3URPA

Re-refinement of pdb entry 5rnt - ribonuclease t1 with guanosine-3',5'-diphosphate and phosphate ion bound
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
CDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
total genus 26
structure length 103
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3urpA00
2GSPA 1BUJA 2KF4A 5GSPA 1BGSA 1TRPA 1HYFA 5HOHA 1RN1A 1PY3A 1BNRA 1B2MA 1JBRA 1GSPA 3WR2A 1X1WA 1C54A 1BNGA 2F56A 1RGHA 1RCKA 1FUTA 4RNTA 3DH2A 1BNIA 1RNTA 1BSEA 1TTOA 1RHLA 1UCKA 7GSPA 1RMSA 1BNFA 3Q3FA 1BNJA 1BRHA 1MGWA 1RCLA 1UCJA 4HAAA 1I2FA 1LRAA 1RGGA 1BU4A 2ZA4A 1BRKA 1AY7A 1I2GA 2AAEA 3KCHA 3SYUA 5BU4A 2BU4A 1R4YA 5RNTA 4HOHA 1GMRA 1LOVA 1RGFA 1B2ZA 1AQZA 1RNBA 1I3IA 1BRGA 3AHWA 3DGYA 1T2HA 4BIRA 1HZ1A 1X1YA 1I3FA 1UCLA 2KF3A 1LOWA 1I0VA 1BSBA 1BSDA 1UCIA 2RBIA 1RDSA 1BNEA 1T2IA 3RNTA 1YGWA 1JBSA 1I8VA 1LNIA 1BNSA 2F4YA 1RGAA 1A2PA 1FZUA 1LOYA 1BANA 1ZGXA 3A5EA 1TRQA 5BIRA 1B21A 1RGKA 1BRJA 1B20A 2F5MA 1Q9EA 1FUSA 2AADA 9RNTA 1IYYA 1CH0A 3GSPA 4J5GA 1RGLA 1YVSA 1DE3A 1X1XA 2RNTA 1RN4A 1FW7A 4GSPA 1RGEA 1GOUA 2KF6A 2C4BA 1DETA 1BOXA 1RSNA 3HOHA 4J5KA 3D5GA 1B2UA 1I2EA 1I0XA 3AGNA 1I70A 2SARA 1X1UA 2HOHA 6RNTA 1BVIA 2KF5A 6GSPA 1GMPA 1BRSA 1SARA 1BAOA 1GMQA 3D4AA 1BIRA 1B2SA 2BIRA 8RNTA 3AHSA 3BU4A 4BU4A 2F5WA 1MGRA 1G02A 1BRIA 1RTUA 4GHOA 1B3SA 1B2XA 1BSAA 1RGCA 2KAAA 1BSCA 1GOYA 7RNTA 1JBTA 1GOVA 3D5IA 1YNVX 3URPA 1BRNL 3AGOA 1PYLA 1RLSA 1FYSA 3WHOA 3BIRA 1B27A
chains in the Genus database with same CATH superfamily
1LXEA 1RJOA 3A76A 1UGIA 1FUWA 1VQM3 1HKXA 2KF4A 4HM8B 4MMZB 2GEXA 4LZIA 1HYFA 4EV2A 2LQVA 1SJWA 3G16A 5HOHA 1RN1A 1PY3A 2UGIA 2QA43 3PZWA 2CG0A 2CFDA 3LT8A 3SLUA 3CME3 2CHCA 3Q1CA 4HM2B 4LMIA 5D83A 1QVF2 1W5ZA 1QALA 1FUTA 4RNTA 3DGOA 4JRFA 1OGZA 5DREA 1TUHA 1IT8A 1BSEA 1TTOA 2CFKA 1D6ZA 1OH0A 3FF2A 7GSPA 4I5QA 3SX1A 4KFFA 3CXC2 4FMDA 2WOFA 3Q3FA 1M904 3DUKA 5I97A 1GY5A 2F99A 1CYUA 3G8ZA 3CNMA 2ZA4A 3N9HA 6STDA 3KN4A 3Q2PA 4EBGA 3HK4A 1CQSA 3F7XA 4WYKB 3NV0A 4HOHA 1IVUA 3V99A 1GMRA 1K9M4 4HM4B 3FZWA 3KSPA 2ZL8A 3BNCA 1RGFA 2CKFB 3O8YA 5M1AA 2SBLA 1B2ZA 5JPUA 1V57A 2HMMB 2UX0A 1OHOA 3SXXA 3AHWA 1IK3A 1ULIB 4FR9A 1X1YA 2CG1A 4ORLA 1GD4A 2KF3A 4MMYB 1LOWA 3RGRA 1F8NA 3CCV3 3NM2A 2CFLA 3K0ZA 2H0IA 2INXA 2WO0A 5AEWB 4N6NB 3LXUX 4GL6A 3CC73 1ISKA 3F40A 1AV4A 1K41A 4XDVA 1Q814 1JBSA 1VQL3 1I8VA 1V74A 3EHCA 4XB5A 2GBWB 3V92A 1Q7HA 2OWPA 1BNSA 2L4VA 3CCM3 1BANA 4RZMA 3EBYA 1B21A 3B4PA 4HM1B 1DVDA 5EEOA 5LC7A 2RGQA 3VGNA 1BRJA 1WQLB 3OW22 1U8CB 1AR0A 2CC3A 4J5GA 3E99A 3M8CA 4N6V0 1FGTA 1N9EA 1WMOA 4MJDA 1DE3A 1X1XA 4XBXA 3GZRA 3K5TA 4HYZA 3WA3A 4FCZA 4LYLB 8CHOA 2UUGC 1M1XB 4GSPA 2C4BA 2ZDJA 3FF0A 3HOHA 3D3LA 1EUIC 3AGNA 2OOVC 3G6E3 1US1A 1BVIA 3H51A 1Y4KA 4HM0B 2BMQB 1S5AA 2IY2A 1OF5A 