4HM4B

Naphthalene 1,2-dioxygenase bound to indan
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to indan
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm4B00
3DMCA 3RGAA 3EBYA 3EF8A 2XSOB 3EQQB 2GEXA 3NBRA 1EG9B 3FLJA 1TP6A 3RGRA 2Z76A 2QIYA 1W6YA 5JPUA 4WYKA 3F7XA 2STDA 5DRVA 3F7SA 5D83A 2A15A 4XM4A 1S5AA 5STDA 3B4PA 3B4OA 5AIIA 3CU3A 1O7WB 4XDWA 1JB4A 3MHEA 3FSDA 1O7NB 3B7CA 1JB5A 2QGUA 3HK4A 4HM3B 4XDVA 1ZO2A 5IENA 1UUVB 1EA2A 2I9WA 4FCMA 3NXJA 2B1XB 3F14A 3GZYB 2K54A 3VSYA 3MSOA 4K1UA 4J8TA 2HMJB 2CKFB 3VGNA 5IF6A 2XSHB 3G16A 2JQ5A 3MYTA 2INXA 3F8HA 1JB2A 4HM4B 1ZX2A 1E97A 3DXOA 4HM1B 5KP4A 4LEHA 2XRXB 4HM6B 1STDA 5IG3A 4WWUC 1GY6A 3WMDA 3NUVA 1W01A 1DMQA 5AIFA 5TGNA 3STDA 3BLZA 3SEDA 2RFRA 3I0YA 3GZBA 1NU3A 2YFJB 4HVNA 3B8LA 3LYGA 5AI1A 3IPTA 1ISKA 5CF2A 3M8CA 1E3RA 1OH0A 5CXOA 4ORLA 4FCJA 3FF0A 3HZPA 1ULIB 1Z1SA 1U5OA 2BMOB 2CHCA 2PZVA 2OWPA 3S5CA 4I4KA 5BVBA 3T8UA 1OHSA 1GS3A 5KP3A 4HKVB 1CQSA 2F99A 4MJDA 3DUKA 1JKGA 4X2OA 2GXFA 3KE7A 3SOYA 4CDLA 2RGQA 4L8OA 3DZLA 3CNXA 4OVMA 1ULJB 2HMNB 5DREA 3F40A 2XR8B 2RCDA 4HM5B 3JUNA 2IMJA 1E3VA 4HZBB 3GRDA 4K1VA 1OF5B 3JUPA 1WQLB 3ROBA 4U13A 5AIHA 3EC9A 1SJWA 3JUOA 4HM0B 3MKIA 2F86B 8CHOA 1JN5B 3GZRA 3EBTA 3ECFA 3H3HA 2BMRB 2HMLB 3H51A 3EN1B 1OPYA 2HMMB 1C7HA 3KKGA 3NV0B 3NHXA 2BMQB 3FH1A 3FGYA 4LGQA 3ER7A 3G8ZA 4N3VA 5G2GA 1OF5A 4L7KA 5FW5A 1OGXA 4J9AA 1A2KA 3UNLA 1NDOB 3SOAA 3CNMA 3FZWA 4WP5A 1Q42A 4HZ9B 2UX0A 1JKGB 2GBXB 2R4IA 2YFLB 1O7HB 1ASKA 1HKXA 2BNGA 3FKAA 1JN5A 1BUQA 3DM8A 3NM2A 3T8NA 3OWUA 4R1KA 3EX9A 3NV0A 5HGRA 5AEWB 5CK6A 2YFIB 5AIGA 1DMNA 3JUQA 1NWWA 5IEOA 4HM2B 3KZTA 3OWYA 4L8PA 2HMOB 3D9RA 3JUMA 5AEUB 1IDPA 3F8XA 3CPOA 4XBTA 6STDA 1W00A 2B24B 5EVHA 1Q40B 3GWRA 4GB5A 1GY7A 1OUNA 5IG4A 1O7PB 5IG5A 4R9KA 1TUHA 4HM8B 4R9LA 1QJGA 5D81A 3MG1A 4HM7B 3F9SA 3K7CA 4HJLB 4IIAA 5D82A 1VZZA 1OCVA 4KVHA 4XB5A 3K0ZA 4STDA 5CF1A 3EHCA 1K41A 7STDA 3MG2A 3OX9A 3G0KA 4Q53A 3E99A 1Q40A 2GBWB 4OUQA 1O7MB 2F98A 5CLKA 2Z77A 3OV4A 3EN8A 4RZMA 4H3UA 3KSPA 4PEJA 4X2HA 3HX8A 5KP1A 2GEYA 1QMAA 3Q90A 3A76A 2HMKB 4XBYA 1O7GB 5JPPA 3FF2A 3UJMA 3MG3A 5IG0A 3LZAA 1OHOA 1UUWB 4WYKB 3OXAA 2W2CA 1GY5A 1AR0A 3GZXB 4LMIA 1GYBA 5IEPA 1OGZA 3OWSA 1W02A 3EJVA 4XBXA 3BB9A 1DMMA 5BXQA 2Z7AA 1OHPA 5IERA
chains in the Genus database with same CATH superfamily
3DMCA 3V99A 3RGAA 3EBYA 3FG4A 3EF8A 2XSOB 1YJ93 1VQ73 2CFGA 2P05A 2GEXA 3EQQB 4O8SA 4CJNA 3NBRA 1EG9B 1AY7A 3FLJA 3SX1A 1TP6A 1T3BA 3LT9A 3RGRA 3DGMA 3PGBA 2E2UA 2SBLA 2Z76A 4FMDA 1PYLA 1RGKA 1W6YA 2F5WA 2QIYA 3MPHA 1B2SA 1UGHI 5JPUA 1AVKA 1OACA 1RN7A 4IT7A 2V1LA 4WYKA 2XH9A 1PY3A 4ILFA 1FZUA 1RGFA 2M7OA 2STDA 3F7XA 3NQYA 5DRVA 1GD4A 5GSPA 4DKIA 3Q1CA 5M19A 1YVBI 3F7SA 5D83A 1YGEA 3CC43 1RGLA 1W7CA 3I563 2A15A 3BNBA 3LT8A 1BSBA 1W2B2 4XM4A 1HZ1A 1S5AA 3WR2A 1AV4A 4K61A 2H0GA 5STDA 2D42A 2K3DA 2MF7A 4AEQA 3B4PA 2OCTA 3B4OA 5AIIA 1CYUA 2WGQA 3CU3A 1UW1A 1O7WB 1T2IA 1JB4A 3MHEA 3PYJA 4XDWA 2UGIA 3FSDA 5M18A 1VQ53 1AQZA 3AMOB 4H61A 1JBSA 1O7NB 3B7CA 4G1MB 1W2ZA 1JB5A 1I8VA 1RSNA 1TFKA 1RGHA 1LOWA 3HIIA 1VQO3 1EEJA 1EUIC 2QGUA 3HK4A 1V74A 1UCIA 3MWZA 3BU4A 1BIRA 4HM3B 1FGOA 4XDVA 1RLSA 1MWUA 1BNGA 1RGEA 1ZO2A 3D4AA 4BTWA 5IENA 1UUVB 1EA2A 1VQ63 5BIRA 2WOHA 1UCJA 2I9WA 4FCMA 3NXJA 1D6YA 1LNHA 1I3FA 2B1XB 3F14A 1UI8A 3HI7A 4N6V0 6RNTA 3FG1A 1VQQA 1IT7A 8RNTA 3GZYB 2K54A 1N8R4 2O3OA 3VSYA 3MSOA 1TFOA 2CFLA 2WO0A 4K1UA 4J8TA 1CEWI 2HMJB 2CKFB 3D5IA 3VGNA 1W6GA 2XSHB 4MMYB 5IF6A 1TU5A 1S723 1SPUA 3G16A 2JQ5A 3CD63 1LOYA 2W9PA 3MYTA 1FW7A 1WTHA 2INXA 4EV5A 3DGOA 1FYSA 4N6MA 3F8HA 2IYJA 3AMOA 4AKZA 2C10A 2KAAA 1X1XA 1I0VA 1UGIA 1JB2A 4HM4B 1YJN3 3DGNA 1B2UA 1BSDA 1ZX2A 1E97A 3DXOA 3LOYA 1U8CB 4HM1B 4X2HA 4GSPA 1B20A 1RCKA 3ALAA 5KP4A 5G1LA 4LEHA 2XRXB 4HM6B 4ZM8A 1LRAA 1RNTA 4KZ1A 1HU9A 3A5EA 1EKMA 1FUSA 1I0XA 1STDA 5IG3A 1GMPA 1BNRA 1RTUA 4WWUC 2QA43 1GY6A 1BRHA 1BNIA 5AYSC 3WMDA 4CCVA 3NUVA 1W01A 1BVIA 1DMQA 3LMLA 5AIFA 2KF3A 5TGNA 3STDA 3BLZA 3SEDA 3D3LA 1TIJA 5AYRB 1B27A 4EXRA 1YHQ3 2RFRA 1Q864 1EQKA 3I0YA 3X42A 1YVSA 4EC6A 2E2VA 4MMZB 7GSPA 4WHAA 4EYCA 3GZBA 1NU3A 2YFJB 4N6NB 1BU4A 2W04A 4HVNA 3CCV3 4TX4A 2KF6A 3B8LA 3DY5A 1IVXA 1W4NA 2W0QA 3LYGA 2SARA 3IJEB 4NHFA 5AI1A 3IPTA 1ISKA 