4HM4B

Naphthalene 1,2-dioxygenase bound to indan
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to indan
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 54
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm4B00
3NBRA 1W6YA 4N3VA 3DUKA 4WWUC 4HM5B 3JUPA 1ZO2A 3F9SA 4HM6B 3HZPA 1OH0A 5HGRA 3B4PA 1EA2A 3H51A 1C7HA 1DMNA 3G0KA 5BXQA 5IF6A 4XBTA 5CF2A 1E3RA 1Q40A 1AR0A 1JB2A 3SEDA 5D82A 2B24B 4ORLA 7STDA 3EN1B 4R1KA 1E3VA 1Q42A 1ZX2A 5AEUB 1S5AA 2STDA 1NU3A 2XRXB 5G2GA 3BB9A 3SOYA 2RCDA 1ULIB 5IG5A 1OF5B 5IENA 8CHOA 3LYGA 3T8UA 3OWSA 3DM8A 6STDA 4MJDA 2IMJA 3E99A 2PZVA 5CXOA 1OHPA 5AIHA 1JKGA 4HM3B 4FCJA 2GEXA 4XBXA 3UNLA 3K7CA 3F14A 3KZTA 4HM7B 3EN8A 1ASKA 1W01A 3GZYB 1A2KA 4WYKA 1O7GB 5DREA 4LEHA 1WQLB 3DXOA 1ULJB 1W02A 2XR8B 1K41A 3DZLA 3NV0A 4HM8B 4U13A 1JB4A 4STDA 2JQ5A 1GS3A 5CF1A 2HMJB 4R9KA 4HZ9B 2HMKB 4HM1B 2W2CA 3OV4A 3FGYA 5IEPA 1Q40B 3STDA 5FW5A 3KSPA 3MSOA 5AIFA 2GEYA 3GRDA 3S5CA 2Z7AA 2QGUA 2GXFA 3GZBA 3DMCA 4XDVA 3OX9A 4K1VA 1OCVA 3OWUA 1JB5A 2YFLB 1GYBA 3G8ZA 3FF0A 5BVBA 2OWPA 3EQQB 3FKAA 1OPYA 1QJGA 2Z77A 1OUNA 1VZZA 1JN5A 3I0YA 4J9AA 3JUMA 2I9WA 4K1UA 3FLJA 3FF2A 3EF8A 3EBTA 4CDLA 2RFRA 2HMLB 1STDA 5AI1A 1JKGB 2Z76A 3RGRA 3ER7A 5CLKA 1DMQA 1HKXA 3MKIA 4PEJA 3EBYA 3ROBA 4WYKB 3EJVA 4HZBB 2GBXB 3SOAA 3NV0B 3RGAA 2BNGA 3A76A 4HM4B 2B1XB 1O7MB 1TP6A 3FSDA 4WP5A 1IDPA 1O7WB 3FZWA 1TUHA 1NDOB 1OGZA 4HJLB 3EHCA 1OHSA 3F40A 2F86B 3CNXA 3M8CA 3UJMA 2XSHB 3HX8A 5AIGA 1QMAA 3B4OA 1O7NB 3MG3A 5D81A 3NXJA 4HM0B 3D9RA 1O7PB 1U5OA 5IERA 3KE7A 3BLZA 1GY6A 1GY7A 4GB5A 3K0ZA 3MG2A 2INXA 5STDA 5DRVA 4XBYA 1Z1SA 5IG4A 2R4IA 3KKGA 3OWYA 2F99A 3EC9A 3T8NA 3Q90A 2RGQA 3F7XA 5AIIA 1DMMA 1JN5B 3MYTA 4R9LA 5CK6A 5D83A 5JPPA 4IIAA 3JUNA 4LMIA 3F7SA 4XDWA 4J8TA 3NUVA 3H3HA 5KP4A 3NM2A 1E97A 3GZXB 3OXAA 5AEWB 2YFJB 4L7KA 2YFIB 4L8OA 3VSYA 3MHEA 3F8XA 3EX9A 3LZAA 1SJWA 4RZMA 4L8PA 1GY5A 3B7CA 2QIYA 3CU3A 5IEOA 3ECFA 5TGNA 3NHXA 4I4KA 2F98A 3F8HA 2HMNB 3IPTA 3VGNA 2GBWB 1ISKA 4XM4A 3JUQA 4X2OA 2UX0A 2XSOB 1NWWA 2HMOB 5JPUA 2BMOB 5KP1A 5EVHA 3GZRA 1BUQA 4OUQA 3G16A 2A15A 5IG0A 2K54A 2HMMB 1CQSA 5IG3A 1OGXA 1OF5A 4XB5A 3HK4A 1W00A 4LGQA 1UUWB 2CHCA 4KVHA 5KP3A 4HM2B 1EG9B 3B8LA 1UUVB 4FCMA 1OHOA 1O7HB 3FH1A 4HVNA 4OVMA 2BMQB 4H3UA 4HKVB 3GWRA 3CPOA 2BMRB 3JUOA 2CKFB 4Q53A 3MG1A 4X2HA 3CNMA 3WMDA
chains in the Genus database with same CATH superfamily
3NBRA 7RNTA 2KXGA 1W6YA 4N3VA 3DUKA 4OK0A 4WWUC 2IYJA 4DKIA 1X1WA 3GSPA 1VQ63 4HM5B 1GMPA 1DETA 1SIHA 3JUPA 3LXUX 1ZO2A 3F9SA 2CK3H 1RGGA 2R41A 4I5QA 1BRJA 3DGOA 4HM6B 2H0HA 2WOFA 4MMYB 2CG1A 3LTDA 1DYUA 1HZ1A 1X1YA 2BT3A 1IT8A 3N9HA 3LTCA 1QAFA 1Q9EA 2P05A 3NBBA 5HOHA 1N5PA 2IY2A 3HZPA 1OH0A 4TX4A 5HGRA 2IUKA 3B4PA 1EA2A 3H51A 1B2UA 1C7HA 1JNQA 1DMNA 4FCZA 3G0KA 5BXQA 1PU4A 1V58A 1K9M4 1UDII 1GOVA 5IF6A 1LQGC 1BIRA 4XBTA 4G1MB 1I70A 4GHOA 2ML5A 5CF2A 1KD14 1E3RA 1W6CA 3EE1A 1Q40A 1AR0A 1JB2A 3SEDA 3PXMA 4GSPA 5D82A 1WTHA 3I563 1A67A 2B24B 4O02B 4RNTA 4ORLA 7STDA 1NNVA 3KFQC 3CCJ3 1FGMA 3X3ZA 1RRLA 5RNTA 1Y4KA 2CG0A 1GOUA 3CC23 3EN1B 3NM7A 3S29A 2W56B 3QK9A 4R1KA 2CFGA 1E3VA 1Q42A 2IA7A 1UI7A 1ZX2A 2H0IA 5AEUB 1S5AA 1Q7Y4 1DE3A 1IT7A 1YVBI 4R4KA 1B3SA 1TU5A 3G4S3 2Y73A 2STDA 1UCIA 3IJEB 1LOVA 1LVNA 4J5GA 1TFKA 4LSOA 1NU3A 1VQO3 1KC84 3LTBA 4CCVA 4WFOA 3JVCA 3FG3A 3CCS3 1BSBA 1UGIA 1RGEA 2OCTA 2XRXB 5G2GA 3BB9A 3D4AA 1TIJA 2RCDA 3Q3FA 1ULIB 3SOYA 2KAAA 1F8NA 1BRNL 1BNFA 5IG5A 1OF5B 1RGCA 1RN7A 5IENA 2FNQA 3URPA 3PCRA 4KT3B 4QWTA 1BGSA 2AAEA 8CHOA 1STFI 3CD63 3LYGA 3D79A 1FGQA 3NX0A 1B2MA 3SXXA 3CCL3 3T8UA 1UI8A 2F5MA 3OWSA 1BNGA 2W56A 3DM8A 3CCQ3 6STDA 1VQ93 1RCKA 4MJDA 1NO3A 2Z6BA 2YX9A 3BU4A 2GU3A 2IMJA 5I97A 3E99A 1BRHA 3WOFB 3K5TA 2PZVA 5CXOA 1OHPA 4HBRA 5AIHA 1JKGA 1YJ93 4HM3B 1SPUA 4FCJA 2GEXA 4XBXA 3SLUA 3UNLA 3K7CA 5M18A 1RKYA 1IVUA 1MWRA 3F14A 3KZTA 4BU4A 2P09A 1VQ53 4HM7B 3I553 1GSPA 3EN8A 2P0MA 2PNCA 3WR2A 1JV2B 4NREA 1ASKA 1BRIA 2XGNA 1W01A 3GZYB 1A2KA 1BRKA 1YVSA 4WYKA 1O7GB 5DREA 4LEHA 1IK3A 1RJOA 1WQLB 1YI23 3DXOA 3MPHA 3U1WA 1ULJB 2L4VA 2KF6A 1W02A 1X1UA 3S28A 5A0OB 2XR8B 3V98A 6RNTA 1K41A 2FGTA 3AGNA 4N6OB 3DZLA 1K734 5JBSA 3NV0A 4HM8B 1IU7A 1UCJA 4U13A 1CYVA 2ZA4A 4N6MA 1JB4A 3V92A 2CFDA 3CXC2 1B2SA 2H0GA 1CH0A 