6GSPA 1BRSA 1SARA 1YGEA 1BAOA 2CFGA 2XEPA 3ER7A 4WWUC 1N5HA 1JN5A 3D4AA 5BVBA 1JB5A 4HVNA 1B2SA 1EA2A 3V98A 3AHSA 3BU4A 2V1LA 1PU4A 3NX0A 2QEX3 1EEJA 1TP6A 4XM4A 1OUNA 3JUPA 1IVVA 5EVHA 1S723 2OOVA 1J2BA 1K8A4 1DMNA 1NDOB 1JBTA 1GOVA 4CDLA 2Z76A 1W2ZA 1MWRA 2IYJA 3EE1A 3DGMA 2XRXB 1FYSA 2K3DA 1STDA 2E2VA 2P05A 2B1XB 1G0TA 1STFI 1VQQA 3UL6A 2CWUA 5M18A 1BUJA 3G0KA 2IMJA 2CK3H 2CWVA 5GSPA 2IUKA 1BGSA 1TRPA 2H0HA 3D79A 4KVHA 3LTDA 3DXOA 3MG1A 1BNRA 2W56B 4KT3B 2RSXA 4JF8A 4RBNA 3WR2A 1LQGC 2XF3A 1BNGA 1RGHA 3B7CA 1Q40B 3F14A 1BNIA 1JKGA 3WODG 1ZX2A 5AYSC 1UCKA 4BL2A 1IU7A 1RMSA 5AIFA 1HU9A 3I553 3T0UA 1LOXA 1BNJA 1RRLA 4K1UA 4L8OA 2Z6BA 3STDA 3T8NA 4HKVB 1LRAA 1BU4A 4R1KA 2GBXB 2F86B 3DM8A 3JUMA 4ILFA 2BMRB 3SEDA 1BRKA 2WOHA 4FCMA 1JV2B 5G2GA 2GU1A 2HMJB 3CMA3 1I2GA 2C10A 1VQ83 2BU4A 3ECFA 3KE7A 4HZ9B 4G1MB 1LOVA 1N8QA 3CPW2 3VF1A 3QRDA 2CX1A 3GZBA 5IG5A 3MG3A 5AIIA 2R4IA 4NPBA 3UNLA 3CCJ3 1RNBA 3WA2X 3H3HA 4IPBA 5AYRB 3EF8A 2CIUA 2GEYA 1TIJA 3EBTA 4DKIA 4EV5A 4MEIA 2P09A 3X42A 3AMOA 1E97A 2RBIA 4KFEA 2W6JH 2O9UX 3DGNA 1JZOA 2F98A 3PXMA 1NNVA 1OCVA 1YGWA 1QVG2 4O02B 1IQ8A 1W4NA 2CW9A 1RGAA 2XFSA 4OUQA 1E3RA 3T8UA 1FZUA 1LOYA 4HM6B 2YX9A 1NU3A 1ZGXA 1Q42A 1YIJ3 1W00A 3PYJA 1WMPA 4LSOA 1UUVB 5CLKA 1A67A 3N54B 1RGKA 3EB8A 2H0GA 1Q9EA 1FUSA 1SIIA 2AADA 2C11A 2QGUA 4K1VA 9RNTA 1O7NB 3KZTA 2BNGA 1RGLA 1FGOA 3L0RA 4J9AA 1TU5A 1UUWB 3NUVA 1VQN3 4FMBA 3WMDA 3F8HA 1R4CA 3X3XA 1VZZA 1BUQA 1GOUA 3EQQB 3GRDA 4N6TA 1FGQA 1DMMA 5AIHA 4MMXB 4J5KA 1LQMB 3BNBA 2QIYA 2Y74A 1I2EA 3MPHA 3N8BA 2ML5A 2HMOB 4QWTA 1GYBA 2M7OA 2HOHA 1JZDA 2SARA 3S67A 1MNLA 2W03A 2KF5A 3GAXA 3I0YA 3MHEA 1GMPA 5IF6A 2O3OA 2BIRA 3F7SA 1MWSA 1DVCA 3LZAA 4BU4A 1YJ93 1KWIA 3KIIA 3CCU3 4LEHA 1G02A 1RTUA 3RDEA 1T5YA 4GHOA 4AKZA 5M19A 1B2XA 1EG9B 4STDA 1BSCA 4OK0A 5LC6A 4N6MA 4EW5A 1W02A 2ZHXB 3KKGA 3OX9A 1A90A 3D5IA 1YNVX 5HGRA 3URPA 4N6LA 3PCRA 3LYGA 2L1SA 4R9KA 1NJI4 1VQ43 5IEPA 1W6YA 1YJW3 1ASKA 3BIRA 1JNQA 2CH9A 3FLJA 2W9QA 4L8PA 3UB1A 5IERA 3MSOA 3S28A 1FGMA 3BLZA 4WYKA 4OVMA 3CCE3 1JB2A 4R80A 4N6OB 3FGYA 5STDA 2D42A 1JBRA 3ROBA 1GSPA 1X1WA 2CWTA 4HM5B 4EC6A 2A15A 3FG1A 2F56A 1C7HA 2E2UA 3DH2A 3J7Yd 1VQP3 1RNTA 2HMKB 1RHLA 3DY5A 3LTBA 5ELUA 1BNFA 1W6GA 1ROAA 4FCJA 5EQLA 1MGWA 1BRHA 5IG4A 1UCJA 3OV4A 4HAAA 1RGGA 3GWRA 5AI1A 3FG3A 1O7WB 1WTHA 2Z77A 1WNHA 1Z1SA 3EJVA 4HBRA 2E2TA 3JVCA 1RRHA 1RKYA 3KCHA 2AAEA 4FMAA 4Q53A 5BU4A 1GY7A 3F8XA 5AEUB 1YVBI 4O2HA 1GS3A 1W6CA 1MOLA 1D6UA 2WGQA 3TDGA 1KQS2 4XDWA 3CC23 5AIGA 1BRGA 2OTL3 3DGYA 3BB9A 3KFQC 1I3FA 4AEQA 1KC84 2GU3A 4N3VA 4EXRA 1I0VA 1BSBA 1T3BA 2IUJA 2FGTA 2Z7AA 1UCIA 1MWTA 4FMCA 3HZPA 3ZFZA 1RDSA 1IQXA 1BNEA 1T2IA 5TGNA 3MG2A 4AKYA 3S29A 3I563 1ZS7A 2W2CA 3NXJA 3K7CA 5CXOA 5D82A 2CX0A 3CCL3 3NQYA 3S5CA 1YHQ3 