3URPA

Re-refinement of pdb entry 5rnt - ribonuclease t1 with guanosine-3',5'-diphosphate and phosphate ion bound
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
CDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
molecule tags Hydrolase
total genus 26
structure length 103
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3urpA00
1LNIA 1I3IA 1HYFA 1JBRA 1BU4A 1BANA 1I0XA 1TRQA 2F5MA 1MGRA 1RLSA 1BSEA 1B2UA 1I3FA 2SARA 3AHWA 1CH0A 1RN1A 1G02A 1SARA 1TRPA 2RBIA 1UCLA 1BNEA 1RGGA 1A2PA 3D4AA 1X1YA 2RNTA 1PYLA 2KF5A 2AAEA 1I2EA 1BRSA 4J5GA 2BU4A 4HOHA 1BRJA 1RSNA 1IYYA 2HOHA 1LOVA 3RNTA 3BU4A 1DETA 5GSPA 1LRAA 2KAAA 1YGWA 2GSPA 5BU4A 1GMRA 4RNTA 7GSPA 1I70A 1BRHA 1RN4A 3HOHA 1BSBA 1FZUA 3KCHA 1T2IA 1B27A 2F4YA 1UCJA 4BIRA 1B2ZA 5HOHA 2AADA 1BNFA 3D5GA 1FUTA 1FUSA 4HAAA 1BVIA 1ZGXA 1GOYA 1RDSA 1I8VA 1RCLA 2KF6A 1GMQA 1B2SA 1UCKA 1AQZA 1RGLA 1UCIA 1FYSA 1BNRA 2C4BA 1BNGA 3Q3FA 3GSPA 1DE3A 1AY7A 1BAOA 3DGYA 2KF3A 8RNTA 1RGKA 1JBTA 3DH2A 2ZA4A 1BOXA 1BSAA 9RNTA 1BIRA 1LOWA 1BRNL 5BIRA 1BNJA 3SYUA 5RNTA 2KF4A 3AGOA 1RNTA 2F5WA 1BGSA 1YVSA 2BIRA 1GOUA 1B21A 1FW7A 1BNSA 1BRKA 4GHOA 1RGEA 1B20A 1I2GA 3AHSA 3URPA 1RHLA 1I2FA 1HZ1A 6RNTA 1GSPA 1RGFA 1X1WA 3BIRA 1BRIA 1RGAA 1Q9EA 1B2MA 1TTOA 1RTUA 1PY3A 1RGCA 1GMPA 1BUJA 1RGHA 1I0VA 1B3SA 7RNTA 1BRGA 2F56A 1X1XA 4GSPA 1LOYA 6GSPA 1GOVA 1JBSA 1R4YA 1BNIA 1RMSA 1RNBA 1BSDA 1C54A 1RCKA 1MGWA 1X1UA 4J5KA 1T2HA 3AGNA 4BU4A 3A5EA 3WR2A 3WHOA 3D5IA 1YNVX 1B2XA 1BSCA
chains in the Genus database with same CATH superfamily
1LNIA 4EC6A 1I3IA 1DMNA 4R9KA 1VQ53 3EJVA 1JB4A 4AKZA 5IW9A 3RDEA 1BANA 1I0XA 4KT3B 3VGNA 4CJNA 1RLSA 1SIHA 2XSOB 2CFWA 4NHFA 2SARA 3CXC2 1AV4A 2PZVA 1AR0A 1G02A 1SARA 3LMLA 4FMDA 4HVNA 1D6UA 3SVAA 1ZX2A 3TDGA 3WA3A 1YIT3 1ZO2A 1NJI4 3EQQB 4KFDA 2WGQA 2FGTA 1A2PA 3D4AA 4DKIA 3OW22 4G1MB 4FMAA 4N6NB 1IQYA 1OH0A 3CU3A 2CG1A 5FGOA 2RNTA 4KFFA 5IG4A 3NBJA 2Z76A 4L7KA 5IF6A 2KF5A 2STDA 3EBYA 1UUWB 3S67A 3BNCA 4J5GA 4LMIA 5M19A 3JUPA 3ZG5A 3KN4A 3F7XA 1RSNA 1VQK3 1GD4A 2OQEC 3EC9A 1VQQA 3CMA3 1IYYA 1LOVA 3J7Yd 3RNTA 2IMJA 3I553 1PFPA 4HM5B 3NXJA 4HZBB 5D82A 2IUJA 3LT8A 3QRDA 1VQP3 1MOLA 3O8YA 2PNCA 4KZ1A 3DGLA 1GMRA 2CX1A 2ZL8A 1IV9A 1MWUA 1FZUA 5JBSA 1T2IA 3NV0B 1B27A 1A2VA 4MMZB 2RGQA 1O7GB 5HOHA 2XSHB 4OK0A 1UGIA 4FMBA 1NB3I 1BVIA 2HMJB 3MSOA 1ZGXA 2B24B 2KF6A 3IMAB 3NV0A 1RJOA 1SIIA 3X3YA 1FGMA 1WQLB 2RFRA 1G96A 3G0KA 4HM0B 2INXA 1BNGA 1DE3A 2SBLA 3FG3A 3DGYA 3ECFA 2CC3A 3GSPA 4FCZA 2HMKB 1QJGA 8RNTA 1N5PA 1Q824 1JBTA 1BOXA 1BSAA 2LYXA 4L8PA 3HIGA 1S5AA 1EG9B 2QIYA 3WODG 3CPW2 5EQLA 5BIRA 1BNJA 2YFJB 1G0TA 1DVCA 2HMMB 1TJDA 3B8LA 4EXRA 1NDOB 2P0XA 3U97A 5CF1A 1QMAA 2IY2A 3AGOA 3GRDA 3OV4A 4XM4A 5LC7A 3ZG0A 1IK3A 1E3VA 2JQ5A 1KQS2 3X41A 1GYBA 2P09A 3BLZA 3PCRA 