3URPA

Re-refinement of pdb entry 5rnt - ribonuclease t1 with guanosine-3',5'-diphosphate and phosphate ion bound
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
CDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
total genus 26
structure length 103
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3urpA00
5BIRA 1HYFA 1RN4A 1TTOA 3AGNA 1X1XA 1GOUA 1UCLA 2KF5A 1BANA 3Q3FA 1BUJA 1B2XA 1RNTA 2F5MA 4HAAA 1RCKA 3AHSA 6RNTA 1I0XA 1YNVX 1DE3A 1FW7A 3BIRA 1BAOA 1RHLA 2BU4A 1BSBA 1I2GA 3GSPA 1BRKA 1BRHA 1X1UA 3DH2A 1RGGA 4GHOA 4J5GA 1LNIA 6GSPA 3RNTA 1BOXA 1GMPA 1UCIA 1GMRA 1BNFA 1BSDA 2HOHA 1BNRA 3AHWA 1B2ZA 1BGSA 1LOYA 1AY7A 1TRQA 1LRAA 2BIRA 1RGFA 2F4YA 4GSPA 1B27A 1RN1A 1HZ1A 1BNJA 4J5KA 4BIRA 3A5EA 1YGWA 1B2MA 1B2UA 1FUTA 3HOHA 2GSPA 1I3FA 2KF4A 5GSPA 1TRPA 2F5WA 1JBTA 1JBRA 4HOHA 1MGRA 1BIRA 1X1WA 4BU4A 5HOHA 1MGWA 4RNTA 1BRJA 3DGYA 1ZGXA 1C54A 2KF3A 3AGOA 1I0VA 1BVIA 1GOYA 1BRIA 2AAEA 1BRSA 1FYSA 1Q9EA 3KCHA 2AADA 2ZA4A 3D5IA 1I2EA 3SYUA 3BU4A 1B3SA 2RNTA 2C4BA 1T2IA 1SARA 1T2HA 1I70A 1IYYA 1B20A 1RCLA 1BRGA 2SARA 1DETA 2KF6A 7GSPA 5BU4A 1RMSA 1PY3A 1LOVA 3D4AA 3URPA 1I8VA 1BRNL 3WR2A 1I2FA 1BSEA 1BU4A 1GMQA 2KAAA 1GOVA 1RGEA 1YVSA 2F56A 8RNTA 1UCJA 1RDSA 1B21A 1BNEA 1RGCA 1RSNA 1RGHA 1FUSA 1RNBA 1BNIA 1RGKA 2RBIA 1LOWA 1BNGA 1B2SA 1BNSA 9RNTA 1CH0A 5RNTA 3D5GA 1A2PA 1PYLA 1X1YA 1AQZA 1RTUA 1JBSA 3WHOA 1BSCA 1UCKA 1RGAA 1RLSA 1GSPA 7RNTA 1FZUA 1I3IA 1BSAA 1RGLA 1G02A 1R4YA
chains in the Genus database with same CATH superfamily
4AKZA 3SXXA 3MKIA 1ULIB 1KD14 1M904 2H0GA 3KZTA 4EC6A 4J9AA 1JN5A 1UCLA 1IT7A 2PZVA 1W01A 4EBGA 3ECFA 4CCVA 1D6YA 2WOFA 4WP5A 1LVNA 3AMOA 3JUPA 4HAAA 1TFOA 1UGIA 5IG4A 3QRDA 1YNVX 1JB4A 2RCDA 4LGQA 1BAOA 4N6OB 1A2VA 1OH0A 4JF8A 1I2GA 1N8R4 4MEIA 3G6E3 4L8PA 3NV0B 2D1WA 2O3OA 2R4IA 2CHCA 3DH2A 2IMJA 3EX9A 3T8NA 1W2ZA 2CH9A 1LQGC 1N5HA 2W56B 2W9QA 4FMAA 3X3ZA 2K0MA 2Y73A 3D79A 3F9SA 5AIGA 2UUGC 6GSPA 3PYJA 1BOXA 3CXC2 4JRFA 1UUWB 2CK3H 1DMNA 1BNFA 1BSDA 5BXQA 2HOHA 1W00A 3FZWA 1B2ZA 3H51A 3S28A 2FGTA 5CF2A 4XDVA 1NJI4 1J2BA 1V58A 1AY7A 3EBYA 1TRQA 3CMA3 3CNMA 1RGFA 2F4YA 2FXTA 1B27A 1UDII 1UGHI 1BNJA 2YFLB 3I0YA 1NWWA 1BUQA 1YGWA 4HM0B 1R4CA 1B2UA 1TP6A 2OQEA 5EVHA 3GZBA 1Q40A 2KF4A 1OCVA 1TRPA 1N9JA 2F5WA 2M7OA 1IDPA 3FF2A 3KN4A 3LTDA 1NDOB 4HVNA 4O8SA 6STDA 1O7NB 3KE7A 3SOAA 2L1SA 4FMDA 1JRQA 1EQKA 3GWRA 5HOHA 3B4OA 2GEXA 4R4KA 1G96A 3EB8A 1ZGXA 4H3UA 1C54A 1W2B2 1W6CA 2KF3A 1JV2B 3CCL3 1GD3A 1VQ63 1Q9EA 2CFLA 2CFKA 1T3BA 3RGRA 2UGIA 4IT7A 3OWUA 3V92A 1LQMB 2BT3A 1B3SA 1OACA 3DUKA 1QJGA 4HM2B 1YGEA 5IEOA 1T2HA 3MPHA 2W03A 5ELUA 1B20A 1RCLA 3PCRA 4KFEA 1AV4A 1AVLA 3WA2X 1IVUA 1G0TA 1W7CA 1I8VA 4GB5A 3WR2A 1TFKA 2L4VA 3EF8A 