1QAKA 3BNEA 3NBJA 3OXAA 2ML6A 2KCDA 3Q90A 3NV0B 5FGOA 2K54A 1UI8A 3A5EA 3NBRA 1PFPA 1TRQA 3OWUA 5KP3A 3X3YA 5BIRA 3CD63 1IVWA 1CYVA 3CCQ3 3EN1B 3FSDA 1UW1A 3CU3A 4K61A 1DMQA 1QAFA 1V58A 1YVSA 2W9PA 1A2VA 2I9WA 2RNTA 3QK9A 3LOYA 1NO3A 3GZXB 4O3VA 1RGEA 3U1WA 4R9LA 1RSNA 5IG0A 1SQWA 3D9RA 2D1WA 3OWSA 1B2UA 1I0XA 1UGHI 1X1UA 1ULJB 1VQ63 4BTXA 3X40A 1OPYA 1U5OA 4L7KA 4EYCA 1LVNA 5DRVA 2WGOA 3NQZA 3EC9A 5JPPA 3HIIA 1BIRA 1NWWA 1W2B2 8RNTA 1FA3A 2HMLB 4RNYA 2F5WA 2W56A 5ELJA 1MGRA 1BRIA 2MF7A 4IIAA 3IPTA 1RGCA 1GD3A 3IMAB 3U97A 5KP1A 4IT7A 2XSOB 3CCR3 1Q40A 3WOFB 1VQ53 1VQ93 1GOYA 1L5GB 3NBBA 4N6UA 3JUQA 4CPKA 7RNTA 1Q864 2MC8A 1BRNL 3AGOA 2RFRA 1MWUA 4WFOA 4R4KA 1PYLA 3WHOA 1VQ73 1B27A 2GSPA 2JDIH 1QMAA 1KSIA 1OF5B 1TJDA 2P0XA 3PS8A 3WOEB 1JJ22 1Q7Y4 1W01A 1IV9A 3UL5A 1JN5B 1A2KA 1VQK3 1OHSA 2YFLB 3PGBA 1B2MA 3B4OA 1Q824 3MYTA 4X2OA 4RNZA 2BT3A 3LTAA 4H3UA 1DYUA 1OHPA 4HM7B 4WP5A 3FKAA 1C54A 1NB3I 2BO9B 4CJNA 1RCKA 1YJN3 5FW5A 4XBTA 2XFTA 1O7HB 1M9GA 3G713 3JUNA 3LTCA 1K734 2XH9A 2R41A 4NHFA 5IW9A 1JB4A 1RCLA 5D81A 1VQO3 1I2FA 5IEOA 2Y73A 3NHXA 2OTJ3 3X3ZA 1N5PA 2HMNB 1SPUA 1ZO2A 1FGRA 3SOYA 1AY7A 3KSED 2IA7A 3JUOA 2J8XB 4U13A 3SYUA 1YI23 3ZG5A 1R4YA 2YFIB 5RNTA 2B24B 3PCSA 3F9SA 3HI7A 1GY6A 1OACA 4HZBB 3LH4A 2K0MA 3B8LA 3LMLA 3CPOA 1AQZA 2W0QA 3UJMA 1N8R4 2OQEC 1I3IA 4HM3B 2CFWA 4BL3A 3HIGA 3X41A 1T2HA 3S27A 4BIRA 1HZ1A 1UCLA 2YFJB 3EN8A 1JKGB 5CF1A 3HX8A 1N9JA 1BSDA 4BTWA 4CCVA 1E3VA 1IV7A 4WHAA 2Q07A 1IQYA 1EQKA 3RNTA 4H61A 2PZVA 2PNCA 1OGXA 1LNIA 1O7PB 2F4YA 3SOAA 2RCDA 3ALAA 3FH1A 5IG3A 1A2PA 3K63A 4O8SA 1YIT3 2OQEA 3IJEB 1AVKA 5G1LA 2FXTA 5KP4A 4KFDA 1RN7A 5IENA 3ZG0A 1IDPA 2OCTA 3DZLA 1B20A 2F5MA 1IYYA 1IT7A 4GB5A 1CH0A 5A0OB 1WMNA 3GSPA 2JQ5A 2BMOB 7STDA 1KD14 5G1KA 4ZM8A 1UUGB 2KRTA 1UDII 3BNDA 3EX9A 4KZ1A 3NM7A 2FNQA 2GXFA 1SIHA 2W04A 1RN4A 3AMOB 2BHMA 1W7CA 3SVAA 4BTYA 3DMCA 1M1K4 1FW7A 3CC43 2KF6A 1DETA 1BOXA 1CEWI 1QJGA 4K90B 3D5GA 1TFKA 1EKMA 1I70A 6RNTA 1K28A 2XGNA 1UI7A 1JRQA 4NREA 4I4KA 1NB5I 2KXGA 5BXQA 1GMQA 4X2HA 3MKIA 2XR8B 5CF2A 3RGAA 1O7MB 3G4S3 1G96A 1D6YA 2XGLA 5CK6A 4PEJA 3MWZA 1B3SA 1LNHA 3K9MC 2XSHB 1BSAA 2KAAA 3CNXA 1TFOA 4XBYA 4LGQA 3FCSB 4HJLB 2LYXA 1IVXA 1ROVA 3DGLA 3GZYB 3FG4A 4TX4A 2P38A 1AVLA 3WDGB 3OWYA 2STDA 3VSYA 3LT9A 5JBSA 1O7GB 3CCS3 2P0MA 1RLSA 4J8TA
chains in the Genus database with same CATH topology