4AKYA 2V1LA 4KVHA 2BT3A 3FG4A 1LNHA 2GU1A 3LTCA 4XDVA 5AIHA 1I2GA 2GBXB 1MWTA 1DYUA 1SJWA 2P05A 1JKGB 4HM2B 4U13A 6RNTA 1X1WA 1OHOA 3STDA 3GZXB 3LOYA 4GL6A 3WMDA 6STDA 1Q9EA 1TP6A 4IPBA 3WOEB 1MWRA 1A90A 1PY3A 2E2VA 5BVBA 1RGCA 3X3XA 1GMPA 2F99A 1CEWI 3LH4A 3OWYA 3L0RA 5AYRB 2Z77A 2OTL3 4GSPA 3EF8A 1LOYA 3ER7A 1C54A 2GEYA 1IDPA 1TIJA 4Q53A 1RCKA 1MGWA 1OGXA 1X1UA 2YX9A 1T3BA 3AGNA 1VQM3 1YJ93 1J2BA 2CWTA 2FNQA 3WHOA 3WR2A 5DREA 3ALAA 1VQL3 1B2XA 1JN5B 4QWTA 3DUKA 3FF0A 1HYFA 1JBRA 1O7HB 3LTDA 3MG1A 3BNBA 3K7CA 1YJW3 2ML5A 1N9JA 1TFKA 1JN5A 3UL6A 3NM2A 5KP4A 3EB8A 1GY6A 3G6E3 2QA43 1TRPA 3AMOA 3FSDA 2BMRB 2W0QA 3S5CA 1DMMA 2GBWB 3FGYA 3CCE3 1W4NA 3H51A 3CC73 2BO9B 3JUNA 1X1YA 4BTYA 1LVNA 2OCTA 3MPHA 4WHAA 3BNEA 3GWRA 2AAEA 3T0UA 1BRSA 4HOHA 2F98A 8CHOA 1L5GB 1Q814 2W9QA 2HOHA 1GY5A 2M7OA 2RCDA 2H0HA 1Q40B 4BL3A 3FF2A 4WYKB 4HM8B 3CC23 1DETA 3BNDA 3MWZA 2W9PA 2GSPA 3OWUA 1LXEA 2R41A 5BU4A 4JF8A 1PU4A 2ML6A 5CLKA 1K9M4 1I70A 4MEIA 3HOHA 1UI8A 2J8XB 1TUHA 2XFSA 1BSBA 4MMXB 2O9UX 3KKGA 4WYKA 2E2UA 1U5OA 2XH9A 1QAKA 3EHCA 2F4YA 3NQZA 1UCJA 2KRTA 2WO0A 3F8HA 4BIRA 5CXOA 3D5GA 3B4OA 4FR9A 1FUSA 3CD63 4HAAA 3PXMA 3RGAA 2CFKA 4I4KA 3PZWA 3Q90A 1OCVA 1ASKA 4N6MA 2OOVC 1QVG2 1AVLA 1ROAA 4K1VA 1UCIA 1TU5A 2QGUA 7STDA 1BAOA 3DGMA 4O8SA 4STDA 3IPTA 5EEOA 3GAXA 1BIRA 1LOWA 5ELUA 3F40A 4RNZA 1UDII 1VQO3 3SYUA 3CCR3 2H0IA 2D42A 3CCS3 1IV7A 2KF4A 3G16A 4LYLB 1W6GA 3DXOA 2CKFB 1R4CA 2Q07A 1DMQA 3NBRA 1ULJB 1W2ZA 2Y74A 4HM7B 4R9LA 2F5WA 1W7CA 1YVSA 1FGRA 1M9GA 4TX4A 1CYVA 2BIRA 3A76A 2CX0A 1M1K4 1ULIB 1M904 1O7MB 1FW7A 1BNSA 2OQEA 3GZBA 1IT8A 3LTBA 1NB5I 2UUGC 3D79A 4N3VA 3URPA 4FMCA 1RHLA 1D6YA 1I2FA 1WTHA 3NHXA 4CPKA 5JPPA 1JV2B 5AEUB 1W6YA 5KP3A 1EA2A 3F14A 3SOYA 1VQ43 1TTOA 1RTUA 1V58A 3PGBA 3I0YA 1BUJA 1JRQA 1VQ83 1I0VA 5D81A 2Z7AA 2WGOA 2OTJ3 4AEQA 3GZRA 1FGQA 2BHMA 6GSPA 1GOVA 2A15A 1Q7HA 1JZOA 4EV2A 1RNBA 1BSDA 3Q2PA 1OACA 1KSIA 4ORLA 5CK6A 3NUVA 3CCV3 1VQ73 3V99A 3EN8A 3K9MC 1V57A 2XF3A 3KE7A 5G2GA 4BU4A 3A5EA 5CF2A 3D5IA 1NNVA 1WMOA 3D3LA 1JNQA 1BU4A 3FCSB 1W2B2 5BXQA 2XFTA 4H61A 3CNMA 2F86B 1FGOA 4FCJA 3U1WA 2F5MA 1TRQA 1AVKA 3CCU3 1B2UA 4OUQA 3AHWA 3UNLA 3S28A 2RBIA 1UCLA 1E3RA 3F8XA 4IIAA 1JKGA 1RGGA 2W03A 3HX8A 3HZPA 4XBYA 3SEDA 3T8UA 1S723 3DMCA 4L8OA 4WP5A 2W6JH 4XB5A 1YI23 3KSPA 3F7SA 4X2HA 2W56B 2ZDJA 1YHQ3 1IVUA 1I2EA 1WMNA 5FW5A 1HU9A 2P0MA 3UB1A 2BU4A 4XBXA 1M1XB 1IU7A 4R1KA 4RZMA 2CFGA 3RGRA 3VSYA 2Z6BA 3NQYA 2L1SA 1OGZA 3BU4A 3MYTA 2W56A 3N54B 3GZYB 3WDGB 1DVDA 5JPUA 5GSPA 3JVCA 1IT7A 1LRAA 2E2TA 2L4VA 1YGWA 1KC84 3CC43 2HMOB 2O3OA 1EQKA 1K734 2HMLB 3BB9A 1JB5A 2P38A 3OWSA 4RNTA 2QEX3 1VQ63 1RRHA 1BRHA 1QAFA 2YFLB 1IVVA 1EKMA 1W02A 1B2ZA 1ISKA 4RBNA 3MG2A 5AIGA 2AADA 1O7PB 1WNHA 3FG1A 3K0ZA 4LSOA 5G1LA 4EV5A 