4J5KA 2YX9A 4LZIA 1K9M4 5CF2A 1RKYA 1UUGB 5EQLA 3M8CA 1E3RA 1OH0A 2CC3A 3CCL3 3KFQC 5CXOA 3NX0A 4ORLA 3S29A 4FCJA 4O02B 5ELJA 1WNHA 1RGAA 4LSOA 2GSPA 1LQGC 3FF0A 6GSPA 1RHLA 1ULIB 3HZPA 4O2HA 3CCR3 3CCS3 1B21A 2RNTA 2QEX3 1FGTA 1Z1SA 1U5OA 1D6ZA 4HBRA 1NJI4 1R4YA 2BMOB 1BRNL 2CHCA 1G0TA 2OWPA 2PZVA 4GHOA 3S5CA 1BNEA 2XFTA 1WMPA 3K5TA 4R80A 4BTYA 4I4KA 2J8XB 3N54B 4IPBA 4NREA 5BVBA 4CPKA 1JJ22 3T8UA 2OTJ3 1X1YA 2OOVA 4EW5A 1X1WA 1OHSA 2XGNA 1GS3A 3UB1A 3AGNA 3RNTA 5KP3A 2W6JH 2XF3A 1CQSA 1ZS7A 4HKVB 3O8YA 1MGRA 1KD14 2F99A 1RN4A 4MJDA 3DUKA 1GD3A 3CME3 1JKGA 4X2OA 2GXFA 3KE7A 3SOYA 4CDLA 1FUWA 2RGQA 1VQL3 3AGOA 1YJW3 1G96A 3GSPA 2ML6A 4L8OA 5ELUA 3DZLA 5HOHA 3CNXA 1IQXA 4OVMA 1BRJA 3J7Yd 3I553 1BNJA 2UUGC 1ULJB 2HMNB 5DREA 9RNTA 4BU4A 3F40A 2XR8B 1LXEA 1WMOA 4N6LA 1VQ83 3LH4A 1F8NA 2GU3A 2RCDA 1B2ZA 2WOFA 1RNBA 2BO9B 4I5QA 3Q2PA 1VQ93 4HM5B 2BU4A 1RRHA 3JUNA 1Q7Y4 2H0IA 2IMJA 3HOHA 1E3VA 4HZBB 3GRDA 3NBBA 4K1VA 3K63A 1OF5B 4LYLB 2Y74A 2CWTA 1GOVA 3LTBA 3JUPA 1WQLB 3ROBA 2LQVA 4U13A 5AIHA 1DVDA 2W9QA 3EC9A 2JDIH 1SJWA 4BTXA 1NO3A 2C11A 3JUOA 1I3IA 1IQ8A 4HM0B 2IUKA 3MKIA 1JNQA 1DVCA 2F86B 5IW9A 1RGCA 2XEPA 1B2MA 1Q9EA 1NNVA 2OQEA 3NBJA 1BGSA 2ZHXB 1R4CA 4N6UA 8CHOA 4OK0A 1KSIA 1JN5B 3GZRA 4FR9A 4JF8A 2BHMA 3KCHA 3EBTA 3ECFA 1G02A 3H3HA 1QAKA 2BMRB 2IUJA 4N6OB 2HMLB 3SXXA 3H51A 2PNCA 1IQYA 1RJOA 1T5YA 3EN1B 3X41A 2CG1A 3K9MC 5LC6A 1OPYA 2Y73A 1QALA 1C7HA 2E2TA 2HMMB 4RNTA 3WOFB 3KKGA 3NV0B 3CC73 3FG3A 2RSXA 3NHXA 1BSCA 2BMQB 2L4VA 3FH1A 3FGYA 2F56A 1DYUA 4LGQA 1V58A 3ER7A 3G8ZA 1BSEA 3Q3FA 4FMBA 5JBSA 1QVF2 3WODG 1J2BA 2XFSA 1JBTA 1UI7A 4BL3A 1K8A4 4N3VA 3LXUX 1SIIA 1VQK3 1KC84 5G2GA 3S28A 1OF5A 4L7KA 4NPBA 5FW5A 1PU4A 1OGXA 4J9AA 1KQS2 1A2KA 1Q814 3UNLA 1NDOB 1K734 1RGGA 3SOAA 5IERA 1MNLA 1X1UA 3CNMA 1YIT3 3BIRA 3FZWA 4WP5A 1Q42A 5G1KA 4HZ9B 3DGLA 1BNFA 1JBRA 3RDEA 2RBIA 2UX0A 1FUTA 1JKGB 4HYZA 2GBXB 1N5HA 3DH2A 3AHWA 1IVVA 2K0MA 1UDII 2KXGA 2R4IA 2YFLB 5EEOA 1O7HB 1ASKA 2Z6BA 2GU1A 1HKXA 2BNGA 3FKAA 1JN5A 3X3YA 1BUQA 3PXMA 2CX1A 3DM8A 2P0MA 3BNCA 2KRTA 3KIIA 3L0RA 2AADA 3NM2A 1MOLA 2FXTA 3T8NA 3OWUA 5RNTA 4R1KA 4WFOA 3EX9A 2FNQA 4RNYA 3NV0A 2KF5A 5HGRA 1TTOA 3SYUA 5CK6A 2YFIB 5AEWB 5AIGA 1DMNA 1VQP3 3JUQA 1NWWA 1IVUA 1D6UA 2KCDA 1JZDA 1BRSA 5IEOA 5LC7A 1C54A 3SVAA 4HM2B 4EBGA 3KZTA 3LTAA 3OWYA 3WOEB 3CCJ3 2WGOA 3X40A 3GAXA 4KT3B 2IA7A 1LNIA 1ROVA 1YI23 1A90A 2AAEA 4L8PA 1BRKA 2HMOB 3CMA3 3QK9A 3UL6A 1RRLA 4QWTA 1GMQA 2CH9A 1SIHA 1MGWA 1N9EA 2HOHA 4O3VA 4R4KA 3X3ZA 1W6CA 3JVCA 1N8QA 1YNVX 1N5PA 3D9RA 1RCLA 3JUMA 3IMAB 3ZFZA 1LOXA 1QAFA 2F4YA 2R41A 3TDGA 5AEUB 1AVLA 3S27A 1IDPA 3WA2X 3F8XA 1BRIA 3UL5A 3CPOA 3AHSA 4XBTA 6STDA 3KSED 1MWSA 3D79A 1IV9A 1W00A 2B24B 5EVHA 2CX0A 1Q40B 1DETA 3GWRA 5BU4A 2D1WA 4GB5A 2C4BA 3PZWA 1GY7A 2P09A 2P38A 1OUNA 1QVG2 2CG0A 5IG4A 2ZL8A 2CFDA 1O7PB 3HIGA 3G4S3 1JZOA 5IG5A 4R9KA 4RBNA 1TUHA 1RMSA 2ZDJA 4HM8B 3PCRA 4R9LA 2MC8A 1QJGA 3CCQ3 1BRGA 2OOVC 5D81A 3CCE3 2BT3A 3MG1A 2LYXA 4FMAA 2ZA4A 3ZG0A 1A2VA 4HM7B 3F9SA 3G6E3 3K7CA 4HJLB 4IIAA 5D82A 1Q824 1VZZA 1KWIA 1OCVA 3D5GA 1Y4KA 3PS8A 4BL2A 1TRQA 1NB5I 3FCSB 2CFWA 2KF4A 4KVHA 1UCLA 2F5MA 4XB5A 3K0ZA 2L1SA 1IYYA 1YIJ3 4STDA 3LTCA 3LTDA 1L5GB 5CF1A 3CCM3 3EHCA 4MMXB 4EV2A 1FGQA 1Q7HA 4BIRA 1K41A 1BAOA 1I2GA 4MEIA 3URPA 4FCZA 7STDA 2CWVA 3MG2A 3SLUA 2ML5A 1RN1A 2Q07A 3OX9A 4AKYA 1BANA 2W56B 1HYFA 1FGMA 1IV7A 3BNDA 3U97A 5I97A 4KFFA 3G0KA 4Q53A 1K28A 3E99A 1Q40A 1A2PA 2FGTA 2GBWB 1IK3A 1FGRA 1N9JA 4OUQA 2CW9A 1O7MB 1BNSA 1DE3A 5FGOA 1A67A 1W5ZA 1BUJA 3QRDA 3T0UA 3EE1A 4N6TA 1GMRA 2F98A 5CLKA 7RNTA 1IT8A 2Z77A 3N8BA 3G713 2CFKA 3EN8A 3OV4A 4RZMA 4H3UA 1SQWA 3KSPA 4PEJA 3WHOA 1B2XA 2O9UX 2W03A 2CK3H 1I70A 1TRPA 3HX8A 4HAAA 1M1XB 2OQEC 3BNEA 2GEYA 5KP1A 1QMAA 3Q90A 4JRFA 3A76A 4RNZA 3V98A 5M1AA 1LOVA 2HMKB 1GOYA 1T2HA 4XBYA 2OTL3 1JRQA 1O7GB 3WDGB 5JPPA 3FF2A 3DGYA 3UJMA 3MG3A 5IG0A 1BOXA 1IVWA 1YGWA 3LZAA 3N9HA 1LQMB 1BSAA 1OHOA 1UUWB 1STFI 3X3XA 3VF1A 4WYKB 3OXAA 1M1K4 3PCSA 3CC23 1IU7A 2W2CA 5A0OB 1FA3A 1JV2B 3KN4A 2XGLA 1VQN3 4KFDA 1VQM3 1GY5A 1AR0A 3GZXB 3V92A 1ROAA 4LMIA 1TJDA 1V57A 1PFPA 2W56A 4K90B 4J5GA 3WA3A 3CPW2 1GYBA 1RDSA 4GL6A 1WMNA 3CXC2 1M904 1ZGXA 1US1A 2H0HA 1OGZA 2CIUA 3OWSA 1W02A 1GSPA 3U1WA 3NQZA 1MWTA 5IEPA 1CYVA 2BIRA 3EJVA 3ZG5A 1M9GA 2CWUA 2IY2A 4FMCA 1SARA 3EB8A 4XBXA 2P0XA 3BB9A 1VQ43 1DMMA 1CH0A 1I2FA 1I2EA 1UCKA 5BXQA 1MWRA 3S67A 3NM7A 2Z7AA 4HOHA 3CCU3 1GOUA 1NB3I 1OHPA 1B3SA 4KFEA 3OW22 1LVNA