2GSPA 1BUJA 2KF4A 5GSPA 1BGSA 1TRPA 1HYFA 5HOHA 1RN1A 1PY3A 1BNRA 1B2MA 1JBRA 1GSPA 3WR2A 1X1WA 1C54A 1BNGA 2F56A 1RGHA 1RCKA 1FUTA 4RNTA 3DH2A 1BNIA 1RNTA 1BSEA 1TTOA 1RHLA 1UCKA 7GSPA 1RMSA 1BNFA 3Q3FA 1BNJA 1BRHA 1MGWA 1RCLA 1UCJA 4HAAA 1I2FA 1LRAA 1RGGA 1BU4A 2ZA4A 1BRKA 1AY7A 1I2GA 2AAEA 3KCHA 3SYUA 5BU4A 2BU4A 1R4YA 5RNTA 4HOHA 1GMRA 1LOVA 1RGFA 1B2ZA 1AQZA 1RNBA 1I3IA 1BRGA 3AHWA 3DGYA 1T2HA 4BIRA 1HZ1A 1X1YA 1I3FA 1UCLA 2KF3A 1LOWA 1I0VA 1BSBA 1BSDA 1UCIA 2RBIA 1RDSA 1BNEA 1T2IA 3RNTA 1YGWA 1JBSA 1I8VA 1LNIA 1BNSA 2F4YA 1RGAA 1A2PA 1FZUA 1LOYA 1BANA 1ZGXA 3A5EA 1TRQA 5BIRA 1B21A 1RGKA 1BRJA 1B20A 2F5MA 1Q9EA 1FUSA 2AADA 9RNTA 1IYYA 1CH0A 3GSPA 4J5GA 1RGLA 1YVSA 1DE3A 1X1XA 2RNTA 1RN4A 1FW7A 4GSPA 1RGEA 1GOUA 2KF6A 2C4BA 1DETA 1BOXA 1RSNA 3HOHA 4J5KA 3D5GA 1B2UA 1I2EA 1I0XA 3AGNA 1I70A 2SARA 1X1UA 2HOHA 6RNTA 1BVIA 2KF5A 6GSPA 1GMPA 1BRSA 1SARA 1BAOA 1GMQA 3D4AA 1BIRA 1B2SA 2BIRA 8RNTA 3AHSA 3BU4A 4BU4A 2F5WA 1MGRA 1G02A 1BRIA 1RTUA 4GHOA 1B3SA 1B2XA 1BSAA 1RGCA 2KAAA 1BSCA 1GOYA 7RNTA 1JBTA 1GOVA 3D5IA 1YNVX 3URPA 1BRNL 3AGOA 1PYLA 1RLSA 1FYSA 3WHOA 3BIRA 1B27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSP A;  1BUJ A;  2KF4 A;  5GSP A;  1BGS A;  1TRP A;  1HYF A;  5HOH A;  1RN1 A;  1PY3 A;  1BNR A;  1B2M A;  1JBR A;  1GSP A;  3WR2 A;  1X1W A;  1C54 A;  1BNG A;  2F56 A;  1RGH A;  1RCK A;  1FUT A;  4RNT A;  3DH2 A;  1BNI A;  1RNT A;  1BSE A;  1TTO A;  1RHL A;  1UCK A;  7GSP A;  1RMS A;  1BNF A;  3Q3F A;  1BNJ A;  1BRH A;  1MGW A;  1RCL A;  1UCJ A;  4HAA A;  1I2F A;  1LRA A;  1RGG A;  1BU4 A;  2ZA4 A;  1BRK A;  1AY7 A;  1I2G A;  2AAE A;  3KCH A;  3SYU A;  5BU4 A;  2BU4 A;  1R4Y A;  5RNT A;  4HOH A;  1GMR A;  1LOV A;  1RGF A;  1B2Z A;  1AQZ A;  1RNB A;  1I3I A;  1BRG A;  3AHW A;  3DGY A;  1T2H A;  4BIR A;  1HZ1 A;  1X1Y A;  1I3F A;  1UCL A;  2KF3 A;  1LOW A;  1I0V A;  1BSB A;  1BSD A;  1UCI A;  2RBI A;  1RDS A;  1BNE A;  1T2I A;  3RNT A;  1YGW A;  1JBS A;  1I8V A;  1LNI A;  1BNS A;  2F4Y A;  1RGA A;  1A2P A;  1FZU A;  1LOY A;  1BAN A;  1ZGX A;  3A5E A;  1TRQ A;  5BIR A;  1B21 A;  1RGK A;  1BRJ A;  1B20 A;  2F5M A;  1Q9E A;  1FUS A;  2AAD A;  9RNT A;  1IYY A;  1CH0 A;  3GSP A;  4J5G A;  1RGL A;  1YVS A;  1DE3 A;  1X1X A;  2RNT A;  1RN4 A;  1FW7 A;  4GSP A;  1RGE A;  1GOU A;  2KF6 A;  2C4B A;  1DET A;  1BOX A;  1RSN A;  3HOH A;  4J5K A;  3D5G A;  1B2U A;  1I2E A;  1I0X A;  3AGN A;  1I70 A;  2SAR A;  1X1U A;  2HOH A;  6RNT A;  1BVI A;  2KF5 A;  6GSP A;  1GMP A;  1BRS A;  1SAR A;  1BAO A;  1GMQ A;  3D4A A;  1BIR A;  1B2S A;  2BIR A;  8RNT A;  3AHS A;  3BU4 A;  4BU4 A;  2F5W A;  1MGR A;  1G02 A;  1BRI A;  1RTU A;  4GHO A;  1B3S A;  1B2X A;  1BSA A;  1RGC A;  2KAA A;  1BSC A;  1GOY A;  7RNT A;  1JBT A;  1GOV A;  3D5I A;  1YNV X;  3URP A;  1BRN L;  3AGO A;  1PYL A;  1RLS A;  1FYS A;  3WHO A;  3BIR A;  1B27 A; 
#chains in the Genus database with same CATH topology
