4HM4B

Naphthalene 1,2-dioxygenase bound to indan
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to indan
rcsb
source organism Pseudomonas sp. c18
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm4B00
3HK4A 3ROBA 3B7CA 3F8HA 4U13A 2HMMB 3BLZA 2OWPA 3I0YA 3EC9A 5G2GA 4K1UA 3EJVA 5IG4A 5CXOA 5IG0A 3EX9A 2GEYA 4HKVB 3HZPA 3S5CA 2Z77A 3UJMA 5CK6A 2B24B 5EVHA 4HM4B 3FGYA 3LYGA 3GZBA 4XBTA 5KP4A 3MYTA 1OH0A 1DMQA 1O7GB 3HX8A 3GZRA 3MG2A 1S5AA 3ECFA 1QJGA 1EG9B 2BNGA 1ZX2A 5BVBA 1AR0A 2F98A 3MG1A 2YFLB 3H3HA 1STDA 1IDPA 4XDWA 2HMKB 1E97A 3MG3A 1OHPA 1NU3A 2IMJA 4HM1B 1W6YA 2XR8B 2QIYA 1WQLB 2BMQB 3KZTA 1JB4A 2XSHB 1JN5A 4X2OA 4R9KA 1GS3A 4J9AA 4N3VA 4HM7B 3BB9A 2BMOB 1W00A 5AIGA 3F7SA 1ZO2A 2YFIB 3B8LA 3OXAA 3CNXA 1HKXA 5CF1A 3WMDA 3RGRA 3SEDA 2HMNB 3NXJA 1U5OA 5IG3A 4WWUC 4L8PA 3EBYA 2HMLB 2I9WA 3F9SA 1E3VA 3DM8A 1OF5B 5AIFA 3DXOA 1GY7A 2B1XB 1ULIB 1SJWA 3D9RA 1OHSA 2HMJB 1OF5A 1JKGA 3B4PA 1GY5A 3JUOA 3FZWA 3MKIA 4XBYA 1QMAA 3ER7A 4WYKB 5STDA 2GBXB 3M8CA 2RFRA 6STDA 1Z1SA 1UUWB 3G0KA 1VZZA 3FLJA 1JB2A 5JPUA 1GY6A 1DMMA 3CPOA 2GEXA 3STDA 2RCDA 4WYKA 4RZMA 5IEOA 3NM2A 4L8OA 3OV4A 3GZYB 5BXQA 1OHOA 3MHEA 1JN5B 4ORLA 2CKFB 5TGNA 5AIIA 1OCVA 3NBRA 4MJDA 1JB5A 4XDVA 3EN8A 5D81A 2Z76A 2BMRB 4KVHA 3FSDA 4WP5A 2YFJB 2K54A 5D82A 2GBWB 1CQSA 5JPPA 3OWYA 1OGXA 4HZ9B 4L7KA 5IG5A 1Q40B 2R4IA 1UUVB 2HMOB 7STDA 3CNMA 1O7HB 1NDOB 2QGUA 3K0ZA 2INXA 3EN1B 2JQ5A 3FKAA 3IPTA 3Q90A 1W01A 1Q40A 4HM8B 3B4OA 2F99A 1JKGB 4R1KA 5DRVA 4FCMA 4XBXA 3SOAA 3NHXA 3SOYA 2XRXB 5IENA 8CHOA 4K1VA 5IERA 4LEHA 4HM3B 1NWWA 1O7PB 1O7WB 4CDLA 5AIHA 4HZBB 1C7HA 2STDA 3FH1A 3CU3A 3EQQB 5HGRA 4HM0B 5AEWB 3EF8A 1Q42A 3T8UA 4PEJA 2Z7AA 3UNLA 4HM6B 2XSOB 2RGQA 5AEUB 3DZLA 3MSOA 4H3UA 3FF2A 3G16A 1ULJB 4J8TA 3DUKA 3F40A 4LMIA 1K41A 1GYBA 2PZVA 3K7CA 5D83A 3F14A 4FCJA 3JUNA 3E99A 1EA2A 3VSYA 1ASKA 1OPYA 2A15A 3OWUA 5IEPA 1OUNA 1W02A 5CF2A 3LZAA 3H51A 5AI1A 1O7NB 4HM2B 4X2HA 1OGZA 3KKGA 4XM4A 5KP3A 4LGQA 1E3RA 4R9LA 3EHCA 3NUVA 4XB5A 3GRDA 3KE7A 2F86B 3JUMA 3G8ZA 5CLKA 2UX0A 3FF0A 4OUQA 3T8NA 1A2KA 3JUPA 4OVMA 3NV0B 5DREA 3RGAA 2GXFA 3EBTA 2CHCA 4STDA 3GZXB 3KSPA 4GB5A 4Q53A 1BUQA 1ISKA 3GWRA 3JUQA 1TP6A 3F7XA 3DMCA 3A76A 4HJLB 1DMNA 1O7MB 3NV0A 4I4KA 3OX9A 5IF6A 4HVNA 3VGNA 4IIAA 4HM5B 1TUHA 3F8XA 5FW5A 5KP1A 2W2CA 3OWSA
chains in the Genus database with same CATH superfamily
3X3ZA 3D5GA 3CC73 2OTL3 1OACA 3HK4A 1BOXA 4K90B 3ROBA 1VQ73 3B7CA 3KFQC 3F8HA 1VQ43 1I3FA 3PZWA 4U13A 2BU4A 2HMMB 1KQS2 1M9GA 2V1LA 2CW9A 4NREA 3SX1A 3BLZA 1JZOA 1I0XA 2OWPA 1MNLA 1BRKA 3I0YA 4LZIA 3EC9A 5G2GA 3CME3 4K1UA 2L4VA 3EJVA 5IG4A 1PY3A 3CC43 1RNTA 1CEWI 4N6LA 3QRDA 1IT7A 4RBNA 3KN4A 1V58A 5CXOA 5IG0A 3EX9A 1AQZA 3K5TA 1TRQA 3AMOB 2P05A 3A5EA 1MGWA 1PFPA 2GEYA 2WGOA 4CPKA 4FMAA 4HKVB 7GSPA 2P09A 3HZPA 3IMAB 4RNTA 3VF1A 3S5CA 4FMCA 7RNTA 2Z77A 5LC6A 4HAAA 2WGQA 2H0GA 5CK6A 3UJMA 5EEOA 2Y74A 1YIJ3 1GMQA 2B24B 5EVHA 4HM4B 1RGHA 1RJOA 3FGYA 4EBGA 3CCR3 3LYGA 1A90A 2W9QA 3GZBA 1BNGA 4I5QA 1B2MA 1BRNL 4XBTA 5KP4A 3BNDA 1BNFA 3MYTA 1OH0A 1MWRA 1DMQA 1O7GB 3HX8A 3GZRA 3MG2A 3MWZA 4NPBA 9RNTA 1DVDA 1C54A 1SARA 1S5AA 1KSIA 1FW7A 2D42A 3ECFA 1QJGA 1EG9B 2BNGA 4O3VA 4WHAA 3X3XA 1UCIA 1ZX2A 1I0VA 3G6E3 5BVBA 1RLSA 1AR0A 2F98A 1TU5A 4J5GA 3MG1A 1EQKA 2YFLB 2IY2A 1CYUA 1KWIA 2Z6BA 1VQO3 2AAEA 4GL6A 3H3HA 4N6TA 2XF3A 3FG3A 1STDA 1B2ZA 1IDPA 4XDWA 1IV7A 2HMKB 1E97A 1JNQA 3MG3A 1Q9EA 2XFSA 1UI7A 3ALAA 1OHPA 1YIT3 1RTUA 1DETA 5FGOA 1NU3A 3S28A 4ZM8A 2IMJA 6RNTA 1AY7A 1GD4A 2LQVA 1X1UA 1LNIA 1B2XA 1BNJA 4HM1B 3UL6A 3D4AA 3LT8A 1W6YA 3WDGB 1ZS7A 2XR8B 3G713 1VQP3 2QIYA 1WQLB 2BMQB 3KSED 3KZTA 3PGBA 3CCV3 3WOEB 3CCU3 3AGOA 1M1XB 1JB4A 1US1A 3ZG5A 2OTJ3 1FZUA 1RGAA 2E2TA 2XSHB 1JN5A 4X2OA 1K734 1WTHA 4R9KA 1JRQA 3LOYA 1I70A 1Q824 1GS3A 1JBRA 1RN7A 2CWVA 1ZGXA 4J9AA 4N3VA 3K9MC 2O9UX 4HM7B 1HYFA 1ROAA 2KAAA 3DGLA 2KF4A 4N6NB 1VQ93 2FXTA 1L5GB 3BB9A 2BMOB 1BSCA 4LSOA 1KC84 4K61A 1Q7HA 3X3YA 1VQ63 3BNCA 1W00A 5AYRB 5AIGA 3X41A 3F7SA 4TX4A 1ZO2A 4FR9A 3CCJ3 1RGCA 1LOWA 3URPA 1GOVA 2MC8A 2YFIB 1VQK3 4KFEA 3B8LA 3D3LA 3OXAA 4H61A 4OK0A 1RSNA 1IT8A 1IV9A 4BL3A 1VQM3 3CNXA 1UCJA 1HKXA 2L1SA 5CF1A 1BNRA 5BU4A 2KF3A 3WMDA 3RGRA 3SEDA 2HMNB 3O8YA 3NXJA 3CCE3 4N6V0 