chains in the Genus database with same CATH topology
3DMCA 3V99A 3RGAA 3EBYA 3FG4A 3EF8A 2XSOB 1YJ93 1VQ73 2CFGA 2P05A 2GEXA 3EQQB 4O8SA 3NBRA 1EG9B 3FLJA 3SX1A 1TP6A 3LT9A 3RGRA 3DGMA 3PGBA 2E2UA 2SBLA 2Z76A 4FMDA 2QIYA 1W6YA 3MPHA 5JPUA 1AVKA 1OACA 1RN7A 4IT7A 2V1LA 4WYKA 2XH9A 3F7XA 2M7OA 2STDA 3NQYA 5DRVA 1GD4A 3Q1CA 1YVBI 3F7SA 5D83A 1YGEA 3CC43 1W7CA 3I563 2A15A 3BNBA 3LT8A 1W2B2 4XM4A 1S5AA 1AV4A 4K61A 5STDA 4AEQA 2D42A 2MF7A 3B4PA 2OCTA 3B4OA 5AIIA 1CYUA 2WGQA 3CU3A 1O7WB 1UW1A 4XDWA 1JB4A 3MHEA 3PYJA 1VQ53 3FSDA 3AMOB 4H61A 1O7NB 3B7CA 4G1MB 1W2ZA 1JB5A 1TFKA 3HIIA 1VQO3 2QGUA 3HK4A 1V74A 3MWZA 4HM3B 1FGOA 4XDVA 1ZO2A 4BTWA 5IENA 1UUVB 1EA2A 1VQ63 2WOHA 2I9WA 4FCMA 3NXJA 1D6YA 1LNHA 2B1XB 3F14A 1UI8A 3HI7A 4N6V0 3FG1A 1IT7A 3GZYB 2K54A 1N8R4 2O3OA 3VSYA 3MSOA 1TFOA 2CFLA 2WO0A 4K1UA 4J8TA 1CEWI 2HMJB 2CKFB 3VGNA 5IF6A 1W6GA 2XSHB 4MMYB 1TU5A 1S723 1SPUA 3G16A 2JQ5A 3CD63 2W9PA 3MYTA 1WTHA 2INXA 4EV5A 3DGOA 4N6MA 3F8HA 3AMOA 4AKZA 2C10A 1JB2A 4HM4B 1YJN3 3DGNA 1ZX2A 1E97A 3DXOA 3LOYA 1U8CB 4HM1B 3ALAA 5KP4A 4LEHA 2XRXB 4HM6B 4ZM8A 4KZ1A 1HU9A 1EKMA 1STDA 5IG3A 2QA43 4WWUC 1GY6A 3WMDA 4CCVA 5AYSC 3NUVA 1W01A 1DMQA 5AIFA 3LMLA 5TGNA 3STDA 3BLZA 3SEDA 3D3LA 1TIJA 5AYRB 4EXRA 1YHQ3 2RFRA 1Q864 1EQKA 3I0YA 3X42A 4EC6A 2E2VA 4MMZB 4WHAA 4EYCA 3GZBA 1NU3A 2YFJB 4N6NB 2W04A 4HVNA 3CCV3 4TX4A 3B8LA 3DY5A 1IVXA 1W4NA 2W0QA 3LYGA 4NHFA 3IJEB 5AI1A 3IPTA 1ISKA 2YX9A 4LZIA 1K9M4 5CF2A 1RKYA 5EQLA 3M8CA 1E3RA 1OH0A 2CC3A 3CCL3 3KFQC 5CXOA 3NX0A 4ORLA 3S29A 4FCJA 4O02B 5ELJA 1WNHA 4LSOA 3FF0A 3HZPA 1ULIB 4O2HA 3CCR3 3CCS3 2QEX3 1FGTA 1Z1SA 1U5OA 1D6ZA 4HBRA 1NJI4 2BMOB 2CHCA 2PZVA 2OWPA 3S5CA 2XFTA 1WMPA 3K5TA 4R80A 4BTYA 4I4KA 3N54B 4IPBA 4NREA 5BVBA 1JJ22 3T8UA 2OTJ3 2OOVA 1OHSA 2XGNA 1GS3A 3UB1A 5KP3A 2W6JH 2XF3A 1CQSA 4HKVB 3O8YA 1KD14 2F99A 4MJDA 3DUKA 1GD3A 3CME3 1JKGA 4X2OA 2GXFA 3KE7A 3SOYA 4CDLA 1FUWA 2RGQA 1VQL3 1YJW3 1G96A 2ML6A 4L8OA 5ELUA 3DZLA 3CNXA 1IQXA 4OVMA 3J7Yd 3I553 1ULJB 2HMNB 5DREA 3F40A 2XR8B 1LXEA 1WMOA 4N6LA 1VQ83 3LH4A 1F8NA 2GU3A 2RCDA 2WOFA 2BO9B 3Q2PA 1VQ93 4HM5B 1RRHA 3JUNA 1Q7Y4 2IMJA 1E3VA 4HZBB 3GRDA 3NBBA 4K1VA 3K63A 1OF5B 2Y74A 2CWTA 3LTBA 3JUPA 1WQLB 3ROBA 2LQVA 4U13A 5AIHA 1DVDA 2W9QA 3EC9A 2JDIH 1SJWA 4BTXA 1NO3A 2C11A 3JUOA 1IQ8A 4HM0B 2IUKA 3MKIA 1JNQA 1DVCA 2F86B 5IW9A 2XEPA 2OQEA 3NBJA 4N6UA 1R4CA 8CHOA 4OK0A 1KSIA 1JN5B 3GZRA 4FR9A 4JF8A 2BHMA 3EBTA 3ECFA 3H3HA 1QAKA 2BMRB 2IUJA 4N6OB 2HMLB 3SXXA 3H51A 2PNCA 1IQYA 1RJOA 1T5YA 3EN1B 3X41A 2CG1A 3K9MC 5LC6A 1OPYA 2Y73A 1QALA 1C7HA 2E2TA 2HMMB 3WOFB 3KKGA 3NV0B 3CC73 3FG3A 2RSXA 3NHXA 2L4VA 2BMQB 3FH1A 3FGYA 4LGQA 1DYUA 3ER7A 3G8ZA 5JBSA 4FMBA 1QVF2 1J2BA 3WODG 2XFSA 1UI7A 1K8A4 4N3VA 3LXUX 1SIIA 1VQK3 1KC84 5G2GA 3S28A 1OF5A 4L7KA 5FW5A 1PU4A 1OGXA 4J9AA 1KQS2 1A2KA 1Q814 3UNLA 1NDOB 1K734 3SOAA 5IERA 1MNLA 3CNMA 1YIT3 3FZWA 4WP5A 1Q42A 4HZ9B 3DGLA 3RDEA 2UX0A 1JKGB 4HYZA 2GBXB 1N5HA 1IVVA 2K0MA 2KXGA 2R4IA 2YFLB 5EEOA 1O7HB 1ASKA 2Z6BA 2GU1A 1HKXA 2BNGA 3FKAA 1JN5A 3X3YA 1BUQA 3PXMA 3DM8A 2P0MA 3BNCA 2KRTA 3KIIA 3L0RA 3NM2A 1MOLA 2FXTA 3T8NA 3OWUA 4R1KA 4WFOA 3EX9A 2FNQA 4RNYA 3NV0A 5HGRA 5AEWB 5CK6A 2YFIB 5AIGA 1DMNA 1VQP3 3JUQA 1NWWA 1IVUA 1D6UA 2KCDA 5IEOA 5LC7A 3SVAA 4HM2B 4EBGA 3KZTA 3LTAA 3OWYA 3WOEB 3CCJ3 2WGOA 3X40A 3GAXA 2IA7A 1ROVA 1YI23 1A90A 4L8PA 3CMA3 2HMOB 3QK9A 3UL6A 1RRLA 4QWTA 2CH9A 1SIHA 1N9EA 4O3VA 4R4KA 3X3ZA 1W6CA 3JVCA 1N8QA 1N5PA 3D9RA 3JUMA 3IMAB 1LOXA 1QAFA 3TDGA 5AEUB 1AVLA 3S27A 1IDPA 3WA2X 3F8XA 3UL5A 3CPOA 4XBTA 6STDA 3KSED 1IV9A 1W00A 2B24B 5EVHA 1Q40B 3GWRA 2D1WA 4GB5A 3PZWA 1GY7A 2P09A 2P38A 1OUNA 1QVG2 2CG0A 5IG4A 2ZL8A 2CFDA 1O7PB 3HIGA 3G4S3 5IG5A 4R9KA 4RBNA 1TUHA 4HM8B 2ZDJA 4R9LA 3PCRA 2MC8A 1QJGA 3CCQ3 2OOVC 5D81A 3CCE3 2BT3A 3MG1A 2LYXA 4FMAA 1A2VA 4HM7B 3F9SA 3G6E3 3K7CA 4HJLB 4IIAA 5D82A 1Q824 1VZZA 1KWIA 1OCVA 1Y4KA 3PS8A 1NB5I 3FCSB 2CFWA 4KVHA 4XB5A 3K0ZA 1YIJ3 4STDA 3LTCA 3LTDA 1L5GB 5CF1A 3CCM3 3EHCA 4MMXB 