1RGEA 3PXMA 1CEWI 1RGCA 3B7CA 1RSNA 1GY5A 4AEQA 2IUJA 4EYCA 2IY2A 2WO0A 3CC73 3CNXA 3CCS3 4O3VA 1JKGB 5ELJA 2RBIA 5M1AA 8CHOA 4U13A 1US1A 4N6LA 2W04A 1ZS7A 3MWZA 3GZXB 1JN5B 3GRDA 9RNTA 5RNTA 4H61A 3F7XA 3B8LA 4FCMA 5M19A 3CCU3 1V57A 4GL6A 2XGNA 1O7PB 1MOLA 3G16A 2INXA 1O7MB 4IPBA 5DREA 2CW9A 3EHCA 1VQ83 3QK9A 3S27A 1UCKA 4BTXA 1RLSA 1JZOA 1NO3A 3EN1B 3GAXA 5G1LA 1O7HB 3WA3A 3CPW2 1BSAA 4R80A 1TUHA 1RKYA 1O7GB 4LYLB 3CCR3 1BRNL 2K3DA 2W56A 1WMNA 2BO9B 2K54A 2GBXB 3G713 1ROVA 2PNCA 3NHXA 2BMRB 3FG1A 2CFGA 3HK4A 1YJW3 4Q53A 1IVWA 1GOUA 3UNLA 2P0MA 1BANA 1B2XA 1VQ43 4NHFA 5IG5A 1M1K4 2XRXB 3FF0A 1IK3A 3CCV3 2QIYA 3FLJA 4L7KA 4ZM8A 4HBRA 1VQK3 2D42A 2CIUA 4KFDA 1QAKA 3ZFZA 3BIRA 4L8OA 5G1KA 3N9HA 1OF5B 3WODG 1N5PA 1MWUA 4BTYA 3JUOA 4KFFA 1UI7A 1OUNA 3CCM3 2UX0A 1X1UA 1JJ22 2Z77A 1L5GB 1MWRA 4N6UA 3WMDA 1YIT3 3MG1A 1RGGA 1Q40B 3U97A 5STDA 1UUGB 1Q7HA 2HMJB 3DGMA 4GHOA 4J5GA 2RFRA 5FW5A 3KSED 4MMZB 1ZO2A 2CWVA 1GMRA 3NX0A 4O02B 1OPYA 1BGSA 4XBXA 2E2VA 2HMMB 3JVCA 4LSOA 2WGQA 4EW5A 1VQ93 2C10A 3X42A 2OQEC 1RN1A 1RRHA 4BIRA 5JBSA 1Q42A 1B2MA 4EV5A 4OK0A 2HMKB 4FMCA 4J8TA 4QWTA 1AVKA 1GD4A 4N3VA 1SQWA 2OOVC 2F86B 2W2CA 1IVXA 1CYVA 3ROBA 1E3VA 1VZZA 1VQM3 1OHPA 5EEOA 4DKIA 4BU4A 5M18A 3AMOB 2QGUA 4R9LA 4PEJA 2CG0A 3HIGA 2IA7A 3TDGA 3K9MC 4CPKA 1BRJA 2ZDJA 3DGYA 3F7SA 1DVCA 4K1VA 1UUVB 1IVVA 3DXOA 3I563 1GOYA 1BRIA 2AAEA 1BRSA 4OUQA 4OVMA 4XB5A 3X41A 3CCE3 3D3LA 4WFOA 1ULJB 4HM4B 1N8QA 1SIIA 1IQXA 3DMCA 3SOYA 5IENA 1RRLA 3SYUA 2HMLB 2R41A 4WWUC 4HM1B 3N8BA 1T2IA 1YIJ3 2LQVA 2YFJB 1I70A 5KP3A 1NNVA 1JB5A 5BU4A 1FGOA 1PY3A 5AEUB 3BNEA 3UB1A 5AYSC 4FR9A 1I2FA 2XFTA 3EN8A 1NB5I 2H0HA 1KSIA 1BU4A 1WQLB 2GU3A 3F14A 1GOVA 1DMMA 1FGMA 1SIHA 8RNTA 3CC23 1YHQ3 1UCJA 3NQZA 1K9M4 1BNEA 4FMBA 1RGHA 1RNBA 3BNDA 1O7WB 5AIFA 3OW22 2YX9A 4BL3A 4X2OA 2QA43 3WOEB 5TGNA 2KCDA 1IT8A 1D6UA 2CWTA 1YJN3 1K734 1BNSA 1CH0A 1FUWA 4N6NB 4ILFA 2IYJA 2MF7A 1EUIC 1OGXA 1GY7A 1X1YA 1AQZA 1ZX2A 3OX9A 1FA3A 1FGQA 1RTUA 5FGOA 1BSCA 2CFWA 4I5QA 3WDGB 3A76A 2GXFA 2XR8B 3B4PA 3DGNA 2E2UA 3NQYA 3G4S3 2RGQA 2XF3A 3L0RA 1FGTA 3LZAA 2XH9A 5BIRA 1WMPA 3HIIA 4K1UA 1WMOA 1VQL3 2V1LA 1X1XA 2KF5A 3X3XA 2KXGA 3BNBA 1BUJA 2ML6A 3SEDA 4WYKB 3LMLA 3OV4A 3JUNA 3MYTA 5A0OB 1W02A 2OCTA 4XM4A 1RCKA 3BB9A 2HMOB 4BL2A 1DVDA 4LMIA 4K90B 1ROAA 5CXOA 1RHLA 3DGOA 1IV7A 2BU4A 1BSBA 3O8YA 4NPBA 3CME3 5HGRA 2O9UX 1BRHA 5CF1A 3HI7A 1WNHA 1TIJA 1JKGA 1RJOA 3K5TA 7STDA 2JQ5A 1V74A 1KWIA 3CU3A 4HZBB 1Q864 1LNIA 3RNTA 1GMPA 2CG1A 3EQQB 3K63A 1UCIA 2OTL3 2CKFB 2GBWB 2XEPA 1AR0A 5DRVA 4BTWA 1DMQA 4KVHA 1VQ73 1LOYA 1JZDA 1W5ZA 1LRAA 2BIRA 4GSPA 4J5KA 1Q7Y4 1HZ1A 2P0XA 1W6GA 2W9PA 3A5EA 2WGOA 2ZL8A 3LT9A 2OOVA 5IERA 1VQQA 3DGLA 1I3FA 