1U5OA 5IG3A 1ROVA 3ZG0A 1MWUA 2ZA4A 1LQGC 4WWUC 4L8PA 1RDSA 5M19A 3EBYA 3AHWA 4HOHA 2HMLB 3CCL3 2I9WA 1WMNA 2F4YA 3F9SA 2BO9B 1E3VA 1FGOA 2KF5A 3DM8A 3PYJA 2CIUA 4J5KA 1BU4A 1OF5B 1SIHA 1R4YA 4N6MA 3CCS3 3CMA3 4KFFA 1HU9A 1GD3A 5AIFA 3RNTA 3FG4A 1EUIC 4MMZB 3DXOA 3K63A 1GY7A 2B1XB 1TIJA 1ULIB 1NB3I 1SJWA 3SXXA 2C10A 3D9RA 1GMPA 1LNHA 4AKYA 2CFWA 1JBTA 5EQLA 1OHSA 3CPW2 3V98A 2HMJB 1TFOA 1BRHA 1YJ93 1OF5A 1RGEA 1NJI4 1BANA 2QEX3 1JKGA 5AYSC 1W5ZA 1PYLA 3LTCA 5ELJA 3B4PA 3LTAA 3WR2A 1GY5A 1RKYA 2WOFA 1RGKA 1QALA 1DE3A 2F5WA 3JUOA 1YHQ3 1IVVA 1B27A 3FZWA 3IJEB 2KXGA 2ZDJA 1RHLA 3MKIA 3WOFB 4XBYA 4BTYA 1WMOA 1QMAA 3ZFZA 3ER7A 4WYKB 1FGQA 1WMPA 3T0UA 3LMLA 5STDA 2HOHA 1B20A 2RNTA 2GBXB 3CCM3 3M8CA 2RFRA 6STDA 2CFDA 1YGWA 1Z1SA 1UUWB 1IVUA 4N6OB 4BTWA 2CWTA 3G0KA 1VZZA 1X1WA 3FLJA 1JB2A 1X1XA 3PXMA 3RDEA 4RNZA 5JPUA 1GY6A 1RRHA 1DMMA 1B2UA 1IQYA 1R4CA 2CG1A 3CPOA 4KFDA 2GEXA 2ZL8A 1N9JA 3STDA 2D1WA 3G4S3 2RCDA 3D5IA 1BGSA 3PS8A 4RZMA 2H0HA 1RCLA 4WYKA 3NM2A 5IEOA 4L8OA 1I2GA 1VQN3 3OV4A 2FGTA 3GZYB 3LTDA 1IK3A 1IVXA 2CG0A 5G1LA 3GAXA 5BXQA 3Q2PA 1RGGA 1OHOA 3HOHA 2ML5A 3MHEA 1JN5B 4ORLA 4BU4A 2CKFB 5TGNA 5AIIA 1TRPA 3CC23 1OCVA 4HBRA 4IT7A 3NBRA 4G1MB 4MJDA 1T5YA 2CH9A 1JB5A 2Y73A 1UW1A 4XDVA 2CFGA 3EN8A 5D81A 2Z76A 1NB5I 3DGNA 2PNCA 2BMRB 1YGEA 1LOVA 1BSAA 1J2BA 2YX9A 4KVHA 5M1AA 3FSDA 4LYLB 4R80A 2FNQA 1GOYA 4WFOA 1FGTA 2WOHA 1TJDA 4WP5A 2YFJB 2K54A 3GSPA 5D82A 1VQ53 3Q3FA 1YI23 2GBWB 3LTBA 1CQSA 1QAKA 2IUKA 2GSPA 5JPPA 2Q07A 1BSDA 1VQL3 3OWYA 4N6UA 5I97A 5M18A 5LC7A 2M7OA 3NQYA 4EYCA 1OGXA 4HZ9B 1TFKA 2QA43 4L7KA 1B2SA 4FMDA 3UB1A 1QAFA 1I3IA 5IG5A 3CD63 1Q40B 1I8VA 2R4IA 1UUVB 2HMOB 1BSBA 7STDA 1Q864 3CNMA 3I553 1Q814 1O7HB 3UL5A 2P0XA 1KD14 3FCSB 2OCTA 1NDOB 1IQXA 2QGUA 3K0ZA 5HOHA 1UGHI 2INXA 1D6UA 1FUSA 3EN1B 2JQ5A 2OQEC 3FKAA 3FG1A 3JVCA 1T2HA 1SQWA 3IPTA 3Q90A 3BIRA 1YJN3 1W01A 4O8SA 3CXC2 3MPHA 1W6CA 3QK9A 1RMSA 2RBIA 1FGMA 4JRFA 2CFKA 2XFTA 1Q40A 1W6GA 3AHSA 3I563 4HM8B 1GOUA 2XGNA 1M904 2KF6A 3WA2X 1MWTA 3B4OA 2E2VA 2F99A 1JKGB 2P0MA 2OQEA 4R1KA 5DRVA 1MOLA 4FCMA 3X40A 3DGOA 1UGIA 1W2B2 1RRLA 1D6ZA 1AVKA 5JBSA 4XBXA 3HI7A 3SOAA 3LH4A 2BIRA 1B3SA 1FUWA 1UUGB 1VQ83 1UCLA 3NHXA 1BRJA 3SOYA 4KT3B 1RN4A 3X42A 3DY5A 2XRXB 5IENA 3S67A 4EC6A 3NM7A 8CHOA 2GU3A 4CJNA 1IVWA 4EW5A 1U8CB 4K1VA 1W4NA 5IERA 1S723 2IYJA 3EE1A 4LEHA 1A2VA 1SIIA 4R4KA 4HM3B 1NWWA 1AV4A 1O7PB 1O7WB 1LOYA 4JF8A 4CDLA 5AIHA 2UUGC 4HZBB 1TTOA 3LT9A 3J7Yd 1C7HA 2STDA 3FH1A 3CU3A 1BNIA 3EQQB 1LOXA 5GSPA 5HGRA 4HM0B 5AEWB 2KCDA 1T3BA 2WO0A 3EF8A 1IU7A 1Q42A 1A2PA 1QVF2 1RCKA 1X1YA 2BHMA 3T8UA 3U97A 4PEJA 1G0TA 2Z7AA 1GSPA 3UNLA 1YVBI 4DKIA 2F56A 4HM6B 1G02A 2XGLA 1N9EA 1V74A 2XSOB 2RGQA 1FYSA 2XH9A 1CH0A 5AEUB 3SLUA 3DZLA 4MMXB 4IPBA 2W03A 3WA3A 1NO3A 3CCQ3 3MSOA 2F5MA 3NBBA 4H3UA 1BSEA 3FF2A 3N54B 1Y4KA 3G16A 1ULJB 1BAOA 2K3DA 1K28A 2CWUA 1YNVX 4J8TA 3DUKA 1DYUA 3F40A 1UI8A 1VQQA 4QWTA 4BIRA 4BTXA 4LMIA 3Q1CA 1K41A 1GYBA 2PZVA 2CK3H 2O3OA 3DH2A 1G96A 3K7CA 4KZ1A 5D83A 1RNBA 1BIRA 3F14A 3WHOA 1BUJA 2W0QA 1MWSA 4FCJA 3JUNA 1RGLA 3AMOA 2CX0A 3E99A 3SYUA 1EA2A 3VSYA 1T2IA 1ASKA 1OPYA 3PCRA 3S29A 1F8NA 1W7CA 1LRAA 2A15A 3N9HA 3OWUA 5IEPA 1LXEA 2P38A 3NBJA 1NNVA 5IW9A 1OUNA 1JV2B 4MEIA 4MMYB 2K0MA 1YJW3 1W02A 2C11A 5CF2A 1M1K4 1EKMA 3LZAA 4FMBA 4RNYA 1UCKA 1WNHA 3H51A 5RNTA 2W56B 1CYVA 5AI1A 1O7NB 2CFLA 4HM2B 1N8R4 1IYYA 1LVNA 1N8QA 2CC3A 1OGZA 3BU4A 4X2HA 1BNSA 3V99A 2C4BA 1N5PA 2CX1A 1RGFA 5BIRA 3KKGA 1BRSA 3BNEA 3AGNA 2MF7A 4FCZA 4XM4A 1A67A 5KP3A 3KIIA 1FA3A 8RNTA 4LGQA 1E3RA 4R9LA 3S27A 4O02B 4O2HA 3EHCA 2W56A 3NUVA 4XB5A 1BVIA 2ML6A 3EB8A 3GRDA 5ELUA 3KE7A 1GMRA 2F86B 2W6JH 3JUMA 2R41A 4AEQA 3G8ZA 2IUJA 1W2ZA 3LXUX 1K8A4 5CLKA 4AKZA 1SPUA 2UX0A 3FF0A 3PCSA 5G1KA 3DGYA 4OUQA 2W04A 3T8NA 1A2KA 3JUPA 4OVMA 3NV0B 6GSPA 2AADA 5DREA 2OOVC 3RGAA 2GXFA 2SBLA 3EBTA 2CHCA 1EEJA 2SARA 4HYZA 1FGRA 4STDA 3GZXB 3KSPA 1Q7Y4 4GB5A 1FUTA 4Q53A 3N8BA 2KRTA 1BRIA 3BNBA 3D79A 1JZDA 1BUQA 3NX0A 3U1WA 3GWRA 3JUQA 2J8XB 5A0OB 3DGMA 1TP6A 1JBSA 1ISKA 4BL2A 3F7XA 3DMCA 3A76A 4CCVA 3OW22 2ZHXB 2OOVA 2IA7A 1B21A 4HJLB 2XEPA 1DMNA 1I2EA 1UDII 1STFI 3L0RA 1O7MB 3WODG 3NV0A 4NHFA 4EV5A 4I4KA 2RSXA 3OX9A 2E2UA 4ILFA 5IF6A 4HVNA 2BT3A 1PU4A 3HIIA 1QVG2 2JDIH 1IQ8A 3VGNA 1K9M4 1BRGA 2GU1A 2UGIA 3V92A 2H0IA 3TDGA 4EXRA 1HZ1A 1JJ22 1MGRA 1AVLA 1RN1A 2W9PA 4IIAA 4EV2A 1I2FA 4HM5B 1TUHA 4GHOA 4GSPA 2LYXA 3F8XA 5FW5A 1V57A 5KP1A 3SVAA 3KCHA 2W2CA 1LQMB 1D6YA 1N5HA 1BNEA 1DVCA 3HIGA 3OWSA 3NQZA 1YVSA