4EV2A 1FGQA 1K41A 4MEIA 4FCZA 7STDA 2CWVA 3MG2A 3SLUA 2ML5A 2Q07A 3OX9A 4AKYA 2W56B 1FGMA 1IV7A 3BNDA 3U97A 5I97A 4KFFA 3G0KA 4Q53A 1K28A 3E99A 1Q40A 2FGTA 2GBWB 1IK3A 1FGRA 1N9JA 4OUQA 2CW9A 1O7MB 5FGOA 1A67A 1W5ZA 3QRDA 3T0UA 3EE1A 4N6TA 2F98A 5CLKA 1IT8A 2Z77A 3N8BA 3G713 2CFKA 3EN8A 3OV4A 4RZMA 4H3UA 1SQWA 3KSPA 4PEJA 2O9UX 2W03A 3HX8A 2CK3H 4X2HA 5KP1A 1M1XB 2OQEC 3BNEA 2GEYA 1QMAA 3Q90A 4JRFA 3A76A 4RNZA 3V98A 2HMKB 4XBYA 2OTL3 1JRQA 1O7GB 3WDGB 5JPPA 3FF2A 3UJMA 3MG3A 5IG0A 1IVWA 3LZAA 3N9HA 1OHOA 1UUWB 1STFI 3X3XA 3VF1A 4WYKB 3OXAA 1M1K4 3PCSA 3CC23 1IU7A 2W2CA 5A0OB 1FA3A 1JV2B 3KN4A 2XGLA 1VQN3 4KFDA 1VQM3 1GY5A 1AR0A 3GZXB 3V92A 1ROAA 4LMIA 2W56A 1PFPA 4K90B 3WA3A 3CPW2 1GYBA 3CXC2 4GL6A 1WMNA 1M904 1US1A 5IEPA 1OGZA 2CIUA 3OWSA 1W02A 3U1WA 3NQZA 1CYVA 3EJVA 1M9GA 2CWUA 4FMCA 4XBXA 3EB8A 2P0XA 3BB9A 1VQ43 1DMMA 5BXQA 3S67A 3NM7A 2Z7AA 3CCU3 1NB3I 1OHPA 4KFEA 3OW22 1LVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMC A;  3RGA A;  3EBY A;  3EF8 A;  2XSO B;  3EQQ B;  2GEX A;  3NBR A;  1EG9 B;  3FLJ A;  1TP6 A;  3RGR A;  2Z76 A;  2QIY A;  1W6Y A;  5JPU A;  4WYK A;  3F7X A;  2STD A;  5DRV A;  3F7S A;  5D83 A;  2A15 A;  4XM4 A;  1S5A A;  5STD A;  3B4P A;  3B4O A;  5AII A;  3CU3 A;  1O7W B;  4XDW A;  1JB4 A;  3MHE A;  3FSD A;  1O7N B;  3B7C A;  1JB5 A;  2QGU A;  3HK4 A;  4HM3 B;  4XDV A;  1ZO2 A;  5IEN A;  1UUV B;  1EA2 A;  2I9W A;  4FCM A;  3NXJ A;  2B1X B;  3F14 A;  3GZY B;  2K54 A;  3VSY A;  3MSO A;  4K1U A;  4J8T A;  2HMJ B;  2CKF B;  3VGN A;  5IF6 A;  2XSH B;  3G16 A;  2JQ5 A;  3MYT A;  2INX A;  3F8H A;  1JB2 A;  4HM4 B;  1ZX2 A;  1E97 A;  3DXO A;  4HM1 B;  5KP4 A;  4LEH A;  2XRX B;  4HM6 B;  1STD A;  5IG3 A;  4WWU C;  1GY6 A;  3WMD A;  3NUV A;  1W01 A;  1DMQ A;  5AIF A;  5TGN A;  3STD A;  3BLZ A;  3SED A;  2RFR A;  3I0Y A;  3GZB A;  1NU3 A;  2YFJ B;  4HVN A;  3B8L A;  3LYG A;  5AI1 A;  3IPT A;  1ISK A;  5CF2 A;  3M8C A;  1E3R A;  1OH0 A;  5CXO A;  4ORL A;  4FCJ A;  3FF0 A;  3HZP A;  1ULI B;  1Z1S A;  1U5O A;  2BMO B;  2CHC A;  2PZV A;  2OWP A;  3S5C A;  4I4K A;  5BVB A;  3T8U A;  1OHS A;  1GS3 A;  5KP3 A;  4HKV B;  1CQS A;  2F99 A;  4MJD A;  3DUK A;  1JKG A;  4X2O A;  2GXF A;  3KE7 A;  3SOY A;  4CDL A;  2RGQ A;  4L8O A;  3DZL A;  3CNX A;  4OVM A;  1ULJ B;  2HMN B;  5DRE A;  3F40 A;  2XR8 B;  2RCD A;  4HM5 B;  3JUN A;  2IMJ A;  1E3V A;  4HZB B;  3GRD A;  4K1V A;  1OF5 B;  3JUP A;  1WQL B;  3ROB A;  4U13 A;  5AIH A;  3EC9 A;  1SJW A;  3JUO A;  4HM0 B;  3MKI A;  2F86 B;  8CHO A;  1JN5 B;  3GZR A;  3EBT A;  3ECF A;  3H3H A;  2BMR B;  2HML B;  3H51 A;  3EN1 B;  1OPY A;  2HMM B;  1C7H A;  3KKG A;  3NV0 B;  3NHX A;  2BMQ B;  3FH1 A;  3FGY A;  4LGQ A;  3ER7 A;  3G8Z A;  4N3V A;  5G2G A;  1OF5 A;  4L7K A;  5FW5 A;  1OGX A;  4J9A A;  1A2K A;  3UNL A;  1NDO B;  3SOA A;  3CNM A;  3FZW A;  4WP5 A;  1Q42 A;  4HZ9 B;  2UX0 A;  1JKG B;  2GBX B;  2R4I A;  2YFL B;  1O7H B;  1ASK A;  1HKX A;  2BNG A;  3FKA A;  1JN5 A;  1BUQ A;  3DM8 A;  3NM2 A;  3T8N A;  3OWU A;  4R1K A;  3EX9 A;  3NV0 A;  5HGR A;  5AEW B;  5CK6 A;  2YFI B;  5AIG A;  1DMN A;  3JUQ A;  1NWW A;  5IEO A;  4HM2 B;  3KZT A;  3OWY A;  4L8P A;  2HMO B;  3D9R A;  3JUM A;  5AEU B;  1IDP A;  3F8X A;  3CPO A;  4XBT A;  6STD A;  1W00 A;  2B24 B;  5EVH A;  1Q40 B;  3GWR A;  4GB5 A;  1GY7 A;  1OUN A;  5IG4 A;  1O7P B;  5IG5 A;  4R9K A;  1TUH A;  4HM8 B;  4R9L A;  1QJG A;  5D81 A;  3MG1 A;  4HM7 B;  3F9S A;  3K7C A;  4HJL B;  4IIA A;  5D82 A;  1VZZ A;  1OCV A;  4KVH A;  4XB5 A;  3K0Z A;  4STD A;  5CF1 A;  3EHC A;  1K41 A;  7STD A;  3MG2 A;  3OX9 A;  3G0K A;  4Q53 A;  3E99 A;  1Q40 A;  2GBW B;  4OUQ A;  1O7M B;  2F98 A;  5CLK A;  2Z77 A;  3OV4 A;  3EN8 A;  4RZM A;  4H3U A;  3KSP A;  4PEJ A;  4X2H A;  3HX8 A;  5KP1 A;  2GEY A;  1QMA A;  3Q90 A;  3A76 A;  2HMK B;  4XBY A;  1O7G B;  5JPP A;  3FF2 A;  3UJM A;  3MG3 A;  5IG0 A;  3LZA A;  1OHO A;  1UUW B;  4WYK B;  3OXA A;  2W2C A;  1GY5 A;  1AR0 A;  3GZX B;  4LMI A;  1GYB A;  5IEP A;  1OGZ A;  3OWS A;  1W02 A;  3EJV A;  4XBX A;  3BB9 A;  1DMM A;  5BXQ A;  2Z7A A;  1OHP A;  5IER A; 
#chains in the Genus database with same CATH topology