 1LXE A;  1RJO A;  3A76 A;  1UGI A;  1FUW A;  1VQM 3;  1HKX A;  2KF4 A;  4HM8 B;  4MMZ B;  2GEX A;  4LZI A;  1HYF A;  4EV2 A;  2LQV A;  1SJW A;  3G16 A;  5HOH A;  1RN1 A;  1PY3 A;  2UGI A;  2QA4 3;  3PZW A;  2CG0 A;  2CFD A;  3LT8 A;  3SLU A;  3CME 3;  2CHC A;  3Q1C A;  4HM2 B;  4LMI A;  5D83 A;  1QVF 2;  1W5Z A;  1QAL A;  1FUT A;  4RNT A;  3DGO A;  4JRF A;  1OGZ A;  5DRE A;  1TUH A;  1IT8 A;  1BSE A;  1TTO A;  2CFK A;  1D6Z A;  1OH0 A;  3FF2 A;  7GSP A;  4I5Q A;  3SX1 A;  4KFF A;  3CXC 2;  4FMD A;  2WOF A;  3Q3F A;  1M90 4;  3DUK A;  5I97 A;  1GY5 A;  2F99 A;  1CYU A;  3G8Z A;  3CNM A;  2ZA4 A;  3N9H A;  6STD A;  3KN4 A;  3Q2P A;  4EBG A;  3HK4 A;  1CQS A;  3F7X A;  4WYK B;  3NV0 A;  4HOH A;  1IVU A;  3V99 A;  1GMR A;  1K9M 4;  4HM4 B;  3FZW A;  3KSP A;  2ZL8 A;  3BNC A;  1RGF A;  2CKF B;  3O8Y A;  5M1A A;  2SBL A;  1B2Z A;  5JPU A;  1V57 A;  2HMM B;  2UX0 A;  1OHO A;  3SXX A;  3AHW A;  1IK3 A;  1ULI B;  4FR9 A;  1X1Y A;  2CG1 A;  4ORL A;  1GD4 A;  2KF3 A;  4MMY B;  1LOW A;  3RGR A;  1F8N A;  3CCV 3;  3NM2 A;  2CFL A;  3K0Z A;  2H0I A;  2INX A;  2WO0 A;  5AEW B;  4N6N B;  3LXU X;  4GL6 A;  3CC7 3;  1ISK A;  3F40 A;  1AV4 A;  1K41 A;  4XDV A;  1Q81 4;  1JBS A;  1VQL 3;  1I8V A;  1V74 A;  3EHC A;  4XB5 A;  2GBW B;  3V92 A;  1Q7H A;  2OWP A;  1BNS A;  2L4V A;  3CCM 3;  1BAN A;  4RZM A;  3EBY A;  1B21 A;  3B4P A;  4HM1 B;  1DVD A;  5EEO A;  5LC7 A;  2RGQ A;  3VGN A;  1BRJ A;  1WQL B;  3OW2 2;  1U8C B;  1AR0 A;  2CC3 A;  4J5G A;  3E99 A;  3M8C A;  4N6V 0;  1FGT A;  1N9E A;  1WMO A;  4MJD A;  1DE3 A;  1X1X A;  4XBX A;  3GZR A;  3K5T A;  4HYZ A;  3WA3 A;  4FCZ A;  4LYL B;  8CHO A;  2UUG C;  1M1X B;  4GSP A;  2C4B A;  2ZDJ A;  3FF0 A;  3HOH A;  3D3L A;  1EUI C;  3AGN A;  2OOV C;  3G6E 3;  1US1 A;  1BVI A;  3H51 A;  1Y4K A;  4HM0 B;  2BMQ B;  1S5A A;  2IY2 A;  1OF5 A;  6GSP A;  1BRS A;  1SAR A;  1YGE A;  1BAO A;  2CFG A;  2XEP A;  3ER7 A;  4WWU C;  1N5H A;  1JN5 A;  3D4A A;  5BVB A;  1JB5 A;  4HVN A;  1B2S A;  1EA2 A;  3V98 A;  3AHS A;  3BU4 A;  2V1L A;  1PU4 A;  3NX0 A;  2QEX 3;  1EEJ A;  1TP6 A;  4XM4 A;  1OUN A;  3JUP A;  1IVV A;  5EVH A;  1S72 3;  2OOV A;  1J2B A;  1K8A 4;  1DMN A;  1NDO B;  1JBT A;  1GOV A;  4CDL A;  2Z76 A;  1W2Z A;  1MWR A;  2IYJ A;  3EE1 A;  3DGM A;  2XRX B;  1FYS A;  2K3D A;  1STD A;  2E2V A;  2P05 A;  2B1X B;  1G0T A;  1STF I;  1VQQ A;  3UL6 A;  2CWU A;  5M18 A;  1BUJ A;  3G0K A;  2IMJ A;  2CK3 H;  2CWV A;  5GSP A;  2IUK A;  1BGS A;  1TRP A;  2H0H A;  3D79 A;  4KVH A;  3LTD A;  3DXO A;  3MG1 A;  1BNR A;  2W56 B;  4KT3 B;  2RSX A;  4JF8 A;  4RBN A;  3WR2 A;  1LQG C;  2XF3 A;  1BNG A;  1RGH A;  3B7C A;  1Q40 B;  3F14 A;  1BNI A;  1JKG A;  3WOD G;  1ZX2 A;  5AYS C;  1UCK A;  4BL2 A;  1IU7 A;  1RMS A;  5AIF A;  1HU9 A;  3I55 3;  3T0U A;  1LOX A;  1BNJ A;  1RRL A;  4K1U A;  4L8O A;  2Z6B A;  3STD A;  3T8N A;  4HKV B;  1LRA A;  1BU4 A;  4R1K A;  2GBX B;  2F86 B;  3DM8 A;  3JUM A;  4ILF A;  2BMR B;  3SED A;  1BRK