3UL5A 5AIIA 2JDIH 1RDSA 1I8VA 3HK4A 5M18A 1GMQA 5STDA 2CWVA 1LQMB 3EX9A 4LZIA 5IG5A 1KWIA 1FYSA 3B4PA 1RKYA 1BNRA 3LT9A 1YVBI 4GB5A 1AY7A 3I563 1IQXA 2XRXB 1GD3A 1Q42A 5EVHA 4J8TA 5KP1A 3PS8A 2R4IA 3KSED 1FA3A 1BRNL 2MC8A 3LYGA 1Q864 2CHCA 3K63A 1OHSA 1FGTA 1Q40A 5AEWB 1GS3A 4HM1B 3MG3A 3H3HA 3HI7A 3CPOA 1RNTA 1A67A 4N6TA 1N8QA 1QALA 2MF7A 3X40A 1UGHI 1BGSA 4K1UA 1T5YA 3D9RA 3IJEB 1BUQA 1GOUA 1B21A 2H0GA 3WA2X 4HKVB 3N8BA 1OHPA 3EBTA 4GHOA 1RGEA 4EYCA 2W04A 1IQ8A 3CCQ3 3LTAA 4HJLB 1HZ1A 3FKAA 2I9WA 1CYUA 3VF1A 2BMQB 5IG3A 3SLUA 1EUIC 1MNLA 4K90B 1RGAA 2CG0A 1IVXA 3NM7A 3X42A 3SOAA 2CFLA 5IEOA 3DGNA 1Y4KA 2D1WA 3LXUX 1YGEA 2K3DA 1QVF2 1RGHA 1K41A 1B3SA 2XEPA 4CCVA 1BRGA 2F56A 1X1XA 3DGOA 3CME3 1KD14 4RNYA 3KZTA 1RN7A 1CQSA 2KCDA 2K54A 3SX1A 3M8CA 4HM4B 1T2HA 1RRLA 4EBGA 5HGRA 2GEXA 3FH1A 2OOVA 3JUOA 3ZFZA 1YNVX 1OUNA 1BSCA 2C11A 4NREA 5I97A 3E99A 3PYJA 4WWUC 4N6OB 3G713 1TFOA 2UGIA 4WFOA 5A0OB 1UUVB 1D6ZA 1HKXA 4MMYB 5G1KA 4BTWA 1MGRA 1W00A 1BSEA 4R4KA 1I3FA 1OF5B 1Q7Y4 1CH0A 1RN1A 4N6UA 5IENA 3K5TA 5ELJA 1O7NB 3EE1A 1U8CB 1BNEA 1IVWA 1MWSA 3F9SA 1W5ZA 3JUQA 2ZHXB 3QK9A 2C10A 1NU3A 4EW5A 5AIFA 3KFQC 1OF5A 1Z1SA 4IT7A 3DM8A 4HZ9B 4XDWA 2CWUA 3MKIA 3DY5A 1GY7A 1PYLA 3CNXA 3UJMA 1ROVA 2RSXA 3FZWA 4MJDA 2KXGA 1BRJA 4OVMA 1F8NA 2OWPA 1K8A4 3G8ZA 3ROBA 2CK3H 3OXAA 3JUMA 5IERA 2LQVA 3N9HA 4O3VA 5D83A 4I5QA 2KAAA 3PCSA 1A2KA 4J9AA 1FUWA 1E97A 2XGNA 4O02B 5AYSC 1SQWA 7GSPA 1RN4A 1JJ22 3KCHA 1VQN3 2UX0A 2W2CA 3V98A 3KIIA 2IUKA 2IA7A 4LGQA 2CFDA 1W01A 1BNFA 1N5HA 1FUTA 1NWWA 1UUGB 4XBTA 2WOFA 1US1A 4NPBA 5IEPA 4X2OA 1GOYA 1RCLA 3FLJA 1JB2A 1UCKA 1B2SA 2GU3A 3OX9A 1NO3A 1K28A 1AQZA 1RGLA 1UI7A 1YJN3 4HM6B 3CCM3 2C4BA 2HMNB 1VZZA 3EN1B 4HBRA 4K61A 3Q3FA 4FCMA 2KF3A 1RGKA 4HYZA 3DH2A 3SXXA 2ZA4A 3V92A 3S27A 1V74A 4ILFA 9RNTA 2BMOB 4N6LA 1LQGC 5RNTA 3MHEA 1STFI 2XGLA 3NBBA 2XR8B 2CH9A 1JZDA 2B1XB 2YFIB 4ZM8A 1STDA 1VQ93 3DZLA 1LOXA 3LZAA 4N6V0 4CDLA 2K0MA 1BRKA 1UW1A 3AMOB 1B20A 1N8R4 4H3UA 4BL2A 3T8NA 3AHSA 3S29A 4R80A 5IG0A 5LC6A 2WOHA 1GSPA 2Y73A 1RGFA 2CIUA 4JRFA 1O7WB 1BRIA 1SPUA 3BIRA 5AI1A 4LEHA 5M1AA 2IYJA 4KFEA 4O2HA 1EEJA 1WMPA 1B2MA 3CCL3 2GXFA 3CCJ3 3WOFB 1ZS7A 7RNTA 2FXTA 4PEJA 3G4S3 3HIIA 1YIJ3 3Q1CA 4BTXA 1JBSA 2CW9A 1R4YA 1RMSA 1BNIA 5TGNA 4J5KA 4HM3B 2BNGA 1N9EA 3NX0A 3X3ZA 1OPYA 3B7CA 5DRVA 1C7HA 1W6CA
chains in the Genus database with same CATH topology