4STDA 2JQ5A 1GS3A 3ZG5A 5CF1A 2E2TA 2CWTA 3Q2PA 3HIGA 2WO0A 1IVVA 1G02A 2L1SA 1RN4A 4EYCA 1UCKA 1QVG2 4O3VA 2HMJB 1AVLA 2M7OA 4R9KA 5M1AA 1LRAA 4HZ9B 1L5GB 2HMKB 1VQM3 4HM1B 1GMRA 1GMQA 2W2CA 3OV4A 2UGIA 3CCU3 2RBIA 1RNTA 2E2VA 2K3DA 3FGYA 1Q40B 4O8SA 3STDA 5IEPA 3G6E3 4CPKA 5FW5A 3KSPA 3MSOA 5AIFA 2GEYA 3GRDA 3S5CA 3Q1CA 2WGOA 2Z7AA 3BNDA 1Q814 4EV5A 2QGUA 2OTL3 2GXFA 4ZM8A 2F5WA 2C4BA 3GZBA 4IPBA 1RGFA 3DMCA 4XDVA 3CME3 1BANA 3OX9A 4K1VA 1BVIA 5IW9A 1W7CA 1OCVA 3EB8A 2W0QA 1SARA 3OWUA 5FGOA 4ILFA 3S67A 3CCR3 1JB5A 1K28A 2XFTA 3A5EA 1WMPA 2YFLB 5BIRA 1EQKA 1FA3A 1EEJA 1AY7A 1LOXA 2CFLA 4RNZA 2CX0A 1GYBA 2XEPA 1YGEA 3G8ZA 1J2BA 1FGOA 4GL6A 5GSPA 1N9JA 2D42A 2MF7A 2AADA 3FF0A 2OWPA 3KSED 5BVBA 3EQQB 3NQYA 2WOHA 3WHOA 3DGNA 3FKAA 1OPYA 1QJGA 2Z77A 2CFWA 3RDEA 1OACA 1B27A 1R4CA 1T2IA 3DY5A 2V1LA 1NB3I 1V57A 3X41A 1N8R4 2CW9A 3CMA3 1OUNA 1VZZA 1A2PA 1PYLA 1RHLA 1JN5A 3I0YA 1IQ8A 4J9AA 1WMOA 3JUMA 3S27A 2W9QA 1RRHA 4MMXB 1TJDA 2I9WA 4K1UA 1JJ22 1R4YA 3FLJA 3K9MC 1W5ZA 1I8VA 3FF2A 2P38A 3EF8A 3EBTA 7GSPA 1N9EA 2W6JH 4AKYA 4CDLA 2CWVA 1LOWA 3BNCA 2OQEA 1V74A 1US1A 2RFRA 1EKMA 2HMLB 3PS8A 1JZDA 1STDA 1BRSA 5AI1A 4EV2A 1JKGB 2GSPA 1MWUA 2KF5A 2Z76A 1LQMB 3RGRA 3ER7A 1MNLA 5CLKA 1BRGA 1DMQA 1HKXA 1MWTA 3CPW2 3MKIA 1JBRA 2BO9B 2E2UA 4PEJA 3EBYA 2CH9A 1CEWI 2D1WA 3ROBA 3AMOA 4WYKB 1YIT3 3EJVA 4N6UA 3RNTA 2KF4A 1IVWA 4IT7A 1K8A4 4HZBB 1RDSA 2CWUA 2GBXB 5G1LA 3SOAA 1FYSA 3X3XA 3LT9A 1B2XA 1ROVA 1WNHA 3NV0B 3RGAA 3WDGB 2BNGA 1CYUA 1BSDA 1S723 1MGRA 3AGOA 3DGYA 3LT8A 3WA2X 3A76A 2K0MA 3PCSA 2B1XB 4HM4B 1O7MB 1TP6A 4EC6A 1YJN3 2W04A 1RGHA 3FSDA 4WP5A 3X40A 2FXTA 3QRDA 1IDPA 3HIIA 4FMBA 1O7WB 1QVF2 2HOHA 2CX1A 3FZWA 4AKZA 1TUHA 1D6ZA 1NDOB 5AYRB 4K90B 4O2HA 1JBTA 1BNIA 1BNRA 1OGZA 1C54A 4HJLB 2W9PA 3EHCA 1OHSA 1FW7A 2RNTA 3F40A 2F86B 4N6NB 3BNBA 4KFFA 5EQLA 1IQYA 1TRQA 4LYLB 1BSEA 1QAKA 1I2GA 2KCDA 3UL6A 3CNXA 3M8CA 1T3BA 2C10A 3UJMA 2XSHB 3HX8A 4BTXA 1VQK3 3L0RA 5AIGA 1UUGB 3CCM3 2BU4A 1QMAA 3ZFZA 3B4OA 2IUJA 1BUJA 1B21A 1O7NB 2QA43 3X3YA 3LH4A 3MG3A 5D81A 1WMNA 1YIJ3 1DVCA 3NXJA 3UB1A 4HM0B 3D9RA 1IV7A 1HYFA 1O7PB 1TRPA 3BIRA 1FZUA 1U5OA 3D5GA 5AYSC 5IERA 3KE7A 5ELJA 1B20A 3BLZA 1GY6A 3D3LA 4BIRA 1GY7A 4FMDA 4GB5A 4MMZB 1I2FA 1TTOA 3K0ZA 3MG2A 2INXA 2P0XA 3CCE3 1M904 5STDA 4FMAA 1M1K4 2W03A 2XGLA 1VQN3 1VQL3 5DRVA 3N54B 4XBYA 1Z1SA 4JRFA 3N8BA 1QALA 5LC7A 3ALAA 5IG4A 2R4IA 2QEX3 3OW22 2ZHXB 3WODG 3KKGA 1W2B2 2KRTA 3OWYA 1D6YA 1SIIA 1MWSA 1T2HA 2F99A 1LNIA 3EC9A 3KN4A 3T8NA 1KQS2 3Q90A 2RGQA 3F7XA 1NB5I 5AIIA 2BHMA 1DMMA 2RSXA 1LOYA 1JN5B 3MYTA 4HYZA 4R9LA 5CK6A 2O3OA 4J5KA 5D83A 5JPPA 1W2ZA 1RCLA 1U8CB 1Q864 4H61A 4IIAA 1Q7HA 3JUNA 1D6UA 4LMIA 1RGKA 3F7SA 4XDWA 1Q824 4J8TA 3NUVA 4HOHA 4NHFA 3H3HA 3SYUA 5G1KA 5KP4A 1UW1A 1B2ZA 3NM2A 2C11A 4JF8A 3FG1A 1LXEA 1KWIA 1E97A 1RGAA 3AHWA 3GZXB 4BTWA 3LOYA 5LC6A 4CJNA 2OTJ3 3OXAA 4KFEA 1RNBA 5AEWB 3DH2A 2O9UX 2YFJB 4L7KA 3AHSA 1I0VA 3AMOB 2YFIB 3ZG0A 1X1XA 4L8OA 3VSYA 1A90A 3MHEA 3NBJA 2ML6A 4MEIA 3F8XA 4NPBA 3EX9A 3LZAA 1VQ43 2CC3A 5EEOA 9RNTA 3HOHA 1SJWA 4RZMA 2SBLA 4L8PA 1TFOA 1RSNA 1NJI4 1GY5A 2J8XB 3DGMA 3B7CA 3NQZA 2QIYA 1VQQA 4R80A 2GU1A 1YHQ3 2Y74A 1JBSA 3CU3A 2OQEC 2UUGC 1GOYA 1FUTA 5IEOA 4EW5A 4N6LA 1FUSA 3ECFA 5TGNA 3UL5A 3NHXA 1A2VA 4I4KA 3SX1A 2Q07A 8RNTA 1IYYA 1RN1A 1FUWA 1W4NA 3D5IA 2F98A 3F8HA 6GSPA 2ZL8A 2HMNB 1EUIC 1T5YA 1IVXA 3IPTA 3PYJA 2CFKA 2LYXA 3VGNA 2GBWB 1ISKA 4XM4A 3JUQA 1ROAA 4X2OA 1BSAA 1RTUA 2UX0A 1RLSA 1VQP3 2XSOB 1PFPA 1IV9A 1BNJA 1I2EA 1YJW3 3PGBA 1BAOA 1BU4A 1VQ83 1NWWA 1G96A 2F4YA 2HMOB 5JPUA 5M19A 3CC43 4BL2A 1RGLA 2MC8A 2BMOB 1AV4A 3U97A 1JZOA 5KP1A 1N5HA 5EVHA 3GZRA 1MOLA 1YGWA 3DGLA 1HU9A 2BIRA 3HI7A 3K63A 3G713 3CC73 1BUQA 1IQXA 1GD3A 4RBNA 4BL3A 2LQVA 4K61A 1ZS7A 1SQWA 2XH9A 3G16A 3FCSB 4OUQA 1AQZA 2A15A 1AVKA 3WOEB 4AEQA 2SARA 4RNYA 3SVAA 3CCV3 5IG0A 1N8QA 2K54A 1I3IA 1KSIA 3KIIA 3WA3A 2HMMB 2KF3A 1FGRA 4EXRA 1BSCA 1CQSA 1BNSA 3LTAA 1LNHA 5IG3A 3KCHA 1OGXA 5ELUA 4FMCA 2OOVA 2F56A 1OF5A 4XB5A 3HK4A 1W00A 2OOVC 2CIUA 4KFDA 4LGQA 1UUWB 2CHCA 1G0TA 1I3FA 4KVHA 5KP3A 5BU4A 3O8YA 1VQ73 1GD4A 2XF3A 2JDIH 4FR9A 4HM2B 1EG9B 1BOXA 3B8LA 1UUVB 4BTYA 1PY3A 4FCMA 2ZDJA 4N6TA 1JRQA 1DVDA 4HAAA 1M1XB 1YNVX 3VF1A 1OHOA 1RMSA 1O7HB 3FH1A 4HVNA 1I0XA 1FGTA 4OVMA 4LZIA 4WHAA 2WGQA 1UCLA 2BMQB 3IMAB 4H3UA 4HKVB 3V99A 4KZ1A 3X42A 3FG4A 1MGWA 3GWRA 3BNEA 3CPOA 1M9GA 3LMLA 2BMRB 4EBGA 3T0UA 3JUOA 2CKFB 3GAXA 1UGHI 4Q53A 1BNEA 3MG1A 4X2HA 4N6V0 3PZWA 3TDGA 1ZGXA 3MWZA 2XFSA 3CNMA 1W6GA 3J7Yd 3WMDA