chains in the Genus database with same CATH topology
3X3ZA 2OTL3 3CC73 1OACA 3HK4A 4K90B 3ROBA 1VQ73 3B7CA 3KFQC 3F8HA 1VQ43 3PZWA 4U13A 2HMMB 1KQS2 1M9GA 2V1LA 2CW9A 4NREA 3SX1A 3BLZA 2OWPA 1MNLA 3I0YA 4LZIA 3EC9A 5G2GA 3CME3 4K1UA 2L4VA 3EJVA 5IG4A 3CC43 4N6LA 1CEWI 3QRDA 1IT7A 4RBNA 3KN4A 5CXOA 5IG0A 3EX9A 3K5TA 3AMOB 2P05A 1PFPA 2GEYA 2WGOA 4FMAA 4HKVB 2P09A 3HZPA 3IMAB 3VF1A 3S5CA 4FMCA 2Z77A 5LC6A 2WGQA 3UJMA 5CK6A 5EEOA 2Y74A 1YIJ3 2B24B 5EVHA 4HM4B 3FGYA 1RJOA 4EBGA 3CCR3 1A90A 3LYGA 2W9QA 3GZBA 4XBTA 5KP4A 3BNDA 3MYTA 1OH0A 1DMQA 1O7GB 3HX8A 3GZRA 3MG2A 3MWZA 1DVDA 1S5AA 1KSIA 2D42A 3ECFA 1QJGA 1EG9B 2BNGA 4O3VA 3X3XA 1ZX2A 3G6E3 5BVBA 1AR0A 2F98A 1TU5A 3MG1A 1EQKA 2YFLB 1CYUA 1KWIA 2Z6BA 1VQO3 4GL6A 3H3HA 4N6TA 2XF3A 3FG3A 1STDA 1IDPA 4XDWA 1IV7A 2HMKB 1E97A 1JNQA 3MG3A 2XFSA 1UI7A 3ALAA 1OHPA 1YIT3 5FGOA 1NU3A 3S28A 4ZM8A 2IMJA 1GD4A 2LQVA 4HM1B 3UL6A 3WDGB 3G713 3LT8A 1W6YA 2XR8B 2QIYA 1WQLB 2BMQB 3KSED 3KZTA 3PGBA 3CCV3 3WOEB 3CCU3 1M1XB 1JB4A 1US1A 2OTJ3 2E2TA 2XSHB 1JN5A 4X2OA 1K734 1WTHA 4R9KA 1JRQA 3LOYA 1Q824 1GS3A 1RN7A 2CWVA 4J9AA 4N3VA 3K9MC 2O9UX 4HM7B 1ROAA 3DGLA 4N6NB 1VQ93 2FXTA 1L5GB 3BB9A 2BMOB 4LSOA 1KC84 4K61A 3X3YA 1VQ63 3BNCA 1W00A 5AYRB 5AIGA 3X41A 3F7SA 4TX4A 1ZO2A 4FR9A 3CCJ3 2MC8A 2YFIB 1VQK3 4KFEA 3B8LA 3D3LA 3OXAA 4H61A 4OK0A 1IT8A 1IV9A 1VQM3 3CNXA 1HKXA 5CF1A 3WMDA 3RGRA 3SEDA 2HMNB 3O8YA 3NXJA 3CCE3 4N6V0 1U5OA 5IG3A 1ROVA 4WWUC 4L8PA 3EBYA 2HMLB 3CCL3 2I9WA 1WMNA 3F9SA 2BO9B 1E3VA 1FGOA 3DM8A 3PYJA 2CIUA 1OF5B 1SIHA 4N6MA 3CCS3 3CMA3 4KFFA 1HU9A 1GD3A 5AIFA 3FG4A 4MMZB 3DXOA 3K63A 1GY7A 2B1XB 1TIJA 1ULIB 1NB3I 1SJWA 3SXXA 2C10A 3D9RA 1LNHA 4AKYA 2CFWA 5EQLA 1OHSA 3CPW2 3V98A 2HMJB 1TFOA 1YJ93 1OF5A 1NJI4 2QEX3 1JKGA 5AYSC 1W5ZA 3LTCA 5ELJA 3B4PA 3LTAA 1GY5A 1RKYA 2WOFA 1QALA 3JUOA 1YHQ3 1IVVA 3FZWA 3IJEB 2KXGA 2ZDJA 3MKIA 3WOFB 4BTYA 4XBYA 1WMOA 1QMAA 3ER7A 4WYKB 1FGQA 1WMPA 3T0UA 3LMLA 5STDA 2GBXB 3CCM3 3M8CA 2RFRA 6STDA 2CFDA 1Z1SA 1UUWB 1IVUA 4N6OB 4BTWA 2CWTA 3G0KA 1VZZA 3FLJA 1JB2A 3PXMA 3RDEA 4RNZA 5JPUA 1GY6A 1RRHA 1DMMA 1R4CA 1IQYA 2CG1A 3CPOA 4KFDA 2GEXA 2ZL8A 1N9JA 3STDA 2D1WA 3G4S3 2RCDA 3PS8A 4RZMA 4WYKA 5IEOA 3NM2A 4L8OA 1VQN3 3OV4A 2FGTA 3GZYB 3LTDA 1IK3A 1IVXA 2CG0A 3GAXA 5BXQA 3Q2PA 1OHOA 2ML5A 3MHEA 1JN5B 4ORLA 2CKFB 5TGNA 5AIIA 3CC23 1OCVA 4HBRA 4IT7A 3NBRA 4G1MB 4MJDA 1T5YA 2CH9A 1JB5A 2Y73A 1UW1A 4XDVA 2CFGA 3EN8A 5D81A 2Z76A 1NB5I 3DGNA 2PNCA 2BMRB 1YGEA 1J2BA 2YX9A 4KVHA 3FSDA 4R80A 2FNQA 4WFOA 1FGTA 2WOHA 4WP5A 2YFJB 2K54A 5D82A 1VQ53 1YI23 2GBWB 3LTBA 1CQSA 1QAKA 2IUKA 5JPPA 2Q07A 1VQL3 3OWYA 4N6UA 5I97A 5LC7A 2M7OA 3NQYA 4EYCA 1OGXA 4HZ9B 1TFKA 2QA43 4L7KA 4FMDA 3UB1A 1QAFA 5IG5A 3CD63 1Q40B 2R4IA 1UUVB 2HMOB 7STDA 1Q864 3CNMA 3I553 1Q814 1O7HB 3UL5A 2P0XA 1KD14 3FCSB 2OCTA 1NDOB 1IQXA 2QGUA 3K0ZA 2INXA 1D6UA 3EN1B 2JQ5A 2OQEC 3FKAA 3FG1A 3JVCA 1SQWA 3IPTA 3Q90A 1YJN3 1W01A 4O8SA 3CXC2 3MPHA 1W6CA 3QK9A 1FGMA 4JRFA 2CFKA 2XFTA 1Q40A 1W6GA 3I563 4HM8B 2XGNA 1M904 3WA2X 3B4OA 2E2VA 2F99A 1JKGB 2P0MA 2OQEA 4R1KA 5DRVA 1MOLA 4FCMA 3X40A 3DGOA 1W2B2 1RRLA 1D6ZA 1AVKA 5JBSA 4XBXA 3HI7A 3SOAA 3LH4A 1FUWA 1VQ83 3NHXA 3SOYA 3X42A 3DY5A 2XRXB 5IENA 3S67A 4EC6A 3NM7A 8CHOA 2GU3A 1IVWA 1U8CB 4K1VA 1W4NA 5IERA 1S723 3EE1A 4LEHA 1A2VA 1SIIA 4R4KA 4HM3B 1NWWA 1AV4A 1O7PB 1O7WB 4JF8A 4CDLA 5AIHA 4HZBB 3LT9A 3J7Yd 1C7HA 2STDA 3FH1A 3CU3A 3EQQB 1LOXA 5HGRA 4HM0B 5AEWB 2KCDA 2WO0A 3EF8A 1IU7A 1Q42A 1QVF2 3T8UA 3U97A 2BHMA 4PEJA 2Z7AA 3UNLA 1YVBI 4HM6B 2XGLA 1N9EA 1V74A 2XSOB 2RGQA 2XH9A 5AEUB 3SLUA 3DZLA 4MMXB 4IPBA 2W03A 3WA3A 1NO3A 3CCQ3 3MSOA 3NBBA 4H3UA 3FF2A 3N54B 1Y4KA 3G16A 1ULJB 1K28A 2CWUA 4J8TA 3DUKA 1DYUA 3F40A 1UI8A 4QWTA 4BTXA 4LMIA 3Q1CA 1K41A 1GYBA 2PZVA 2CK3H 2O3OA 3K7CA 1G96A 4KZ1A 5D83A 3F14A 2W0QA 4FCJA 3JUNA 3AMOA 3E99A 1EA2A 3VSYA 1ASKA 1OPYA 3PCRA 3S29A 1F8NA 1W7CA 2A15A 3N9HA 3OWUA 5IEPA 1LXEA 2P38A 3NBJA 5IW9A 1OUNA 1JV2B 4MEIA 4MMYB 2K0MA 1YJW3 