A;  2WOH A;  4FCM A;  1JV2 B;  5G2G A;  2GU1 A;  2HMJ B;  3CMA 3;  1I2G A;  2C10 A;  1VQ8 3;  2BU4 A;  3ECF A;  3KE7 A;  4HZ9 B;  4G1M B;  1LOV A;  1N8Q A;  3CPW 2;  3VF1 A;  3QRD A;  2CX1 A;  3GZB A;  5IG5 A;  3MG3 A;  5AII A;  2R4I A;  4NPB A;  3UNL A;  3CCJ 3;  1RNB A;  3WA2 X;  3H3H A;  4IPB A;  5AYR B;  3EF8 A;  2CIU A;  2GEY A;  1TIJ A;  3EBT A;  4DKI A;  4EV5 A;  4MEI A;  2P09 A;  3X42 A;  3AMO A;  1E97 A;  2RBI A;  4KFE A;  2W6J H;  2O9U X;  3DGN A;  1JZO A;  2F98 A;  3PXM A;  1NNV A;  1OCV A;  1YGW A;  1QVG 2;  4O02 B;  1IQ8 A;  1W4N A;  2CW9 A;  1RGA A;  2XFS A;  4OUQ A;  1E3R A;  3T8U A;  1FZU A;  1LOY A;  4HM6 B;  2YX9 A;  1NU3 A;  1ZGX A;  1Q42 A;  1YIJ 3;  1W00 A;  3PYJ A;  1WMP A;  4LSO A;  1UUV B;  5CLK A;  1A67 A;  3N54 B;  1RGK A;  3EB8 A;  2H0G A;  1Q9E A;  1FUS A;  1SII A;  2AAD A;  2C11 A;  2QGU A;  4K1V A;  9RNT A;  1O7N B;  3KZT A;  2BNG A;  1RGL A;  1FGO A;  3L0R A;  4J9A A;  1TU5 A;  1UUW B;  3NUV A;  1VQN 3;  4FMB A;  3WMD A;  3F8H A;  1R4C A;  3X3X A;  1VZZ A;  1BUQ A;  1GOU A;  3EQQ B;  3GRD A;  4N6T A;  1FGQ A;  1DMM A;  5AIH A;  4MMX B;  4J5K A;  1LQM B;  3BNB A;  2QIY A;  2Y74 A;  1I2E A;  3MPH A;  3N8B A;  2ML5 A;  2HMO B;  4QWT A;  1GYB A;  2M7O A;  2HOH A;  1JZD A;  2SAR A;  3S67 A;  1MNL A;  2W03 A;  2KF5 A;  3GAX A;  3I0Y A;  3MHE A;  1GMP A;  5IF6 A;  2O3O A;  2BIR A;  3F7S A;  1MWS A;  1DVC A;  3LZA A;  4BU4 A;  1YJ9 3;  1KWI A;  3KII A;  3CCU 3;  4LEH A;  1G02 A;  1RTU A;  3RDE A;  1T5Y A;  4GHO A;  4AKZ A;  5M19 A;  1B2X A;  1EG9 B;  4STD A;  1BSC A;  4OK0 A;  5LC6 A;  4N6M A;  4EW5 A;  1W02 A;  2ZHX B;  3KKG A;  3OX9 A;  1A90 A;  3D5I A;  1YNV X;  5HGR A;  3URP A;  4N6L A;  3PCR A;  3LYG A;  2L1S A;  4R9K A;  1NJI 4;  1VQ4 3;  5IEP A;  1W6Y A;  1YJW 3;  1ASK A;  3BIR A;  1JNQ A;  2CH9 A;  3FLJ A;  2W9Q A;  4L8P A;  3UB1 A;  5IER A;  3MSO A;  3S28 A;  1FGM A;  3BLZ A;  4WYK A;  4OVM A;  3CCE 3;  1JB2 A;  4R80 A;  4N6O B;  3FGY A;  5STD A;  2D42 A;  1JBR A;  3ROB A;  1GSP A;  1X1W A;  2CWT A;  4HM5 B;  4EC6 A;  2A15 A;  3FG1 A;  2F56 A;  1C7H A;  2E2U A;  3DH2 A;  3J7Y d;  1VQP 3;  1RNT A;  2HMK B;  1RHL A;  3DY5 A;  3LTB A;  5ELU A;  1BNF A;  1W6G A;  1ROA A;  4FCJ A;  5EQL A;  1MGW A;  1BRH A;  5IG4 A;  1UCJ A;  3OV4 A;  4HAA A;  1RGG A;  3GWR A;  5AI1 A;  3FG3 A;  1O7W B;  1WTH A;  2Z77 A;  1WNH A;  1Z1S A;  3EJV A;  4HBR A;  2E2T A;  3JVC A;  1RRH A;  1RKY A;  3KCH A;  2AAE A;  4FMA A;  4Q53 A;  5BU4 A;  1GY7 A;  3F8X A;  5AEU B;  1YVB I;  4O2H A;  1GS3 A;  1W6C A;  1MOL A;  1D6U A;  2WGQ A;  3TDG A;  1KQS 2;  4XDW A;  3CC2 3;  5AIG A;  1BRG A;  2OTL 3;  3DGY A;  3BB9 A;  3KFQ C;  1I3F A;  4AEQ A;  1KC8 4;  2GU3 A;  4N3V A;  4EXR A;  1I0V A;  1BSB A;  1T3B A;  2IUJ A;  