1LNIA 1I3IA 1HYFA 1JBRA 1BU4A 1BANA 1I0XA 1TRQA 2F5MA 1MGRA 1RLSA 1BSEA 1B2UA 1I3FA 2SARA 3AHWA 1CH0A 1RN1A 1G02A 1SARA 1TRPA 2RBIA 1UCLA 1BNEA 1RGGA 1A2PA 3D4AA 1X1YA 2RNTA 1PYLA 2KF5A 2AAEA 1I2EA 1BRSA 4J5GA 2BU4A 4HOHA 1BRJA 1RSNA 1IYYA 2HOHA 1LOVA 3RNTA 3BU4A 1DETA 5GSPA 1LRAA 2KAAA 1YGWA 2GSPA 5BU4A 1GMRA 4RNTA 7GSPA 1I70A 1BRHA 1RN4A 3HOHA 1BSBA 1FZUA 3KCHA 1T2IA 1B27A 2F4YA 1UCJA 4BIRA 1B2ZA 5HOHA 2AADA 1BNFA 3D5GA 1FUTA 1FUSA 4HAAA 1BVIA 1ZGXA 1GOYA 1RDSA 1I8VA 1RCLA 2KF6A 1GMQA 1B2SA 1UCKA 1AQZA 1RGLA 1UCIA 1FYSA 1BNRA 2C4BA 1BNGA 3Q3FA 3GSPA 1DE3A 1AY7A 1BAOA 3DGYA 2KF3A 8RNTA 1RGKA 1JBTA 3DH2A 2ZA4A 1BOXA 1BSAA 9RNTA 1BIRA 1LOWA 1BRNL 5BIRA 1BNJA 3SYUA 5RNTA 2KF4A 3AGOA 1RNTA 2F5WA 1BGSA 1YVSA 2BIRA 1GOUA 1B21A 1FW7A 1BNSA 1BRKA 4GHOA 1RGEA 1B20A 1I2GA 3AHSA 3URPA 1RHLA 1I2FA 1HZ1A 6RNTA 1GSPA 1RGFA 1X1WA 3BIRA 1BRIA 1RGAA 1Q9EA 1B2MA 1TTOA 1RTUA 1PY3A 1RGCA 1GMPA 1BUJA 1RGHA 1I0VA 1B3SA 7RNTA 1BRGA 2F56A 1X1XA 4GSPA 1LOYA 6GSPA 1GOVA 1JBSA 1R4YA 1BNIA 1RMSA 1RNBA 1BSDA 1C54A 1RCKA 1MGWA 1X1UA 4J5KA 1T2HA 3AGNA 4BU4A 3A5EA 3WR2A 3WHOA 3D5IA 1YNVX 1B2XA 1BSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNI A;  1I3I A;  1HYF A;  1JBR A;  1BU4 A;  1BAN A;  1I0X A;  1TRQ A;  2F5M A;  1MGR A;  1RLS A;  1BSE A;  1B2U A;  1I3F A;  2SAR A;  3AHW A;  1CH0 A;  1RN1 A;  1G02 A;  1SAR A;  1TRP A;  2RBI A;  1UCL A;  1BNE A;  1RGG A;  1A2P A;  3D4A A;  1X1Y A;  2RNT A;  1PYL A;  2KF5 A;  2AAE A;  1I2E A;  1BRS A;  4J5G A;  2BU4 A;  4HOH A;  1BRJ A;  1RSN A;  1IYY A;  2HOH A;  1LOV A;  3RNT A;  3BU4 A;  1DET A;  5GSP A;  1LRA A;  2KAA A;  1YGW A;  2GSP A;  5BU4 A;  1GMR A;  4RNT A;  7GSP A;  1I70 A;  1BRH A;  1RN4 A;  3HOH A;  1BSB A;  1FZU A;  3KCH A;  1T2I A;  1B27 A;  2F4Y A;  1UCJ A;  4BIR A;  1B2Z A;  5HOH A;  2AAD A;  1BNF A;  3D5G A;  1FUT A;  1FUS A;  4HAA A;  1BVI A;  1ZGX A;  1GOY A;  1RDS A;  1I8V A;  1RCL A;  2KF6 A;  1GMQ A;  1B2S A;  1UCK A;  1AQZ A;  1RGL A;  1UCI A;  1FYS A;  1BNR A;  2C4B A;  1BNG A;  3Q3F A;  3GSP A;  1DE3 A;  1AY7 A;  1BAO A;  3DGY A;  2KF3 A;  8RNT A;  1RGK A;  1JBT A;  3DH2 A;  2ZA4 A;  1BOX A;  1BSA A;  9RNT A;  1BIR A;  1LOW A;  1BRN L;  5BIR A;  1BNJ A;  3SYU A;  5RNT A;  2KF4 A;  3AGO A;  1RNT A;  2F5W A;  1BGS A;  1YVS A;  2BIR A;  1GOU A;  1B21 A;  1FW7 A;  1BNS A;  1BRK A;  4GHO A;  1RGE A;  1B20 A;  1I2G A;  3AHS A;  3URP A;  1RHL A;  1I2F A;  1HZ1 A;  6RNT A;  1GSP A;  1RGF A;  1X1W A;  3BIR A;  1BRI A;  1RGA A;  1Q9E A;  1B2M A;  1TTO A;  1RTU A;  1PY3 A;  1RGC A;  1GMP A;  1BUJ A;  1RGH A;  1I0V A;  1B3S A;  7RNT A;  1BRG A;  2F56 A;  1X1X A;  4GSP A;  1LOY A;  6GSP A;  1GOV A;  1JBS A;  1R4Y A;  1BNI A;  1RMS A;  1RNB A;  1BSD A;  1C54 A;  1RCK A;  1MGW A;  1X1U A;  4J5K A;  1T2H A;  3AGN A;  4BU4 A;  3A5E A;  3WR2 A;  3WHO A;  3D5I A;  1YNV X;  1B2X A;  1BSC A; 
#chains in the Genus database with same CATH topology