1W02A 2C11A 5CF2A 1M1K4 1EKMA 3LZAA 4FMBA 4RNYA 1WNHA 3H51A 2W56B 1CYVA 5AI1A 1O7NB 2CFLA 4HM2B 1N8R4 1LVNA 1N8QA 2CC3A 1OGZA 4X2HA 3V99A 1N5PA 3KKGA 3BNEA 2MF7A 4FCZA 4XM4A 1A67A 5KP3A 3KIIA 1FA3A 4LGQA 1E3RA 4R9LA 3S27A 4O02B 4O2HA 3EHCA 2W56A 3NUVA 4XB5A 2ML6A 3EB8A 3GRDA 5ELUA 3KE7A 2F86B 2W6JH 3JUMA 4AEQA 3G8ZA 2IUJA 1W2ZA 3LXUX 1K8A4 5CLKA 4AKZA 1SPUA 2UX0A 3FF0A 3PCSA 4OUQA 2W04A 3T8NA 1A2KA 3JUPA 4OVMA 3NV0B 5DREA 2OOVC 3RGAA 2GXFA 2SBLA 3EBTA 2CHCA 4HYZA 1FGRA 4STDA 3GZXB 3KSPA 1Q7Y4 4GB5A 4Q53A 3N8BA 2KRTA 3BNBA 1BUQA 3NX0A 3U1WA 3GWRA 3JUQA 5A0OB 1ISKA 3DGMA 1TP6A 3F7XA 3DMCA 3A76A 4CCVA 3OW22 2OOVA 2IA7A 4HJLB 2XEPA 1DMNA 1STFI 3L0RA 1O7MB 3WODG 3NV0A 4NHFA 4EV5A 4I4KA 2RSXA 3OX9A 2E2UA 5IF6A 1PU4A 4HVNA 2BT3A 1VQP3 3HIIA 1QVG2 2JDIH 1IQ8A 3VGNA 1K9M4 2GU1A 3V92A 3TDGA 4EXRA 1JJ22 1AVLA 2W9PA 4IIAA 4EV2A 4HM5B 1TUHA 2LYXA 3F8XA 5FW5A 5KP1A 3SVAA 2W2CA 1N5HA 1D6YA 3HIGA 1DVCA 3OWSA 3NQZA 4WHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK4 A;  3ROB A;  3B7C A;  3F8H A;  4U13 A;  2HMM B;  3BLZ A;  2OWP A;  3I0Y A;  3EC9 A;  5G2G A;  4K1U A;  3EJV A;  5IG4 A;  5CXO A;  5IG0 A;  3EX9 A;  2GEY A;  4HKV B;  3HZP A;  3S5C A;  2Z77 A;  3UJM A;  5CK6 A;  2B24 B;  5EVH A;  4HM4 B;  3FGY A;  3LYG A;  3GZB A;  4XBT A;  5KP4 A;  3MYT A;  1OH0 A;  1DMQ A;  1O7G B;  3HX8 A;  3GZR A;  3MG2 A;  1S5A A;  3ECF A;  1QJG A;  1EG9 B;  2BNG A;  1ZX2 A;  5BVB A;  1AR0 A;  2F98 A;  3MG1 A;  2YFL B;  3H3H A;  1STD A;  1IDP A;  4XDW A;  2HMK B;  1E97 A;  3MG3 A;  1OHP A;  1NU3 A;  2IMJ A;  4HM1 B;  1W6Y A;  2XR8 B;  2QIY A;  1WQL B;  2BMQ B;  3KZT A;  1JB4 A;  2XSH B;  1JN5 A;  4X2O A;  4R9K A;  1GS3 A;  4J9A A;  4N3V A;  4HM7 B;  3BB9 A;  2BMO B;  1W00 A;  5AIG A;  3F7S A;  1ZO2 A;  2YFI B;  3B8L A;  3OXA A;  3CNX A;  1HKX A;  5CF1 A;  3WMD A;  3RGR A;  3SED A;  2HMN B;  3NXJ A;  1U5O A;  5IG3 A;  4WWU C;  4L8P A;  3EBY A;  2HML B;  2I9W A;  3F9S A;  1E3V A;  3DM8 A;  1OF5 B;  5AIF A;  3DXO A;  1GY7 A;  2B1X B;  1ULI B;  1SJW A;  3D9R A;  1OHS A;  2HMJ B;  1OF5 A;  1JKG A;  3B4P A;  1GY5 A;  3JUO A;  3FZW A;  3MKI A;  4XBY A;  1QMA A;  3ER7 A;  4WYK B;  5STD A;  2GBX B;  3M8C A;  2RFR A;  6STD A;  1Z1S A;  1UUW B;  3G0K A;  1VZZ A;  3FLJ A;  1JB2 A;  5JPU A;  1GY6 A;  1DMM A;  3CPO A;  2GEX A;  3STD A;  2RCD A;  4WYK A;  4RZM A;  5IEO A;  3NM2 A;  4L8O A;  3OV4 A;  3GZY B;  5BXQ A;  1OHO A;  3MHE A;  1JN5 B;  4ORL A;  2CKF B;  5TGN A;  5AII A;  1OCV A;  3NBR A;  4MJD A;  1JB5 A;  4XDV A;  3EN8 A;  5D81 A;  2Z76 A;  2BMR B;  4KVH A;  3FSD A;  4WP5 A;  2YFJ B;  2K54 A;  5D82 A;  2GBW B;  1CQS A;  5JPP A;  3OWY A;  1OGX A;  4HZ9 B;  4L7K A;  5IG5 A;  1Q40 B;  2R4I A;  1UUV B;  2HMO B;  7STD A;  3CNM A;  1O7H B;  1NDO B;  2QGU A;  3K0Z A;  2INX A;  3EN1 B;  2JQ5 A;  3FKA A;  3IPT A;  3Q90 A;  1W01 A;  1Q40 A;  4HM8 B;  3B4O A;  2F99 A;  1JKG B;  4R1K A;  5DRV A;  4FCM A;  4XBX A;  3SOA A;  3NHX A;  3SOY A;  2XRX B;  5IEN A;  8CHO A;  4K1V A;  5IER A;  4LEH A;  4HM3 B;  1NWW A;  1O7P B;  1O7W B;  4CDL A;  5AIH A;  4HZB B;  1C7H A;  2STD A;  3FH1 A;  3CU3 A;  3EQQ B;  5HGR A;  4HM0 B;  5AEW B;  3EF8 A;  1Q42 A;  3T8U A;  4PEJ A;  2Z7A A;  3UNL A;  4HM6 B;  2XSO B;  2RGQ A;  5AEU B;  3DZL A;  3MSO A;  4H3U A;  3FF2 A;  3G16 A;  1ULJ B;  4J8T A;  3DUK A;  3F40 A;  4LMI A;  1K41 A;  1GYB A;  2PZV A;  3K7C A;  5D83 A;  3F14 A;  4FCJ A;  3JUN A;  3E99 A;  1EA2 A;  3VSY A;  1ASK A;  1OPY A;  2A15 A;  3OWU A;  5IEP A;  1OUN A;  1W02 A;  5CF2 A;  3LZA A;  3H51 A;  5AI1 A;  1O7N B;  4HM2 B;  4X2H A;  1OGZ A;  3KKG A;  4XM4 A;  5KP3 A;  4LGQ A;  1E3R A;  4R9L A;  3EHC A;  3NUV A;  4XB5 A;  3GRD A;  3KE7 A;  2F86 B;  3JUM A;  3G8Z A;  5CLK A;  2UX0 A;  3FF0 A;  4OUQ A;  3T8N A;  1A2K A;  3JUP A;  4OVM A;  3NV0 B;  5DRE A;  3RGA A;  2GXF A;  3EBT A;  2CHC A;  4STD A;  3GZX B;  3KSP A;  4GB5 A;  4Q53 A;  1BUQ A;  1ISK A;  3GWR A;  3JUQ A;  1TP6 A;  3F7X A;  3DMC A;  3A76 A;  4HJL B;  1DMN A;  1O7M B;  3NV0 A;  4I4K A;  3OX9 A;  5IF6 A;  4HVN A;  3VGN A;  4IIA A;  4HM5 B;  1TUH A;  3F8X A;  5FW5 A;  5KP1 A;  2W2C A;  3OWS A; 
#chains in the Genus database with same CATH topology