5D81A 5GSPA 2B1XB 1HKXA 1EA2A 3VF1A 3F8XA 3UJMA 5KP4A 1JBTA 1JBRA 4HOHA 1IU7A 1S5AA 2C11A 3I553 1IQ8A 4LEHA 3MG3A 3SLUA 3D9RA 3PS8A 3IPTA 1MGWA 4X2HA 3PCSA 1VQO3 1MNLA 2BHMA 3V99A 1LOXA 1OF5A 3AGOA 3VGNA 1FYSA 1OHSA 4RBNA 2AADA 2ZA4A 1U8CB 3UL5A 1I2EA 3LH4A 1A67A 1STDA 1NU3A 2RNTA 2A15A 2C4BA 3ALAA 3IMAB 1SARA 4KZ1A 4MMYB 1ISKA 3LOYA 2Z7AA 3NBBA 3RDEA 3MSOA 1IYYA 1BRGA 2ZHXB 3EBTA 1DETA 5JPUA 1GYBA 2KF6A 2P38A 7GSPA 3HZPA 3DM8A 3NUVA 3G0KA 3D4AA 3UL6A 1F8NA 1BSEA 5AEWB 1Q814 1GMQA 3PGBA 1YVSA 3T8UA 2F56A 1B21A 1RDSA 3OXAA 3OWSA 1VQN3 1PFPA 3SX1A 4HJLB 3LTAA 2Z76A 5IG0A 3NV0A 1STFI 5AI1A 3JUMA 1W6YA 5LC7A 1IV9A 2WOHA 2SBLA 1CQSA 1JNQA 1BNGA 1B2SA 3J7Yd 3ZG5A 3S29A 5D83A 3D5GA 3GZRA 3MHEA 4EXRA 3F8HA 3X3YA 3FKAA 1YI23 3BLZA 3NM2A 3PZWA 3M8CA 1S723 1RN7A 3H3HA 3CCQ3 1SPUA 1VQ53 3WHOA 5IF6A 4HYZA 1RGAA 3CPOA 4RNYA 1GSPA 1GS3A 2BMOB 3CC43 1FUTA 2J8XB 1R4YA 4HKVB 1CYUA 1HU9A 2B24B 3STDA 3N54B 3ER7A 1HYFA 1RN4A 1TTOA 3NXJA 2P09A 4N6MA 1E97A 1JB2A 3LTBA 4STDA 3AGNA 3Q3FA 4CDLA 1T5YA 2GU1A 1RNTA 2Y74A 3FG3A 2W6JH 1FGRA 4HM8B 2F5MA 3V98A 3AHSA 2P05A 6RNTA 2Z6BA 1I0XA 1K28A 2CX1A 2JDIH 1DE3A 1FW7A 1MWTA 4NREA 2KRTA 5CLKA 5G2GA 3GSPA 1OHOA 4RNZA 1BRKA 1K8A4 2XSOB 2YFIB 5IW9A 3KIIA 2ML5A 3FG4A 1W4NA 1M1XB 3BNCA 4HM3B 1D6ZA 5D82A 4XDWA 5AYRB 1K41A 4XBYA 4O2HA 3LYGA 2IUKA 3U1WA 1BNRA 3AHWA 2H0IA 3T0UA 1UW1A 4FCZA 3F40A 1TU5A 1YVBI 1QALA 1UI8A 1A2KA 2XFSA 3Q1CA 2E2TA 2QEX3 1DYUA 1Q824 2CC3A 1IQYA 3LT8A 1KQS2 2I9WA 3X40A 1LXEA 1Z1SA 3HOHA 2GSPA 1OGZA 2RSXA 5IG3A 2OTJ3 3EE1A 1WTHA 5JPPA 2CX0A 3KFQC 3NBJA 3KSPA 2BNGA 4N6TA 1MGRA 1BIRA 4WYKA 3S67A 1EG9B 3LXUX 4G1MB 1X1WA 3ZG0A 4HM5B 3FH1A 2F98A 2XSHB 3G8ZA 3HX8A 2XGLA 4RNTA 1TJDA 2LYXA 3LTCA 1YJ93 4HM7B 4WHAA 4TX4A 3CD63 4MMXB 5I97A 1I0VA 1BVIA 3KCHA 5BVBA 3K0ZA 3IJEB 3DY5A 5IEPA 3D5IA 1NB3I 1EKMA 4KT3B 3BU4A 4I4KA 3Q2PA 1QVF2 3E99A 5KP1A 5CK6A 3FGYA 4IIAA 1SJWA 2SARA 4HZ9B 2OWPA 4RZMA 4XBTA 3FSDA 1RMSA 1LOVA 3K7CA 4R9KA 1M9GA 2CFDA 2Q07A 3URPA 2F99A 3FCSB 3DZLA 1C7HA 1QVG2 2BMQB 4N6V0 1MWSA 4K61A 2KAAA 3NM7A 1PU4A 3JUQA 5LC6A 4R1KA 3NBRA 2W0QA 1E3RA 1FUSA 4CJNA 1QMAA 1BNIA 1VQP3 4ORLA 1RGKA 2GEYA 1GY6A 5EQLA 3S5CA 1A90A 5AIHA 1LOWA 4FCJA 3KKGA 4AKYA 3GZYB 2MC8A 1LNHA 1QAFA 1A2PA 3EJVA 3Q90A 3CCJ3 5AIIA 1KC84 3MG2A 1PYLA 3VSYA 1Y4KA 3OWYA 1N9EA 4HM6B 4MJDA 3EC9A 1JBSA 2HMNB 3WOFB 2FNQA 4EV2A 4LZIA 1EEJA 3RGAA 2STDA 3SVAA 7RNTA 1U5OA 1FZUA 1I3IA 1RGLA 1G02A 2CWUA 1ASKA
chains in the Genus database with same CATH topology
