1E3RA

Crystal structure of ketosteroid isomerase mutant d40n (d38n ti numbering) from pseudomonas putida complexed with androsten-3beta-ol-17-one
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords ISOMERASE
publication title Detection of Large Pka Perturbations of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
total genus 33
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1e3rA00
4L8OA 3EN1B 1SJWA 1W00A 3F8HA 5EVHA 3B4PA 3NV0A 3G0KA 4J9AA 1OGZA 3NXJA 1GS3A 3GZRA 3EHCA 4OVMA 4HM4B 4HM2B 3NUVA 2JQ5A 1DMNA 2YFJB 2XRXB 1ZO2A 3MYTA 2CKFB 1NDOB 4Q53A 1QMAA 3I0YA 4HJLB 5DREA 3UJMA 1JN5B 5IERA 3ER7A 1ISKA 1JKGA 4HKVB 3DUKA 2XSHB 3F8XA 5JPUA 3KZTA 1W01A 5IEOA 3GZBA 4U13A 3KKGA 1OPYA 2YFIB 2BMOB 3CU3A 4X2OA 4HM0B 1OF5B 1BUQA 2GBXB 3UNLA 1DMMA 3EBTA 4L8PA 5IG5A 3OXAA 2XSOB 6STDA 5IG4A 2BNGA 3EBYA 4HM5B 3JUNA 1WQLB 3S5CA 5CF2A 1JN5A 5AIHA 2INXA 1DMQA 3SOYA 3F7SA 3OWSA 4RZMA 3D9RA 5IG0A 3B7CA 5AIFA 1OHSA 3JUOA 4XDWA 3DM8A 4XBXA 3DXOA 4XB5A 2BMRB 1JKGB 3FF0A 3IPTA 4HZ9B 1OF5A 5IG3A 4XBTA 1E97A 1O7PB 3RGRA 2F86B 3WMDA 5IF6A 5KP3A 5CXOA 2GBWB 5CK6A 5AIGA 4R9KA 3CNXA 3LZAA 4K1VA 3CPOA 4OUQA 1GY5A 5KP4A 1S5AA 1OH0A 1OCVA 3H3HA 1JB5A 2RCDA 2IMJA 1Q42A 3G16A 2GEXA 1GY6A 4FCJA 4XBYA 3FLJA 2RFRA 3F14A 3SOAA 5CF1A 4LGQA 4HZBB 3EC9A 3BLZA 5JPPA 2R4IA 2GXFA 4MJDA 2Z76A 3KE7A 1CQSA 1JB2A 1TUHA 2RGQA 4FCMA 4IIAA 3K7CA 3F9SA 3F40A 1K41A 3DMCA 3EF8A 1OHPA 4XM4A 4H3UA 4R1KA 1NWWA 1TP6A 3FF2A 3ROBA 1STDA 3FGYA 2Z7AA 2STDA 3OX9A 3EJVA 1ASKA 5AEWB 1Q40A 3OWUA 1ULJB 3K0ZA 4HM6B 3NHXA 3VGNA 2BMQB 1ULIB 4WWUC 5IENA 5KP1A 1C7HA 2Z77A 4LEHA 2QIYA 1VZZA 1O7GB 3ECFA 3HK4A 3T8NA 2OWPA 4R9LA 3JUPA 1OUNA 3VSYA 1OHOA 3EQQB 2UX0A 5IEPA 2QGUA 3NM2A 2K54A 2GEYA 1O7HB 3RGAA 1JB4A 4CDLA 2XR8B 3F7XA 3FH1A 1E3VA 1Z1SA 3B4OA 3GZXB 2I9WA 3FKAA 4HM8B 2CHCA 1EA2A 3Q90A 3KSPA 2B1XB 5FW5A 1UUWB 4I4KA 5D81A 2A15A 1O7MB 3CNMA 2HMMB 1W02A 3HX8A 2B24B 4J8TA 3GRDA 3H51A 5TGNA 1Q40B 3BB9A 4WYKB 2HMNB 2HMLB 3JUQA 1GYBA 1EG9B 4HM1B 1W6YA 3SEDA 4KVHA 4K1UA 3T8UA 3E99A 4HM3B 3JUMA 3LYGA 3GWRA 5AEUB 2YFLB 4STDA 4WP5A 3OV4A 2HMJB 5D83A 4GB5A 5D82A 3FSDA 2W2CA 1GY7A 2HMOB 5HGRA 3EN8A 4ORLA 5STDA 3MG3A 4HM7B 5BXQA 5CLKA 1AR0A 1QJGA 5AIIA 1A2KA 1O7WB 4PEJA 3MKIA 8CHOA 5DRVA 1HKXA 1NU3A 5G2GA 1ZX2A 2PZVA 3NV0B 7STDA 3NBRA 3MG1A 4N3VA 2HMKB 4HVNA 4WYKA 4XDVA 3EX9A 5BVBA 3G8ZA 1E3RA 3B8LA 2F98A 3MSOA 3MG2A 3OWYA 1IDPA 3FZWA 2F99A 3HZPA 4X2HA 3DZLA 4L7KA 1UUVB 3MHEA 5AI1A 1OGXA 4LMIA 1O7NB 3STDA 1U5OA 3M8CA 3GZYB 3A76A
chains in the Genus database with same CATH superfamily
4L8OA 1IVVA 3EN1B 1SJWA 1W00A 3F8HA 4CJNA 5GSPA 3HOHA 2OQEC 2C10A 1PY3A 5EVHA 3SX1A 2CX0A 2OQEA 3B4PA 3FG1A 1LOXA 3NV0A 1I2EA 3G0KA 4JF8A 1DE3A 4BTWA 1Q7HA 4H61A 3IMAB 2CG1A 1BVIA 2GSPA 5LC6A 3U97A 1I2GA 4J9AA 1IV9A 4TX4A 1B2SA 2P05A 2W9QA 2QEX3 4K61A 1OGZA 3NXJA 2F56A 1GS3A 3GZRA 7GSPA 1LOYA 3BNEA 3CCS3 3EHCA 1DETA 4OVMA 1KD14 4HM4B 1DYUA 4HM2B 1QVF2 4FCZA 4EBGA 3NUVA 1BSEA 2JQ5A 1DMNA 2YFJB 2YX9A 2ZDJA 2IUJA 3UL6A 3WOEB 2BT3A 1TFKA 3JVCA 3G713 2OTL3 2XRXB 4O3VA 2QA43 1I8VA 1SIHA 1ZO2A 2CH9A 3RDEA 1GOVA 4ILFA 3CXC2 3DGYA 5FGOA 1LQMB 1N5HA 2CX1A 3MYTA 2W56B 2CKFB 2J8XB 1NDOB 4Q53A 3NBJA 1KWIA 5RNTA 1QMAA 1RN7A 3I0YA 2XGNA 4HJLB 1RN1A 1JNQA 5DREA 1SARA 1FGRA 2KF4A 4N6TA 3UJMA 3ZFZA 1JN5B 1IV7A 5IERA 2M7OA 3ER7A 1BRSA 2CW9A 3X40A 1ISKA 1JKGA 4HKVB 3DUKA 1BRHA 1YHQ3 3GSPA 1TRQA 4BL2A 2XSHB 3PCSA 3Q3FA 3F8XA 1RMSA 3WOFB 1UCLA 5JPUA 1JRQA 2E2TA 3AHSA 3KZTA 3U1WA 1BANA 3BNDA 1VQN3 1BIRA 1BAOA 1W01A 1VQ63 2KF3A 2W6JH 4N6OB 2AADA 3UL5A 2C4BA 4RBNA 5IEOA 2ZL8A 3S27A 1WMPA 3GZBA 3ZG5A 4EXRA 4U13A 4FMDA 2BO9B 1BNIA 1I3FA 3AMOB 3D5GA 3UB1A 2WOHA 3KKGA 1IQYA 1OPYA 3DH2A 1NO3A 2YFIB 4EW5A 2BMOB 1CEWI 3CU3A 3QRDA 1NB3I 4X2OA 4HM0B 3S29A 3CC43 1OF5B 2WO0A 2WOFA 1BUQA 1ZS7A 2MF7A 3KFQC 2CWUA 3IJEB 1YIJ3 1Q824 2GBXB 3UNLA 1US1A 1D6YA 1DMMA 3EBTA 1ROVA 2CK3H 1GMRA 2GU3A 2LQVA 2IA7A 5AYSC 2KCDA 4L8PA 1B2XA 4N6NB 5IG5A 1W5ZA 3OXAA 2XSOB 3PZWA 6STDA 1G02A 2BNGA 2ML6A 3NQYA 4MEIA 2W56A 3EBYA 5IG4A 1UGHI 1M904 1BNFA 3NX0A 4HM5B 1STFI 1BRNL 3FG4A 1RGEA 2LYXA 1W2B2 2WGQA 1T2HA 1I2FA 1R4CA 5M1AA 3JUNA 1WQLB 3S5CA 5CF2A 1JN5A 1V74A 5AIHA 2OTJ3 1VQ43 2INXA 1ZGXA 1DMQA 4FR9A 3TDGA 2D42A 1W6CA 3LTCA 1I0XA 3SOYA 