 3X3Z A;  3D5G A;  3CC7 3;  2OTL 3;  1OAC A;  3HK4 A;  1BOX A;  4K90 B;  3ROB A;  1VQ7 3;  3B7C A;  3KFQ C;  3F8H A;  1VQ4 3;  1I3F A;  3PZW A;  4U13 A;  2BU4 A;  2HMM B;  1KQS 2;  1M9G A;  2V1L A;  2CW9 A;  4NRE A;  3SX1 A;  3BLZ A;  1JZO A;  1I0X A;  2OWP A;  1MNL A;  1BRK A;  3I0Y A;  4LZI A;  3EC9 A;  5G2G A;  3CME 3;  4K1U A;  2L4V A;  3EJV A;  5IG4 A;  1PY3 A;  3CC4 3;  1RNT A;  1CEW I;  4N6L A;  3QRD A;  1IT7 A;  4RBN A;  3KN4 A;  1V58 A;  5CXO A;  5IG0 A;  3EX9 A;  1AQZ A;  3K5T A;  1TRQ A;  3AMO B;  2P05 A;  3A5E A;  1MGW A;  1PFP A;  2GEY A;  2WGO A;  4CPK A;  4FMA A;  4HKV B;  7GSP A;  2P09 A;  3HZP A;  3IMA B;  4RNT A;  3VF1 A;  3S5C A;  4FMC A;  7RNT A;  2Z77 A;  5LC6 A;  4HAA A;  2WGQ A;  2H0G A;  5CK6 A;  3UJM A;  5EEO A;  2Y74 A;  1YIJ 3;  1GMQ A;  2B24 B;  5EVH A;  4HM4 B;  1RGH A;  1RJO A;  3FGY A;  4EBG A;  3CCR 3;  3LYG A;  1A90 A;  2W9Q A;  3GZB A;  1BNG A;  4I5Q A;  1B2M A;  1BRN L;  4XBT A;  5KP4 A;  3BND A;  1BNF A;  3MYT A;  1OH0 A;  1MWR A;  1DMQ A;  1O7G B;  3HX8 A;  3GZR A;  3MG2 A;  3MWZ A;  4NPB A;  9RNT A;  1DVD A;  1C54 A;  1SAR A;  1S5A A;  1KSI A;  1FW7 A;  2D42 A;  3ECF A;  1QJG A;  1EG9 B;  2BNG A;  4O3V A;  4WHA A;  3X3X A;  1UCI A;  1ZX2 A;  1I0V A;  3G6E 3;  5BVB A;  1RLS A;  1AR0 A;  2F98 A;  1TU5 A;  4J5G A;  3MG1 A;  1EQK A;  2YFL B;  2IY2 A;  1CYU A;  1KWI A;  2Z6B A;  1VQO 3;  2AAE A;  4GL6 A;  3H3H A;  4N6T A;  2XF3 A;  3FG3 A;  1STD A;  1B2Z A;  1IDP A;  4XDW A;  1IV7 A;  2HMK B;  1E97 A;  1JNQ A;  3MG3 A;  1Q9E A;  2XFS A;  1UI7 A;  3ALA A;  1OHP A;  1YIT 3;  1RTU A;  1DET A;  5FGO A;  1NU3 A;  3S28 A;  4ZM8 A;  2IMJ A;  6RNT A;  1AY7 A;  1GD4 A;  2LQV A;  1X1U A;  1LNI A;  1B2X A;  1BNJ A;  4HM1 B;  3UL6 A;  3D4A A;  3LT8 A;  1W6Y A;  3WDG B;  1ZS7 A;  2XR8 B;  3G71 3;  1VQP 3;  2QIY A;  1WQL B;  2BMQ B;  3KSE D;  3KZT A;  3PGB A;  3CCV 3;  3WOE B;  3CCU 3;  3AGO A;  1M1X B;  1JB4 A;  1US1 A;  3ZG5 A;  2OTJ 3;  1FZU A;  1RGA A;  2E2T A;  2XSH B;  1JN5 A;  4X2O A;  1K73 4;  1WTH A;  4R9K A;  1JRQ A;  3LOY A;  1I70 A;  1Q82 4;  1GS3 A;  1JBR A;  1RN7 A;  2CWV A;  1ZGX A;  4J9A A;  4N3V A;  3K9M C;  2O9U X;  4HM7 B;  1HYF A;  1ROA A;  2KAA A;  3DGL A;  2KF4 A;  4N6N B;  1VQ9 3;  2FXT A;  1L5G B;  3BB9 A;  2BMO B;  1BSC A;  4LSO A;  1KC8 4;  4K61 A;  1Q7H A;  3X3Y A;  1VQ6 3;  3BNC A;  1W00 A;  5AYR B;  5AIG A;  3X41 A;  3F7S A;  4TX4 A;  1ZO2 A;  4FR9 A;  3CCJ 3;  1RGC A;  1LOW A;  3URP A;  1GOV A;  2MC8 A;  2YFI B;  1VQK 3;  4KFE A;  3B8L A;  3D3L A;  3OXA A;  4H61 A;  4OK0 A;  1RSN A;  1IT8 A;  1IV9 A;  4BL3 A;  1VQM 3;  3CNX A;  1UCJ A;  1HKX A;  2L1S A;  5CF1 A;  1BNR A;  5BU4 A;  2KF3 A;  3WMD A;  3RGR A;  3SED A;  2HMN B;  3O8Y A;  3NXJ A;  3CCE 3;  4N6V 0;  1U5O A;  5IG3 A;  1ROV A;  3ZG0 A;  1MWU A;  2ZA4 A;  1LQG C;  4WWU C;  4L8P A;  1RDS A;  5M19 A;  3EBY A;  3AHW A;  4HOH A;  2HML B;  3CCL 3;  2I9W A;  1WMN A;  2F4Y A;  3F9S A;  2BO9 B;  1E3V A;  1FGO A;  2KF5 A;  3DM8 A;  3PYJ A;  2CIU A;  4J5K A;  1BU4 A;  1OF5 B;  1SIH A;  1R4Y A;  4N6M A;  3CCS 3;  3CMA 3;  4KFF A;  1HU9 A;  1GD3 A;  5AIF A;  3RNT A;  3FG4 A;  1EUI C;  4MMZ B;  3DXO A;  3K63 A;  1GY7 A;  2B1X B;  1TIJ A;  1ULI B;  1NB3 I;  1SJW A;  3SXX A;  2C10 A;  3D9R A;  1GMP A;  1LNH A;  4AKY A;  2CFW A;  1JBT A;  5EQL A;  1OHS A;  3CPW 2;  3V98 A;  2HMJ B;  1TFO A;  1BRH A;  1YJ9 3;  1OF5 A;  1RGE A;  1NJI 4;  1BAN A;  2QEX 3;  1JKG A;  5AYS C;  1W5Z A;  1PYL A;  3LTC A;  5ELJ A;  3B4P A;  3LTA A;  3WR2 A;  1GY5 A;  1RKY A;  2WOF A;  1RGK A;  1QAL A;  1DE3 A;  2F5W A;  3JUO A;  1YHQ 3;  1IVV A;  1B27 A;  3FZW A;  3IJE B;  2KXG A;  2ZDJ A;  1RHL A;  3MKI A;  3WOF B;  4XBY A;  4BTY A;  1WMO A;  1QMA A;  3ZFZ A;  3ER7 A;  4WYK B;  1FGQ A;  1WMP A;  3T0U A;  3LML A;  5STD A;  2HOH A;  1B20 A;  2RNT A;  2GBX B;  3CCM 3;  3M8C A;  2RFR A;  6STD A;  2CFD A;  1YGW A;  1Z1S A;  1UUW B;  1IVU A;  4N6O B;  4BTW A;  2CWT A;  3G0K A;  1VZZ A;  1X1W A;  3FLJ A;  1JB2 A;  1X1X A;  3PXM A;  3RDE A;  4RNZ A;  5JPU A;  1GY6 A;  1RRH A;  1DMM A;  1B2U A;  1IQY A;  1R4C A;  2CG1 A;  3CPO A;  4KFD A;  2GEX A;  2ZL8 A;  1N9J A;  3STD A;  2D1W A;  3G4S 3;  2RCD A;  3D5I A;  1BGS A;  3PS8 A;  4RZM