5BIRA 1HYFA 1RN4A 1TTOA 3AGNA 1X1XA 1GOUA 1UCLA 2KF5A 1BANA 3Q3FA 1BUJA 1B2XA 1RNTA 2F5MA 4HAAA 1RCKA 3AHSA 6RNTA 1I0XA 1YNVX 1DE3A 1FW7A 3BIRA 1BAOA 1RHLA 2BU4A 1BSBA 1I2GA 3GSPA 1BRKA 1BRHA 1X1UA 3DH2A 1RGGA 4GHOA 4J5GA 1LNIA 6GSPA 3RNTA 1BOXA 1GMPA 1UCIA 1GMRA 1BNFA 1BSDA 2HOHA 1BNRA 3AHWA 1B2ZA 1BGSA 1LOYA 1AY7A 1TRQA 1LRAA 2BIRA 1RGFA 2F4YA 4GSPA 1B27A 1RN1A 1HZ1A 1BNJA 4J5KA 4BIRA 3A5EA 1YGWA 1B2MA 1B2UA 1FUTA 3HOHA 2GSPA 1I3FA 2KF4A 5GSPA 1TRPA 2F5WA 1JBTA 1JBRA 4HOHA 1MGRA 1BIRA 1X1WA 4BU4A 5HOHA 1MGWA 4RNTA 1BRJA 3DGYA 1ZGXA 1C54A 2KF3A 3AGOA 1I0VA 1BVIA 1GOYA 1BRIA 2AAEA 1BRSA 1FYSA 1Q9EA 3KCHA 2AADA 2ZA4A 3D5IA 1I2EA 3SYUA 3BU4A 1B3SA 2RNTA 2C4BA 1T2IA 1SARA 1T2HA 1I70A 1IYYA 1B20A 1RCLA 1BRGA 2SARA 1DETA 2KF6A 7GSPA 5BU4A 1RMSA 1PY3A 1LOVA 3D4AA 3URPA 1I8VA 1BRNL 3WR2A 1I2FA 1BSEA 1BU4A 1GMQA 2KAAA 1GOVA 1RGEA 1YVSA 2F56A 8RNTA 1UCJA 1RDSA 1B21A 1BNEA 1RGCA 1RSNA 1RGHA 1FUSA 1RNBA 1BNIA 1RGKA 2RBIA 1LOWA 1BNGA 1B2SA 1BNSA 9RNTA 1CH0A 5RNTA 3D5GA 1A2PA 1PYLA 1X1YA 1AQZA 1RTUA 1JBSA 3WHOA 1BSCA 1UCKA 1RGAA 1RLSA 1GSPA 7RNTA 1FZUA 1I3IA 1BSAA 1RGLA 1G02A 1R4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BIR A;  1HYF A;  1RN4 A;  1TTO A;  3AGN A;  1X1X A;  1GOU A;  1UCL A;  2KF5 A;  1BAN A;  3Q3F A;  1BUJ A;  1B2X A;  1RNT A;  2F5M A;  4HAA A;  1RCK A;  3AHS A;  6RNT A;  1I0X A;  1YNV X;  1DE3 A;  1FW7 A;  3BIR A;  1BAO A;  1RHL A;  2BU4 A;  1BSB A;  1I2G A;  3GSP A;  1BRK A;  1BRH A;  1X1U A;  3DH2 A;  1RGG A;  4GHO A;  4J5G A;  1LNI A;  6GSP A;  3RNT A;  1BOX A;  1GMP A;  1UCI A;  1GMR A;  1BNF A;  1BSD A;  2HOH A;  1BNR A;  3AHW A;  1B2Z A;  1BGS A;  1LOY A;  1AY7 A;  1TRQ A;  1LRA A;  2BIR A;  1RGF A;  2F4Y A;  4GSP A;  1B27 A;  1RN1 A;  1HZ1 A;  1BNJ A;  4J5K A;  4BIR A;  3A5E A;  1YGW A;  1B2M A;  1B2U A;  1FUT A;  3HOH A;  2GSP A;  1I3F A;  2KF4 A;  5GSP A;  1TRP A;  2F5W A;  1JBT A;  1JBR A;  4HOH A;  1MGR A;  1BIR A;  1X1W A;  4BU4 A;  5HOH A;  1MGW A;  4RNT A;  1BRJ A;  3DGY A;  1ZGX A;  1C54 A;  2KF3 A;  3AGO A;  1I0V A;  1BVI A;  1GOY A;  1BRI A;  2AAE A;  1BRS A;  1FYS A;  1Q9E A;  3KCH A;  2AAD A;  2ZA4 A;  3D5I A;  1I2E A;  3SYU A;  3BU4 A;  1B3S A;  2RNT A;  2C4B A;  1T2I A;  1SAR A;  1T2H A;  1I70 A;  1IYY A;  1B20 A;  1RCL A;  1BRG A;  2SAR A;  1DET A;  2KF6 A;  7GSP A;  5BU4 A;  1RMS A;  1PY3 A;  1LOV A;  3D4A A;  3URP A;  1I8V A;  1BRN L;  3WR2 A;  1I2F A;  1BSE A;  1BU4 A;  1GMQ A;  2KAA A;  1GOV A;  1RGE A;  1YVS A;  2F56 A;  8RNT A;  1UCJ A;  1RDS A;  1B21 A;  1BNE A;  1RGC A;  1RSN A;  1RGH A;  1FUS A;  1RNB A;  1BNI A;  1RGK A;  2RBI A;  1LOW A;  1BNG A;  1B2S A;  1BNS A;  9RNT A;  1CH0 A;  5RNT A;  3D5G A;  1A2P A;  1PYL A;  1X1Y A;  1AQZ A;  1RTU A;  1JBS A;  3WHO A;  1BSC A;  1UCK A;  1RGA A;  1RLS A;  1GSP A;  7RNT A;  1FZU A;  1I3I A;  1BSA A;  1RGL A;  1G02 A;  1R4Y A; 
#chains in the Genus database with same CATH topology