3CC73 3F7SA 4WHAA 2RBIA 3OWSA 2FGTA 1G0TA 2OOVA 2HOHA 4DKIA 4JRFA 1BSDA 2F5MA 1BSAA 4RZMA 5A0OB 3N8BA 1TJDA 3D9RA 1PU4A 3BIRA 2XFSA 5IG0A 3B7CA 5AIFA 1OHSA 3JUOA 4XDWA 3DM8A 4XBXA 1LNIA 1RJOA 3LT8A 3DXOA 3AMOA 1LRAA 3NBBA 3WODG 1RSNA 2BMRB 1V58A 4XB5A 1JKGB 1LOVA 4AKYA 1U8CB 3EE1A 3FF0A 1TIJA 1GOUA 3IPTA 1BRKA 4LZIA 2CC3A 3PYJA 4HZ9B 1CYUA 1FGTA 1RKYA 3CME3 1UCIA 1OF5A 1JV2B 5IG3A 3DGLA 3WA2X 3PCRA 1YI23 3LT9A 1BGSA 4NPBA 3D79A 4XBTA 1A90A 2BU4A 3CCE3 2KAAA 1LVNA 1K9M4 1E97A 3PS8A 2WGOA 1O7PB 3RGRA 2F86B 3WMDA 3BNBA 4R80A 1GMPA 1BOXA 5IF6A 1QVG2 2ZHXB 4CPKA 1GD4A 5KP3A 4LSOA 1I70A 3D5IA 5CXOA 1JBRA 1AV4A 2JDIH 1MNLA 3DGMA 1B20A 2GBWB 1K28A 1RCKA 2H0GA 2SBLA 2XH9A 4J5KA 3G6E3 1JZOA 1AVLA 1F8NA 5G1KA 1LQGC 5CK6A 1CYVA 4R9KA 3CNXA 5AIGA 1RNTA 2C11A 3LZAA 4K1VA 1YVSA 3CPOA 4EV5A 3LOYA 2ML5A 2Q07A 4FMCA 4N6UA 4O8SA 3T0UA 4OUQA 1GY5A 3CCJ3 2P38A 5KP4A 1SIIA 1KSIA 1J2BA 1WNHA 1S5AA 1OH0A 2UUGC 2KF6A 1OCVA 2MC8A 2GU1A 3H3HA 1VQO3 2H0IA 5M18A 2IYJA 1JB5A 2RCDA 2IMJA 1VQ73 5AYRB 2W9PA 3GAXA 2K0MA 1N9JA 1RLSA 4GL6A 1VQK3 1GD3A 2O9UX 1Q42A 3G16A 3X3ZA 1Q9EA 2GEXA 9RNTA 1GY6A 4FCJA 1K8A4 2FNQA 3S28A 3D3LA 4XBYA 3HI7A 3FLJA 1VQP3 2RFRA 1CH0A 1Q864 1RGAA 3HIGA 1FW7A 3LMLA 3F14A 4KFEA 3SOAA 1ROAA 4LGQA 5CF1A 1M1K4 3CCV3 1BNGA 1AQZA 3LTBA 3CCQ3 2IUKA 3LTDA 3EC9A 4HZBB 3BLZA 4HBRA 5JPPA 2RNTA 2UGIA 2R4IA 1C54A 2GXFA 2CFLA 3FCSB 1BRIA 4MJDA 4WFOA 2Z76A 7RNTA 2CWTA 3O8YA 3KE7A 4O02B 3CPW2 1CQSA 1JB2A 1DVDA 1TUHA 3WDGB 2RGQA 1IYYA 4FCMA 4IIAA 1FGQA 3KN4A 4AKZA 3K7CA 1YVBI 1IVXA 1BNEA 3F9SA 3LXUX 5HOHA 3F40A 1BNRA 4MMZB 3RNTA 1UDII 1X1XA 1EQKA 1N9EA 1HYFA 3NQZA 3URPA 1K41A 2AAEA 1VQL3 1B2ZA 1OACA 2D1WA 3DMCA 1GOYA 1T2IA 3EF8A 3X3XA 1T3BA 1BNSA 1LNHA 1OHPA 3D4AA 3Q2PA 3WA3A 4EV2A 3DGOA 2Y73A 4XM4A 1FUWA 1AY7A 4H3UA 3V98A 4R1KA 3CCR3 1NWWA 4FMBA 1TP6A 4QWTA 1B2MA 1G96A 2P0MA 1R4YA 3MPHA 1TFOA 1WMOA 3FF2A 2XEPA 3ROBA 1STDA 3FGYA 2L1SA 2Z7AA 1BUJA 1FGOA 2STDA 1X1YA 1WMNA 3N9HA 5JBSA 3OX9A 1KC84 2CFDA 3EJVA 1BSBA 5IW9A 1RTUA 1JJ22 1ASKA 3K5TA 1Q40A 5AEWB 3OWUA 2OOVC 1UI7A 1ULJB 3K0ZA 4BTXA 4HM6B 4EC6A 1I0VA 3NHXA 3VGNA 2BMQB 1ULIB 1RGKA 1VQQA 2CFKA 4WWUC 2W03A 3SXXA 3NM7A 5IENA 5KP1A 3CC23 1DVCA 1HU9A 1C7HA 1PFPA 1RGCA 1TRPA 1NNVA 1SQWA 3PGBA 3CCM3 2Z77A 1A67A 4LEHA 1Y4KA 2KRTA 2QIYA 1VZZA 3AGNA 1O7GB 3OW22 3ECFA 3HK4A 1L5GB 2OWPA 3T8NA 4R9LA 4ZM8A 2W0QA 3JUPA 3KSED 1OUNA 3VSYA 1OHOA 2F4YA 3VF1A 1RGFA 2CWVA 1YJN3 3CD63 3EQQB 2UX0A 1BSCA 4CCVA 2QGUA 1FUTA 4NHFA 5IEPA 4RNZA 3X42A 1UCKA 3NM2A 4BL3A 2K54A 4HYZA 2GEYA 1O7HB 3RGAA 1JB4A 4CDLA 2XR8B 1QALA 1YGWA 3F7XA 3CCU3 3FH1A 1PYLA 1BU4A 4N6LA 1A2VA 1YJ93 4N6MA 1E3VA 3SVAA 3I553 1W6GA 1Z1SA 6GSPA 1IQ8A 1YGEA 3B4OA 3GZXB 1I3IA 1RDSA 2I9WA 1FA3A 1EUIC 3FKAA 2ZA4A 1MWUA 2FXTA 4GHOA 4HM8B 2CHCA 1EA2A 1MGWA 3Q90A 4IPBA 3KSPA 2BHMA 3A76A 4KFFA 2SARA 2B1XB 5FW5A 1IK3A 1UUWB 3A5EA 4I4KA 5D81A 4RNTA 2A15A 1O7MB 2V1LA 3CNMA 5EQLA 2HMMB 1RRHA 4KFDA 1W02A 3HX8A 1AVKA 2B24B 2XFTA 3V99A 3BNCA 4J8TA 4K90B 2E2UA 3GRDA 3V92A 1FYSA 1UW1A 4HOHA 1YNVX 5I97A 3H51A 2O3OA 3G4S3 1IQXA 2Z6BA 3LH4A 5BIRA 1VQ53 5ELUA 1VQM3 1FGMA 1RGHA 1W4NA 1X1UA 3BU4A 1Q40B 5TGNA 3BB9A 1TTOA 4WYKB 2HMNB 3CCL3 2HMLB 3JUQA 1N8QA 2KXGA 3FG3A 1GYBA 3DGNA 1UUGB 1EG9B 1BRJA 4I5QA 4HM1B 1V57A 1W6YA 1WTHA 3SEDA 4KVHA 4GSPA 2BIRA 1IT8A 2P0XA 4K1UA 1RHLA 2KF5A 3T8UA 1UGIA 4BTYA 3E99A 1KQS2 1M9GA 1VQ83 4MMYB 1X1WA 4HM3B 1MWRA 3J7Yd 1NB5I 3JUMA 3LYGA 3GWRA 1T5YA 3LTAA 1K734 5AEUB 1HZ1A 2RSXA 6RNTA 1S723 2YFLB 4KT3B 4STDA 2H0HA 2XGLA 1EKMA 4KZ1A 3CMA3 1RGGA 4WP5A 1D6ZA 3OV4A 1GMQA 2HMJB 5D83A 4GB5A 5D82A 3FSDA 2Y74A 2W2CA 1GY7A 4RNYA 2HMOB 3EB8A 3EN8A 2W04A 1RN4A 5HGRA 4ORLA 5STDA 3MG3A 3PXMA 4HM7B 5ELJA 5BXQA 4BU4A 1RNBA 5CLKA 1AR0A 1QJGA 1IU7A 1IVUA 3WR2A 1RGLA 2K3DA 5AIIA 4EYCA 1YIT3 1A2KA 1O7WB 1JBTA 3KIIA 1SPUA 1A2PA 8RNTA 3DY5A 4PEJA 3MKIA 3Q1CA 3X41A 8CHOA 1RCLA 1Q7Y4 5DRVA 1HKXA 1NU3A 1MOLA 5G2GA 1ZX2A 2R41A 1UI8A 4HAAA 1JZDA 2PZVA 1B3SA 3NV0B 3ZG0A 2PNCA 4NREA 7STDA 2L4VA 4FMAA 3S67A 3NBRA 3MG1A 4N3VA 2CFGA 2HMKB 3WHOA 4HVNA 5M19A 4WYKA 1LXEA 2P09A 3N54B 4R4KA 1TU5A 4XDVA 2OCTA 3EX9A 2E2VA 5BVBA 4N6V0 3G8ZA 1B2UA 1NJI4 3QK9A 3HIIA 5BU4A 4OK0A 1E3RA 4LYLB 5G1LA 3B8LA 1FUSA 2IY2A 3L0RA 1B27A 1IVWA 4J5GA 4O2HA 1UCJA 1MWSA 2CIUA 2F98A 5LC7A 1W7CA 1BNJA 4G1MB 1GSPA 1BRGA 2CG0A 3AGOA 3KCHA 3MSOA 1LOWA 3AHWA 3MG2A 1JBSA 3OWYA 1IDPA 1MGRA 3FZWA 1N5PA 1B21A 1QAKA 2F99A 2XF3A 3HZPA 4IT7A 4X2HA 3DZLA 3X3YA 4BIRA 1QAFA 1EEJA 2F5WA 3SLUA 2CFWA 4L7KA 1VQ93 3MWZA 1FZUA 1IT7A 1UUVB 3I563 1RRLA 4MMXB 3K63A 3MHEA 5AI1A 5EEOA 1OGXA 1D6UA 3ALAA 4LMIA 3K9MC 1O7NB 3SYUA 1M1XB 3STDA 1Q814 4AEQA 1N8R4 1YJW3 1W2ZA 1U5OA 3M8CA 3GZYB 1MWTA