A;  2H0H A;  1RCL A;  4WYK A;  3NM2 A;  5IEO A;  4L8O A;  1I2G A;  1VQN 3;  3OV4 A;  2FGT A;  3GZY B;  3LTD A;  1IK3 A;  1IVX A;  2CG0 A;  5G1L A;  3GAX A;  5BXQ A;  3Q2P A;  1RGG A;  1OHO A;  3HOH A;  2ML5 A;  3MHE A;  1JN5 B;  4ORL A;  4BU4 A;  2CKF B;  5TGN A;  5AII A;  1TRP A;  3CC2 3;  1OCV A;  4HBR A;  4IT7 A;  3NBR A;  4G1M B;  4MJD A;  1T5Y A;  2CH9 A;  1JB5 A;  2Y73 A;  1UW1 A;  4XDV A;  2CFG A;  3EN8 A;  5D81 A;  2Z76 A;  1NB5 I;  3DGN A;  2PNC A;  2BMR B;  1YGE A;  1LOV A;  1BSA A;  1J2B A;  2YX9 A;  4KVH A;  5M1A A;  3FSD A;  4LYL B;  4R80 A;  2FNQ A;  1GOY A;  4WFO A;  1FGT A;  2WOH A;  1TJD A;  4WP5 A;  2YFJ B;  2K54 A;  3GSP A;  5D82 A;  1VQ5 3;  3Q3F A;  1YI2 3;  2GBW B;  3LTB A;  1CQS A;  1QAK A;  2IUK A;  2GSP A;  5JPP A;  2Q07 A;  1BSD A;  1VQL 3;  3OWY A;  4N6U A;  5I97 A;  5M18 A;  5LC7 A;  2M7O A;  3NQY A;  4EYC A;  1OGX A;  4HZ9 B;  1TFK A;  2QA4 3;  4L7K A;  1B2S A;  4FMD A;  3UB1 A;  1QAF A;  1I3I A;  5IG5 A;  3CD6 3;  1Q40 B;  1I8V A;  2R4I A;  1UUV B;  2HMO B;  1BSB A;  7STD A;  1Q86 4;  3CNM A;  3I55 3;  1Q81 4;  1O7H B;  3UL5 A;  2P0X A;  1KD1 4;  3FCS B;  2OCT A;  1NDO B;  1IQX A;  2QGU A;  3K0Z A;  5HOH A;  1UGH I;  2INX A;  1D6U A;  1FUS A;  3EN1 B;  2JQ5 A;  2OQE C;  3FKA A;  3FG1 A;  3JVC A;  1T2H A;  1SQW A;  3IPT A;  3Q90 A;  3BIR A;  1YJN 3;  1W01 A;  4O8S A;  3CXC 2;  3MPH A;  1W6C A;  3QK9 A;  1RMS A;  2RBI A;  1FGM A;  4JRF A;  2CFK A;  2XFT A;  1Q40 A;  1W6G A;  3AHS A;  3I56 3;  4HM8 B;  1GOU A;  2XGN A;  1M90 4;  2KF6 A;  3WA2 X;  1MWT A;  3B4O A;  2E2V A;  2F99 A;  1JKG B;  2P0M A;  2OQE A;  4R1K A;  5DRV A;  1MOL A;  4FCM A;  3X40 A;  3DGO A;  1UGI A;  1W2B 2;  1RRL A;  1D6Z A;  1AVK A;  5JBS A;  4XBX A;  3HI7 A;  3SOA A;  3LH4 A;  2BIR A;  1B3S A;  1FUW A;  1UUG B;  1VQ8 3;  1UCL A;  3NHX A;  1BRJ A;  3SOY A;  4KT3 B;  1RN4 A;  3X42 A;  3DY5 A;  2XRX B;  5IEN A;  3S67 A;  4EC6 A;  3NM7 A;  8CHO A;  2GU3 A;  4CJN A;  1IVW A;  4EW5 A;  1U8C B;  4K1V A;  1W4N A;  5IER A;  1S72 3;  2IYJ A;  3EE1 A;  4LEH A;  1A2V A;  1SII A;  4R4K A;  4HM3 B;  1NWW A;  1AV4 A;  1O7P B;  1O7W B;  1LOY A;  4JF8 A;  4CDL A;  5AIH A;  2UUG C;  4HZB B;  1TTO A;  3LT9 A;  3J7Y d;  1C7H A;  2STD A;  3FH1 A;  3CU3 A;  1BNI A;  3EQQ B;  1LOX A;  5GSP A;  5HGR A;  4HM0 B;  5AEW B;  2KCD A;  1T3B A;  2WO0 A;  3EF8 A;  1IU7 A;  1Q42 A;  1A2P A;  1QVF 2;  1RCK A;  1X1Y A;  2BHM A;  3T8U A;  3U97 A;  4PEJ A;  1G0T A;  2Z7A A;  1GSP A;  3UNL A;  1YVB I;  4DKI A;  2F56 A;  4HM6 B;  1G02 A;  2XGL A;  1N9E A;  1V74 A;  2XSO B;  2RGQ A;  1FYS A;  2XH9 A;  1CH0 A;  5AEU B;  3SLU A;  3DZL A;  4MMX B;  4IPB A;  2W03 A;  3WA3 A;  1NO3 A;  3CCQ 3;  3MSO A;  2F5M A;  3NBB A;  4H3U A;  1BSE A;  3FF2 A;  3N54 B;  1Y4K A;  3G16 A;  1ULJ B;  1BAO A;  2K3D A;  1K28 A;  2CWU A;  1YNV X;  4J8T A;  3DUK A;  1DYU A;  3F40 A;  1UI8 A;  1VQQ A;  4QWT A;  4BIR A;  4BTX A;  4LMI A;  3Q1C A;  1K41 A;  1GYB A;  2PZV A;  2CK3 H;  2O3O A;  3DH2 A;  1G96 A;  3K7C A;  4KZ1 A;  5D83 A;  1RNB A;  1BIR A;  3F14 A;  3WHO A;  1BUJ A;  2W0Q A;  1MWS A;  4FCJ A;  3JUN A;  1RGL A;  3AMO A;  2CX0 A;  3E99 A;  3SYU A;  1EA2 A;  3VSY A;  1T2I A;  1ASK A;  1OPY A;  3PCR A;  3S29 A;  1F8N A;  1W7C A;  1LRA A;  2A15 A;  3N9H A;  3OWU A;  5IEP A;  1LXE A;  2P38 A;  3NBJ A;  1NNV A;  5IW9 A;  1OUN A;  1JV2 B;  4MEI A;  4MMY B;  2K0M A;  1YJW 3;  1W02 A;  2C11 A;  5CF2 A;  1M1K 4;  1EKM A;  3LZA A;  4FMB A;  4RNY A;  1UCK A;  1WNH A;  3H51 A;  5RNT A;  2W56 B;  1CYV A;  5AI1 A;  1O7N B;  2CFL A;  4HM2 B;  1N8R 4;  1IYY A;  1LVN A;  1N8Q A;  2CC3 A;  1OGZ A;  3BU4 A;  4X2H A;  1BNS A;  3V99 A;  2C4B A;  1N5P A;  2CX1 A;  1RGF A;  5BIR A;  3KKG A;  1BRS A;  3BNE A;  3AGN A;  2MF7 A;  4FCZ A;  4XM4 A;  1A67 A;  5KP3 A;  3KII A;  1FA3 A;  8RNT A;  4LGQ A;  1E3R A;  4R9L A;  3S27 A;  4O02 B;  4O2H A;  3EHC A;  2W56 A;  3NUV A;  4XB5 A;  1BVI A;  2ML6 A;  3EB8 A;  3GRD A;  5ELU A;  3KE7 A;  1GMR A;  2F86 B;  2W6J H;  3JUM A;  2R41 A;  4AEQ A;  3G8Z A;  2IUJ A;  1W2Z A;  3LXU X;  1K8A 4;  5CLK A;  4AKZ A;  1SPU A;  2UX0 A;  3FF0 A;  3PCS A;  5G1K A;  3DGY A;  4OUQ A;  2W04 A;  3T8N A;  1A2K A;  3JUP A;  4OVM A;  