 4AKZ A;  3SXX A;  3MKI A;  1ULI B;  1KD1 4;  1M90 4;  2H0G A;  3KZT A;  4EC6 A;  4J9A A;  1JN5 A;  1UCL A;  1IT7 A;  2PZV A;  1W01 A;  4EBG A;  3ECF A;  4CCV A;  1D6Y A;  2WOF A;  4WP5 A;  1LVN A;  3AMO A;  3JUP A;  4HAA A;  1TFO A;  1UGI A;  5IG4 A;  3QRD A;  1YNV X;  1JB4 A;  2RCD A;  4LGQ A;  1BAO A;  4N6O B;  1A2V A;  1OH0 A;  4JF8 A;  1I2G A;  1N8R 4;  4MEI A;  3G6E 3;  4L8P A;  3NV0 B;  2D1W A;  2O3O A;  2R4I A;  2CHC A;  3DH2 A;  2IMJ A;  3EX9 A;  3T8N A;  1W2Z A;  2CH9 A;  1LQG C;  1N5H A;  2W56 B;  2W9Q A;  4FMA A;  3X3Z A;  2K0M A;  2Y73 A;  3D79 A;  3F9S A;  5AIG A;  2UUG C;  6GSP A;  3PYJ A;  1BOX A;  3CXC 2;  4JRF A;  1UUW B;  2CK3 H;  1DMN A;  1BNF A;  1BSD A;  5BXQ A;  2HOH A;  1W00 A;  3FZW A;  1B2Z A;  3H51 A;  3S28 A;  2FGT A;  5CF2 A;  4XDV A;  1NJI 4;  1J2B A;  1V58 A;  1AY7 A;  3EBY A;  1TRQ A;  3CMA 3;  3CNM A;  1RGF A;  2F4Y A;  2FXT A;  1B27 A;  1UDI I;  1UGH I;  1BNJ A;  2YFL B;  3I0Y A;  1NWW A;  1BUQ A;  1YGW A;  4HM0 B;  1R4C A;  1B2U A;  1TP6 A;  2OQE A;  5EVH A;  3GZB A;  1Q40 A;  2KF4 A;  1OCV A;  1TRP A;  1N9J A;  2F5W A;  2M7O A;  1IDP A;  3FF2 A;  3KN4 A;  3LTD A;  1NDO B;  4HVN A;  4O8S A;  6STD A;  1O7N B;  3KE7 A;  3SOA A;  2L1S A;  4FMD A;  1JRQ A;  1EQK A;  3GWR A;  5HOH A;  3B4O A;  2GEX A;  4R4K A;  1G96 A;  3EB8 A;  1ZGX A;  4H3U A;  1C54 A;  1W2B 2;  1W6C A;  2KF3 A;  1JV2 B;  3CCL 3;  1GD3 A;  1VQ6 3;  1Q9E A;  2CFL A;  2CFK A;  1T3B A;  3RGR A;  2UGI A;  4IT7 A;  3OWU A;  3V92 A;  1LQM B;  2BT3 A;  1B3S A;  1OAC A;  3DUK A;  1QJG A;  4HM2 B;  1YGE A;  5IEO A;  1T2H A;  3MPH A;  2W03 A;  5ELU A;  1B20 A;  1RCL A;  3PCR A;  4KFE A;  1AV4 A;  1AVL A;  3WA2 X;  1IVU A;  1G0T A;  1W7C A;  1I8V A;  4GB5 A;  3WR2 A;  1TFK A;  2L4V A;  3EF8 A;  1RGE A;  3PXM A;  1CEW I;  1RGC A;  3B7C A;  1RSN A;  1GY5 A;  4AEQ A;  2IUJ A;  4EYC A;  2IY2 A;  2WO0 A;  3CC7 3;  3CNX A;  3CCS 3;  4O3V A;  1JKG B;  5ELJ A;  2RBI A;  5M1A A;  8CHO A;  4U13 A;  1US1 A;  4N6L A;  2W04 A;  1ZS7 A;  3MWZ A;  3GZX B;  1JN5 B;  3GRD A;  9RNT A;  5RNT A;  4H61 A;  3F7X A;  3B8L A;  4FCM A;  5M19 A;  3CCU 3;  1V57 A;  4GL6 A;  2XGN A;  1O7P B;  1MOL A;  3G16 A;  2INX A;  1O7M B;  4IPB A;  5DRE A;  2CW9 A;  3EHC A;  1VQ8 3;  3QK9 A;  3S27 A;  1UCK A;  4BTX A;  1RLS A;  1JZO A;  1NO3 A;  3EN1 B;  3GAX A;  5G1L A;  1O7H B;  3WA3 A;  3CPW 2;  1BSA A;  4R80 A;  1TUH A;  1RKY A;  1O7G B;  4LYL B;  3CCR 3;  1BRN L;  2K3D A;  2W56 A;  1WMN A;  2BO9 B;  2K54 A;  2GBX B;  3G71 3;  1ROV A;  2PNC A;  3NHX A;  2BMR B;  3FG1 A;  2CFG A;  3HK4 A;  1YJW 3;  4Q53 A;  1IVW A;  1GOU A;  3UNL A;  2P0M A;  1BAN A;  1B2X A;  1VQ4 3;  4NHF A;  5IG5 A;  1M1K 4;  2XRX