chains in the Genus database with same CATH topology
3NBRA 2KXGA 1W6YA 4N3VA 3DUKA 4OK0A 4WWUC 1VQ63 4HM5B 3JUPA 1SIHA 3LXUX 1ZO2A 3F9SA 2CK3H 3DGOA 4HM6B 4MMYB 2WOFA 2CG1A 3LTDA 1DYUA 2BT3A 1IT8A 3N9HA 3LTCA 1QAFA 2P05A 3NBBA 1N5PA 3HZPA 1OH0A 4TX4A 5HGRA 2IUKA 3B4PA 1EA2A 3H51A 1JNQA 1C7HA 1DMNA 4FCZA 3G0KA 5BXQA 1PU4A 1K9M4 5IF6A 4XBTA 4G1MB 2ML5A 5CF2A 1KD14 1E3RA 1W6CA 3EE1A 1Q40A 1AR0A 1JB2A 3SEDA 3PXMA 5D82A 3I563 1WTHA 1A67A 2B24B 4O02B 4ORLA 7STDA 3KFQC 3CCJ3 1FGMA 3X3ZA 1RRLA 1Y4KA 2CG0A 3CC23 3EN1B 3NM7A 3S29A 2W56B 3QK9A 4R1KA 2CFGA 1E3VA 1Q42A 2IA7A 1UI7A 1ZX2A 5AEUB 1Q7Y4 1S5AA 1IT7A 1YVBI 4R4KA 1TU5A 3G4S3 2Y73A 2STDA 3IJEB 1VQO3 1LVNA 4LSOA 1TFKA 1NU3A 1KC84 3LTBA 4CCVA 4WFOA 3JVCA 3FG3A 3CCS3 2OCTA 2XRXB 5G2GA 3BB9A 1TIJA 2RCDA 3SOYA 1ULIB 1F8NA 5IG5A 1OF5B 1RN7A 5IENA 2FNQA 3PCRA 4QWTA 8CHOA 1STFI 3CD63 3LYGA 1FGQA 3NX0A 3SXXA 3CCL3 3T8UA 1UI8A 3OWSA 2W56A 3DM8A 3CCQ3 6STDA 1VQ93 4MJDA 1NO3A 2Z6BA 2YX9A 2GU3A 2IMJA 5I97A 3E99A 3WOFB 3K5TA 2PZVA 5CXOA 1OHPA 4HBRA 5AIHA 1JKGA 1YJ93 4HM3B 1SPUA 4FCJA 2GEXA 4XBXA 3SLUA 3UNLA 3K7CA 1RKYA 1IVUA 1VQ53 3F14A 3KZTA 2P09A 4HM7B 3I553 3EN8A 2P0MA 2PNCA 1JV2B 4NREA 1ASKA 2XGNA 1W01A 3GZYB 1A2KA 4WYKA 1O7GB 5DREA 4LEHA 1IK3A 1RJOA 1WQLB 1YI23 3DXOA 3MPHA 3U1WA 1ULJB 2L4VA 5A0OB 1W02A 3S28A 2XR8B 3V98A 1K41A 2FGTA 4N6OB 1K734 3DZLA 5JBSA 3NV0A 4HM8B 1IU7A 4U13A 1CYVA 4N6MA 1JB4A 3V92A 2CFDA 3CXC2 4STDA 2JQ5A 1GS3A 5CF1A 2E2TA 2CWTA 3Q2PA 3HIGA 2WO0A 1IVVA 4EYCA 1QVG2 4O3VA 2HMJB 1AVLA 2M7OA 4R9KA 1L5GB 4HZ9B 2HMKB 1VQM3 4HM1B 2W2CA 3OV4A 3CCU3 2E2VA 3FGYA 5IEPA 1Q40B 4O8SA 3STDA 3G6E3 5FW5A 3KSPA 3MSOA 5AIFA 2GEYA 3GRDA 3S5CA 3Q1CA 2WGOA 2Z7AA 3BNDA 1Q814 4EV5A 2QGUA 2OTL3 2GXFA 4ZM8A 3GZBA 4IPBA 3DMCA 4XDVA 3CME3 3OX9A 4K1VA 5IW9A 1W7CA 1OCVA 3EB8A 2W0QA 3OWUA 5FGOA 3S67A 3CCR3 1JB5A 1K28A 2XFTA 1EQKA 1WMPA 2YFLB 1FA3A 1LOXA 2CFLA 4RNZA 1GYBA 2XEPA 1YGEA 3G8ZA 1J2BA 1FGOA 4GL6A 1N9JA 2D42A 2MF7A 3FF0A 3KSED 2OWPA 5BVBA 3EQQB 3NQYA 2WOHA 3DGNA 3FKAA 1OPYA 1QJGA 2Z77A 2CFWA 3RDEA 1OACA 1R4CA 3DY5A 2V1LA 1NB3I 3X41A 1N8R4 2CW9A 3CMA3 1OUNA 1VZZA 1JN5A 3I0YA 1IQ8A 4J9AA 1WMOA 3JUMA 3S27A 2W9QA 1RRHA 4MMXB 2I9WA 4K1UA 1JJ22 3FLJA 3K9MC 1W5ZA 3FF2A 2P38A 3EF8A 3EBTA 1N9EA 2W6JH 4AKYA 4CDLA 2CWVA 3BNCA 2OQEA 1V74A 1US1A 2RFRA 1EKMA 2HMLB 3PS8A 1STDA 5AI1A 4EV2A 1JKGB 2Z76A 3RGRA 3ER7A 1MNLA 5CLKA 1DMQA 1HKXA 3CPW2 3MKIA 2BO9B 2E2UA 4PEJA 3EBYA 2CH9A 1CEWI 2D1WA 3ROBA 3AMOA 4WYKB 1YIT3 3EJVA 4N6UA 1IVWA 4IT7A 1K8A4 4HZBB 2GBXB 2CWUA 3SOAA 3X3XA 3LT9A 1ROVA 1WNHA 3NV0B 3RGAA 3WDGB 2BNGA 1CYUA 1S723 3LT8A 3WA2X 4EC6A 3A76A 2K0MA 3PCSA 2B1XB 4HM4B 1O7MB 1TP6A 1YJN3 2W04A 3FSDA 4WP5A 3X40A 2FXTA 3QRDA 1IDPA 3HIIA 4FMBA 1O7WB 1QVF2 4AKZA 3FZWA 1TUHA 1D6ZA 1NDOB 5AYRB 4K90B 4O2HA 1OGZA 4HJLB 2W9PA 3EHCA 1OHSA 3F40A 2F86B 4N6NB 3BNBA 4KFFA 5EQLA 1IQYA 1QAKA 2KCDA 3UL6A 3CNXA 3M8CA 3UJMA 2C10A 2XSHB 3HX8A 4BTXA 1VQK3 3L0RA 5AIGA 3CCM3 1QMAA 3B4OA 2IUJA 1O7NB 2QA43 3X3YA 3LH4A 3MG3A 5D81A 1WMNA 1YIJ3 1DVCA 3NXJA 3UB1A 4HM0B 3D9RA 1IV7A 1O7PB 1U5OA 5AYSC 5IERA 3KE7A 5ELJA 3BLZA 1GY6A 3D3LA 1GY7A 4FMDA 4GB5A 4MMZB 3K0ZA 3MG2A 2INXA 2P0XA 3CCE3 1M904 5STDA 4FMAA 1M1K4 2W03A 2XGLA 1VQN3 1VQL3 5DRVA 3N54B 4XBYA 1Z1SA 4JRFA 3N8BA 1QALA 5LC7A 3ALAA 5IG4A 2R4IA 2QEX3 3OW22 3WODG 3KKGA 1W2B2 2KRTA 3OWYA 1D6YA 1SIIA 2F99A 3EC9A 1KQS2 3KN4A 3T8NA 3Q90A 2RGQA 3F7XA 1NB5I 5AIIA 2BHMA 1DMMA 2RSXA 1JN5B 3MYTA 4HYZA 4R9LA 5CK6A 2O3OA 5D83A 5JPPA 1W2ZA 1U8CB 1Q864 4H61A 4IIAA 3JUNA 1D6UA 4LMIA 3F7SA 4XDWA 1Q824 4J8TA 3NUVA 4NHFA 3H3HA 5KP4A 1UW1A 3NM2A 2C11A 4JF8A 3FG1A 1LXEA 1KWIA 1E97A 3GZXB 4BTWA 3LOYA 5LC6A 2OTJ3 3OXAA 4KFEA 5AEWB 2O9UX 2YFJB 4L7KA 3AMOB 2YFIB 1A90A 4L8OA 3VSYA 3MHEA 3NBJA 2ML6A 4MEIA 3F8XA 3EX9A 3LZAA 1VQ43 2CC3A 5EEOA 1SJWA 4RZMA 2SBLA 4L8PA 1TFOA 1NJI4 1GY5A 3DGMA 3B7CA 3NQZA 2QIYA 4R80A 2GU1A 1YHQ3 2Y74A 3CU3A 2OQEC 5IEOA 4N6LA 3ECFA 5TGNA 3UL5A 3NHXA 1A2VA 