3NV0 B;  6GSP A;  2AAD A;  5DRE A;  2OOV C;  3RGA A;  2GXF A;  2SBL A;  3EBT A;  2CHC A;  1EEJ A;  2SAR A;  4HYZ A;  1FGR A;  4STD A;  3GZX B;  3KSP A;  1Q7Y 4;  4GB5 A;  1FUT A;  4Q53 A;  3N8B A;  2KRT A;  1BRI A;  3BNB A;  3D79 A;  1JZD A;  1BUQ A;  3NX0 A;  3U1W A;  3GWR A;  3JUQ A;  2J8X B;  5A0O B;  3DGM A;  1TP6 A;  1JBS A;  1ISK A;  4BL2 A;  3F7X A;  3DMC A;  3A76 A;  4CCV A;  3OW2 2;  2ZHX B;  2OOV A;  2IA7 A;  1B21 A;  4HJL B;  2XEP A;  1DMN A;  1I2E A;  1UDI I;  1STF I;  3L0R A;  1O7M B;  3WOD G;  3NV0 A;  4NHF A;  4EV5 A;  4I4K A;  2RSX A;  3OX9 A;  2E2U A;  4ILF A;  5IF6 A;  4HVN A;  2BT3 A;  1PU4 A;  3HII A;  1QVG 2;  2JDI H;  1IQ8 A;  3VGN A;  1K9M 4;  1BRG A;  2GU1 A;  2UGI A;  3V92 A;  2H0I A;  3TDG A;  4EXR A;  1HZ1 A;  1JJ2 2;  1MGR A;  1AVL A;  1RN1 A;  2W9P A;  4IIA A;  4EV2 A;  1I2F A;  4HM5 B;  1TUH A;  4GHO A;  4GSP A;  2LYX A;  3F8X A;  5FW5 A;  1V57 A;  5KP1 A;  3SVA A;  3KCH A;  2W2C A;  1LQM B;  1D6Y A;  1N5H A;  1BNE A;  1DVC A;  3HIG A;  3OWS A;  3NQZ A;  1YVS A; 
#chains in the Genus database with same CATH homology
 3X3Z A;  2OTL 3;  3CC7 3;  1OAC A;  3HK4 A;  4K90 B;  3ROB A;  1VQ7 3;  3B7C A;  3KFQ C;  3F8H A;  1VQ4 3;  3PZW A;  4U13 A;  2HMM B;  1KQS 2;  1M9G A;  2V1L A;  2CW9 A;  4NRE A;  3SX1 A;  3BLZ A;  2OWP A;  1MNL A;  3I0Y A;  4LZI A;  3EC9 A;  5G2G A;  3CME 3;  4K1U A;  2L4V A;  3EJV A;  5IG4 A;  3CC4 3;  4N6L A;  1CEW I;  3QRD A;  1IT7 A;  4RBN A;  3KN4 A;  5CXO A;  5IG0 A;  3EX9 A;  3K5T A;  3AMO B;  2P05 A;  1PFP A;  2GEY A;  2WGO A;  4FMA A;  4HKV B;  2P09 A;  3HZP A;  3IMA B;  3VF1 A;  3S5C A;  4FMC A;  2Z77 A;  5LC6 A;  2WGQ A;  3UJM A;  5CK6 A;  5EEO A;  2Y74 A;  1YIJ 3;  2B24 B;  5EVH A;  4HM4 B;  3FGY A;  1RJO A;  4EBG A;  3CCR 3;  1A90 A;  3LYG A;  2W9Q A;  3GZB A;  4XBT A;  5KP4 A;  3BND A;  3MYT A;  1OH0 A;  1DMQ A;  1O7G B;  3HX8 A;  3GZR A;  3MG2 A;  3MWZ A;  1DVD A;  1S5A A;  1KSI A;  2D42 A;  3ECF A;  1QJG A;  1EG9 B;  2BNG A;  4O3V A;  3X3X A;  1ZX2 A;  3G6E 3;  5BVB A;  1AR0 A;  2F98 A;  1TU5 A;  3MG1 A;  1EQK A;  2YFL B;  1CYU A;  1KWI A;  2Z6B A;  1VQO 3;  4GL6 A;  3H3H A;  4N6T A;  2XF3 A;  3FG3 A;  1STD A;  1IDP A;  4XDW A;  1IV7 A;  2HMK B;  1E97 A;  1JNQ A;  3MG3 A;  2XFS A;  1UI7 A;  3ALA A;  1OHP A;  1YIT 3;  5FGO A;  1NU3 A;  3S28 A;  4ZM8 A;  2IMJ A;  1GD4 A;  2LQV A;  4HM1 B;  3UL6 A;  3WDG B;  3G71 3;  3LT8 A;  1W6Y A;  2XR8 B;  2QIY A;  1WQL B;  2BMQ B;  3KSE D;  3KZT A;  3PGB A;  3CCV 3;  3WOE B;  3CCU 3;  1M1X B;  1JB4 A;  1US1 A;  2OTJ 3;  2E2T A;  2XSH B;  1JN5 A;  4X2O A;  1K73 4;  1WTH A;  4R9K A;  1JRQ A;  3LOY A;  1Q82 4;  1GS3 A;  1RN7 A;  2CWV A;  4J9A A;  4N3V A;  3K9M C;  2O9U X;  4HM7 B;  1ROA A;  3DGL A;  4N6N B;  1VQ9 3;  2FXT A;  1L5G B;  3BB9 A;  2BMO B;  4LSO A;  1KC8 4;  4K61 A;  3X3Y A;  1VQ6 3;  3BNC A;  1W00 A;  5AYR B;  5AIG A;  3X41 A;  3F7S A;  4TX4 A;  1ZO2 A;  4FR9 A;  3CCJ 3;  2MC8 A;  2YFI B;  1VQK 3;  4KFE A;  3B8L A;  3D3L A;  3OXA A;  4H61 A;  4OK0 A;  1IT8 A;  1IV9 A;  1VQM 3;  3CNX A;  1HKX A;  5CF1 A;  3WMD A;  3RGR A;  3SED A;  2HMN B;  3O8Y A;  3NXJ A;  3CCE 3;  4N6V 0;  1U5O A;  5IG3 A;  1ROV A;  4WWU C;  4L8P A;  3EBY A;  2HML B;  3CCL 3;  2I9W A;  1WMN A;  3F9S A;  2BO9 B;  1E3V A;  1FGO A;  3DM8 A;  3PYJ A;  2CIU A;  1OF5 B;  1SIH A;  4N6M A;  3CCS 3;  3CMA 3;  4KFF A;  1HU9 A;  1GD3 A;  5AIF A;  3FG4 A;  4MMZ B;  3DXO A;  3K63 A;  1GY7 A;  2B1X B;  1TIJ A;  1ULI B;  1NB3 I;  1SJW A;  3SXX A;  2C10 A;  3D9R A;  1LNH A;  4AKY A;  2CFW A;  5EQL A;  1OHS A;  3CPW 2;  3V98 A;  2HMJ B;  1TFO A;  1YJ9 3;  1OF5 A;  1NJI 4;  2QEX 3;  1JKG A;  5AYS C;  1W5Z A;  3LTC A;  5ELJ A;  3B4P A;  3LTA A;  1GY5 A;  1RKY A;  2WOF A;  1QAL A;  3JUO A;  1YHQ 3;  1IVV A;  3FZW A;  3IJE B;  2KXG A;  2ZDJ A;  3MKI A;  3WOF B;  4BTY A;  4XBY A;  1WMO A;  1QMA A;  3ER7 A;  4WYK B;  1FGQ A;  1WMP A;  3T0U A;  3LML A;  5STD A;  2GBX B;  3CCM 3;  3M8C A;  2RFR A;  6STD A;  2CFD A;  1Z1S A;  1UUW B;  1IVU A;  4N6O B;  4BTW A;  2CWT A;  3G0K A;  1VZZ A;  3FLJ A;  1JB2 A;  3PXM A;  3RDE A;  4RNZ A;  5JPU A;  1GY6 A;  1RRH A;  1DMM A;  1R4C A;  1IQY A;  2CG1 A;  3CPO A;  4KFD A;  2GEX A;  