B;  3FF0 A;  1IK3 A;  3CCV 3;  2QIY A;  3FLJ A;  4L7K A;  4ZM8 A;  4HBR A;  1VQK 3;  2D42 A;  2CIU A;  4KFD A;  1QAK A;  3ZFZ A;  3BIR A;  4L8O A;  5G1K A;  3N9H A;  1OF5 B;  3WOD G;  1N5P A;  1MWU A;  4BTY A;  3JUO A;  4KFF A;  1UI7 A;  1OUN A;  3CCM 3;  2UX0 A;  1X1U A;  1JJ2 2;  2Z77 A;  1L5G B;  1MWR A;  4N6U A;  3WMD A;  1YIT 3;  3MG1 A;  1RGG A;  1Q40 B;  3U97 A;  5STD A;  1UUG B;  1Q7H A;  2HMJ B;  3DGM A;  4GHO A;  4J5G A;  2RFR A;  5FW5 A;  3KSE D;  4MMZ B;  1ZO2 A;  2CWV A;  1GMR A;  3NX0 A;  4O02 B;  1OPY A;  1BGS A;  4XBX A;  2E2V A;  2HMM B;  3JVC A;  4LSO A;  2WGQ A;  4EW5 A;  1VQ9 3;  2C10 A;  3X42 A;  2OQE C;  1RN1 A;  1RRH A;  4BIR A;  5JBS A;  1Q42 A;  1B2M A;  4EV5 A;  4OK0 A;  2HMK B;  4FMC A;  4J8T A;  4QWT A;  1AVK A;  1GD4 A;  4N3V A;  1SQW A;  2OOV C;  2F86 B;  2W2C A;  1IVX A;  1CYV A;  3ROB A;  1E3V A;  1VZZ A;  1VQM 3;  1OHP A;  5EEO A;  4DKI A;  4BU4 A;  5M18 A;  3AMO B;  2QGU A;  4R9L A;  4PEJ A;  2CG0 A;  3HIG A;  2IA7 A;  3TDG A;  3K9M C;  4CPK A;  1BRJ A;  2ZDJ A;  3DGY A;  3F7S A;  1DVC A;  4K1V A;  1UUV B;  1IVV A;  3DXO A;  3I56 3;  1GOY A;  1BRI A;  2AAE A;  1BRS A;  4OUQ A;  4OVM A;  4XB5 A;  3X41 A;  3CCE 3;  3D3L A;  4WFO A;  1ULJ B;  4HM4 B;  1N8Q A;  1SII A;  1IQX A;  3DMC A;  3SOY A;  5IEN A;  1RRL A;  3SYU A;  2HML B;  2R41 A;  4WWU C;  4HM1 B;  3N8B A;  1T2I A;  1YIJ 3;  2LQV A;  2YFJ B;  1I70 A;  5KP3 A;  1NNV A;  1JB5 A;  5BU4 A;  1FGO A;  1PY3 A;  5AEU B;  3BNE A;  3UB1 A;  5AYS C;  4FR9 A;  1I2F A;  2XFT A;  3EN8 A;  1NB5 I;  2H0H A;  1KSI A;  1BU4 A;  1WQL B;  2GU3 A;  3F14 A;  1GOV A;  1DMM A;  1FGM A;  1SIH A;  8RNT A;  3CC2 3;  1YHQ 3;  1UCJ A;  3NQZ A;  1K9M 4;  1BNE A;  4FMB A;  1RGH A;  1RNB A;  3BND A;  1O7W B;  5AIF A;  3OW2 2;  2YX9 A;  4BL3 A;  4X2O A;  2QA4 3;  3WOE B;  5TGN A;  2KCD A;  1IT8 A;  1D6U A;  2CWT A;  1YJN 3;  1K73 4;  1BNS A;  1CH0 A;  1FUW A;  4N6N B;  4ILF A;  2IYJ A;  2MF7 A;  1EUI C;  1OGX A;  1GY7 A;  1X1Y A;  1AQZ A;  1ZX2 A;  3OX9 A;  1FA3 A;  1FGQ A;  1RTU A;  5FGO A;  1BSC A;  2CFW A;  4I5Q A;  3WDG B;  3A76 A;  2GXF A;  2XR8 B;  3B4P A;  3DGN A;  2E2U A;  3NQY A;  3G4S 3;  2RGQ A;  2XF3 A;  3L0R A;  1FGT A;  3LZA A;  2XH9 A;  5BIR A;  1WMP A;  3HII A;  4K1U A;  1WMO A;  1VQL 3;  2V1L A;  1X1X A;  2KF5 A;  3X3X A;  2KXG A;  3BNB A;  1BUJ A;  2ML6 A;  3SED A;  4WYK B;  3LML A;  3OV4 A;  3JUN A;  3MYT A;  5A0O B;  1W02 A;  2OCT A;  4XM4 A;  1RCK A;  3BB9 A;  2HMO B;  4BL2 A;  1DVD A;  4LMI A;  4K90 B;  1ROA A;  5CXO A;  1RHL A;  3DGO A;  1IV7 A;  2BU4 A;  1BSB A;  3O8Y A;  4NPB A;  3CME 3;  5HGR A;  2O9U X;  1BRH A;  5CF1 A;  3HI7 A;  1WNH A;  1TIJ A;  1JKG A;  1RJO A;  3K5T