2FGT A;  2Z7A A;  1UCI A;  1MWT A;  4FMC A;  3HZP A;  3ZFZ A;  1RDS A;  1IQX A;  1BNE A;  1T2I A;  5TGN A;  3MG2 A;  4AKY A;  3S29 A;  3I56 3;  1ZS7 A;  2W2C A;  3NXJ A;  3K7C A;  5CXO A;  5D82 A;  2CX0 A;  3CCL 3;  3NQY A;  3S5C A;  1YHQ 3;  1QAK A;  3BNE A;  3NBJ A;  3OXA A;  2ML6 A;  2KCD A;  3Q90 A;  3NV0 B;  5FGO A;  2K54 A;  1UI8 A;  3A5E A;  3NBR A;  1PFP A;  1TRQ A;  3OWU A;  5KP3 A;  3X3Y A;  5BIR A;  3CD6 3;  1IVW A;  1CYV A;  3CCQ 3;  3EN1 B;  3FSD A;  1UW1 A;  3CU3 A;  4K61 A;  1DMQ A;  1QAF A;  1V58 A;  1YVS A;  2W9P A;  1A2V A;  2I9W A;  2RNT A;  3QK9 A;  3LOY A;  1NO3 A;  3GZX B;  4O3V A;  1RGE A;  3U1W A;  4R9L A;  1RSN A;  5IG0 A;  1SQW A;  3D9R A;  2D1W A;  3OWS A;  1B2U A;  1I0X A;  1UGH I;  1X1U A;  1ULJ B;  1VQ6 3;  4BTX A;  3X40 A;  1OPY A;  1U5O A;  4L7K A;  4EYC A;  1LVN A;  5DRV A;  2WGO A;  3NQZ A;  3EC9 A;  5JPP A;  3HII A;  1BIR A;  1NWW A;  1W2B 2;  8RNT A;  1FA3 A;  2HML B;  4RNY A;  2F5W A;  2W56 A;  5ELJ A;  1MGR A;  1BRI A;  2MF7 A;  4IIA A;  3IPT A;  1RGC A;  1GD3 A;  3IMA B;  3U97 A;  5KP1 A;  4IT7 A;  2XSO B;  3CCR 3;  1Q40 A;  3WOF B;  1VQ5 3;  1VQ9 3;  1GOY A;  1L5G B;  3NBB A;  4N6U A;  3JUQ A;  4CPK A;  7RNT A;  1Q86 4;  2MC8 A;  1BRN L;  3AGO A;  2RFR A;  1MWU A;  4WFO A;  4R4K A;  1PYL A;  3WHO A;  1VQ7 3;  1B27 A;  2GSP A;  2JDI H;  1QMA A;  1KSI A;  1OF5 B;  1TJD A;  2P0X A;  3PS8 A;  3WOE B;  1JJ2 2;  1Q7Y 4;  1W01 A;  1IV9 A;  3UL5 A;  1JN5 B;  1A2K A;  1VQK 3;  1OHS A;  2YFL B;  3PGB A;  1B2M A;  3B4O A;  1Q82 4;  3MYT A;  4X2O A;  4RNZ A;  2BT3 A;  3LTA A;  4H3U A;  1DYU A;  1OHP A;  4HM7 B;  4WP5 A;  3FKA A;  1C54 A;  1NB3 I;  2BO9 B;  4CJN A;  1RCK A;  1YJN 3;  5FW5 A;  4XBT A;  2XFT A;  1O7H B;  1M9G A;  3G71 3;  3JUN A;  3LTC A;  1K73 4;  2XH9 A;  2R41 A;  4NHF A;  5IW9 A;  1JB4 A;  1RCL A;  5D81 A;  1VQO 3;  1I2F A;  5IEO A;  2Y73 A;  3NHX A;  2OTJ 3;  3X3Z A;  1N5P A;  2HMN B;  1SPU A;  1ZO2 A;  1FGR A;  3SOY A;  1AY7 A;  3KSE D;  2IA7 A;  3JUO A;  2J8X B;  4U13 A;  3SYU A;  1YI2 3;  3ZG5 A;  1R4Y A;  2YFI B;  5RNT A;  2B24 B;  3PCS A;  3F9S A;  3HI7 A;  1GY6 A;  1OAC A;  4HZB B;  3LH4 A;  2K0M A;  3B8L A;  3LML A;  3CPO A;  1AQZ A;  2W0Q A;  3UJM A;  1N8R 4;  2OQE C;  1I3I A;  4HM3 B;  2CFW A;  4BL3 A;  3HIG A;  3X41 A;  1T2H A;  3S27 A;  4BIR A;  1HZ1 A;  1UCL A;  2YFJ B;  3EN8 A;  1JKG B;  5CF1 A;  3HX8 A;  1N9J A;  1BSD A;  4BTW A;  4CCV A;  1E3V A;  1IV7 A;  4WHA A;  2Q07 A;  1IQY A;  1EQK A;  3RNT A;  4H61 A;  2PZV A;  2PNC A;  1OGX A;  1LNI A;  1O7P B;  2F4Y A;  3SOA A;  2RCD A;  3ALA A;  3FH1 A;  5IG3 A;  1A2P A;  3K63 A;  4O8S A;  1YIT 3;  2OQE A;  3IJE B;  1AVK A;  5G1L A;  2FXT A;  5KP4 A;  4KFD A;  1RN7 A;  5IEN A;  3ZG0 A;  1IDP A;  2OCT A;  3DZL