 3DMC A;  3V99 A;  3RGA A;  3EBY A;  3FG4 A;  3EF8 A;  2XSO B;  1YJ9 3;  1VQ7 3;  2CFG A;  2P05 A;  2GEX A;  3EQQ B;  4O8S A;  4CJN A;  3NBR A;  1EG9 B;  1AY7 A;  3FLJ A;  3SX1 A;  1TP6 A;  1T3B A;  3LT9 A;  3RGR A;  3DGM A;  3PGB A;  2E2U A;  2SBL A;  2Z76 A;  4FMD A;  1PYL A;  1RGK A;  1W6Y A;  2F5W A;  2QIY A;  3MPH A;  1B2S A;  1UGH I;  5JPU A;  1AVK A;  1OAC A;  1RN7 A;  4IT7 A;  2V1L A;  4WYK A;  2XH9 A;  1PY3 A;  4ILF A;  1FZU A;  1RGF A;  2M7O A;  2STD A;  3F7X A;  3NQY A;  5DRV A;  1GD4 A;  5GSP A;  4DKI A;  3Q1C A;  5M19 A;  1YVB I;  3F7S A;  5D83 A;  1YGE A;  3CC4 3;  1RGL A;  1W7C A;  3I56 3;  2A15 A;  3BNB A;  3LT8 A;  1BSB A;  1W2B 2;  4XM4 A;  1HZ1 A;  1S5A A;  3WR2 A;  1AV4 A;  4K61 A;  2H0G A;  5STD A;  2D42 A;  2K3D A;  2MF7 A;  4AEQ A;  3B4P A;  2OCT A;  3B4O A;  5AII A;  1CYU A;  2WGQ A;  3CU3 A;  1UW1 A;  1O7W B;  1T2I A;  1JB4 A;  3MHE A;  3PYJ A;  4XDW A;  2UGI A;  3FSD A;  5M18 A;  1VQ5 3;  1AQZ A;  3AMO B;  4H61 A;  1JBS A;  1O7N B;  3B7C A;  4G1M B;  1W2Z A;  1JB5 A;  1I8V A;  1RSN A;  1TFK A;  1RGH A;  1LOW A;  3HII A;  1VQO 3;  1EEJ A;  1EUI C;  2QGU A;  3HK4 A;  1V74 A;  1UCI A;  3MWZ A;  3BU4 A;  1BIR A;  4HM3 B;  1FGO A;  4XDV A;  1RLS A;  1MWU A;  1BNG A;  1RGE A;  1ZO2 A;  3D4A A;  4BTW A;  5IEN A;  1UUV B;  1EA2 A;  1VQ6 3;  5BIR A;  2WOH A;  1UCJ A;  2I9W A;  4FCM A;  3NXJ A;  1D6Y A;  1LNH A;  1I3F A;  2B1X B;  3F14 A;  1UI8 A;  3HI7 A;  4N6V 0;  6RNT A;  3FG1 A;  1VQQ A;  1IT7 A;  8RNT A;  3GZY B;  2K54 A;  1N8R 4;  2O3O A;  3VSY A;  3MSO A;  1TFO A;  2CFL A;  2WO0 A;  4K1U A;  4J8T A;  1CEW I;  2HMJ B;  2CKF B;  3D5I A;  3VGN A;  1W6G A;  2XSH B;  4MMY B;  5IF6 A;  1TU5 A;  1S72 3;  1SPU A;  3G16 A;  2JQ5 A;  3CD6 3;  1LOY A;  2W9P A;  3MYT A;  1FW7 A;  1WTH A;  2INX A;  4EV5 A;  3DGO A;  1FYS A;  4N6M A;  3F8H A;  2IYJ A;  3AMO A;  4AKZ A;  2C10 A;  2KAA A;  1X1X A;  1I0V A;  1UGI A;  1JB2 A;  4HM4 B;  1YJN 3;  3DGN A;  1B2U A;  1BSD A;  1ZX2 A;  1E97 A;  3DXO A;  3LOY A;  1U8C B;  4HM1 B;  4X2H A;  4GSP A;  1B20 A;  1RCK A;  3ALA A;  5KP4 A;  5G1L A;  4LEH A;  2XRX B;  4HM6 B;  4ZM8 A;  1LRA A;  1RNT A;  4KZ1 A;  1HU9 A;  3A5E A;  1EKM A;  1FUS A;  1I0X A;  1STD A;  5IG3 A;  1GMP A;  1BNR A;  1RTU A;  4WWU C;  2QA4 3;  1GY6 A;  1BRH A;  1BNI A;  5AYS C;  3WMD A;  4CCV A;  3NUV A;  1W01 A;  1BVI A;  1DMQ A;  3LML A;  5AIF A;  2KF3 A;  5TGN A;  3STD A;  3BLZ A;  3SED A;  3D3L A;  1TIJ A;  5AYR B;  1B27 A;  4EXR A;  1YHQ 3;  2RFR A;  1Q86 4;  1EQK A;  3I0Y A;  3X42 A;  1YVS A;  4EC6 A;  2E2V A;  4MMZ B;  7GSP A;  4WHA A;  4EYC A;  3GZB A;  1NU3 A;  2YFJ B;  4N6N B;  1BU4 A;  2W04 A;  4HVN A;  3CCV 3;  4TX4 A;  2KF6 A;  3B8L A;  3DY5 A;  1IVX A;  1W4N A;  2W0Q A;  3LYG A;  2SAR A;  3IJE B;  4NHF A;  5AI1 A;  3IPT A;  1ISK A;  4J5K A;  2YX9 A;  4LZI A;  1K9M 4;  5CF2 A;  1RKY A;  1UUG B;  5EQL A;  3M8C A;  1E3R A;  1OH0 A;  2CC3 A;  3CCL 3;  3KFQ C;  5CXO A;  3NX0 A;  4ORL A;  3S29 A;  4FCJ A;  4O02 B;  5ELJ A;  1WNH A;  1RGA A;  4LSO A;  2GSP A;  1LQG C;  3FF0 A;  6GSP A;  1RHL A;  1ULI B;  3HZP A;  4O2H A;  3CCR 3;  3CCS 3;  1B21 A;  2RNT A;  2QEX 3;  1FGT A;  1Z1S A;  1U5O A;  1D6Z A;  4HBR A;  1NJI 4;  1R4Y A;  2BMO B;  1BRN L;  2CHC A;  1G0T A;  2OWP A;  2PZV A;  4GHO A;  3S5C A;  1BNE A;  2XFT A;  1WMP A;  3K5T A;  4R80 A;  4BTY A;  4I4K A;  2J8X B;  3N54 B;  4IPB A;  4NRE A;  5BVB A;  4CPK A;  1JJ2 2;  3T8U A;  2OTJ 3;  1X1Y A;  2OOV A;  4EW5 A;  1X1W A;  1OHS A;  2XGN A;  1GS3 A;  3UB1 A;  3AGN A;  3RNT A;  5KP3 A;  2W6J H;  2XF3 A;  1CQS A;  1ZS7 A;  4HKV B;  3O8Y A;  1MGR A;  1KD1 4;  2F99 A;  1RN4 A;  4MJD A;  3DUK A;  1GD3 A;  3CME 3;  1JKG A;  4X2O A;  2GXF A;  3KE7 A;  3SOY A;  4CDL A;  1FUW A;  2RGQ A;  1VQL 3;  3AGO A;  1YJW 3;  1G96 A;  3GSP A;  2ML6 A;  4L8O A;  5ELU A;  3DZL A;  5HOH A;  3CNX A;  1IQX A;  4OVM A;  1BRJ A;  3J7Y d;  3I55 3;  1BNJ A;  2UUG C;  1ULJ B;  2HMN B;  5DRE A;  9RNT A;  4BU4 A;  3F40 A;  2XR8 B;  1LXE A;  1WMO A;  4N6L A;  1VQ8 3;  3LH4 A;  1F8N A;  2GU3 A;  2RCD A;  1B2Z A;  2WOF A;  1RNB A;  2BO9 B;  4I5Q A;  3Q2P A;  1VQ9 3;  4HM5 B;  2BU4 A;  1RRH A;  3JUN A;  1Q7Y 4;  2H0I A;  2IMJ A;  3HOH A;  1E3V A;  4HZB B;  3GRD A;  