2ZL8 A;  1N9J A;  3STD A;  2D1W A;  3G4S 3;  2RCD A;  3PS8 A;  4RZM A;  4WYK A;  5IEO A;  3NM2 A;  4L8O A;  1VQN 3;  3OV4 A;  2FGT A;  3GZY B;  3LTD A;  1IK3 A;  1IVX A;  2CG0 A;  3GAX A;  5BXQ A;  3Q2P A;  1OHO A;  2ML5 A;  3MHE A;  1JN5 B;  4ORL A;  2CKF B;  5TGN A;  5AII A;  3CC2 3;  1OCV A;  4HBR A;  4IT7 A;  3NBR A;  4G1M B;  4MJD A;  1T5Y A;  2CH9 A;  1JB5 A;  2Y73 A;  1UW1 A;  4XDV A;  2CFG A;  3EN8 A;  5D81 A;  2Z76 A;  1NB5 I;  3DGN A;  2PNC A;  2BMR B;  1YGE A;  1J2B A;  2YX9 A;  4KVH A;  3FSD A;  4R80 A;  2FNQ A;  4WFO A;  1FGT A;  2WOH A;  4WP5 A;  2YFJ B;  2K54 A;  5D82 A;  1VQ5 3;  1YI2 3;  2GBW B;  3LTB A;  1CQS A;  1QAK A;  2IUK A;  5JPP A;  2Q07 A;  1VQL 3;  3OWY A;  4N6U A;  5I97 A;  5LC7 A;  2M7O A;  3NQY A;  4EYC A;  1OGX A;  4HZ9 B;  1TFK A;  2QA4 3;  4L7K A;  4FMD A;  3UB1 A;  1QAF A;  5IG5 A;  3CD6 3;  1Q40 B;  2R4I A;  1UUV B;  2HMO B;  7STD A;  1Q86 4;  3CNM A;  3I55 3;  1Q81 4;  1O7H B;  3UL5 A;  2P0X A;  1KD1 4;  3FCS B;  2OCT A;  1NDO B;  1IQX A;  2QGU A;  3K0Z A;  2INX A;  1D6U A;  3EN1 B;  2JQ5 A;  2OQE C;  3FKA A;  3FG1 A;  3JVC A;  1SQW A;  3IPT A;  3Q90 A;  1YJN 3;  1W01 A;  4O8S A;  3CXC 2;  3MPH A;  1W6C A;  3QK9 A;  1FGM A;  4JRF A;  2CFK A;  2XFT A;  1Q40 A;  1W6G A;  3I56 3;  4HM8 B;  2XGN A;  1M90 4;  3WA2 X;  3B4O A;  2E2V A;  2F99 A;  1JKG B;  2P0M A;  2OQE A;  4R1K A;  5DRV A;  1MOL A;  4FCM A;  3X40 A;  3DGO A;  1W2B 2;  1RRL A;  1D6Z A;  1AVK A;  5JBS A;  4XBX A;  3HI7 A;  3SOA A;  3LH4 A;  1FUW A;  1VQ8 3;  3NHX A;  3SOY A;  3X42 A;  3DY5 A;  2XRX B;  5IEN A;  3S67 A;  4EC6 A;  3NM7 A;  8CHO A;  2GU3 A;  1IVW A;  1U8C B;  4K1V A;  1W4N A;  5IER A;  1S72 3;  3EE1 A;  4LEH A;  1A2V A;  1SII A;  4R4K A;  4HM3 B;  1NWW A;  1AV4 A;  1O7P B;  1O7W B;  4JF8 A;  4CDL A;  5AIH A;  4HZB B;  3LT9 A;  3J7Y d;  1C7H A;  2STD A;  3FH1 A;  3CU3 A;  3EQQ B;  1LOX A;  5HGR A;  4HM0 B;  5AEW B;  2KCD A;  2WO0 A;  3EF8 A;  1IU7 A;  1Q42 A;  1QVF 2;  3T8U A;  3U97 A;  2BHM A;  4PEJ A;  2Z7A A;  3UNL A;  1YVB I;  4HM6 B;  2XGL A;  1N9E A;  1V74 A;  2XSO B;  2RGQ A;  2XH9 A;  5AEU B;  3SLU A;  3DZL A;  4MMX B;  4IPB A;  2W03 A;  3WA3 A;  1NO3 A;  3CCQ 3;  3MSO A;  3NBB A;  4H3U A;  3FF2 A;  3N54 B;  1Y4K A;  3G16 A;  1ULJ B;  1K28 A;  2CWU A;  4J8T A;  3DUK A;  1DYU A;  3F40 A;  1UI8 A;  4QWT A;  4BTX A;  4LMI A;  3Q1C A;  1K41 A;  1GYB A;  2PZV A;  2CK3 H;  2O3O A;  3K7C A;  1G96 A;  4KZ1 A;  5D83 A;  3F14 A;  2W0Q A;  4FCJ A;  3JUN A;  3AMO A;  3E99 A;  1EA2 A;  3VSY A;  1ASK A;  1OPY A;  3PCR A;  3S29 A;  1F8N A;  1W7C A;  2A15 A;  3N9H A;  3OWU A;  5IEP A;  1LXE A;  2P38 A;  3NBJ A;  5IW9 A;  1OUN A;  1JV2 B;  4MEI A;  4MMY B;  2K0M A;  1YJW 3;  1W02 A;  2C11 A;  5CF2 A;  1M1K 4;  1EKM A;  3LZA A;  4FMB A;  4RNY A;  1WNH A;  3H51 A;  2W56 B;  1CYV A;  5AI1 A;  1O7N B;  2CFL A;  4HM2 B;  1N8R 4;  1LVN A;  1N8Q A;  2CC3 A;  1OGZ A;  4X2H A;  3V99 A;  1N5P A;  3KKG A;  3BNE A;  2MF7 A;  4FCZ A;  4XM4 A;  1A67 A;  5KP3 A;  3KII A;  1FA3 A;  4LGQ A;  1E3R A;  4R9L A;  3S27 A;  4O02 B;  4O2H A;  3EHC A;  2W56 A;  3NUV A;  4XB5 A;  2ML6 A;  3EB8 A;  3GRD A;  5ELU A;  3KE7 A;  2F86 B;  2W6J H;  3JUM A;  4AEQ A;  3G8Z A;  2IUJ A;  1W2Z A;  3LXU X;  1K8A 4;  5CLK A;  4AKZ A;  1SPU A;  2UX0 A;  3FF0 A;  3PCS A;  4OUQ A;  2W04 A;  3T8N A;  1A2K A;  3JUP A;  4OVM A;  3NV0 B;  5DRE A;  2OOV C;  3RGA A;  2GXF A;  2SBL A;  3EBT A;  2CHC A;  4HYZ A;  1FGR A;  4STD A;  3GZX B;  3KSP A;  1Q7Y 4;  4GB5 A;  4Q53 A;  3N8B A;  2KRT A;  3BNB A;  1BUQ A;  3NX0 A;  3U1W A;  3GWR A;  3JUQ A;  5A0O B;  1ISK A;  3DGM A;  1TP6 A;  3F7X A;  3DMC A;  3A76 A;  4CCV A;  3OW2 2;  2OOV A;  2IA7 A;  4HJL B;  2XEP A;  1DMN A;  1STF I;  3L0R A;  1O7M B;  3WOD G;  3NV0 A;  4NHF A;  4EV5 A;  4I4K A;  2RSX A;  3OX9 A;  2E2U A;  5IF6 A;  1PU4 A;  4HVN A;  2BT3 A;  1VQP 3;  3HII A;  1QVG 2;  2JDI H;  1IQ8 A;  3VGN A;  1K9M 4;  2GU1 A;  3V92 A;  3TDG A;  4EXR A;  1JJ2 2;  1AVL A;  2W9P A;  4IIA A;  4EV2 A;  4HM5 B;  1TUH A;  2LYX A;  3F8X A;  5FW5 A;  5KP1 A;  3SVA A;  2W2C A;  1N5H A;  1D6Y A;  3HIG A;  1DVC A;  3OWS A;  3NQZ A;  4WHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...