chains in the Genus database with same CATH topology
4L8OA 1IVVA 3EN1B 1SJWA 1W00A 3F8HA 2OQEC 2C10A 5EVHA 3SX1A 2OQEA 3B4PA 3FG1A 1LOXA 3NV0A 3G0KA 4JF8A 4BTWA 4H61A 3IMAB 2CG1A 5LC6A 3U97A 4J9AA 1IV9A 4TX4A 2P05A 2W9QA 2QEX3 4K61A 1OGZA 3NXJA 1GS3A 3GZRA 3BNEA 3CCS3 3EHCA 4OVMA 1KD14 4HM4B 1DYUA 4HM2B 1QVF2 4FCZA 4EBGA 3NUVA 2JQ5A 1DMNA 2YFJB 2YX9A 2ZDJA 2IUJA 3UL6A 3WOEB 2BT3A 1TFKA 3JVCA 3G713 2OTL3 2XRXB 4O3VA 2QA43 1SIHA 1ZO2A 2CH9A 3RDEA 3CXC2 5FGOA 1N5HA 3MYTA 2W56B 2CKFB 1NDOB 4Q53A 3NBJA 1KWIA 1QMAA 1RN7A 3I0YA 2XGNA 4HJLB 1JNQA 5DREA 1FGRA 4N6TA 3UJMA 1JN5B 1IV7A 5IERA 2M7OA 3ER7A 2CW9A 3X40A 1ISKA 1JKGA 4HKVB 3DUKA 1YHQ3 2XSHB 3PCSA 3F8XA 3WOFB 5JPUA 1JRQA 2E2TA 3KZTA 3U1WA 3BNDA 1VQN3 1W01A 1VQ63 2W6JH 4N6OB 3UL5A 4RBNA 5IEOA 2ZL8A 3S27A 1WMPA 3GZBA 4EXRA 4U13A 4FMDA 2BO9B 3AMOB 3UB1A 2WOHA 3KKGA 1IQYA 1OPYA 1NO3A 2YFIB 2BMOB 1CEWI 3CU3A 3QRDA 1NB3I 4X2OA 4HM0B 3S29A 3CC43 1OF5B 2WO0A 2WOFA 1BUQA 2MF7A 3KFQC 2CWUA 3IJEB 1YIJ3 1Q824 2GBXB 3UNLA 1US1A 1D6YA 1DMMA 3EBTA 1ROVA 2CK3H 2GU3A 2LQVA 2IA7A 5AYSC 2KCDA 4L8PA 4N6NB 5IG5A 1W5ZA 3OXAA 2XSOB 3PZWA 6STDA 5IG4A 2BNGA 2ML6A 3NQYA 4MEIA 2W56A 3EBYA 1M904 3NX0A 4HM5B 1STFI 3FG4A 2LYXA 1W2B2 2WGQA 1R4CA 3JUNA 1WQLB 3S5CA 5CF2A 1JN5A 1V74A 5AIHA 2OTJ3 1VQ43 2INXA 1DMQA 4FR9A 3TDGA 2D42A 1W6CA 3LTCA 3SOYA 3CC73 3F7SA 4WHAA 3OWSA 2FGTA 2OOVA 4JRFA 4RZMA 5A0OB 3N8BA 3D9RA 1PU4A 2XFSA 5IG0A 3B7CA 5AIFA 1OHSA 3JUOA 4XDWA 3DM8A 4XBXA 1RJOA 3LT8A 3DXOA 3AMOA 3NBBA 3WODG 4XB5A 2BMRB 1JKGB 4AKYA 1U8CB 3EE1A 3FF0A 1TIJA 3IPTA 4LZIA 2CC3A 3PYJA 4HZ9B 1CYUA 1FGTA 1RKYA 3CME3 1OF5A 1JV2B 5IG3A 3DGLA 3WA2X 3PCRA 1YI23 3LT9A 4XBTA 1A90A 3CCE3 1LVNA 1K9M4 1E97A 3PS8A 2WGOA 1O7PB 3RGRA 2F86B 3WMDA 3BNBA 4R80A 1QVG2 5IF6A 1GD4A 5KP3A 4LSOA 5CXOA 1AV4A 2JDIH 1MNLA 3DGMA 2GBWB 1K28A 2SBLA 2XH9A 3G6E3 1AVLA 1F8NA 5CK6A 1CYVA 4R9KA 3CNXA 5AIGA 3LZAA 2C11A 4K1VA 3CPOA 4EV5A 3LOYA 2ML5A 2Q07A 4FMCA 4N6UA 4O8SA 3T0UA 4OUQA 1GY5A 3CCJ3 2P38A 5KP4A 1SIIA 1KSIA 1J2BA 1WNHA 1S5AA 1OH0A 2MC8A 1OCVA 2GU1A 3H3HA 1VQO3 1JB5A 2RCDA 2IMJA 1VQ73 5AYRB 2W9PA 3GAXA 2K0MA 1N9JA 4GL6A 1VQK3 1GD3A 2O9UX 1Q42A 3G16A 3X3ZA 2GEXA 1GY6A 4FCJA 1K8A4 2FNQA 3S28A 3D3LA 4XBYA 3HI7A 3FLJA 1VQP3 2RFRA 1Q864 3HIGA 3LMLA 3F14A 4KFEA 3SOAA 1ROAA 4LGQA 5CF1A 1M1K4 3CCV3 3LTBA 3CCQ3 2IUKA 3LTDA 3EC9A 4HZBB 3BLZA 4HBRA 5JPPA 2R4IA 2GXFA 2CFLA 3FCSB 4MJDA 4WFOA 2Z76A 2CWTA 3O8YA 3KE7A 4O02B 3CPW2 1CQSA 1JB2A 1DVDA 1TUHA 3WDGB 2RGQA 4FCMA 4IIAA 1FGQA 3KN4A 4AKZA 3K7CA 1YVBI 1IVXA 3F9SA 3LXUX 3F40A 4MMZB 1EQKA 1N9EA 3NQZA 1K41A 1VQL3 1OACA 2D1WA 3DMCA 3X3XA 3EF8A 1OHPA 1LNHA 3Q2PA 3WA3A 4EV2A 3DGOA 2Y73A 4XM4A 1FUWA 4H3UA 3V98A 4R1KA 3CCR3 1NWWA 4FMBA 1TP6A 4QWTA 1G96A 2P0MA 3MPHA 1TFOA 1WMOA 3FF2A 2XEPA 3ROBA 1STDA 3FGYA 2Z7AA 1FGOA 2STDA 3N9HA 1WMNA 5JBSA 1KC84 3OX9A 2CFDA 3EJVA 5IW9A 1JJ22 1ASKA 3K5TA 1Q40A 5AEWB 3OWUA 2OOVC 1UI7A 1ULJB 3K0ZA 4BTXA 4HM6B 4EC6A 3NHXA 3VGNA 2BMQB 1ULIB 2CFKA 4WWUC 2W03A 3SXXA 3NM7A 5IENA 5KP1A 3CC23 1DVCA 1HU9A 1C7HA 1PFPA 1SQWA 3PGBA 3CCM3 1A67A 2Z77A 4LEHA 1Y4KA 2KRTA 2QIYA 1VZZA 1O7GB 3OW22 3ECFA 3HK4A 1L5GB 2OWPA 3T8NA 4R9LA 4ZM8A 2W0QA 3JUPA 3KSED 1OUNA 3VSYA 1OHOA 3VF1A 2CWVA 1YJN3 3CD63 3EQQB 2UX0A 4CCVA 2QGUA 5IEPA 4NHFA 4RNZA 3X42A 3NM2A 2K54A 4HYZA 2GEYA 1O7HB 3RGAA 1JB4A 4CDLA 2XR8B 1QALA 3F7XA 3CCU3 3FH1A 4N6LA 1A2VA 1YJ93 4N6MA 1E3VA 3SVAA 3I553 1W6GA 1Z1SA 1IQ8A 1YGEA 3B4OA 3GZXB 2I9WA 1FA3A 3FKAA 2FXTA 4HM8B 2CHCA 1EA2A 3Q90A 4IPBA 3KSPA 2BHMA 4KFFA 2B1XB 5FW5A 1IK3A 1UUWB 4I4KA 5D81A 2A15A 1O7MB 2V1LA 3CNMA 5EQLA 2HMMB 1RRHA 4KFDA 1W02A 3HX8A 1AVKA 2B24B 2XFTA 3V99A 3BNCA 4J8TA 4K90B 2E2UA 3GRDA 3V92A 1UW1A 5I97A 3H51A 2O3OA 3G4S3 1IQXA 2Z6BA 3LH4A 1VQ53 5ELUA 1VQM3 1FGMA 1W4NA 5TGNA 3CCL3 1Q40B 3BB9A 4WYKB 2HMNB 2HMLB 3JUQA 1N8QA 2KXGA 3FG3A 1GYBA 