4I4KA 3SX1A 2Q07A 1FUWA 1W4NA 2F98A 3F8HA 2ZL8A 2HMNB 1T5YA 3PYJA 1IVXA 3IPTA 2CFKA 2LYXA 3VGNA 2GBWB 1ISKA 4XM4A 3JUQA 1ROAA 4X2OA 2UX0A 1VQP3 2XSOB 1PFPA 1IV9A 1YJW3 3PGBA 1VQ83 1NWWA 1G96A 2HMOB 5JPUA 3CC43 2MC8A 2BMOB 1AV4A 3U97A 5KP1A 1N5HA 5EVHA 3GZRA 1MOLA 3DGLA 1HU9A 3HI7A 3K63A 3G713 3CC73 1BUQA 1IQXA 1GD3A 4RBNA 2LQVA 4K61A 1SQWA 2XH9A 3G16A 3FCSB 4OUQA 2A15A 1AVKA 3WOEB 4AEQA 3SVAA 4RNYA 3CCV3 5IG0A 1N8QA 2K54A 3KIIA 1KSIA 3WA3A 2HMMB 1FGRA 4EXRA 1CQSA 3LTAA 1LNHA 5IG3A 1OGXA 5ELUA 4FMCA 2OOVA 1OF5A 4XB5A 3HK4A 1W00A 2OOVC 2CIUA 4KFDA 4LGQA 1UUWB 2CHCA 4KVHA 5KP3A 1VQ73 3O8YA 1GD4A 2XF3A 2JDIH 4FR9A 4HM2B 1EG9B 3B8LA 1UUVB 4BTYA 4FCMA 4N6TA 2ZDJA 1DVDA 1JRQA 1M1XB 3VF1A 1OHOA 1O7HB 3FH1A 4HVNA 4OVMA 1FGTA 4LZIA 4WHAA 2WGQA 2BMQB 3IMAB 4H3UA 4HKVB 3V99A 4KZ1A 3X42A 3FG4A 3GWRA 3BNEA 3CPOA 1M9GA 3LMLA 2BMRB 4EBGA 3T0UA 3JUOA 2CKFB 3GAXA 4Q53A 3MG1A 4X2HA 4N6V0 3PZWA 3TDGA 3MWZA 2XFSA 3CNMA 1W6GA 3J7Yd 3WMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBR A;  1W6Y A;  4N3V A;  3DUK A;  4WWU C;  4HM5 B;  3JUP A;  1ZO2 A;  3F9S A;  4HM6 B;  3HZP A;  1OH0 A;  5HGR A;  3B4P A;  1EA2 A;  3H51 A;  1C7H A;  1DMN A;  3G0K A;  5BXQ A;  5IF6 A;  4XBT A;  5CF2 A;  1E3R A;  1Q40 A;  1AR0 A;  1JB2 A;  3SED A;  5D82 A;  2B24 B;  4ORL A;  7STD A;  3EN1 B;  4R1K A;  1E3V A;  1Q42 A;  1ZX2 A;  5AEU B;  1S5A A;  2STD A;  1NU3 A;  2XRX B;  5G2G A;  3BB9 A;  3SOY A;  2RCD A;  1ULI B;  5IG5 A;  1OF5 B;  5IEN A;  8CHO A;  3LYG A;  3T8U A;  3OWS A;  3DM8 A;  6STD A;  4MJD A;  2IMJ A;  3E99 A;  2PZV A;  5CXO A;  1OHP A;  5AIH A;  1JKG A;  4HM3 B;  4FCJ A;  2GEX A;  4XBX A;  3UNL A;  3K7C A;  3F14 A;  3KZT A;  4HM7 B;  3EN8 A;  1ASK A;  1W01 A;  3GZY B;  1A2K A;  4WYK A;  1O7G B;  5DRE A;  4LEH A;  1WQL B;  3DXO A;  1ULJ B;  1W02 A;  2XR8 B;  1K41 A;  3DZL A;  3NV0 A;  4HM8 B;  4U13 A;  1JB4 A;  4STD A;  2JQ5 A;  1GS3 A;  5CF1 A;  2HMJ B;  4R9K A;  4HZ9 B;  2HMK B;  4HM1 B;  2W2C A;  3OV4 A;  3FGY A;  5IEP A;  1Q40 B;  3STD A;  5FW5 A;  3KSP A;  3MSO A;  5AIF A;  2GEY A;  3GRD A;  3S5C A;  2Z7A A;  2QGU A;  2GXF A;  3GZB A;  3DMC A;  4XDV A;  3OX9 A;  4K1V A;  1OCV A;  3OWU A;  1JB5 A;  2YFL B;  1GYB A;  3G8Z A;  3FF0 A;  5BVB A;  2OWP A;  3EQQ B;  3FKA A;  1OPY A;  1QJG A;  2Z77 A;  1OUN A;  1VZZ A;  1JN5 A;  3I0Y A;  4J9A A;  3JUM A;  2I9W A;  4K1U A;  3FLJ A;  3FF2 A;  3EF8 A;  3EBT A;  4CDL A;  2RFR A;  2HML B;  1STD A;  5AI1 A;  1JKG B;  2Z76 A;  3RGR A;  3ER7 A;  5CLK A;  1DMQ A;  1HKX A;  3MKI A;  4PEJ A;  3EBY A;  3ROB A;  4WYK B;  3EJV A;  4HZB B;  2GBX B;  3SOA A;  3NV0 B;  3RGA A;  2BNG A;  3A76 A;  4HM4 B;  2B1X B;  1O7M B;  1TP6 A;  3FSD A;  4WP5 A;  1IDP A;  1O7W B;  3FZW A;  1TUH A;  1NDO B;  1OGZ A;  4HJL B;  3EHC A;  1OHS A;  3F40 A;  2F86 B;  3CNX A;  3M8C A;  3UJM A;  2XSH B;  3HX8 A;  5AIG A;  1QMA A;  3B4O A;  1O7N B;  3MG3 A;  5D81 A;  3NXJ A;  4HM0 B;  3D9R A;  1O7P B;  1U5O A;  5IER A;  3KE7 A;  3BLZ A;  1GY6 A;  1GY7 A;  4GB5 A;  3K0Z A;  3MG2 A;  2INX A;  5STD A;  5DRV A;  4XBY A;  1Z1S A;  5IG4 A;  2R4I A;  3KKG A;  3OWY A;  2F99 A;  3EC9 A;  3T8N A;  3Q90 A;  2RGQ A;  3F7X A;  5AII A;  1DMM A;  1JN5 B;  3MYT A;  4R9L A;  5CK6 A;  5D83 A;  5JPP A;  4IIA A;  3JUN A;  4LMI A;  3F7S A;  4XDW A;  4J8T A;  3NUV A;  3H3H A;  5KP4 A;  3NM2 A;  1E97 A;  3GZX B;  3OXA A;  5AEW B;  2YFJ B;  4L7K A;  2YFI B;  4L8O A;  3VSY A;  3MHE A;  3F8X A;  3EX9 A;  3LZA A;  1SJW A;  4RZM A;  4L8P A;  1GY5 A;  3B7C A;  2QIY A;  3CU3 A;  5IEO A;  3ECF A;  5TGN A;  3NHX A;  4I4K A;  2F98 A;  3F8H A;  2HMN B;  3IPT A;  3VGN A;  2GBW B;  1ISK A;  4XM4 A;  3JUQ A;  4X2O A;  2UX0 A;  2XSO B;  1NWW A;  2HMO B;  5JPU A;  2BMO B;  5KP1 A;  5EVH A;  3GZR A;  1BUQ A;  4OUQ A;  3G16 A;  2A15 A;  5IG0 A;  2K54 A;  2HMM B;  1CQS A;  5IG3 A;  1OGX A;  1OF5 A;  4XB5 A;  3HK4 A;  1W00 A;  4LGQ A;  1UUW B;  2CHC A;  4KVH A;  5KP3 A;  4HM2 B;  1EG9 B;  3B8L A;  1UUV B;  4FCM A;  1OHO A;  1O7H B;  3FH1 A;  4HVN A;  4OVM A;  2BMQ B;  4H3U A;  4HKV B;  3GWR A;  3CPO A;  2BMR B;  3JUO A;  2CKF B;  4Q53 A;  3MG1 A;  4X2H A;  3CNM A;  3WMD A; 
#chains in the Genus database with same CATH topology
