  2BMR B;  5TGN A;  4O8S A;  1YIJ 3;  4HM2 B;  4BTX A;  2P0X A;  4FR9 A;  4AEQ A;  1IVX A;  4OVM A;  2BHM A;  1Q40 A;  3HX8 A;  3VF1 A;  3DXO A;  1WNH A;  3D3L A;  2GU1 A;  4FMC A;  1HU9 A;  5I97 A;  5AEU B;  1WMO A;  3F7S A;  4KZ1 A;  4AKZ A;  3FG3 A;  1VQL 3;  3UJM A;  2B1X B;  3EF8 A;  5IW9 A;  2E2V A;  3CPO A;  1Q40 B;  1US1 A;  1FGQ A;  2K0M A;  2E2U A;  2GEX A;  3BNC A;  2WO0 A;  2ZDJ A;  3CNX A;  2R4I A;  5CF1 A;  3CCL 3;  1VQ7 3;  3FGY A;  2STD A;  2INX A;  3HI7 A;  5CF2 A;  2C11 A;  4XDW A;  2RSX A;  3PXM A;  5IEP A;  1K8A 4;  1SPU A;  3LOY A;  1LVN A;  3X3X A;  3NBB A;  1K28 A;  3EC9 A;  4EXR A;  1VQ4 3;  1JB2 A;  5CLK A;  3NHX A;  4HM5 B;  1QJG A;  2PNC A;  4TX4 A;  1D6Y A;  4FMB A;  2FGT A;  3CC4 3;  4GL6 A;  4N6V 0;  1UI8 A;  4AKY A;  4R80 A;  1T5Y A;  2IUJ A;  1Q42 A;  3X41 A;  1W6Y A;  2Z6B A;  1IQ8 A;  1TU5 A;  1A2K A;  3GZR A;  3BLZ A;  3OWU A;  3RGA A;  2XGL A;  1DYU A;  2K54 A;  2ML5 A;  1JKG A;  2WOF A;  2QGU A;  3ROB A;  1NWW A;  3PZW A;  4Q53 A;  1E3R A;  4XDV A;  1TUH A;  3CCJ 3;  5KP3 A;  5LC7 A;  2WGO A;  4MJD A;  1CYV A;  1OH0 A;  4N6U A;  3EN1 B;  5D82 A;  2OOV A;  1JKG B;  4X2H A;  3ER7 A;  4FCM A;  1KC8 4;  1BUQ A;  2W56 A;  1S5A A;  2O3O A;  3G0K A;  5LC6 A;  5IEN A;  3CCE 3;  1FA3 A;  1VQ6 3;  3BND A;  3IMA B;  1VQK 3;  4MEI A;  3FF0 A;  1O7N B;  4HM6 B;  3BNB A;  2M7O A;  3Q1C A;  3NM2 A;  1W6C A;  4L8P A;  1WQL B;  3EHC A;  1IDP A;  1DMN A;  4HM0 B;  2IMJ A;  2W56 B;  1U8C B;  1IQX A;  1GD4 A;  2W04 A;  3M8C A;  4KFD A;  4H3U A;  1IT7 A;  2YFJ B;  4G1M B;  4HYZ A;  1AVL A;  5AII A;  2JDI H;  2KCD A;  1K9M 4;  1IVV A;  3EB8 A;  5STD A;  1ZX2 A;  2XH9 A;  2QIY A;  3B4P A;  1UI7 A;  1GS3 A;  4HJL B;  4KFF A;  1NB3 I;  1Q86 4;  1IU7 A;  1DVD A;  2XSH B;  1YHQ 3;  2JQ5 A;  3MSO A;  3GZY B;  2CFG A;  1NB5 I;  1C7H A;  3LML A;  1J2B A;  1O7P B;  1OHO A;  4R4K A;  1WMN A;  2CHC A;  3DGM A;  5HGR A;  3DMC A;  2XGN A;  4H61 A;  2I9W A;  3WDG B;  5D83 A;  4HM7 B;  4PEJ A;  1U5O A;  5EEO A;  3WOF B;  1FGO A;  3UL5 A;  4N3V A;  2SBL A;  3H3H A;  3CMA 3;  4BTW A;  4LMI A;  1RKY A;  2XR8 B;  1ISK A;  4IPB A;  1M9G A;  3K7C A;  5IG5 A;  3EE1 A;  3HIG A;  2B24 B;  4WP5 A;  3PS8 A;  3WA2 X;  2Y74 A;  3LH4 A;  4N6L A;  3T8U A;  2RGQ A;  3MG1 A;  4ORL A;  1N8Q A;  1JB4 A;  3CC2 3;  3DUK A;  3X40 A;  1NDO B;  1RN7 A;  3FSD A;  1STD A;  1AVK A;  2BO9 B;  2BT3 A;  4IIA A;  1M1K 4;  4WFO A;  3Q2P A;  2HMJ B;  5KP1 A;  3NBR A;  4HM8 B;  4O02 B;  2BNG A;  3KSE D;  3KSP A;  3V98 A;  5AEW B;  1ROV A;  3CXC 2;  4WYK A;  2XSO B;  1OHP A;  3G8Z A;  2OQE A;  1L5G B;  1AR0 A;  3LT8 A;  1QAL A;  2P38 A;  1OGZ A;  2W9P A;  3QRD A;  2HMK B;  2CFD A;  4FCZ A;  5IF6 A;  4O2H A;  4FMD A;  2CFK A;  4WYK B;  2OCT A;  2W0Q A;  1ULI B;  1M1X B;  1TIJ A;  4EC6 A;  2XEP A;  3RDE A;  4WHA A;  3CCS 3;  2CFW A;  2F86 B;  2YFI B;  4EV5 A;  1W2B 2;  1YVB I;  1W7C A;  3DGO A;  4X2O A;  3J7Y d;  4MMZ B;  2P09 A;  2Q07 A;  4RNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...