3NBB A;  4K1V A;  3K63 A;  1OF5 B;  4LYL B;  2Y74 A;  2CWT A;  1GOV A;  3LTB A;  3JUP A;  1WQL B;  3ROB A;  2LQV A;  4U13 A;  5AIH A;  1DVD A;  2W9Q A;  3EC9 A;  2JDI H;  1SJW A;  4BTX A;  1NO3 A;  2C11 A;  3JUO A;  1I3I A;  1IQ8 A;  4HM0 B;  2IUK A;  3MKI A;  1JNQ A;  1DVC A;  2F86 B;  5IW9 A;  1RGC A;  2XEP A;  1B2M A;  1Q9E A;  1NNV A;  2OQE A;  3NBJ A;  1BGS A;  2ZHX B;  1R4C A;  4N6U A;  8CHO A;  4OK0 A;  1KSI A;  1JN5 B;  3GZR A;  4FR9 A;  4JF8 A;  2BHM A;  3KCH A;  3EBT A;  3ECF A;  1G02 A;  3H3H A;  1QAK A;  2BMR B;  2IUJ A;  4N6O B;  2HML B;  3SXX A;  3H51 A;  2PNC A;  1IQY A;  1RJO A;  1T5Y A;  3EN1 B;  3X41 A;  2CG1 A;  3K9M C;  5LC6 A;  1OPY A;  2Y73 A;  1QAL A;  1C7H A;  2E2T A;  2HMM B;  4RNT A;  3WOF B;  3KKG A;  3NV0 B;  3CC7 3;  3FG3 A;  2RSX A;  3NHX A;  1BSC A;  2BMQ B;  2L4V A;  3FH1 A;  3FGY A;  2F56 A;  1DYU A;  4LGQ A;  1V58 A;  3ER7 A;  3G8Z A;  1BSE A;  3Q3F A;  4FMB A;  5JBS A;  1QVF 2;  3WOD G;  1J2B A;  2XFS A;  1JBT A;  1UI7 A;  4BL3 A;  1K8A 4;  4N3V A;  3LXU X;  1SII A;  1VQK 3;  1KC8 4;  5G2G A;  3S28 A;  1OF5 A;  4L7K A;  4NPB A;  5FW5 A;  1PU4 A;  1OGX A;  4J9A A;  1KQS 2;  1A2K A;  1Q81 4;  3UNL A;  1NDO B;  1K73 4;  1RGG A;  3SOA A;  5IER A;  1MNL A;  1X1U A;  3CNM A;  1YIT 3;  3BIR A;  3FZW A;  4WP5 A;  1Q42 A;  5G1K A;  4HZ9 B;  3DGL A;  1BNF A;  1JBR A;  3RDE A;  2RBI A;  2UX0 A;  1FUT A;  1JKG B;  4HYZ A;  2GBX B;  1N5H A;  3DH2 A;  3AHW A;  1IVV A;  2K0M A;  1UDI I;  2KXG A;  2R4I A;  2YFL B;  5EEO A;  1O7H B;  1ASK A;  2Z6B A;  2GU1 A;  1HKX A;  2BNG A;  3FKA A;  1JN5 A;  3X3Y A;  1BUQ A;  3PXM A;  2CX1 A;  3DM8 A;  2P0M A;  3BNC A;  2KRT A;  3KII A;  3L0R A;  2AAD A;  3NM2 A;  1MOL A;  2FXT A;  3T8N A;  3OWU A;  5RNT A;  4R1K A;  4WFO A;  3EX9 A;  2FNQ A;  4RNY A;  3NV0 A;  2KF5 A;  5HGR A;  1TTO A;  3SYU A;  5CK6 A;  2YFI B;  5AEW B;  5AIG A;  1DMN A;  1VQP 3;  3JUQ A;  1NWW A;  1IVU A;  1D6U A;  2KCD A;  1JZD A;  1BRS A;  5IEO A;  5LC7 A;  1C54 A;  3SVA A;  4HM2 B;  4EBG A;  3KZT A;  3LTA A;  3OWY A;  3WOE B;  3CCJ 3;  2WGO A;  3X40 A;  3GAX A;  4KT3 B;  2IA7 A;  1LNI A;  1ROV A;  1YI2 3;  1A90 A;  2AAE A;  4L8P A;  1BRK A;  2HMO B;  3CMA 3;  3QK9 A;  3UL6 A;  1RRL A;  4QWT A;  1GMQ A;  2CH9 A;  1SIH A;  1MGW A;  1N9E A;  2HOH A;  4O3V A;  4R4K A;  3X3Z A;  1W6C A;  3JVC A;  1N8Q A;  1YNV X;  1N5P A;  3D9R A;  1RCL A;  3JUM A;  3IMA B;  3ZFZ A;  1LOX A;  1QAF A;  2F4Y A;  2R41 A;  3TDG A;  5AEU B;  1AVL A;  3S27 A;  1IDP A;  3WA2 X;  3F8X A;  1BRI A;  3UL5 A;  3CPO A;  3AHS A;  4XBT A;  6STD A;  3KSE D;  1MWS A;  3D79 A;  1IV9 A;  1W00 A;  2B24 B;  5EVH A;  2CX0 A;  1Q40 B;  1DET A;  3GWR A;  5BU4 A;  2D1W A;  4GB5 A;  2C4B A;  3PZW A;  1GY7 A;  2P09 A;  2P38 A;  1OUN A;  1QVG 2;  2CG0 A;  5IG4 A;  2ZL8 A;  2CFD A;  1O7P B;  3HIG A;  3G4S 3;  1JZO A;  5IG5 A;  4R9K A;  4RBN A;  1TUH A;  1RMS A;  2ZDJ A;  4HM8 B;  3PCR A;  4R9L A;  2MC8 A;  1QJG A;  3CCQ 3;  1BRG A;  2OOV C;  5D81 A;  3CCE 3;  2BT3 A;  3MG1 A;  2LYX A;  4FMA A;  2ZA4 A;  3ZG0 A;  1A2V A;  4HM7 B;  3F9S A;  3G6E 3;  3K7C A;  4HJL B;  4IIA A;  5D82 A;  1Q82 4;  1VZZ A;  1KWI A;  1OCV A;  3D5G A;  1Y4K A;  3PS8 A;  4BL2 A;  1TRQ A;  1NB5 I;  3FCS B;  2CFW A;  2KF4 A;  4KVH A;  1UCL A;  2F5M A;  4XB5 A;  3K0Z A;  2L1S A;  1IYY A;  1YIJ 3;  4STD A;  3LTC A;  3LTD A;  1L5G B;  5CF1 A;  3CCM 3;  3EHC A;  4MMX B;  4EV2 A;  1FGQ A;  1Q7H A;  4BIR A;  1K41 A;  1BAO A;  1I2G A;  4MEI A;  3URP A;  4FCZ A;  7STD A;  2CWV A;  3MG2 A;  3SLU A;  2ML5 A;  1RN1 A;  2Q07 A;  3OX9 A;  4AKY A;  1BAN A;  2W56 B;  1HYF A;  1FGM A;  1IV7 A;  3BND A;  3U97 A;  5I97 A;  4KFF A;  3G0K A;  4Q53 A;  1K28 A;  3E99 A;  1Q40 A;  1A2P A;  2FGT A;  2GBW B;  1IK3 A;  1FGR A;  1N9J A;  4OUQ A;  2CW9 A;  1O7M B;  1BNS A;  1DE3 A;  5FGO A;  1A67 A;  1W5Z A;  1BUJ A;  3QRD A;  3T0U A;  3EE1 A;  4N6T A;  1GMR A;  2F98 A;  5CLK A;  7RNT A;  1IT8 A;  2Z77 A;  3N8B A;  3G71 3;  2CFK A;  3EN8 A;  3OV4 A;  4RZM A;  4H3U A;  1SQW A;  3KSP A;  4PEJ A;  3WHO A;  1B2X A;  2O9U X;  2W03 A;  2CK3 H;  1I70 A;  1TRP A;  3HX8 A;  4HAA A;  1M1X B;  2OQE C;  3BNE A;  2GEY A;  5KP1 A;  1QMA A;  3Q90 A;  4JRF A;  