A;  1B20 A;  2F5M A;  1IYY A;  1IT7 A;  4GB5 A;  1CH0 A;  5A0O B;  1WMN A;  3GSP A;  2JQ5 A;  2BMO B;  7STD A;  1KD1 4;  5G1K A;  4ZM8 A;  1UUG B;  2KRT A;  1UDI I;  3BND A;  3EX9 A;  4KZ1 A;  3NM7 A;  2FNQ A;  2GXF A;  1SIH A;  2W04 A;  1RN4 A;  3AMO B;  2BHM A;  1W7C A;  3SVA A;  4BTY A;  3DMC A;  1M1K 4;  1FW7 A;  3CC4 3;  2KF6 A;  1DET A;  1BOX A;  1CEW I;  1QJG A;  4K90 B;  3D5G A;  1TFK A;  1EKM A;  1I70 A;  6RNT A;  1K28 A;  2XGN A;  1UI7 A;  1JRQ A;  4NRE A;  4I4K A;  1NB5 I;  2KXG A;  5BXQ A;  1GMQ A;  4X2H A;  3MKI A;  2XR8 B;  5CF2 A;  3RGA A;  1O7M B;  3G4S 3;  1G96 A;  1D6Y A;  2XGL A;  5CK6 A;  4PEJ A;  3MWZ A;  1B3S A;  1LNH A;  3K9M C;  2XSH B;  1BSA A;  2KAA A;  3CNX A;  1TFO A;  4XBY A;  4LGQ A;  3FCS B;  4HJL B;  2LYX A;  1IVX A;  1ROV A;  3DGL A;  3GZY B;  3FG4 A;  4TX4 A;  2P38 A;  1AVL A;  3WDG B;  3OWY A;  2STD A;  3VSY A;  3LT9 A;  5JBS A;  1O7G B;  3CCS 3;  2P0M A;  1RLS A;  4J8T A; 
#chains in the Genus database with same CATH homology
 2GSP A;  1BUJ A;  2KF4 A;  5GSP A;  1BGS A;  1TRP A;  1HYF A;  5HOH A;  1RN1 A;  1PY3 A;  1BNR A;  1B2M A;  1JBR A;  1GSP A;  3WR2 A;  1X1W A;  1C54 A;  1BNG A;  2F56 A;  1RGH A;  1RCK A;  1FUT A;  4RNT A;  3DH2 A;  1BNI A;  1RNT A;  1BSE A;  1TTO A;  1RHL A;  1UCK A;  7GSP A;  1RMS A;  1BNF A;  3Q3F A;  1BNJ A;  1BRH A;  1MGW A;  1RCL A;  1UCJ A;  4HAA A;  1I2F A;  1LRA A;  1RGG A;  1BU4 A;  2ZA4 A;  1BRK A;  1AY7 A;  1I2G A;  2AAE A;  3KCH A;  3SYU A;  5BU4 A;  2BU4 A;  1R4Y A;  5RNT A;  4HOH A;  1GMR A;  1LOV A;  1RGF A;  1B2Z A;  1AQZ A;  1RNB A;  1I3I A;  1BRG A;  3AHW A;  3DGY A;  1T2H A;  4BIR A;  1HZ1 A;  1X1Y A;  1I3F A;  1UCL A;  2KF3 A;  1LOW A;  1I0V A;  1BSB A;  1BSD A;  1UCI A;  2RBI A;  1RDS A;  1BNE A;  1T2I A;  3RNT A;  1YGW A;  1JBS A;  1I8V A;  1LNI A;  1BNS A;  2F4Y A;  1RGA A;  1A2P A;  1FZU A;  1LOY A;  1BAN A;  1ZGX A;  3A5E A;  1TRQ A;  5BIR A;  1B21 A;  1RGK A;  1BRJ A;  1B20 A;  2F5M A;  1Q9E A;  1FUS A;  2AAD A;  9RNT A;  1IYY A;  1CH0 A;  3GSP A;  4J5G A;  1RGL A;  1YVS A;  1DE3 A;  1X1X A;  2RNT A;  1RN4 A;  1FW7 A;  4GSP A;  1RGE A;  1GOU A;  2KF6 A;  2C4B A;  1DET A;  1BOX A;  1RSN A;  3HOH A;  4J5K A;  3D5G A;  1B2U A;  1I2E A;  1I0X A;  3AGN A;  1I70 A;  2SAR A;  1X1U A;  2HOH A;  6RNT A;  1BVI A;  2KF5 A;  6GSP A;  1GMP A;  1BRS A;  1SAR A;  1BAO A;  1GMQ A;  3D4A A;  1BIR A;  1B2S A;  2BIR A;  8RNT A;  3AHS A;  3BU4 A;  4BU4 A;  2F5W A;  1MGR A;  1G02 A;  1BRI A;  1RTU A;  4GHO A;  1B3S A;  1B2X A;  1BSA A;  1RGC A;  2KAA A;  1BSC A;  1GOY A;  7RNT A;  1JBT A;  1GOV A;  3D5I A;  1YNV X;  3URP A;  1BRN L;  3AGO A;  1PYL A;  1RLS A;  1FYS A;  3WHO A;  3BIR A;  1B27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...