3DGNA 1EG9B 4HM1B 1WTHA 1W6YA 3SEDA 4KVHA 1IT8A 2P0XA 4K1UA 3T8UA 4BTYA 3E99A 1KQS2 1M9GA 1VQ83 4MMYB 4HM3B 3J7Yd 1NB5I 3JUMA 3LYGA 3GWRA 1T5YA 3LTAA 1K734 5AEUB 1S723 2RSXA 2YFLB 4STDA 3CMA3 2XGLA 1EKMA 4KZ1A 4WP5A 1D6ZA 3OV4A 2HMJB 5D83A 4GB5A 5D82A 3FSDA 2Y74A 2W2CA 1GY7A 4RNYA 2HMOB 3EB8A 3EN8A 2W04A 5HGRA 4ORLA 5STDA 3MG3A 3PXMA 4HM7B 5ELJA 5BXQA 5CLKA 1AR0A 1QJGA 1IU7A 1IVUA 5AIIA 4EYCA 1YIT3 1A2KA 1O7WB 3KIIA 1SPUA 3DY5A 4PEJA 3MKIA 3Q1CA 3X41A 8CHOA 1Q7Y4 5DRVA 1HKXA 1NU3A 1MOLA 5G2GA 1ZX2A 1UI8A 2PZVA 3NV0B 2PNCA 4NREA 7STDA 2L4VA 4FMAA 3S67A 3NBRA 3MG1A 4N3VA 2CFGA 2HMKB 4HVNA 4WYKA 1LXEA 2P09A 3N54B 4R4KA 1TU5A 4XDVA 2OCTA 3EX9A 2E2VA 5BVBA 4N6V0 3G8ZA 1NJI4 3QK9A 3HIIA 4OK0A 1E3RA 3B8LA 3L0RA 1IVWA 4O2HA 2CIUA 2F98A 5LC7A 1W7CA 4G1MB 2CG0A 3MSOA 3MG2A 3OWYA 1IDPA 3FZWA 1N5PA 1QAKA 2XF3A 2F99A 4IT7A 3HZPA 4X2HA 3DZLA 3X3YA 1QAFA 3SLUA 2CFWA 4L7KA 1VQ93 3MWZA 1IT7A 1UUVB 3I563 1RRLA 4MMXB 3K63A 3MHEA 5AI1A 5EEOA 1OGXA 1D6UA 3ALAA 4LMIA 3K9MC 1O7NB 1M1XB 3STDA 1Q814 4AEQA 1N8R4 1YJW3 1W2ZA 1U5OA 3M8CA 3GZYB 3A76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8O A;  3EN1 B;  1SJW A;  1W00 A;  3F8H A;  5EVH A;  3B4P A;  3NV0 A;  3G0K A;  4J9A A;  1OGZ A;  3NXJ A;  1GS3 A;  3GZR A;  3EHC A;  4OVM A;  4HM4 B;  4HM2 B;  3NUV A;  2JQ5 A;  1DMN A;  2YFJ B;  2XRX B;  1ZO2 A;  3MYT A;  2CKF B;  1NDO B;  4Q53 A;  1QMA A;  3I0Y A;  4HJL B;  5DRE A;  3UJM A;  1JN5 B;  5IER A;  3ER7 A;  1ISK A;  1JKG A;  4HKV B;  3DUK A;  2XSH B;  3F8X A;  5JPU A;  3KZT A;  1W01 A;  5IEO A;  3GZB A;  4U13 A;  3KKG A;  1OPY A;  2YFI B;  2BMO B;  3CU3 A;  4X2O A;  4HM0 B;  1OF5 B;  1BUQ A;  2GBX B;  3UNL A;  1DMM A;  3EBT A;  4L8P A;  5IG5 A;  3OXA A;  2XSO B;  6STD A;  5IG4 A;  2BNG A;  3EBY A;  4HM5 B;  3JUN A;  1WQL B;  3S5C A;  5CF2 A;  1JN5 A;  5AIH A;  2INX A;  1DMQ A;  3SOY A;  3F7S A;  3OWS A;  4RZM A;  3D9R A;  5IG0 A;  3B7C A;  5AIF A;  1OHS A;  3JUO A;  4XDW A;  3DM8 A;  4XBX A;  3DXO A;  4XB5 A;  2BMR B;  1JKG B;  3FF0 A;  3IPT A;  4HZ9 B;  1OF5 A;  5IG3 A;  4XBT A;  1E97 A;  1O7P B;  3RGR A;  2F86 B;  3WMD A;  5IF6 A;  5KP3 A;  5CXO A;  2GBW B;  5CK6 A;  5AIG A;  4R9K A;  3CNX A;  3LZA A;  4K1V A;  3CPO A;  4OUQ A;  1GY5 A;  5KP4 A;  1S5A A;  1OH0 A;  1OCV A;  3H3H A;  1JB5 A;  2RCD A;  2IMJ A;  1Q42 A;  3G16 A;  2GEX A;  1GY6 A;  4FCJ A;  4XBY A;  3FLJ A;  2RFR A;  3F14 A;  3SOA A;  5CF1 A;  4LGQ A;  4HZB B;  3EC9 A;  3BLZ A;  5JPP A;  2R4I A;  2GXF A;  4MJD A;  2Z76 A;  3KE7 A;  1CQS A;  1JB2 A;  1TUH A;  2RGQ A;  4FCM A;  4IIA A;  3K7C A;  3F9S A;  3F40 A;  1K41 A;  3DMC A;  3EF8 A;  1OHP A;  4XM4 A;  4H3U A;  4R1K A;  1NWW A;  1TP6 A;  3FF2 A;  3ROB A;  1STD A;  3FGY A;  2Z7A A;  2STD A;  3OX9 A;  3EJV A;  1ASK A;  5AEW B;  1Q40 A;  3OWU A;  1ULJ B;  3K0Z A;  4HM6 B;  3NHX A;  3VGN A;  2BMQ B;  1ULI B;  4WWU C;  5IEN A;  5KP1 A;  1C7H A;  2Z77 A;  4LEH A;  2QIY A;  1VZZ A;  1O7G B;  3ECF A;  3HK4 A;  3T8N A;  2OWP A;  4R9L A;  3JUP A;  1OUN A;  3VSY A;  1OHO A;  3EQQ B;  2UX0 A;  5IEP A;  2QGU A;  3NM2 A;  2K54 A;  2GEY A;  1O7H B;  3RGA A;  1JB4 A;  4CDL A;  2XR8 B;  3F7X A;  3FH1 A;  1E3V A;  1Z1S A;  3B4O A;  3GZX B;  2I9W A;  3FKA A;  4HM8 B;  2CHC A;  1EA2 A;  3Q90 A;  3KSP A;  2B1X B;  5FW5 A;  1UUW B;  4I4K A;  5D81 A;  2A15 A;  1O7M B;  3CNM A;  2HMM B;  1W02 A;  3HX8 A;  2B24 B;  4J8T A;  3GRD A;  3H51 A;  5TGN A;  1Q40 B;  3BB9 A;  4WYK B;  2HMN B;  2HML B;  3JUQ A;  1GYB A;  1EG9 B;  4HM1 B;  1W6Y A;  3SED A;  4KVH A;  4K1U A;  3T8U A;  3E99 A;  4HM3 B;  3JUM A;  3LYG A;  3GWR A;  5AEU B;  2YFL B;  4STD A;  4WP5 A;  3OV4 A;  2HMJ B;  5D83 A;  4GB5 A;  5D82 A;  3FSD A;  2W2C A;  1GY7 A;  2HMO B;  5HGR A;  3EN8 A;  4ORL A;  5STD A;  3MG3 A;  4HM7 B;  5BXQ A;  5CLK A;  1AR0 A;  1QJG A;  5AII A;  1A2K A;  1O7W B;  4PEJ A;  3MKI A;  8CHO A;  5DRV A;  1HKX A;  1NU3 A;  5G2G A;  1ZX2 A;  2PZV A;  3NV0 B;  7STD A;  3NBR A;  3MG1 A;  4N3V A;  2HMK B;  4HVN A;  4WYK A;  4XDV A;  3EX9 A;  5BVB A;  3G8Z A;  1E3R A;  3B8L A;  2F98 A;  3MSO A;  3MG2 A;  3OWY A;  1IDP A;  3FZW A;  2F99 A;  3HZP A;  4X2H A;  3DZL A;  4L7K A;  1UUV B;  3MHE A;  5AI1 A;  1OGX A;  4LMI A;  1O7N B;  3STD A;  1U5O A;  3M8C A;  3GZY B;  3A76 A; 