 3NBR A;  7RNT A;  2KXG A;  1W6Y A;  4N3V A;  3DUK A;  4OK0 A;  4WWU C;  2IYJ A;  4DKI A;  1X1W A;  3GSP A;  1VQ6 3;  4HM5 B;  1GMP A;  1DET A;  1SIH A;  3JUP A;  3LXU X;  1ZO2 A;  3F9S A;  2CK3 H;  1RGG A;  2R41 A;  4I5Q A;  1BRJ A;  3DGO A;  4HM6 B;  2H0H A;  2WOF A;  4MMY B;  2CG1 A;  3LTD A;  1DYU A;  1HZ1 A;  1X1Y A;  2BT3 A;  1IT8 A;  3N9H A;  3LTC A;  1QAF A;  1Q9E A;  2P05 A;  3NBB A;  5HOH A;  1N5P A;  2IY2 A;  3HZP A;  1OH0 A;  4TX4 A;  5HGR A;  2IUK A;  3B4P A;  1EA2 A;  3H51 A;  1B2U A;  1C7H A;  1JNQ A;  1DMN A;  4FCZ A;  3G0K A;  5BXQ A;  1PU4 A;  1V58 A;  1K9M 4;  1UDI I;  1GOV A;  5IF6 A;  1LQG C;  1BIR A;  4XBT A;  4G1M B;  1I70 A;  4GHO A;  2ML5 A;  5CF2 A;  1KD1 4;  1E3R A;  1W6C A;  3EE1 A;  1Q40 A;  1AR0 A;  1JB2 A;  3SED A;  3PXM A;  4GSP A;  5D82 A;  1WTH A;  3I56 3;  1A67 A;  2B24 B;  4O02 B;  4RNT A;  4ORL A;  7STD A;  1NNV A;  3KFQ C;  3CCJ 3;  1FGM A;  3X3Z A;  1RRL A;  5RNT A;  1Y4K A;  2CG0 A;  1GOU A;  3CC2 3;  3EN1 B;  3NM7 A;  3S29 A;  2W56 B;  3QK9 A;  4R1K A;  2CFG A;  1E3V A;  1Q42 A;  2IA7 A;  1UI7 A;  1ZX2 A;  2H0I A;  5AEU B;  1S5A A;  1Q7Y 4;  1DE3 A;  1IT7 A;  1YVB I;  4R4K A;  1B3S A;  1TU5 A;  3G4S 3;  2Y73 A;  2STD A;  1UCI A;  3IJE B;  1LOV A;  1LVN A;  4J5G A;  1TFK A;  4LSO A;  1NU3 A;  1VQO 3;  1KC8 4;  3LTB A;  4CCV A;  4WFO A;  3JVC A;  3FG3 A;  3CCS 3;  1BSB A;  1UGI A;  1RGE A;  2OCT A;  2XRX B;  5G2G A;  3BB9 A;  3D4A A;  1TIJ A;  2RCD A;  3Q3F A;  1ULI B;  3SOY A;  2KAA A;  1F8N A;  1BRN L;  1BNF A;  5IG5 A;  1OF5 B;  1RGC A;  1RN7 A;  5IEN A;  2FNQ A;  3URP A;  3PCR A;  4KT3 B;  4QWT A;  1BGS A;  2AAE A;  8CHO A;  1STF I;  3CD6 3;  3LYG A;  3D79 A;  1FGQ A;  3NX0 A;  1B2M A;  3SXX A;  3CCL 3;  3T8U A;  1UI8 A;  2F5M A;  3OWS A;  1BNG A;  2W56 A;  3DM8 A;  3CCQ 3;  6STD A;  1VQ9 3;  1RCK A;  4MJD A;  1NO3 A;  2Z6B A;  2YX9 A;  3BU4 A;  2GU3 A;  2IMJ A;  5I97 A;  3E99 A;  1BRH A;  3WOF B;  3K5T A;  2PZV A;  5CXO A;  1OHP A;  4HBR A;  5AIH A;  1JKG A;  1YJ9 3;  4HM3 B;  1SPU A;  4FCJ A;  2GEX A;  4XBX A;  3SLU A;  3UNL A;  3K7C A;  5M18 A;  1RKY A;  1IVU A;  1MWR A;  3F14 A;  3KZT A;  4BU4 A;  2P09 A;  1VQ5 3;  4HM7 B;  3I55 3;  1GSP A;  3EN8 A;  2P0M A;  2PNC A;  3WR2 A;  1JV2 B;  4NRE A;  1ASK A;  1BRI A;  2XGN A;  1W01 A;  3GZY B;  1A2K A;  1BRK A;  1YVS A;  4WYK A;  1O7G B;  5DRE A;  4LEH A;  1IK3 A;  1RJO A;  1WQL B;  1YI2 3;  3DXO A;  3MPH A;  3U1W A;  1ULJ B;  2L4V A;  2KF6 A;  1W02 A;  1X1U A;  3S28 A;  5A0O B;  2XR8 B;  3V98 A;  6RNT A;  1K41 A;  2FGT A;  3AGN A;  4N6O B;  3DZL A;  1K73 4;  5JBS A;  3NV0 A;  4HM8 B;  1IU7 A;  1UCJ A;  4U13 A;  1CYV A;  2ZA4 A;  4N6M A;  1JB4 A;  3V92 A;  2CFD A;  3CXC 2;  1B2S A;  2H0G A;  1CH0 A;  4STD A;  2JQ5 A;  1GS3 A;  3ZG5 A;  5CF1 A;  2E2T A;  2CWT A;  3Q2P A;  3HIG A;  2WO0 A;  1IVV A;  1G02 A;  2L1S A;  1RN4 A;  4EYC A;  1UCK A;  1QVG 2;  4O3V A;  2HMJ B;  1AVL A;  2M7O A;  4R9K A;  5M1A A;  1LRA A;  4HZ9 B;  1L5G B;  2HMK B;  1VQM 3;  4HM1 B;  1GMR A;  1GMQ A;  2W2C A;  3OV4 A;  2UGI A;  3CCU 3;  2RBI A;  1RNT A;  2E2V A;  2K3D A;  3FGY A;  1Q40 B;  4O8S A;  3STD A;  5IEP A;  3G6E 3;  4CPK A;  5FW5 A;  3KSP A;  3MSO A;  5AIF A;  2GEY A;  3GRD A;  3S5C A;  3Q1C A;  2WGO A;  2Z7A A;  3BND A;  1Q81 4;  4EV5 A;  2QGU A;  2OTL 3;  2GXF A;  4ZM8 A;  2F5W A;  2C4B A;  3GZB A;  4IPB A;  1RGF A;  3DMC A;  4XDV A;  3CME 3;  1BAN A;  3OX9 A;  4K1V A;  1BVI A;  5IW9 A;  1W7C A;  1OCV A;  3EB8 A;  2W0Q A;  1SAR A;  3OWU A;  5FGO A;  4ILF A;  3S67 A;  3CCR 3;  1JB5 A;  1K28 A;  2XFT A;  3A5E A;  1WMP A;  2YFL B;  5BIR A;  1EQK A;  1FA3 A;  1EEJ A;  1AY7 A;  1LOX A;  2CFL A;  4RNZ A;  2CX0 A;  1GYB A;  2XEP A;  1YGE A;  3G8Z A;  1J2B A;  1FGO A;  4GL6 A;  5GSP A;  1N9J A;  2D42 A;  2MF7 A;  2AAD A;  3FF0 A;  2OWP A;  3KSE D;  5BVB A;  3EQQ B;  3NQY A;  2WOH A;  3WHO A;  3DGN A;  3FKA A;  1OPY A;  1QJG A;  2Z77 A;  2CFW A;  3RDE A;  1OAC A;  1B27 A;  1R4C A;  1T2I A;  3DY5 A;  2V1L A;  1NB3 I;  1V57 A;  3X41 A;  1N8R 4;  2CW9 A;  3CMA 3;  1OUN A;  1VZZ A;  1A2P A;  1PYL A;  1RHL A;  1JN5 A;  3I0Y A;  1IQ8 A;  4J9A A;  1WMO A;  3JUM A;  3S27 A;  2W9Q A;  1RRH A;  4MMX B;  1TJD A;  2I9W A;  4K1U