A;  7STD A;  2JQ5 A;  1V74 A;  1KWI A;  3CU3 A;  4HZB B;  1Q86 4;  1LNI A;  3RNT A;  1GMP A;  2CG1 A;  3EQQ B;  3K63 A;  1UCI A;  2OTL 3;  2CKF B;  2GBW B;  2XEP A;  1AR0 A;  5DRV A;  4BTW A;  1DMQ A;  4KVH A;  1VQ7 3;  1LOY A;  1JZD A;  1W5Z A;  1LRA A;  2BIR A;  4GSP A;  4J5K A;  1Q7Y 4;  1HZ1 A;  2P0X A;  1W6G A;  2W9P A;  3A5E A;  2WGO A;  2ZL8 A;  3LT9 A;  2OOV A;  5IER A;  1VQQ A;  3DGL A;  1I3F A;  5D81 A;  5GSP A;  2B1X B;  1HKX A;  1EA2 A;  3VF1 A;  3F8X A;  3UJM A;  5KP4 A;  1JBT A;  1JBR A;  4HOH A;  1IU7 A;  1S5A A;  2C11 A;  3I55 3;  1IQ8 A;  4LEH A;  3MG3 A;  3SLU A;  3D9R A;  3PS8 A;  3IPT A;  1MGW A;  4X2H A;  3PCS A;  1VQO 3;  1MNL A;  2BHM A;  3V99 A;  1LOX A;  1OF5 A;  3AGO A;  3VGN A;  1FYS A;  1OHS A;  4RBN A;  2AAD A;  2ZA4 A;  1U8C B;  3UL5 A;  1I2E A;  3LH4 A;  1A67 A;  1STD A;  1NU3 A;  2RNT A;  2A15 A;  2C4B A;  3ALA A;  3IMA B;  1SAR A;  4KZ1 A;  4MMY B;  1ISK A;  3LOY A;  2Z7A A;  3NBB A;  3RDE A;  3MSO A;  1IYY A;  1BRG A;  2ZHX B;  3EBT A;  1DET A;  5JPU A;  1GYB A;  2KF6 A;  2P38 A;  7GSP A;  3HZP A;  3DM8 A;  3NUV A;  3G0K A;  3D4A A;  3UL6 A;  1F8N A;  1BSE A;  5AEW B;  1Q81 4;  1GMQ A;  3PGB A;  1YVS A;  3T8U A;  2F56 A;  1B21 A;  1RDS A;  3OXA A;  3OWS A;  1VQN 3;  1PFP A;  3SX1 A;  4HJL B;  3LTA A;  2Z76 A;  5IG0 A;  3NV0 A;  1STF I;  5AI1 A;  3JUM A;  1W6Y A;  5LC7 A;  1IV9 A;  2WOH A;  2SBL A;  1CQS A;  1JNQ A;  1BNG A;  1B2S A;  3J7Y d;  3ZG5 A;  3S29 A;  5D83 A;  3D5G A;  3GZR A;  3MHE A;  4EXR A;  3F8H A;  3X3Y A;  3FKA A;  1YI2 3;  3BLZ A;  3NM2 A;  3PZW A;  3M8C A;  1S72 3;  1RN7 A;  3H3H A;  3CCQ 3;  1SPU A;  1VQ5 3;  3WHO A;  5IF6 A;  4HYZ A;  1RGA A;  3CPO A;  4RNY A;  1GSP A;  1GS3 A;  2BMO B;  3CC4 3;  1FUT A;  2J8X B;  1R4Y A;  4HKV B;  1CYU A;  1HU9 A;  2B24 B;  3STD A;  3N54 B;  3ER7 A;  1HYF A;  1RN4 A;  1TTO A;  3NXJ A;  2P09 A;  4N6M A;  1E97 A;  1JB2 A;  3LTB A;  4STD A;  3AGN A;  3Q3F A;  4CDL A;  1T5Y A;  2GU1 A;  1RNT A;  2Y74 A;  3FG3 A;  2W6J H;  1FGR A;  4HM8 B;  2F5M A;  3V98 A;  3AHS A;  2P05 A;  6RNT A;  2Z6B A;  1I0X A;  1K28 A;  2CX1 A;  2JDI H;  1DE3 A;  1FW7 A;  1MWT A;  4NRE A;  2KRT A;  5CLK A;  5G2G A;  3GSP A;  1OHO A;  4RNZ A;  1BRK A;  1K8A 4;  2XSO B;  2YFI B;  5IW9 A;  3KII A;  2ML5 A;  3FG4 A;  1W4N A;  1M1X B;  3BNC A;  4HM3 B;  1D6Z A;  5D82 A;  4XDW A;  5AYR B;  1K41 A;  4XBY A;  4O2H A;  3LYG A;  2IUK A;  3U1W A;  1BNR A;  3AHW A;  2H0I A;  3T0U A;  1UW1 A;  4FCZ A;  3F40 A;  1TU5 A;  1YVB I;  1QAL A;  1UI8 A;  1A2K A;  2XFS A;  3Q1C A;  2E2T A;  2QEX 3;  1DYU A;  1Q82 4;  2CC3 A;  1IQY A;  3LT8 A;  1KQS 2;  2I9W A;  3X40 A;  1LXE A;  1Z1S A;  3HOH A;  2GSP A;  1OGZ A;  2RSX