#chains in the Genus database with same CATH topology
 4L8O A;  1IVV A;  3EN1 B;  1SJW A;  1W00 A;  3F8H A;  4CJN A;  5GSP A;  3HOH A;  2OQE C;  2C10 A;  1PY3 A;  5EVH A;  3SX1 A;  2CX0 A;  2OQE A;  3B4P A;  3FG1 A;  1LOX A;  3NV0 A;  1I2E A;  3G0K A;  4JF8 A;  1DE3 A;  4BTW A;  1Q7H A;  4H61 A;  3IMA B;  2CG1 A;  1BVI A;  2GSP A;  5LC6 A;  3U97 A;  1I2G A;  4J9A A;  1IV9 A;  4TX4 A;  1B2S A;  2P05 A;  2W9Q A;  2QEX 3;  4K61 A;  1OGZ A;  3NXJ A;  2F56 A;  1GS3 A;  3GZR A;  7GSP A;  1LOY A;  3BNE A;  3CCS 3;  3EHC A;  1DET A;  4OVM A;  1KD1 4;  4HM4 B;  1DYU A;  4HM2 B;  1QVF 2;  4FCZ A;  4EBG A;  3NUV A;  1BSE A;  2JQ5 A;  1DMN A;  2YFJ B;  2YX9 A;  2ZDJ A;  2IUJ A;  3UL6 A;  3WOE B;  2BT3 A;  1TFK A;  3JVC A;  3G71 3;  2OTL 3;  2XRX B;  4O3V A;  2QA4 3;  1I8V A;  1SIH A;  1ZO2 A;  2CH9 A;  3RDE A;  1GOV A;  4ILF A;  3CXC 2;  3DGY A;  5FGO A;  1LQM B;  1N5H A;  2CX1 A;  3MYT A;  2W56 B;  2CKF B;  2J8X B;  1NDO B;  4Q53 A;  3NBJ A;  1KWI A;  5RNT A;  1QMA A;  1RN7 A;  3I0Y A;  2XGN A;  4HJL B;  1RN1 A;  1JNQ A;  5DRE A;  1SAR A;  1FGR A;  2KF4 A;  4N6T A;  3UJM A;  3ZFZ A;  1JN5 B;  1IV7 A;  5IER A;  2M7O A;  3ER7 A;  1BRS A;  2CW9 A;  3X40 A;  1ISK A;  1JKG A;  4HKV B;  3DUK A;  1BRH A;  1YHQ 3;  3GSP A;  1TRQ A;  4BL2 A;  2XSH B;  3PCS A;  3Q3F A;  3F8X A;  1RMS A;  3WOF B;  1UCL A;  5JPU A;  1JRQ A;  2E2T A;  3AHS A;  3KZT A;  3U1W A;  1BAN A;  3BND A;  1VQN 3;  1BIR A;  1BAO A;  1W01 A;  1VQ6 3;  2KF3 A;  2W6J H;  4N6O B;  2AAD A;  3UL5 A;  2C4B A;  4RBN A;  5IEO A;  2ZL8 A;  3S27 A;  1WMP A;  3GZB A;  3ZG5 A;  4EXR A;  4U13 A;  4FMD A;  2BO9 B;  1BNI A;  1I3F A;  3AMO B;  3D5G A;  3UB1 A;  2WOH A;  3KKG A;  1IQY A;  1OPY A;  3DH2 A;  1NO3 A;  2YFI B;  4EW5 A;  2BMO B;  1CEW I;  3CU3 A;  3QRD A;  1NB3 I;  4X2O A;  4HM0 B;  3S29 A;  3CC4 3;  1OF5 B;  2WO0 A;  2WOF A;  1BUQ A;  1ZS7 A;  2MF7 A;  3KFQ C;  2CWU A;  3IJE B;  1YIJ 3;  1Q82 4;  2GBX B;  3UNL A;  1US1 A;  1D6Y A;  1DMM A;  3EBT A;  1ROV A;  2CK3 H;  1GMR A;  2GU3 A;  2LQV A;  2IA7 A;  5AYS C;  2KCD A;  4L8P A;  1B2X A;  4N6N B;  5IG5 A;  1W5Z A;  3OXA A;  2XSO B;  3PZW A;  6STD A;  1G02 A;  2BNG A;  2ML6 A;  3NQY A;  4MEI A;  2W56 A;  3EBY A;  5IG4 A;  1UGH I;  1M90 4;  1BNF A;  3NX0 A;  4HM5 B;  1STF I;  1BRN L;  3FG4 A;  1RGE A;  2LYX A;  1W2B 2;  2WGQ A;  1T2H A;  1I2F A;  1R4C A;  5M1A A;  3JUN A;  1WQL B;  3S5C A;  5CF2 A;  1JN5 A;  1V74 A;  5AIH A;  2OTJ 3;  1VQ4 3;  2INX A;  1ZGX A;  1DMQ A;  4FR9 A;  3TDG A;  2D42 A;  1W6C A;  3LTC A;  1I0X A;  3SOY A;  3CC7 3;  3F7S A;  4WHA A;  2RBI A;  3OWS A;  2FGT A;  1G0T A;  2OOV A;  2HOH A;  4DKI A;  4JRF A;  1BSD A;  2F5M A;  1BSA A;  4RZM A;  5A0O B;  3N8B A;  1TJD A;  3D9R A;  1PU4 A;  3BIR A;  2XFS A;  5IG0 A;  3B7C A;  5AIF A;  1OHS A;  3JUO A;  4XDW A;  3DM8 A;  4XBX A;  1LNI A;  1RJO A;  3LT8 A;  3DXO A;  3AMO A;  1LRA A;  3NBB A;  3WOD G;  1RSN A;  2BMR B;  1V58 A;  4XB5 A;  1JKG B;  1LOV A;  4AKY A;  1U8C B;  3EE1 A;  3FF0 A;  1TIJ A;  1GOU A;  3IPT A;  1BRK A;  4LZI A;  2CC3 A;  3PYJ A;  4HZ9 B;  1CYU A;  1FGT A;  1RKY A;  3CME 3;  1UCI A;  1OF5 A;  1JV2 B;  5IG3 A;  3DGL A;  3WA2 X;  3PCR A;  1YI2 3;  3LT9 A;  1BGS A;  4NPB A;  3D79 A;  4XBT A;  1A90 A;  2BU4 A;  3CCE 3;  2KAA A;  1LVN A;  1K9M 4;  1E97 A;  3PS8 A;  2WGO A;  1O7P B;  3RGR A;  2F86 B;  3WMD A;  3BNB A;  4R80 A;  1GMP A;  1BOX A;  5IF6 A;  1QVG 2;  2ZHX B;  4CPK A;  1GD4 A;  5KP3 A;  4LSO A;  1I70 A;  3D5I A;  5CXO A;  1JBR A;  1AV4 A;  2JDI H;  1MNL A;  3DGM A;  1B20 A;  2GBW B;  1K28 A;  1RCK A;  2H0G A;  2SBL A;  2XH9 A;  4J5K A;  3G6E 3;  1JZO A;  1AVL A;  1F8N A;  5G1K A;  1LQG C;  5CK6 A;  1CYV A;  4R9K A;  3CNX A;  5AIG A;  1RNT A;  2C11 A;  3LZA A;  4K1V A;  1YVS A;  3CPO A;  4EV5 A;  3LOY A;  2ML5 A;  2Q07 A;  4FMC A;  4N6U A;  4O8S A;  3T0U A;  4OUQ A;  1GY5 A;  3CCJ 3;  2P38 A;  5KP4 A;  1SII A;  1KSI A;  1J2B A;  1WNH A;  1S5A A;  1OH0 A;  2UUG C;  2KF6 A;  1OCV A;  2MC8 A;  2GU1 A;  3H3H A;  1VQO 3;  2H0I A;  5M18 A;  2IYJ A;  1JB5 A;  2RCD A;  2IMJ A;  1VQ7 3;  5AYR B;  2W9P A;  3GAX A;  2K0M A;  1N9J A;  1RLS A;  4GL6 A;  1VQK 3;  1GD3 A;  2O9U X;  1Q42 A;  3G16 A;  3X3Z