3A76 A;  4RNZ A;  3V98 A;  5M1A A;  1LOV A;  2HMK B;  1GOY A;  1T2H A;  4XBY A;  2OTL 3;  1JRQ A;  1O7G B;  3WDG B;  5JPP A;  3FF2 A;  3DGY A;  3UJM A;  3MG3 A;  5IG0 A;  1BOX A;  1IVW A;  1YGW A;  3LZA A;  3N9H A;  1LQM B;  1BSA A;  1OHO A;  1UUW B;  1STF I;  3X3X A;  3VF1 A;  4WYK B;  3OXA A;  1M1K 4;  3PCS A;  3CC2 3;  1IU7 A;  2W2C A;  5A0O B;  1FA3 A;  1JV2 B;  3KN4 A;  2XGL A;  1VQN 3;  4KFD A;  1VQM 3;  1GY5 A;  1AR0 A;  3GZX B;  3V92 A;  1ROA A;  4LMI A;  1TJD A;  1V57 A;  1PFP A;  2W56 A;  4K90 B;  4J5G A;  3WA3 A;  3CPW 2;  1GYB A;  1RDS A;  4GL6 A;  1WMN A;  3CXC 2;  1M90 4;  1ZGX A;  1US1 A;  2H0H A;  1OGZ A;  2CIU A;  3OWS A;  1W02 A;  1GSP A;  3U1W A;  3NQZ A;  1MWT A;  5IEP A;  1CYV A;  2BIR A;  3EJV A;  3ZG5 A;  1M9G A;  2CWU A;  2IY2 A;  4FMC A;  1SAR A;  3EB8 A;  4XBX A;  2P0X A;  3BB9 A;  1VQ4 3;  1DMM A;  1CH0 A;  1I2F A;  1I2E A;  1UCK A;  5BXQ A;  1MWR A;  3S67 A;  3NM7 A;  2Z7A A;  4HOH A;  3CCU 3;  1GOU A;  1NB3 I;  1OHP A;  1B3S A;  4KFE A;  3OW2 2;  1LVN A; 
#chains in the Genus database with same CATH homology
 3DMC A;  3V99 A;  3RGA A;  3EBY A;  3FG4 A;  3EF8 A;  2XSO B;  1YJ9 3;  1VQ7 3;  2CFG A;  2P05 A;  2GEX A;  3EQQ B;  4O8S A;  3NBR A;  1EG9 B;  3FLJ A;  3SX1 A;  1TP6 A;  3LT9 A;  3RGR A;  3DGM A;  3PGB A;  2E2U A;  2SBL A;  2Z76 A;  4FMD A;  2QIY A;  1W6Y A;  3MPH A;  5JPU A;  1AVK A;  1OAC A;  1RN7 A;  4IT7 A;  2V1L A;  4WYK A;  2XH9 A;  3F7X A;  2M7O A;  2STD A;  3NQY A;  5DRV A;  1GD4 A;  3Q1C A;  1YVB I;  3F7S A;  5D83 A;  1YGE A;  3CC4 3;  1W7C A;  3I56 3;  2A15 A;  3BNB A;  3LT8 A;  1W2B 2;  4XM4 A;  1S5A A;  1AV4 A;  4K61 A;  5STD A;  4AEQ A;  2D42 A;  2MF7 A;  3B4P A;  2OCT A;  3B4O A;  5AII A;  1CYU A;  2WGQ A;  3CU3 A;  1O7W B;  1UW1 A;  4XDW A;  1JB4 A;  3MHE A;  3PYJ A;  1VQ5 3;  3FSD A;  3AMO B;  4H61 A;  1O7N B;  3B7C A;  4G1M B;  1W2Z A;  1JB5 A;  1TFK A;  3HII A;  1VQO 3;  2QGU A;  3HK4 A;  1V74 A;  3MWZ A;  4HM3 B;  1FGO A;  4XDV A;  1ZO2 A;  4BTW A;  5IEN A;  1UUV B;  1EA2 A;  1VQ6 3;  2WOH A;  2I9W A;  4FCM A;  3NXJ A;  1D6Y A;  1LNH A;  2B1X B;  3F14 A;  1UI8 A;  3HI7 A;  4N6V 0;  3FG1 A;  1IT7 A;  3GZY B;  2K54 A;  1N8R 4;  2O3O A;  3VSY A;  3MSO A;  1TFO A;  2CFL A;  2WO0 A;  4K1U A;  4J8T A;  1CEW I;  2HMJ B;  2CKF B;  3VGN A;  5IF6 A;  1W6G A;  2XSH B;  4MMY B;  1TU5 A;  1S72 3;  1SPU A;  3G16 A;  2JQ5 A;  3CD6 3;  2W9P A;  3MYT A;  1WTH A;  2INX A;  4EV5 A;  3DGO A;  4N6M A;  3F8H A;  3AMO A;  4AKZ A;  2C10 A;  1JB2 A;  4HM4 B;  1YJN 3;  3DGN A;  1ZX2 A;  1E97 A;  3DXO A;  3LOY A;  1U8C B;  4HM1 B;  3ALA A;  5KP4 A;  4LEH A;  2XRX B;  4HM6 B;  4ZM8 A;  4KZ1 A;  1HU9 A;  1EKM A;  1STD A;  5IG3 A;  2QA4 3;  4WWU C;  1GY6 A;  3WMD A;  4CCV A;  5AYS C;  3NUV A;  1W01 A;  1DMQ A;  5AIF A;  3LML A;  5TGN A;  3STD A;  3BLZ A;  3SED A;  3D3L A;  1TIJ A;  5AYR B;  4EXR A;  1YHQ 3;  2RFR A;  1Q86 4;  1EQK A;  3I0Y A;  3X42 A;  4EC6 A;  2E2V A;  4MMZ B;  4WHA A;  4EYC A;  3GZB A;  1NU3 A;  2YFJ B;  4N6N B;  2W04 A;  4HVN A;  3CCV 3;  4TX4 A;  3B8L A;  3DY5 A;  1IVX A;  1W4N A;  2W0Q A;  3LYG A;  4NHF A;  3IJE B;  5AI1 A;  3IPT A;  1ISK A;  2YX9 A;  4LZI A;  1K9M 4;  5CF2 A;  1RKY A;  5EQL A;  3M8C A;  1E3R A;  1OH0 A;  2CC3 A;  3CCL 3;  3KFQ C;  5CXO A;  3NX0 A;  4ORL A;  3S29 A;  4FCJ A;  4O02 B;  5ELJ A;  1WNH A;  4LSO A;  3FF0 A;  3HZP A;  1ULI B;  4O2H A;  3CCR 3;  3CCS 3;  2QEX 3;  1FGT A;  1Z1S A;  1U5O A;  1D6Z A;  4HBR A;  1NJI 4;  2BMO B;  2CHC A;  2PZV A;  2OWP A;  3S5C A;  2XFT A;  1WMP A;  3K5T A;  4R80 A;  4BTY A;  4I4K A;  3N54 B;  4IPB A;  4NRE A;  5BVB A;  1JJ2 2;  3T8U A;  2OTJ 3;  2OOV A;  1OHS A;  2XGN A;  1GS3 A;  3UB1 A;  5KP3 A;  2W6J H;  2XF3 A;  1CQS A;  4HKV B;  3O8Y A;  1KD1 4;  2F99 A;  4MJD A;  3DUK A;  1GD3 A;  3CME 3;  1JKG A;  4X2O A;  2GXF A;  3KE7 A;  3SOY A;  4CDL A;  1FUW A;  2RGQ A;  1VQL 3;  1YJW 3;  1G96 A;  2ML6 A;  4L8O A;  5ELU A;  3DZL A;  3CNX A;  1IQX A;  4OVM A;  3J7Y d;  3I55 3;  1ULJ B;  2HMN B;  5DRE A;  3F40 A;  2XR8 B;  1LXE A;  1WMO A;  4N6L A;  1VQ8 3;  3LH4 A;  1F8N A;  2GU3 A;  2RCD A;  2WOF A;  2BO9 B;  3Q2P A;  1VQ9 3;  4HM5 B;  1RRH A;  3JUN A;  1Q7Y 4;  2IMJ A;  1E3V A;  4HZB B;  3GRD A;  3NBB A;  4K1V A;  3K63 A;  1OF5 B;  2Y74 A;  2CWT A;  3LTB A;  3JUP A;  1WQL B;  3ROB A;  2LQV A;  4U13 A;  5AIH A;  1DVD A;  2W9Q A;  3EC9 A;  2JDI H;  1SJW A;  4BTX A;  1NO3 A;  2C11 A;  3JUO A;  1IQ8 A;  4HM0 B;  2IUK A;  3MKI A;  1JNQ A;  1DVC A;  2F86 B;  5IW9 A;  2XEP A;  2OQE A;  3NBJ A;  4N6U A;  1R4C A;  8CHO A;  4OK0 A;  1KSI A;  1JN5 B;  3GZR A;  4FR9 A;  4JF8 A;  2BHM A;  3EBT A;  3ECF A;  3H3H A;  1QAK A;  2BMR B;  2IUJ A;  4N6O B;  2HML B;  3SXX A;  3H51 A;  2PNC A;  1IQY A;  1RJO A;  1T5Y A;  3EN1 B;  3X41 A;  2CG1 A;  3K9M C;  5LC6 A;  1OPY A;  2Y73 A;  1QAL A;  1C7H A;  2E2T A;  2HMM B;  3WOF B;  3KKG A;  3NV0 B;  3CC7 3;  3FG3 A;  2RSX A;  3NHX A;  2L4V A;  2BMQ B;  3FH1 A;  3FGY A;  4LGQ A;  1DYU A;  3ER7 A;  3G8Z A;  5JBS A;  4FMB A;  1QVF 2;  1J2B A;  3WOD G;  2XFS A;  1UI7 A;  1K8A 4;  4N3V A;  3LXU X;  1SII A;  1VQK 3;  1KC8 4;  5G2G A;  3S28 A;  1OF5 A;  4L7K A;  5FW5 A;  1PU4 A;  1OGX A;  4J9A A;  1KQS 2;  1A2K A;  1Q81 4;  3UNL A;  1NDO B;  1K73 4;  3SOA A;  5IER A;  1MNL A;  3CNM A;  1YIT 3;  3FZW A;  4WP5 A;  1Q42 A;  4HZ9 B;  3DGL A;  3RDE A;  2UX0 A;  1JKG B;  4HYZ A;  2GBX B;  1N5H A;  1IVV A;  2K0M A;  2KXG A;  2R4I A;  2YFL B;  5EEO A;  1O7H B;  1ASK A;  2Z6B A;  2GU1 A;  1HKX A;  2BNG A;  3FKA A;  1JN5 A;  3X3Y A;  1BUQ A;  3PXM A;  3DM8 A;  2P0M A;  3BNC A;  2KRT A;  3KII A;  3L0R A;  3NM2 A;  1MOL A;  2FXT A;  3T8N A;  3OWU A;  4R1K A;  4WFO A;  3EX9 A;  2FNQ A;  4RNY A;  3NV0 A;  5HGR A;  5AEW B;  5CK6 A;  2YFI B;  5AIG A;  1DMN A;  1VQP 3;  3JUQ A;  1NWW A;  1IVU A;  1D6U A;  2KCD A;  5IEO A;  5LC7 A;  3SVA A;  4HM2 B;  4EBG A;  3KZT A;  3LTA A;  3OWY A;  3WOE B;  3CCJ 3;  2WGO A;  3X40 A;  3GAX A;  2IA7 A;  1ROV A;  1YI2 3;  1A90 A;  4L8P A;  3CMA 3;  2HMO B;  3QK9 A;  3UL6 A;  1RRL A;  4QWT A;  2CH9 A;  1SIH A;  1N9E A;  4O3V A;  4R4K A;  3X3Z A;  1W6C A;  3JVC A;  1N8Q A;  1N5P A;  3D9R A;  3JUM A;  3IMA B;  1LOX A;  1QAF A;  3TDG A;  5AEU B;  1AVL A;  3S27 A;  1IDP A;  3WA2 X;  3F8X A;  3UL5 A;  3CPO A;  4XBT A;  6STD A;  3KSE D;  1IV9 A;  1W00 A;  2B24 B;  5EVH A;  1Q40 B;  3GWR A;  2D1W A;  4GB5 A;  3PZW A;  1GY7 A;  2P09 A;  2P38 A;  1OUN A;  1QVG 2;  2CG0 A;  5IG4 A;  2ZL8 A;  2CFD A;  1O7P B;  3HIG A;  3G4S 3;  5IG5 A;  4R9K A;  4RBN A;  1TUH A;  4HM8 B;  2ZDJ A;  4R9L A;  3PCR A;  2MC8 A;  1QJG A;  3CCQ 3;  2OOV C;  5D81 A;  3CCE 3;  2BT3 A;  3MG1 A;  2LYX A;  4FMA A;  1A2V A;  4HM7 B;  3F9S A;  3G6E 3;  3K7C A;  4HJL B;  4IIA A;  5D82 A;  1Q82 4;  1VZZ A;  1KWI A;  1OCV A;  1Y4K A;  3PS8 A;  1NB5 I;  3FCS B;  2CFW A;  4KVH A;  4XB5 A;  3K0Z A;  1YIJ 3;  4STD A;  3LTC A;  3LTD A;  1L5G B;  5CF1 A;  3CCM 3;  3EHC A;  4MMX B;  4EV2 A;  1FGQ A;  1K41 A;  4MEI A;  4FCZ A;  7STD A;  2CWV A;  3MG2 A;  3SLU A;  2ML5 A;  2Q07 A;  3OX9 A;  4AKY A;  2W56 B;  1FGM A;  1IV7 A;  3BND A;  3U97 A;  5I97 A;  4KFF A;  3G0K A;  4Q53 A;  1K28 A;  3E99 A;  1Q40 A;  2FGT A;  2GBW B;  1IK3 A;  1FGR A;  1N9J A;  4OUQ A;  2CW9 A;  1O7M B;  5FGO A;  1A67 A;  1W5Z A;  3QRD A;  3T0U A;  3EE1 A;  4N6T A;  2F98 A;  5CLK A;  1IT8 A;  2Z77 A;  3N8B A;  3G71 3;  2CFK A;  3EN8 A;  3OV4 A;  4RZM A;  4H3U A;  1SQW A;  3KSP A;  4PEJ A;  2O9U X;  2W03 A;  3HX8 A;  2CK3 H;  4X2H A;  5KP1 A;  1M1X B;  2OQE C;  3BNE A;  2GEY A;  1QMA A;  3Q90 A;  4JRF A;  3A76 A;  4RNZ A;  3V98 A;  2HMK B;  4XBY A;  2OTL 3;  1JRQ A;  1O7G B;  3WDG B;  5JPP A;  3FF2 A;  3UJM A;  3MG3 A;  5IG0 A;  1IVW A;  3LZA A;  3N9H A;  1OHO A;  1UUW B;  1STF I;  3X3X A;  3VF1 A;  4WYK B;  3OXA A;  1M1K 4;  3PCS A;  3CC2 3;  1IU7 A;  2W2C A;  5A0O B;  1FA3 A;  1JV2 B;  3KN4 A;  2XGL A;  1VQN 3;  4KFD A;  1VQM 3;  1GY5 A;  1AR0 A;  3GZX B;  3V92 A;  1ROA A;  4LMI A;  2W56 A;  1PFP A;  4K90 B;  3WA3 A;  3CPW 2;  1GYB A;  3CXC 2;  4GL6 A;  1WMN A;  1M90 4;  1US1 A;  5IEP A;  1OGZ A;  2CIU A;  3OWS A;  1W02 A;  3U1W A;  3NQZ A;  1CYV A;  3EJV A;  1M9G A;  2CWU A;  4FMC A;  4XBX A;  3EB8 A;  2P0X A;  3BB9 A;  1VQ4 3;  1DMM A;  5BXQ A;  3S67 A;  3NM7 A;  2Z7A A;  3CCU 3;  1NB3 I;  1OHP A;  4KFE A;  3OW2 2;  1LVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...