A;  1JJ2 2;  1R4Y A;  3FLJ A;  3K9M C;  1W5Z A;  1I8V A;  3FF2 A;  2P38 A;  3EF8 A;  3EBT A;  7GSP A;  1N9E A;  2W6J H;  4AKY A;  4CDL A;  2CWV A;  1LOW A;  3BNC A;  2OQE A;  1V74 A;  1US1 A;  2RFR A;  1EKM A;  2HML B;  3PS8 A;  1JZD A;  1STD A;  1BRS A;  5AI1 A;  4EV2 A;  1JKG B;  2GSP A;  1MWU A;  2KF5 A;  2Z76 A;  1LQM B;  3RGR A;  3ER7 A;  1MNL A;  5CLK A;  1BRG A;  1DMQ A;  1HKX A;  1MWT A;  3CPW 2;  3MKI A;  1JBR A;  2BO9 B;  2E2U A;  4PEJ A;  3EBY A;  2CH9 A;  1CEW I;  2D1W A;  3ROB A;  3AMO A;  4WYK B;  1YIT 3;  3EJV A;  4N6U A;  3RNT A;  2KF4 A;  1IVW A;  4IT7 A;  1K8A 4;  4HZB B;  1RDS A;  2CWU A;  2GBX B;  5G1L A;  3SOA A;  1FYS A;  3X3X A;  3LT9 A;  1B2X A;  1ROV A;  1WNH A;  3NV0 B;  3RGA A;  3WDG B;  2BNG A;  1CYU A;  1BSD A;  1S72 3;  1MGR A;  3AGO A;  3DGY A;  3LT8 A;  3WA2 X;  3A76 A;  2K0M A;  3PCS A;  2B1X B;  4HM4 B;  1O7M B;  1TP6 A;  4EC6 A;  1YJN 3;  2W04 A;  1RGH A;  3FSD A;  4WP5 A;  3X40 A;  2FXT A;  3QRD A;  1IDP A;  3HII A;  4FMB A;  1O7W B;  1QVF 2;  2HOH A;  2CX1 A;  3FZW A;  4AKZ A;  1TUH A;  1D6Z A;  1NDO B;  5AYR B;  4K90 B;  4O2H A;  1JBT A;  1BNI A;  1BNR A;  1OGZ A;  1C54 A;  4HJL B;  2W9P A;  3EHC A;  1OHS A;  1FW7 A;  2RNT A;  3F40 A;  2F86 B;  4N6N B;  3BNB A;  4KFF A;  5EQL A;  1IQY A;  1TRQ A;  4LYL B;  1BSE A;  1QAK A;  1I2G A;  2KCD A;  3UL6 A;  3CNX A;  3M8C A;  1T3B A;  2C10 A;  3UJM A;  2XSH B;  3HX8 A;  4BTX A;  1VQK 3;  3L0R A;  5AIG A;  1UUG B;  3CCM 3;  2BU4 A;  1QMA A;  3ZFZ A;  3B4O A;  2IUJ A;  1BUJ A;  1B21 A;  1O7N B;  2QA4 3;  3X3Y A;  3LH4 A;  3MG3 A;  5D81 A;  1WMN A;  1YIJ 3;  1DVC A;  3NXJ A;  3UB1 A;  4HM0 B;  3D9R A;  1IV7 A;  1HYF A;  1O7P B;  1TRP A;  3BIR A;  1FZU A;  1U5O A;  3D5G A;  5AYS C;  5IER A;  3KE7 A;  5ELJ A;  1B20 A;  3BLZ A;  1GY6 A;  3D3L A;  4BIR A;  1GY7 A;  4FMD A;  4GB5 A;  4MMZ B;  1I2F A;  1TTO A;  3K0Z A;  3MG2 A;  2INX A;  2P0X A;  3CCE 3;  1M90 4;  5STD A;  4FMA A;  1M1K 4;  2W03 A;  2XGL A;  1VQN 3;  1VQL 3;  5DRV A;  3N54 B;  4XBY A;  1Z1S A;  4JRF A;  3N8B A;  1QAL A;  5LC7 A;  3ALA A;  5IG4 A;  2R4I A;  2QEX 3;  3OW2 2;  2ZHX B;  3WOD G;  3KKG A;  1W2B 2;  2KRT A;  3OWY A;  1D6Y A;  1SII A;  1MWS A;  1T2H A;  2F99 A;  1LNI A;  3EC9 A;  3KN4 A;  3T8N A;  1KQS 2;  3Q90 A;  2RGQ A;  3F7X A;  1NB5 I;  5AII A;  2BHM A;  1DMM A;  2RSX A;  1LOY A;  1JN5 B;  3MYT A;  4HYZ A;  4R9L A;  5CK6 A;  2O3O A;  4J5K A;  5D83 A;  5JPP A;  1W2Z A;  1RCL A;  1U8C B;  1Q86 4;  4H61 A;  4IIA A;  1Q7H A;  3JUN A;  1D6U A;  4LMI A;  1RGK A;  3F7S A;  4XDW A;  1Q82 4;  4J8T A;  3NUV A;  4HOH A;  4NHF A;  3H3H A;  3SYU A;  5G1K A;  5KP4 A;  1UW1 A;  1B2Z A;  3NM2 A;  2C11 A;  4JF8 A;  3FG1 A;  1LXE A;  1KWI A;  1E97 A;  1RGA A;  3AHW A;  3GZX B;  4BTW A;  3LOY A;  5LC6 A;  4CJN A;  2OTJ 3;  3OXA A;  4KFE A;  1RNB A;  5AEW B;  3DH2 A;  2O9U X;  2YFJ B;  4L7K A;  3AHS A;  1I0V A;  3AMO B;  2YFI B;  3ZG0 A;  1X1X A;  4L8O A;  3VSY A;  1A90 A;  3MHE A;  3NBJ A;  2ML6 A;  4MEI A;  3F8X A;  4NPB A;  3EX9 A;  3LZA A;  1VQ4 3;  2CC3 A;  5EEO A;  9RNT A;  3HOH A;  1SJW A;  4RZM A;  2SBL A;  4L8P A;  1TFO A;  1RSN A;  1NJI 4;  1GY5 A;  2J8X B;  3DGM A;  3B7C A;  3NQZ A;  2QIY A;  1VQQ A;  4R80 A;  2GU1 A;  1YHQ 3;  2Y74 A;  1JBS A;  3CU3 A;  2OQE C;  2UUG C;  1GOY A;  1FUT A;  5IEO A;  4EW5 A;  4N6L A;  1FUS A;  3ECF A;  5TGN A;  3UL5 A;  3NHX A;  1A2V A;  4I4K A;  3SX1 A;  2Q07 A;  8RNT A;  1IYY A;  1RN1 A;  1FUW A;  1W4N A;  3D5I A;  2F98 A;  3F8H A;  6GSP A;  2ZL8 A;  2HMN B;  1EUI C;  1T5Y A;  1IVX A;  3IPT A;  3PYJ A;  2CFK A;  2LYX A;  3VGN A;  2GBW B;  1ISK A;  4XM4 A;  3JUQ A;  1ROA A;  4X2O A;  1BSA A;  1RTU A;  2UX0 A;  1RLS A;  1VQP 3;  2XSO B;  1PFP A;  1IV9 A;  1BNJ A;  1I2E A;  1YJW 3;  3PGB A;  1BAO A;  1BU4 A;  1VQ8 3;  1NWW A;  1G96 A;  2F4Y A;  2HMO B;  5JPU A;  5M19 A;  3CC4 3;  4BL2 A;  1RGL A;  2MC8 A;  2BMO B;  1AV4 A;  3U97 A;  1JZO A;  5KP1 A;  1N5H A;  5EVH A;  3GZR A;  1MOL A;  1YGW A;  3DGL A;  1HU9 A;  2BIR A;  3HI7 A;  3K63 A;  3G71 3;  3CC7 3;  1BUQ A;  1IQX A;  1GD3 A;  4RBN A;  4BL3 A;  2LQV A;  4K61 A;  1ZS7 A;  1SQW A;  2XH9 A;  3G16 A;  3FCS B;  4OUQ A;  1AQZ A;  2A15 A;  1AVK A;  3WOE