 1LNI A;  4EC6 A;  1I3I A;  1DMN A;  4R9K A;  1VQ5 3;  3EJV A;  1JB4 A;  4AKZ A;  5IW9 A;  3RDE A;  1BAN A;  1I0X A;  4KT3 B;  3VGN A;  4CJN A;  1RLS A;  1SIH A;  2XSO B;  2CFW A;  4NHF A;  2SAR A;  3CXC 2;  1AV4 A;  2PZV A;  1AR0 A;  1G02 A;  1SAR A;  3LML A;  4FMD A;  4HVN A;  1D6U A;  3SVA A;  1ZX2 A;  3TDG A;  3WA3 A;  1YIT 3;  1ZO2 A;  1NJI 4;  3EQQ B;  4KFD A;  2WGQ A;  2FGT A;  1A2P A;  3D4A A;  4DKI A;  3OW2 2;  4G1M B;  4FMA A;  4N6N B;  1IQY A;  1OH0 A;  3CU3 A;  2CG1 A;  5FGO A;  2RNT A;  4KFF A;  5IG4 A;  3NBJ A;  2Z76 A;  4L7K A;  5IF6 A;  2KF5 A;  2STD A;  3EBY A;  1UUW B;  3S67 A;  3BNC A;  4J5G A;  4LMI A;  5M19 A;  3JUP A;  3ZG5 A;  3KN4 A;  3F7X A;  1RSN A;  1VQK 3;  1GD4 A;  2OQE C;  3EC9 A;  1VQQ A;  3CMA 3;  1IYY A;  1LOV A;  3J7Y d;  3RNT A;  2IMJ A;  3I55 3;  1PFP A;  4HM5 B;  3NXJ A;  4HZB B;  5D82 A;  2IUJ A;  3LT8 A;  3QRD A;  1VQP 3;  1MOL A;  3O8Y A;  2PNC A;  4KZ1 A;  3DGL A;  1GMR A;  2CX1 A;  2ZL8 A;  1IV9 A;  1MWU A;  1FZU A;  5JBS A;  1T2I A;  3NV0 B;  1B27 A;  1A2V A;  4MMZ B;  2RGQ A;  1O7G B;  5HOH A;  2XSH B;  4OK0 A;  1UGI A;  4FMB A;  1NB3 I;  1BVI A;  2HMJ B;  3MSO A;  1ZGX A;  2B24 B;  2KF6 A;  3IMA B;  3NV0 A;  1RJO A;  1SII A;  3X3Y A;  1FGM A;  1WQL B;  2RFR A;  1G96 A;  3G0K A;  4HM0 B;  2INX A;  1BNG A;  1DE3 A;  2SBL A;  3FG3 A;  3DGY A;  3ECF A;  2CC3 A;  3GSP A;  4FCZ A;  2HMK B;  1QJG A;  8RNT A;  1N5P A;  1Q82 4;  1JBT A;  1BOX A;  1BSA A;  2LYX A;  4L8P A;  3HIG A;  1S5A A;  1EG9 B;  2QIY A;  3WOD G;  3CPW 2;  5EQL A;  5BIR A;  1BNJ A;  2YFJ B;  1G0T A;  1DVC A;  2HMM B;  1TJD A;  3B8L A;  4EXR A;  1NDO B;  2P0X A;  3U97 A;  5CF1 A;  1QMA A;  2IY2 A;  3AGO A;  3GRD A;  3OV4 A;  4XM4 A;  5LC7 A;  3ZG0 A;  1IK3 A;  1E3V A;  2JQ5 A;  1KQS 2;  3X41 A;  1GYB A;  2P09 A;  3BLZ A;  3PCR A;  4AKY A;  2V1L A;  4KVH A;  2BT3 A;  3FG4 A;  1LNH A;  2GU1 A;  3LTC A;  4XDV A;  5AIH A;  1I2G A;  2GBX B;  1MWT A;  1DYU A;  1SJW A;  2P05 A;  1JKG B;  4HM2 B;  4U13 A;  6RNT A;  1X1W A;  1OHO A;  3STD A;  3GZX B;  3LOY A;  4GL6 A;  3WMD A;  6STD A;  1Q9E A;  1TP6 A;  4IPB A;  3WOE B;  1MWR A;  1A90 A;  1PY3 A;  2E2V A;  5BVB A;  1RGC A;  3X3X A;  1GMP A;  2F99 A;  1CEW I;  3LH4 A;  3OWY A;  3L0R A;  5AYR B;  2Z77 A;  2OTL 3;  4GSP A;  3EF8 A;  1LOY A;  3ER7 A;  1C54 A;  2GEY A;  1IDP A;  1TIJ A;  4Q53 A;  1RCK A;  1MGW A;  1OGX A;  1X1U A;  2YX9 A;  1T3B A;  3AGN A;  1VQM 3;  1YJ9 3;  1J2B A;  2CWT A;  2FNQ A;  3WHO A;  3WR2 A;  5DRE A;  3ALA A;  1VQL 3;  1B2X A;  1JN5 B;  4QWT A;  3DUK A;  3FF0 A;  1HYF A;  1JBR A;  1O7H B;  3LTD A;  3MG1 A;  3BNB A;  3K7C A;  1YJW 3;  2ML5 A;  1N9J A;  1TFK A;  1JN5 A;  3UL6 A;  3NM2 A;  5KP4 A;  3EB8 A;  1GY6 A;  3G6E 3;  2QA4 3;  1TRP A;  3AMO A;  3FSD A;  2BMR B;  2W0Q A;  3S5C A;  1DMM A;  2GBW B;  3FGY A;  3CCE 3;  1W4N A;  3H51 A;  3CC7 3;  2BO9 B;  3JUN A;  1X1Y A;  4BTY A;  1LVN A;  2OCT A;  3MPH A;  4WHA A;  3BNE A;  3GWR A;  2AAE A;  3T0U