A;  1Q9E A;  2GEX A;  9RNT A;  1GY6 A;  4FCJ A;  1K8A 4;  2FNQ A;  3S28 A;  3D3L A;  4XBY A;  3HI7 A;  3FLJ A;  1VQP 3;  2RFR A;  1CH0 A;  1Q86 4;  1RGA A;  3HIG A;  1FW7 A;  3LML A;  3F14 A;  4KFE A;  3SOA A;  1ROA A;  4LGQ A;  5CF1 A;  1M1K 4;  3CCV 3;  1BNG A;  1AQZ A;  3LTB A;  3CCQ 3;  2IUK A;  3LTD A;  3EC9 A;  4HZB B;  3BLZ A;  4HBR A;  5JPP A;  2RNT A;  2UGI A;  2R4I A;  1C54 A;  2GXF A;  2CFL A;  3FCS B;  1BRI A;  4MJD A;  4WFO A;  2Z76 A;  7RNT A;  2CWT A;  3O8Y A;  3KE7 A;  4O02 B;  3CPW 2;  1CQS A;  1JB2 A;  1DVD A;  1TUH A;  3WDG B;  2RGQ A;  1IYY A;  4FCM A;  4IIA A;  1FGQ A;  3KN4 A;  4AKZ A;  3K7C A;  1YVB I;  1IVX A;  1BNE A;  3F9S A;  3LXU X;  5HOH A;  3F40 A;  1BNR A;  4MMZ B;  3RNT A;  1UDI I;  1X1X A;  1EQK A;  1N9E A;  1HYF A;  3NQZ A;  3URP A;  1K41 A;  2AAE A;  1VQL 3;  1B2Z A;  1OAC A;  2D1W A;  3DMC A;  1GOY A;  1T2I A;  3EF8 A;  3X3X A;  1T3B A;  1BNS A;  1LNH A;  1OHP A;  3D4A A;  3Q2P A;  3WA3 A;  4EV2 A;  3DGO A;  2Y73 A;  4XM4 A;  1FUW A;  1AY7 A;  4H3U A;  3V98 A;  4R1K A;  3CCR 3;  1NWW A;  4FMB A;  1TP6 A;  4QWT A;  1B2M A;  1G96 A;  2P0M A;  1R4Y A;  3MPH A;  1TFO A;  1WMO A;  3FF2 A;  2XEP A;  3ROB A;  1STD A;  3FGY A;  2L1S A;  2Z7A A;  1BUJ A;  1FGO A;  2STD A;  1X1Y A;  1WMN A;  3N9H A;  5JBS A;  3OX9 A;  1KC8 4;  2CFD A;  3EJV A;  1BSB A;  5IW9 A;  1RTU A;  1JJ2 2;  1ASK A;  3K5T A;  1Q40 A;  5AEW B;  3OWU A;  2OOV C;  1UI7 A;  1ULJ B;  3K0Z A;  4BTX A;  4HM6 B;  4EC6 A;  1I0V A;  3NHX A;  3VGN A;  2BMQ B;  1ULI B;  1RGK A;  1VQQ A;  2CFK A;  4WWU C;  2W03 A;  3SXX A;  3NM7 A;  5IEN A;  5KP1 A;  3CC2 3;  1DVC A;  1HU9 A;  1C7H A;  1PFP A;  1RGC A;  1TRP A;  1NNV A;  1SQW A;  3PGB A;  3CCM 3;  2Z77 A;  1A67 A;  4LEH A;  1Y4K A;  2KRT A;  2QIY A;  1VZZ A;  3AGN A;  1O7G B;  3OW2 2;  3ECF A;  3HK4 A;  1L5G B;  2OWP A;  3T8N A;  4R9L A;  4ZM8 A;  2W0Q A;  3JUP A;  3KSE D;  1OUN A;  3VSY A;  1OHO A;  2F4Y A;  3VF1 A;  1RGF A;  2CWV A;  1YJN 3;  3CD6 3;  3EQQ B;  2UX0 A;  1BSC A;  4CCV A;  2QGU A;  1FUT A;  4NHF A;  5IEP A;  4RNZ A;  3X42 A;  1UCK A;  3NM2 A;  4BL3 A;  2K54 A;  4HYZ A;  2GEY A;  1O7H B;  3RGA A;  1JB4 A;  4CDL A;  2XR8 B;  1QAL A;  1YGW A;  3F7X A;  3CCU 3;  3FH1 A;  1PYL A;  1BU4 A;  4N6L A;  1A2V A;  1YJ9 3;  4N6M A;  1E3V A;  3SVA A;  3I55 3;  1W6G A;  1Z1S A;  6GSP A;  1IQ8 A;  1YGE A;  3B4O A;  3GZX B;  1I3I A;  1RDS A;  2I9W A;  1FA3 A;  1EUI C;  3FKA A;  2ZA4 A;  1MWU A;  2FXT A;  4GHO A;  4HM8 B;  2CHC A;  1EA2 A;  1MGW A;  3Q90 A;  4IPB A;  3KSP A;  2BHM A;  3A76 A;  4KFF A;  2SAR A;  2B1X B;  5FW5 A;  1IK3 A;  1UUW B;  3A5E A;  4I4K A;  5D81 A;  4RNT A;  2A15 A;  1O7M B;  2V1L A;  3CNM A;  5EQL A;  2HMM B;  1RRH A;  4KFD A;  1W02 A;  3HX8 A;  1AVK A;  2B24 B;  2XFT A;  3V99 A;  3BNC A;  4J8T A;  4K90 B;  2E2U A;  3GRD A;  3V92 A;  1FYS A;  1UW1 A;  4HOH A;  1YNV X;  5I97 A;  3H51 A;  2O3O A;  3G4S 3;  1IQX A;  2Z6B A;  3LH4 A;  5BIR A;  1VQ5 3;  5ELU A;  1VQM 3;  1FGM A;  1RGH A;  1W4N A;  1X1U A;  3BU4 A;  1Q40 B;  5TGN A;  3BB9 A;  1TTO A;  4WYK B;  2HMN B;  3CCL 3;  2HML B;  3JUQ A;  1N8Q A;  2KXG A;  3FG3 A;  1GYB A;  3DGN A;  1UUG B;  1EG9 B;  1BRJ A;  4I5Q A;  4HM1 B;  1V57 A;  1W6Y A;  1WTH A;  3SED A;  4KVH A;  4GSP A;  2BIR A;  1IT8 A;  2P0X A;  4K1U A;  1RHL A;  2KF5 A;  3T8U A;  1UGI A;  4BTY A;  3E99 A;  1KQS 2;  1M9G A;  1VQ8 3;  4MMY B;  1X1W A;  4HM3 B;  1MWR A;  3J7Y d;  1NB5 I;  3JUM A;  3LYG A;  3GWR A;  1T5Y A;  3LTA A;  1K73 4;  5AEU B;  1HZ1 A;  2RSX A;  6RNT A;  1S72 3;  2YFL B;  4KT3 B;  4STD A;  2H0H A;  2XGL A;  1EKM A;  4KZ1 A;  3CMA 3;  1RGG A;  4WP5 A;  1D6Z A;  3OV4 A;  1GMQ A;  2HMJ B;  5D83 A;  4GB5 A;  5D82 A;  3FSD A;  2Y74 A;  2W2C A;  1GY7 A;  4RNY A;  2HMO B;  3EB8 A;  3EN8 A;  2W04 A;  1RN4 A;  5HGR A;  4ORL A;  5STD A;  3MG3 A;  3PXM A;  4HM7 B;  5ELJ A;  5BXQ A;  4BU4 A;  1RNB A;  5CLK A;  1AR0 A;  1QJG A;  1IU7 A;  1IVU A;  3WR2 A;  1RGL A;  2K3D A;  5AII A;  4EYC A;  1YIT 3;  1A2K A;  1O7W B;  1JBT A;  3KII A;  1SPU A;  1A2P A;  8RNT A;  3DY5 A;  4PEJ A;  3MKI A;  3Q1C A;  3X41 A;  8CHO A;  1RCL A;  1Q7Y 4;  5DRV A;  1HKX A;  1NU3 A;  1MOL A;  5G2G A;  1ZX2 A;  2R41 A;  1UI8 A;  4HAA A;  1JZD