B;  4AEQ A;  2SAR A;  4RNY A;  3SVA A;  3CCV 3;  5IG0 A;  1N8Q A;  2K54 A;  1I3I A;  1KSI A;  3KII A;  3WA3 A;  2HMM B;  2KF3 A;  1FGR A;  4EXR A;  1BSC A;  1CQS A;  1BNS A;  3LTA A;  1LNH A;  5IG3 A;  3KCH A;  1OGX A;  5ELU A;  4FMC A;  2OOV A;  2F56 A;  1OF5 A;  4XB5 A;  3HK4 A;  1W00 A;  2OOV C;  2CIU A;  4KFD A;  4LGQ A;  1UUW B;  2CHC A;  1G0T A;  1I3F A;  4KVH A;  5KP3 A;  5BU4 A;  3O8Y A;  1VQ7 3;  1GD4 A;  2XF3 A;  2JDI H;  4FR9 A;  4HM2 B;  1EG9 B;  1BOX A;  3B8L A;  1UUV B;  4BTY A;  1PY3 A;  4FCM A;  2ZDJ A;  4N6T A;  1JRQ A;  1DVD A;  4HAA A;  1M1X B;  1YNV X;  3VF1 A;  1OHO A;  1RMS A;  1O7H B;  3FH1 A;  4HVN A;  1I0X A;  1FGT A;  4OVM A;  4LZI A;  4WHA A;  2WGQ A;  1UCL A;  2BMQ B;  3IMA B;  4H3U A;  4HKV B;  3V99 A;  4KZ1 A;  3X42 A;  3FG4 A;  1MGW A;  3GWR A;  3BNE A;  3CPO A;  1M9G A;  3LML A;  2BMR B;  4EBG A;  3T0U A;  3JUO A;  2CKF B;  3GAX A;  1UGH I;  4Q53 A;  1BNE A;  3MG1 A;  4X2H A;  4N6V 0;  3PZW A;  3TDG A;  1ZGX A;  3MWZ A;  2XFS A;  3CNM A;  1W6G A;  3J7Y d;  3WMD A; 
#chains in the Genus database with same CATH homology
 3NBR A;  2KXG A;  1W6Y A;  4N3V A;  3DUK A;  4OK0 A;  4WWU C;  1VQ6 3;  4HM5 B;  3JUP A;  1SIH A;  3LXU X;  1ZO2 A;  3F9S A;  2CK3 H;  3DGO A;  4HM6 B;  4MMY B;  2WOF A;  2CG1 A;  3LTD A;  1DYU A;  2BT3 A;  1IT8 A;  3N9H A;  3LTC A;  1QAF A;  2P05 A;  3NBB A;  1N5P A;  3HZP A;  1OH0 A;  4TX4 A;  5HGR A;  2IUK A;  3B4P A;  1EA2 A;  3H51 A;  1JNQ A;  1C7H A;  1DMN A;  4FCZ A;  3G0K A;  5BXQ A;  1PU4 A;  1K9M 4;  5IF6 A;  4XBT A;  4G1M B;  2ML5 A;  5CF2 A;  1KD1 4;  1E3R A;  1W6C A;  3EE1 A;  1Q40 A;  1AR0 A;  1JB2 A;  3SED A;  3PXM A;  5D82 A;  3I56 3;  1WTH A;  1A67 A;  2B24 B;  4O02 B;  4ORL A;  7STD A;  3KFQ C;  3CCJ 3;  1FGM A;  3X3Z A;  1RRL A;  1Y4K A;  2CG0 A;  3CC2 3;  3EN1 B;  3NM7 A;  3S29 A;  2W56 B;  3QK9 A;  4R1K A;  2CFG A;  1E3V A;  1Q42 A;  2IA7 A;  1UI7 A;  1ZX2 A;  5AEU B;  1Q7Y 4;  1S5A A;  1IT7 A;  1YVB I;  4R4K A;  1TU5 A;  3G4S 3;  2Y73 A;  2STD A;  3IJE B;  1VQO 3;  1LVN A;  4LSO A;  1TFK A;  1NU3 A;  1KC8 4;  3LTB A;  4CCV A;  4WFO A;  3JVC A;  3FG3 A;  3CCS 3;  2OCT A;  2XRX B;  5G2G A;  3BB9 A;  1TIJ A;  2RCD A;  3SOY A;  1ULI B;  1F8N A;  5IG5 A;  1OF5 B;  1RN7 A;  5IEN A;  2FNQ A;  3PCR A;  4QWT A;  8CHO A;  1STF I;  3CD6 3;  3LYG A;  1FGQ A;  3NX0 A;  3SXX A;  3CCL 3;  3T8U A;  1UI8 A;  3OWS A;  2W56 A;  3DM8 A;  3CCQ 3;  6STD A;  1VQ9 3;  4MJD A;  1NO3 A;  2Z6B A;  2YX9 A;  2GU3 A;  2IMJ A;  5I97 A;  3E99 A;  3WOF B;  3K5T A;  2PZV A;  5CXO A;  1OHP A;  4HBR A;  5AIH A;  1JKG A;  1YJ9 3;  4HM3 B;  1SPU A;  4FCJ A;  2GEX A;  4XBX A;  3SLU A;  3UNL A;  3K7C A;  1RKY A;  1IVU A;  1VQ5 3;  3F14 A;  3KZT A;  2P09 A;  4HM7 B;  3I55 3;  3EN8 A;  2P0M A;  2PNC A;  1JV2 B;  4NRE A;  1ASK A;  2XGN A;  1W01 A;  3GZY B;  1A2K A;  4WYK A;  1O7G B;  5DRE A;  4LEH A;  1IK3 A;  1RJO A;  1WQL B;  1YI2 3;  3DXO A;  3MPH A;  3U1W A;  1ULJ B;  2L4V A;  5A0O B;  1W02 A;  3S28 A;  2XR8 B;  3V98 A;  1K41 A;  2FGT A;  4N6O B;  1K73 4;  3DZL A;  5JBS A;  3NV0 A;  4HM8 B;  1IU7 A;  4U13 A;  1CYV A;  4N6M A;  1JB4 A;  3V92 A;  2CFD A;  3CXC 2;  4STD A;  2JQ5 A;  1GS3 A;  5CF1 A;  2E2T A;  2CWT A;  3Q2P A;  3HIG A;  2WO0 A;  1IVV A;  4EYC A;  1QVG 2;  4O3V A;  2HMJ B;  1AVL A;  2M7O A;  4R9K A;  1L5G B;  4HZ9 B;  2HMK B;  1VQM 3;  4HM1 B;  2W2C A;  3OV4 A;  3CCU 3;  2E2V A;  3FGY A;  5IEP A;  1Q40 B;  4O8S A;  3STD A;  3G6E 3;  5FW5 A;  3KSP A;  3MSO A;  5AIF A;  2GEY A;  3GRD A;  3S5C A;  3Q1C A;  2WGO A;  2Z7A A;  3BND A;  1Q81 4;  4EV5 A;  2QGU A;  2OTL 3;  2GXF A;  4ZM8 A;  3GZB A;  4IPB A;  3DMC A;  4XDV A;  3CME 3;  3OX9 A;  4K1V A;  5IW9 A;  1W7C A;  1OCV A;  3EB8 A;  2W0Q A;  3OWU A;  5FGO A;  3S67 A;  3CCR 3;  1JB5 A;  1K28 A;  2XFT A;  1EQK A;  1WMP A;  2YFL B;  1FA3 A;  1LOX A;  2CFL A;  4RNZ A;  1GYB A;  2XEP A;  1YGE A;  3G8Z A;  1J2B A;  1FGO A;  4GL6 A;  1N9J A;  2D42 A;  2MF7 A;  3FF0 A;  3KSE D;  2OWP A;  5BVB A;  3EQQ B;  3NQY A;  2WOH A;  3DGN A;  3FKA A;  1OPY A;  1QJG A;  2Z77 A;  2CFW A;  3RDE A;  1OAC A;  1R4C A;  3DY5 A;  2V1L A;  1NB3 I;  3X41 A;  1N8R 4;  2CW9 A;  3CMA 3;  1OUN A;  1VZZ A;  1JN5 A;  