A;  1BRS A;  4HOH A;  2F98 A;  8CHO A;  1L5G B;  1Q81 4;  2W9Q A;  2HOH A;  1GY5 A;  2M7O A;  2RCD A;  2H0H A;  1Q40 B;  4BL3 A;  3FF2 A;  4WYK B;  4HM8 B;  3CC2 3;  1DET A;  3BND A;  3MWZ A;  2W9P A;  2GSP A;  3OWU A;  1LXE A;  2R41 A;  5BU4 A;  4JF8 A;  1PU4 A;  2ML6 A;  5CLK A;  1K9M 4;  1I70 A;  4MEI A;  3HOH A;  1UI8 A;  2J8X B;  1TUH A;  2XFS A;  1BSB A;  4MMX B;  2O9U X;  3KKG A;  4WYK A;  2E2U A;  1U5O A;  2XH9 A;  1QAK A;  3EHC A;  2F4Y A;  3NQZ A;  1UCJ A;  2KRT A;  2WO0 A;  3F8H A;  4BIR A;  5CXO A;  3D5G A;  3B4O A;  4FR9 A;  1FUS A;  3CD6 3;  4HAA A;  3PXM A;  3RGA A;  2CFK A;  4I4K A;  3PZW A;  3Q90 A;  1OCV A;  1ASK A;  4N6M A;  2OOV C;  1QVG 2;  1AVL A;  1ROA A;  4K1V A;  1UCI A;  1TU5 A;  2QGU A;  7STD A;  1BAO A;  3DGM A;  4O8S A;  4STD A;  3IPT A;  5EEO A;  3GAX A;  1BIR A;  1LOW A;  5ELU A;  3F40 A;  4RNZ A;  1UDI I;  1VQO 3;  3SYU A;  3CCR 3;  2H0I A;  2D42 A;  3CCS 3;  1IV7 A;  2KF4 A;  3G16 A;  4LYL B;  1W6G A;  3DXO A;  2CKF B;  1R4C A;  2Q07 A;  1DMQ A;  3NBR A;  1ULJ B;  1W2Z A;  2Y74 A;  4HM7 B;  4R9L A;  2F5W A;  1W7C A;  1YVS A;  1FGR A;  1M9G A;  4TX4 A;  1CYV A;  2BIR A;  3A76 A;  2CX0 A;  1M1K 4;  1ULI B;  1M90 4;  1O7M B;  1FW7 A;  1BNS A;  2OQE A;  3GZB A;  1IT8 A;  3LTB A;  1NB5 I;  2UUG C;  3D79 A;  4N3V A;  3URP A;  4FMC A;  1RHL A;  1D6Y A;  1I2F A;  1WTH A;  3NHX A;  4CPK A;  5JPP A;  1JV2 B;  5AEU B;  1W6Y A;  5KP3 A;  1EA2 A;  3F14 A;  3SOY A;  1VQ4 3;  1TTO A;  1RTU A;  1V58 A;  3PGB A;  3I0Y A;  1BUJ A;  1JRQ A;  1VQ8 3;  1I0V A;  5D81 A;  2Z7A A;  2WGO A;  2OTJ 3;  4AEQ A;  3GZR A;  1FGQ A;  2BHM A;  6GSP A;  1GOV A;  2A15 A;  1Q7H A;  1JZO A;  4EV2 A;  1RNB A;  1BSD A;  3Q2P A;  1OAC A;  1KSI A;  4ORL A;  5CK6 A;  3NUV A;  3CCV 3;  1VQ7 3;  3V99 A;  3EN8 A;  3K9M C;  1V57 A;  2XF3 A;  3KE7 A;  5G2G A;  4BU4 A;  3A5E A;  5CF2 A;  3D5I A;  1NNV A;  1WMO A;  3D3L A;  1JNQ A;  1BU4 A;  3FCS B;  1W2B 2;  5BXQ A;  2XFT A;  4H61 A;  3CNM A;  2F86 B;  1FGO A;  4FCJ A;  3U1W A;  2F5M A;  1TRQ A;  1AVK A;  3CCU 3;  1B2U A;  4OUQ A;  3AHW A;  3UNL A;  3S28 A;  2RBI A;  1UCL A;  1E3R A;  3F8X A;  4IIA A;  1JKG A;  1RGG A;  2W03 A;  3HX8 A;  3HZP A;  4XBY A;  3SED A;  3T8U A;  1S72 3;  3DMC A;  4L8O A;  4WP5 A;  2W6J H;  4XB5 A;  1YI2 3;  3KSP A;  3F7S A;  4X2H A;  2W56 B;  2ZDJ A;  1YHQ 3;  1IVU A;  1I2E A;  1WMN A;  5FW5 A;  1HU9 A;  2P0M A;  3UB1 A;  2BU4 A;  4XBX A;  1M1X B;  1IU7 A;  4R1K A;  4RZM A;  2CFG A;  3RGR A;  3VSY A;  2Z6B A;  3NQY A;  2L1S A;  1OGZ A;  3BU4 A;  3MYT A;  2W56 A;  3N54 B;  3GZY B;  3WDG B;  1DVD A;  5JPU A;  5GSP A;  3JVC A;  1IT7 A;  1LRA A;  2E2T A;  2L4V A;  1YGW A;  1KC8 4;  3CC4 3;  2HMO B;  2O3O A;  1EQK A;  1K73 4;  2HML B;  3BB9 A;  1JB5 A;  2P38 A;  3OWS A;  4RNT A;  2QEX 3;  1VQ6 3;  1RRH A;  1BRH A;  1QAF A;  2YFL B;  1IVV A;  1EKM A;  1W02 A;  1B2Z A;  1ISK A;  4RBN A;  3MG2 A;  5AIG A;  2AAD A;  1O7P B;  1WNH A;  3FG1 A;  3K0Z A;  4LSO A;  5G1L A;  4EV5 A;  3UL5 A;  5AII A;  2JDI H;  1RDS A;  1I8V A;  3HK4 A;  5M18 A;  1GMQ A;  5STD A;  2CWV A;  1LQM B;  3EX9 A;  4LZI A;  5IG5 A;  1KWI A;  1FYS A;  3B4P A;  1RKY A;  1BNR A;  3LT9 A;  1YVB I;  4GB5 A;  1AY7 A;  3I56 3;  1IQX A;  2XRX B;  1GD3 A;  1Q42 A;  5EVH A;  4J8T A;  5KP1 A;  3PS8 A;  2R4I A;  3KSE D;  1FA3 A;  1BRN L;  2MC8 A;  3LYG A;  1Q86 4;  2CHC A;  3K63 A;  1OHS A;  1FGT A;  1Q40 A;  5AEW B;  1GS3 A;  4HM1 B;  3MG3 A;  3H3H A;  3HI7 A;  3CPO A;  1RNT A;  1A67 A;  4N6T A;  1N8Q A;  1QAL A;  2MF7 A;  3X40 A;  1UGH I;  1BGS A;  4K1U A;  1T5Y A;  3D9R A;  3IJE B;  1BUQ A;  1GOU A;  1B21 A;  2H0G A;  3WA2 X;  4HKV B;  3N8B A;  1OHP A;  3EBT A;  4GHO A;  1RGE A;  4EYC A;  2W04 A;  1IQ8 A;  3CCQ 3;  3LTA A;  4HJL B;  1HZ1 A;  3FKA A;  2I9W A;  1CYU A;  3VF1 A;  2BMQ B;  5IG3 A;  3SLU A;  1EUI C;  1MNL A;  4K90 B;  1RGA A;  2CG0 A;  1IVX A;  3NM7 A;  3X42 A;  3SOA A;  2CFL A;  5IEO A;  3DGN A;  1Y4K A;  2D1W A;  3LXU X;  1YGE A;  2K3D A;  1QVF 2;  1RGH A;  1K41 A;  1B3S A;  2XEP A;  4CCV A;  1BRG A;  2F56 A;  1X1X A;  3DGO A;  3CME 3;  1KD1 4;  4RNY A;  3KZT A;  1RN7 A;  1CQS A;  2KCD A;  2K54 A;  3SX1 A;  3M8C A;  4HM4 B;  1T2H A;  1RRL A;  4EBG A;  5HGR A;  2GEX A;  3FH1 A;  2OOV A;  3JUO A;  3ZFZ A;  1YNV X;  1OUN A;  1BSC A;  2C11 A;  4NRE A;  5I97 A;  3E99 A;  3PYJ A;  4WWU C;  4N6O B;  3G71 3;  1TFO A;  2UGI A;  4WFO A;  5A0O B;  1UUV B;  1D6Z A;  1HKX A;  4MMY B;  5G1K A;  4BTW A;  1MGR A;  1W00 A;  1BSE A;  4R4K A;  1I3F A;  1OF5 B;  1Q7Y 4;  1CH0 A;  1RN1 A;  4N6U A;  5IEN A;  3K5T A;  5ELJ A;  1O7N B;  3EE1 A;  1U8C B;  1BNE A;  1IVW A;  1MWS A;  3F9S A;  1W5Z A;  3JUQ A;  2ZHX B;  3QK9 A;  2C10 A;  1NU3 A;  4EW5 A;  5AIF A;  3KFQ C;  1OF5 A;  1Z1S A;  4IT7 A;  3DM8 A;  4HZ9 B;  4XDW A;  2CWU A;  3MKI A;  3DY5 A;  1GY7 A;  1PYL A;  3CNX A;  3UJM A;  1ROV A;  2RSX A;  3FZW A;  4MJD A;  2KXG A;  1BRJ A;  4OVM A;  1F8N A;  2OWP A;  1K8A 4;  3G8Z A;  3ROB A;  2CK3 H;  3OXA A;  3JUM A;  5IER A;  2LQV A;  3N9H A;  4O3V A;  5D83 A;  4I5Q A;  2KAA A;  3PCS A;  1A2K A;  4J9A A;  1FUW A;  1E97 A;  2XGN A;  4O02 B;  5AYS C;  1SQW A;  7GSP A;  1RN4 A;  1JJ2 2;  3KCH A;  1VQN 3;  2UX0 A;  2W2C A;  3V98 A;  3KII A;  2IUK A;  2IA7 A;  4LGQ A;  2CFD A;  1W01 A;  1BNF A;  1N5H A;  1FUT A;  1NWW A;  1UUG B;  4XBT A;  2WOF A;  1US1 A;  4NPB A;  5IEP A;  4X2O A;  1GOY A;  1RCL A;  3FLJ A;  1JB2 A;  1UCK A;  1B2S A;  2GU3 A;  3OX9 A;  1NO3 A;  1K28 A;  1AQZ A;  1RGL A;  1UI7 A;  1YJN 3;  4HM6 B;  3CCM 3;  