A;  2PZV A;  1B3S A;  3NV0 B;  3ZG0 A;  2PNC A;  4NRE A;  7STD A;  2L4V A;  4FMA A;  3S67 A;  3NBR A;  3MG1 A;  4N3V A;  2CFG A;  2HMK B;  3WHO A;  4HVN A;  5M19 A;  4WYK A;  1LXE A;  2P09 A;  3N54 B;  4R4K A;  1TU5 A;  4XDV A;  2OCT A;  3EX9 A;  2E2V A;  5BVB A;  4N6V 0;  3G8Z A;  1B2U A;  1NJI 4;  3QK9 A;  3HII A;  5BU4 A;  4OK0 A;  1E3R A;  4LYL B;  5G1L A;  3B8L A;  1FUS A;  2IY2 A;  3L0R A;  1B27 A;  1IVW A;  4J5G A;  4O2H A;  1UCJ A;  1MWS A;  2CIU A;  2F98 A;  5LC7 A;  1W7C A;  1BNJ A;  4G1M B;  1GSP A;  1BRG A;  2CG0 A;  3AGO A;  3KCH A;  3MSO A;  1LOW A;  3AHW A;  3MG2 A;  1JBS A;  3OWY A;  1IDP A;  1MGR A;  3FZW A;  1N5P A;  1B21 A;  1QAK A;  2F99 A;  2XF3 A;  3HZP A;  4IT7 A;  4X2H A;  3DZL A;  3X3Y A;  4BIR A;  1QAF A;  1EEJ A;  2F5W A;  3SLU A;  2CFW A;  4L7K A;  1VQ9 3;  3MWZ A;  1FZU A;  1IT7 A;  1UUV B;  3I56 3;  1RRL A;  4MMX B;  3K63 A;  3MHE A;  5AI1 A;  5EEO A;  1OGX A;  1D6U A;  3ALA A;  4LMI A;  3K9M C;  1O7N B;  3SYU A;  1M1X B;  3STD A;  1Q81 4;  4AEQ A;  1N8R 4;  1YJW 3;  1W2Z A;  1U5O A;  3M8C A;  3GZY B;  1MWT A; 
#chains in the Genus database with same CATH homology
 4L8O A;  1IVV A;  3EN1 B;  1SJW A;  1W00 A;  3F8H A;  2OQE C;  2C10 A;  5EVH A;  3SX1 A;  2OQE A;  3B4P A;  3FG1 A;  1LOX A;  3NV0 A;  3G0K A;  4JF8 A;  4BTW A;  4H61 A;  3IMA B;  2CG1 A;  5LC6 A;  3U97 A;  4J9A A;  1IV9 A;  4TX4 A;  2P05 A;  2W9Q A;  2QEX 3;  4K61 A;  1OGZ A;  3NXJ A;  1GS3 A;  3GZR A;  3BNE A;  3CCS 3;  3EHC A;  4OVM A;  1KD1 4;  4HM4 B;  1DYU A;  4HM2 B;  1QVF 2;  4FCZ A;  4EBG A;  3NUV A;  2JQ5 A;  1DMN A;  2YFJ B;  2YX9 A;  2ZDJ A;  2IUJ A;  3UL6 A;  3WOE B;  2BT3 A;  1TFK A;  3JVC A;  3G71 3;  2OTL 3;  2XRX B;  4O3V A;  2QA4 3;  1SIH A;  1ZO2 A;  2CH9 A;  3RDE A;  3CXC 2;  5FGO A;  1N5H A;  3MYT A;  2W56 B;  2CKF B;  1NDO B;  4Q53 A;  3NBJ A;  1KWI A;  1QMA A;  1RN7 A;  3I0Y A;  2XGN A;  4HJL B;  1JNQ A;  5DRE A;  1FGR A;  4N6T A;  3UJM A;  1JN5 B;  1IV7 A;  5IER A;  2M7O A;  3ER7 A;  2CW9 A;  3X40 A;  1ISK A;  1JKG A;  4HKV B;  3DUK A;  1YHQ 3;  2XSH B;  3PCS A;  3F8X A;  3WOF B;  5JPU A;  1JRQ A;  2E2T A;  3KZT A;  3U1W A;  3BND A;  1VQN 3;  1W01 A;  1VQ6 3;  2W6J H;  4N6O B;  3UL5 A;  4RBN A;  5IEO A;  2ZL8 A;  3S27 A;  1WMP A;  3GZB A;  4EXR A;  4U13 A;  4FMD A;  2BO9 B;  3AMO B;  3UB1 A;  2WOH A;  3KKG A;  1IQY A;  1OPY A;  1NO3 A;  2YFI B;  2BMO B;  1CEW I;  3CU3 A;  3QRD A;  1NB3 I;  4X2O A;  4HM0 B;  3S29 A;  3CC4 3;  1OF5 B;  2WO0 A;  2WOF A;  1BUQ A;  2MF7 A;  3KFQ C;  2CWU A;  3IJE B;  1YIJ 3;  1Q82 4;  2GBX B;  3UNL A;  1US1 A;  1D6Y A;  1DMM A;  3EBT A;  1ROV A;  2CK3 H;  2GU3 A;  2LQV A;  2IA7 A;  5AYS C;  2KCD A;  4L8P A;  4N6N B;  5IG5 A;  1W5Z A;  3OXA A;  2XSO B;  3PZW A;  6STD A;  5IG4 A;  2BNG A;  2ML6 A;  3NQY A;  4MEI A;  2W56 A;  3EBY A;  1M90 4;  3NX0 A;  4HM5 B;  1STF I;  3FG4 A;  2LYX A;  1W2B 2;  2WGQ A;  1R4C A;  3JUN A;  1WQL B;  3S5C A;  5CF2 A;  1JN5 A;  1V74 A;  5AIH A;  2OTJ 3;  1VQ4 3;  2INX A;  1DMQ A;  4FR9 A;  3TDG A;  2D42 A;  1W6C A;  3LTC A;  3SOY A;  3CC7 3;  3F7S A;  4WHA A;  3OWS A;  2FGT A;  2OOV A;  4JRF A;  4RZM A;  5A0O B;  3N8B A;  3D9R A;  1PU4 A;  2XFS A;  5IG0 A;  3B7C A;  5AIF A;  1OHS A;  3JUO A;  4XDW A;  3DM8 A;  4XBX A;  1RJO A;  3LT8 A;  3DXO A;  3AMO A;  3NBB A;  3WOD G;  4XB5 A;  2BMR B;  1JKG B;  4AKY A;  1U8C B;  3EE1 A;  3FF0 A;  1TIJ A;  3IPT A;  4LZI A;  2CC3 A;  3PYJ A;  4HZ9 B;  1CYU A;  1FGT A;  1RKY A;  3CME 3;  1OF5 A;  1JV2 B;  5IG3 A;  3DGL A;  3WA2 X;  3PCR A;  1YI2 3;  3LT9 A;  4XBT A;  1A90 A;  3CCE 3;  1LVN A;  1K9M 4;  1E97 A;  3PS8 A;  2WGO A;  1O7P B;  3RGR A;  2F86 B;  3WMD A;  3BNB A;  4R80 A;  1QVG 2;  5IF6 A;  1GD4 A;  5KP3 A;  4LSO A;  5CXO A;  1AV4 A;  2JDI H;  1MNL A;  3DGM A;  2GBW B;  1K28 A;  2SBL A;  2XH9 A;  3G6E 3;  1AVL A;  1F8N A;  5CK6 A;  1CYV A;  4R9K A;  3CNX A;  5AIG A;  3LZA A;  2C11 A;  4K1V A;  3CPO A;  4EV5 A;  3LOY A;  2ML5 A;  2Q07 A;  4FMC A;  4N6U A;  4O8S A;  3T0U A;  4OUQ A;  1GY5 A;  3CCJ 3;  2P38 A;  5KP4 A;  1SII A;  1KSI A;  1J2B A;  1WNH A;  1S5A A;  1OH0 A;  2MC8 A;  1OCV A;  2GU1 A;  3H3H A;  1VQO 3;  1JB5 A;  2RCD A;  2IMJ A;  1VQ7 3;  5AYR B;  2W9P A;  3GAX A;  2K0M