3I0Y A;  1IQ8 A;  4J9A A;  1WMO A;  3JUM A;  3S27 A;  2W9Q A;  1RRH A;  4MMX B;  2I9W A;  4K1U A;  1JJ2 2;  3FLJ A;  3K9M C;  1W5Z A;  3FF2 A;  2P38 A;  3EF8 A;  3EBT A;  1N9E A;  2W6J H;  4AKY A;  4CDL A;  2CWV A;  3BNC A;  2OQE A;  1V74 A;  1US1 A;  2RFR A;  1EKM A;  2HML B;  3PS8 A;  1STD A;  5AI1 A;  4EV2 A;  1JKG B;  2Z76 A;  3RGR A;  3ER7 A;  1MNL A;  5CLK A;  1DMQ A;  1HKX A;  3CPW 2;  3MKI A;  2BO9 B;  2E2U A;  4PEJ A;  3EBY A;  2CH9 A;  1CEW I;  2D1W A;  3ROB A;  3AMO A;  4WYK B;  1YIT 3;  3EJV A;  4N6U A;  1IVW A;  4IT7 A;  1K8A 4;  4HZB B;  2GBX B;  2CWU A;  3SOA A;  3X3X A;  3LT9 A;  1ROV A;  1WNH A;  3NV0 B;  3RGA A;  3WDG B;  2BNG A;  1CYU A;  1S72 3;  3LT8 A;  3WA2 X;  4EC6 A;  3A76 A;  2K0M A;  3PCS A;  2B1X B;  4HM4 B;  1O7M B;  1TP6 A;  1YJN 3;  2W04 A;  3FSD A;  4WP5 A;  3X40 A;  2FXT A;  3QRD A;  1IDP A;  3HII A;  4FMB A;  1O7W B;  1QVF 2;  4AKZ A;  3FZW A;  1TUH A;  1D6Z A;  1NDO B;  5AYR B;  4K90 B;  4O2H A;  1OGZ A;  4HJL B;  2W9P A;  3EHC A;  1OHS A;  3F40 A;  2F86 B;  4N6N B;  3BNB A;  4KFF A;  5EQL A;  1IQY A;  1QAK A;  2KCD A;  3UL6 A;  3CNX A;  3M8C A;  3UJM A;  2C10 A;  2XSH B;  3HX8 A;  4BTX A;  1VQK 3;  3L0R A;  5AIG A;  3CCM 3;  1QMA A;  3B4O A;  2IUJ A;  1O7N B;  2QA4 3;  3X3Y A;  3LH4 A;  3MG3 A;  5D81 A;  1WMN A;  1YIJ 3;  1DVC A;  3NXJ A;  3UB1 A;  4HM0 B;  3D9R A;  1IV7 A;  1O7P B;  1U5O A;  5AYS C;  5IER A;  3KE7 A;  5ELJ A;  3BLZ A;  1GY6 A;  3D3L A;  1GY7 A;  4FMD A;  4GB5 A;  4MMZ B;  3K0Z A;  3MG2 A;  2INX A;  2P0X A;  3CCE 3;  1M90 4;  5STD A;  4FMA A;  1M1K 4;  2W03 A;  2XGL A;  1VQN 3;  1VQL 3;  5DRV A;  3N54 B;  4XBY A;  1Z1S A;  4JRF A;  3N8B A;  1QAL A;  5LC7 A;  3ALA A;  5IG4 A;  2R4I A;  2QEX 3;  3OW2 2;  3WOD G;  3KKG A;  1W2B 2;  2KRT A;  3OWY A;  1D6Y A;  1SII A;  2F99 A;  3EC9 A;  1KQS 2;  3KN4 A;  3T8N A;  3Q90 A;  2RGQ A;  3F7X A;  1NB5 I;  5AII A;  2BHM A;  1DMM A;  2RSX A;  1JN5 B;  3MYT A;  4HYZ A;  4R9L A;  5CK6 A;  2O3O A;  5D83 A;  5JPP A;  1W2Z A;  1U8C B;  1Q86 4;  4H61 A;  4IIA A;  3JUN A;  1D6U A;  4LMI A;  3F7S A;  4XDW A;  1Q82 4;  4J8T A;  3NUV A;  4NHF A;  3H3H A;  5KP4 A;  1UW1 A;  3NM2 A;  2C11 A;  4JF8 A;  3FG1 A;  1LXE A;  1KWI A;  1E97 A;  3GZX B;  4BTW A;  3LOY A;  5LC6 A;  2OTJ 3;  3OXA A;  4KFE A;  5AEW B;  2O9U X;  2YFJ B;  4L7K A;  3AMO B;  2YFI B;  1A90 A;  4L8O A;  3VSY A;  3MHE A;  3NBJ A;  2ML6 A;  4MEI A;  3F8X A;  3EX9 A;  3LZA A;  1VQ4 3;  2CC3 A;  5EEO A;  1SJW A;  4RZM A;  2SBL A;  4L8P A;  1TFO A;  1NJI 4;  1GY5 A;  3DGM A;  3B7C A;  3NQZ A;  2QIY A;  4R80 A;  2GU1 A;  1YHQ 3;  2Y74 A;  3CU3 A;  2OQE C;  5IEO A;  4N6L A;  3ECF A;  5TGN A;  3UL5 A;  3NHX A;  1A2V A;  4I4K A;  3SX1 A;  2Q07 A;  1FUW A;  1W4N A;  2F98 A;  3F8H A;  2ZL8 A;  2HMN B;  1T5Y A;  3PYJ A;  1IVX A;  3IPT A;  2CFK A;  2LYX A;  3VGN A;  2GBW B;  1ISK A;  4XM4 A;  3JUQ A;  1ROA A;  4X2O A;  2UX0 A;  1VQP 3;  2XSO B;  1PFP A;  1IV9 A;  1YJW 3;  3PGB A;  1VQ8 3;  1NWW A;  1G96 A;  2HMO B;  5JPU A;  3CC4 3;  2MC8 A;  2BMO B;  1AV4 A;  3U97 A;  5KP1 A;  1N5H A;  5EVH A;  3GZR A;  1MOL A;  3DGL A;  1HU9 A;  3HI7 A;  3K63 A;  3G71 3;  3CC7 3;  1BUQ A;  1IQX A;  1GD3 A;  4RBN A;  2LQV A;  4K61 A;  1SQW A;  2XH9 A;  3G16 A;  3FCS B;  4OUQ A;  2A15 A;  1AVK A;  3WOE B;  4AEQ A;  3SVA A;  4RNY A;  3CCV 3;  5IG0 A;  1N8Q A;  2K54 A;  3KII A;  1KSI A;  3WA3 A;  2HMM B;  1FGR A;  4EXR A;  1CQS A;  3LTA A;  1LNH A;  5IG3 A;  1OGX A;  5ELU A;  4FMC A;  2OOV A;  1OF5 A;  4XB5 A;  3HK4 A;  1W00 A;  2OOV C;  2CIU A;  4KFD A;  4LGQ A;  1UUW B;  2CHC A;  4KVH A;  5KP3 A;  1VQ7 3;  3O8Y A;  1GD4 A;  2XF3 A;  2JDI H;  4FR9 A;  4HM2 B;  1EG9 B;  3B8L A;  1UUV B;  4BTY A;  4FCM A;  4N6T A;  2ZDJ A;  1DVD A;  1JRQ A;  1M1X B;  3VF1 A;  1OHO A;  1O7H B;  3FH1 A;  4HVN A;  4OVM A;  1FGT A;  4LZI A;  4WHA A;  2WGQ A;  2BMQ B;  3IMA B;  4H3U A;  4HKV B;  3V99 A;  4KZ1 A;  3X42 A;  3FG4 A;  3GWR A;  3BNE A;  3CPO A;  1M9G A;  3LML A;  2BMR B;  4EBG A;  3T0U A;  3JUO A;  2CKF B;  3GAX A;  4Q53 A;  3MG1 A;  4X2H A;  4N6V 0;  3PZW A;  3TDG A;  3MWZ A;  2XFS A;  3CNM A;  1W6G A;  3J7Y d;  3WMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...