2C4B A;  2HMN B;  1VZZ A;  3EN1 B;  4HBR A;  4K61 A;  3Q3F A;  4FCM A;  2KF3 A;  1RGK A;  4HYZ A;  3DH2 A;  3SXX A;  2ZA4 A;  3V92 A;  3S27 A;  1V74 A;  4ILF A;  9RNT A;  2BMO B;  4N6L A;  1LQG C;  5RNT A;  3MHE A;  1STF I;  2XGL A;  3NBB A;  2XR8 B;  2CH9 A;  1JZD A;  2B1X B;  2YFI B;  4ZM8 A;  1STD A;  1VQ9 3;  3DZL A;  1LOX A;  3LZA A;  4N6V 0;  4CDL A;  2K0M A;  1BRK A;  1UW1 A;  3AMO B;  1B20 A;  1N8R 4;  4H3U A;  4BL2 A;  3T8N A;  3AHS A;  3S29 A;  4R80 A;  5IG0 A;  5LC6 A;  2WOH A;  1GSP A;  2Y73 A;  1RGF A;  2CIU A;  4JRF A;  1O7W B;  1BRI A;  1SPU A;  3BIR A;  5AI1 A;  4LEH A;  5M1A A;  2IYJ A;  4KFE A;  4O2H A;  1EEJ A;  1WMP A;  1B2M A;  3CCL 3;  2GXF A;  3CCJ 3;  3WOF B;  1ZS7 A;  7RNT A;  2FXT A;  4PEJ A;  3G4S 3;  3HII A;  1YIJ 3;  3Q1C A;  4BTX A;  1JBS A;  2CW9 A;  1R4Y A;  1RMS A;  1BNI A;  5TGN A;  4J5K A;  4HM3 B;  2BNG A;  1N9E A;  3NX0 A;  3X3Z A;  1OPY A;  3B7C A;  5DRV A;  1C7H A;  1W6C A; 
#chains in the Genus database with same CATH homology
 1LNI A;  1I3I A;  1HYF A;  1JBR A;  1BU4 A;  1BAN A;  1I0X A;  1TRQ A;  2F5M A;  1MGR A;  1RLS A;  1BSE A;  1B2U A;  1I3F A;  2SAR A;  3AHW A;  1CH0 A;  1RN1 A;  1G02 A;  1SAR A;  1TRP A;  2RBI A;  1UCL A;  1BNE A;  1RGG A;  1A2P A;  3D4A A;  1X1Y A;  2RNT A;  1PYL A;  2KF5 A;  2AAE A;  1I2E A;  1BRS A;  4J5G A;  2BU4 A;  4HOH A;  1BRJ A;  1RSN A;  1IYY A;  2HOH A;  1LOV A;  3RNT A;  3BU4 A;  1DET A;  5GSP A;  1LRA A;  2KAA A;  1YGW A;  2GSP A;  5BU4 A;  1GMR A;  4RNT A;  7GSP A;  1I70 A;  1BRH A;  1RN4 A;  3HOH A;  1BSB A;  1FZU A;  3KCH A;  1T2I A;  1B27 A;  2F4Y A;  1UCJ A;  4BIR A;  1B2Z A;  5HOH A;  2AAD A;  1BNF A;  3D5G A;  1FUT A;  1FUS A;  4HAA A;  1BVI A;  1ZGX A;  1GOY A;  1RDS A;  1I8V A;  1RCL A;  2KF6 A;  1GMQ A;  1B2S A;  1UCK A;  1AQZ A;  1RGL A;  1UCI A;  1FYS A;  1BNR A;  2C4B A;  1BNG A;  3Q3F A;  3GSP A;  1DE3 A;  1AY7 A;  1BAO A;  3DGY A;  2KF3 A;  8RNT A;  1RGK A;  1JBT A;  3DH2 A;  2ZA4 A;  1BOX A;  1BSA A;  9RNT A;  1BIR A;  1LOW A;  1BRN L;  5BIR A;  1BNJ A;  3SYU A;  5RNT A;  2KF4 A;  3AGO A;  1RNT A;  2F5W A;  1BGS A;  1YVS A;  2BIR A;  1GOU A;  1B21 A;  1FW7 A;  1BNS A;  1BRK A;  4GHO A;  1RGE A;  1B20 A;  1I2G A;  3AHS A;  3URP A;  1RHL A;  1I2F A;  1HZ1 A;  6RNT A;  1GSP A;  1RGF A;  1X1W A;  3BIR A;  1BRI A;  1RGA A;  1Q9E A;  1B2M A;  1TTO A;  1RTU A;  1PY3 A;  1RGC A;  1GMP A;  1BUJ A;  1RGH A;  1I0V A;  1B3S A;  7RNT A;  1BRG A;  2F56 A;  1X1X A;  4GSP A;  1LOY A;  6GSP A;  1GOV A;  1JBS A;  1R4Y A;  1BNI A;  1RMS A;  1RNB A;  1BSD A;  1C54 A;  1RCK A;  1MGW A;  1X1U A;  4J5K A;  1T2H A;  3AGN A;  4BU4 A;  3A5E A;  3WR2 A;  3WHO A;  3D5I A;  1YNV X;  1B2X A;  1BSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...