A;  1N9J A;  4GL6 A;  1VQK 3;  1GD3 A;  2O9U X;  1Q42 A;  3G16 A;  3X3Z A;  2GEX A;  1GY6 A;  4FCJ A;  1K8A 4;  2FNQ A;  3S28 A;  3D3L A;  4XBY A;  3HI7 A;  3FLJ A;  1VQP 3;  2RFR A;  1Q86 4;  3HIG A;  3LML A;  3F14 A;  4KFE A;  3SOA A;  1ROA A;  4LGQ A;  5CF1 A;  1M1K 4;  3CCV 3;  3LTB A;  3CCQ 3;  2IUK A;  3LTD A;  3EC9 A;  4HZB B;  3BLZ A;  4HBR A;  5JPP A;  2R4I A;  2GXF A;  2CFL A;  3FCS B;  4MJD A;  4WFO A;  2Z76 A;  2CWT A;  3O8Y A;  3KE7 A;  4O02 B;  3CPW 2;  1CQS A;  1JB2 A;  1DVD A;  1TUH A;  3WDG B;  2RGQ A;  4FCM A;  4IIA A;  1FGQ A;  3KN4 A;  4AKZ A;  3K7C A;  1YVB I;  1IVX A;  3F9S A;  3LXU X;  3F40 A;  4MMZ B;  1EQK A;  1N9E A;  3NQZ A;  1K41 A;  1VQL 3;  1OAC A;  2D1W A;  3DMC A;  3X3X A;  3EF8 A;  1OHP A;  1LNH A;  3Q2P A;  3WA3 A;  4EV2 A;  3DGO A;  2Y73 A;  4XM4 A;  1FUW A;  4H3U A;  3V98 A;  4R1K A;  3CCR 3;  1NWW A;  4FMB A;  1TP6 A;  4QWT A;  1G96 A;  2P0M A;  3MPH A;  1TFO A;  1WMO A;  3FF2 A;  2XEP A;  3ROB A;  1STD A;  3FGY A;  2Z7A A;  1FGO A;  2STD A;  3N9H A;  1WMN A;  5JBS A;  1KC8 4;  3OX9 A;  2CFD A;  3EJV A;  5IW9 A;  1JJ2 2;  1ASK A;  3K5T A;  1Q40 A;  5AEW B;  3OWU A;  2OOV C;  1UI7 A;  1ULJ B;  3K0Z A;  4BTX A;  4HM6 B;  4EC6 A;  3NHX A;  3VGN A;  2BMQ B;  1ULI B;  2CFK A;  4WWU C;  2W03 A;  3SXX A;  3NM7 A;  5IEN A;  5KP1 A;  3CC2 3;  1DVC A;  1HU9 A;  1C7H A;  1PFP A;  1SQW A;  3PGB A;  3CCM 3;  1A67 A;  2Z77 A;  4LEH A;  1Y4K A;  2KRT A;  2QIY A;  1VZZ A;  1O7G B;  3OW2 2;  3ECF A;  3HK4 A;  1L5G B;  2OWP A;  3T8N A;  4R9L A;  4ZM8 A;  2W0Q A;  3JUP A;  3KSE D;  1OUN A;  3VSY A;  1OHO A;  3VF1 A;  2CWV A;  1YJN 3;  3CD6 3;  3EQQ B;  2UX0 A;  4CCV A;  2QGU A;  5IEP A;  4NHF A;  4RNZ A;  3X42 A;  3NM2 A;  2K54 A;  4HYZ A;  2GEY A;  1O7H B;  3RGA A;  1JB4 A;  4CDL A;  2XR8 B;  1QAL A;  3F7X A;  3CCU 3;  3FH1 A;  4N6L A;  1A2V A;  1YJ9 3;  4N6M A;  1E3V A;  3SVA A;  3I55 3;  1W6G A;  1Z1S A;  1IQ8 A;  1YGE A;  3B4O A;  3GZX B;  2I9W A;  1FA3 A;  3FKA A;  2FXT A;  4HM8 B;  2CHC A;  1EA2 A;  3Q90 A;  4IPB A;  3KSP A;  2BHM A;  4KFF A;  2B1X B;  5FW5 A;  1IK3 A;  1UUW B;  4I4K A;  5D81 A;  2A15 A;  1O7M B;  2V1L A;  3CNM A;  5EQL A;  2HMM B;  1RRH A;  4KFD A;  1W02 A;  3HX8 A;  1AVK A;  2B24 B;  2XFT A;  3V99 A;  3BNC A;  4J8T A;  4K90 B;  2E2U A;  3GRD A;  3V92 A;  1UW1 A;  5I97 A;  3H51 A;  2O3O A;  3G4S 3;  1IQX A;  2Z6B A;  3LH4 A;  1VQ5 3;  5ELU A;  1VQM 3;  1FGM A;  1W4N A;  5TGN A;  3CCL 3;  1Q40 B;  3BB9 A;  4WYK B;  2HMN B;  2HML B;  3JUQ A;  1N8Q A;  2KXG A;  3FG3 A;  1GYB A;  3DGN A;  1EG9 B;  4HM1 B;  1WTH A;  1W6Y A;  3SED A;  4KVH A;  1IT8 A;  2P0X A;  4K1U A;  3T8U A;  4BTY A;  3E99 A;  1KQS 2;  1M9G A;  1VQ8 3;  4MMY B;  4HM3 B;  3J7Y d;  1NB5 I;  3JUM A;  3LYG A;  3GWR A;  1T5Y A;  3LTA A;  1K73 4;  5AEU B;  1S72 3;  2RSX A;  2YFL B;  4STD A;  3CMA 3;  2XGL A;  1EKM A;  4KZ1 A;  4WP5 A;  1D6Z A;  3OV4 A;  2HMJ B;  5D83 A;  4GB5 A;  5D82 A;  3FSD A;  2Y74 A;  2W2C A;  1GY7 A;  4RNY A;  2HMO B;  3EB8 A;  3EN8 A;  2W04 A;  5HGR A;  4ORL A;  5STD A;  3MG3 A;  3PXM A;  4HM7 B;  5ELJ A;  5BXQ A;  5CLK A;  1AR0 A;  1QJG A;  1IU7 A;  1IVU A;  5AII A;  4EYC A;  1YIT 3;  1A2K A;  1O7W B;  3KII A;  1SPU A;  3DY5 A;  4PEJ A;  3MKI A;  3Q1C A;  3X41 A;  8CHO A;  1Q7Y 4;  5DRV A;  1HKX A;  1NU3 A;  1MOL A;  5G2G A;  1ZX2 A;  1UI8 A;  2PZV A;  3NV0 B;  2PNC A;  4NRE A;  7STD A;  2L4V A;  4FMA A;  3S67 A;  3NBR A;  3MG1 A;  4N3V A;  2CFG A;  2HMK B;  4HVN A;  4WYK A;  1LXE A;  2P09 A;  3N54 B;  4R4K A;  1TU5 A;  4XDV A;  2OCT A;  3EX9 A;  2E2V A;  5BVB A;  4N6V 0;  3G8Z A;  1NJI 4;  3QK9 A;  3HII A;  4OK0 A;  1E3R A;  3B8L A;  3L0R A;  1IVW A;  4O2H A;  2CIU A;  2F98 A;  5LC7 A;  1W7C A;  4G1M B;  2CG0 A;  3MSO A;  3MG2 A;  3OWY A;  1IDP A;  3FZW A;  1N5P A;  1QAK A;  2XF3 A;  2F99 A;  4IT7 A;  3HZP A;  4X2H A;  3DZL A;  3X3Y A;  1QAF A;  3SLU A;  2CFW A;  4L7K A;  1VQ9 3;  3MWZ A;  1IT7 A;  1UUV B;  3I56 3;  1RRL A;  4MMX B;  3K63 A;  3MHE A;  5AI1 A;  5EEO A;  1OGX A;  1D6U A;  3ALA A;  4LMI A;  3K9M C;  1O7N B;  1M1X B;  3STD A;  1Q81 4;  4AEQ A;  1N8R 4;  1YJW 3;  1W2Z A;  1U5O A;  3M8C A;  3GZY B;  3A76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...