A;  5IG3 A;  2OTJ 3;  3EE1 A;  1WTH A;  5JPP A;  2CX0 A;  3KFQ C;  3NBJ A;  3KSP A;  2BNG A;  4N6T A;  1MGR A;  1BIR A;  4WYK A;  3S67 A;  1EG9 B;  3LXU X;  4G1M B;  1X1W A;  3ZG0 A;  4HM5 B;  3FH1 A;  2F98 A;  2XSH B;  3G8Z A;  3HX8 A;  2XGL A;  4RNT A;  1TJD A;  2LYX A;  3LTC A;  1YJ9 3;  4HM7 B;  4WHA A;  4TX4 A;  3CD6 3;  4MMX B;  5I97 A;  1I0V A;  1BVI A;  3KCH A;  5BVB A;  3K0Z A;  3IJE B;  3DY5 A;  5IEP A;  3D5I A;  1NB3 I;  1EKM A;  4KT3 B;  3BU4 A;  4I4K A;  3Q2P A;  1QVF 2;  3E99 A;  5KP1 A;  5CK6 A;  3FGY A;  4IIA A;  1SJW A;  2SAR A;  4HZ9 B;  2OWP A;  4RZM A;  4XBT A;  3FSD A;  1RMS A;  1LOV A;  3K7C A;  4R9K A;  1M9G A;  2CFD A;  2Q07 A;  3URP A;  2F99 A;  3FCS B;  3DZL A;  1C7H A;  1QVG 2;  2BMQ B;  4N6V 0;  1MWS A;  4K61 A;  2KAA A;  3NM7 A;  1PU4 A;  3JUQ A;  5LC6 A;  4R1K A;  3NBR A;  2W0Q A;  1E3R A;  1FUS A;  4CJN A;  1QMA A;  1BNI A;  1VQP 3;  4ORL A;  1RGK A;  2GEY A;  1GY6 A;  5EQL A;  3S5C A;  1A90 A;  5AIH A;  1LOW A;  4FCJ A;  3KKG A;  4AKY A;  3GZY B;  2MC8 A;  1LNH A;  1QAF A;  1A2P A;  3EJV A;  3Q90 A;  3CCJ 3;  5AII A;  1KC8 4;  3MG2 A;  1PYL A;  3VSY A;  1Y4K A;  3OWY A;  1N9E A;  4HM6 B;  4MJD A;  3EC9 A;  1JBS A;  2HMN B;  3WOF B;  2FNQ A;  4EV2 A;  4LZI A;  1EEJ A;  3RGA A;  2STD A;  3SVA A;  7RNT A;  1U5O A;  1FZU A;  1I3I A;  1RGL A;  1G02 A;  2CWU A;  1ASK A; 
#chains in the Genus database with same CATH homology
 5BIR A;  1HYF A;  1RN4 A;  1TTO A;  3AGN A;  1X1X A;  1GOU A;  1UCL A;  2KF5 A;  1BAN A;  3Q3F A;  1BUJ A;  1B2X A;  1RNT A;  2F5M A;  4HAA A;  1RCK A;  3AHS A;  6RNT A;  1I0X A;  1YNV X;  1DE3 A;  1FW7 A;  3BIR A;  1BAO A;  1RHL A;  2BU4 A;  1BSB A;  1I2G A;  3GSP A;  1BRK A;  1BRH A;  1X1U A;  3DH2 A;  1RGG A;  4GHO A;  4J5G A;  1LNI A;  6GSP A;  3RNT A;  1BOX A;  1GMP A;  1UCI A;  1GMR A;  1BNF A;  1BSD A;  2HOH A;  1BNR A;  3AHW A;  1B2Z A;  1BGS A;  1LOY A;  1AY7 A;  1TRQ A;  1LRA A;  2BIR A;  1RGF A;  2F4Y A;  4GSP A;  1B27 A;  1RN1 A;  1HZ1 A;  1BNJ A;  4J5K A;  4BIR A;  3A5E A;  1YGW A;  1B2M A;  1B2U A;  1FUT A;  3HOH A;  2GSP A;  1I3F A;  2KF4 A;  5GSP A;  1TRP A;  2F5W A;  1JBT A;  1JBR A;  4HOH A;  1MGR A;  1BIR A;  1X1W A;  4BU4 A;  5HOH A;  1MGW A;  4RNT A;  1BRJ A;  3DGY A;  1ZGX A;  1C54 A;  2KF3 A;  3AGO A;  1I0V A;  1BVI A;  1GOY A;  1BRI A;  2AAE A;  1BRS A;  1FYS A;  1Q9E A;  3KCH A;  2AAD A;  2ZA4 A;  3D5I A;  1I2E A;  3SYU A;  3BU4 A;  1B3S A;  2RNT A;  2C4B A;  1T2I A;  1SAR A;  1T2H A;  1I70 A;  1IYY A;  1B20 A;  1RCL A;  1BRG A;  2SAR A;  1DET A;  2KF6 A;  7GSP A;  5BU4 A;  1RMS A;  1PY3 A;  1LOV A;  3D4A A;  3URP A;  1I8V A;  1BRN L;  3WR2 A;  1I2F A;  1BSE A;  1BU4 A;  1GMQ A;  2KAA A;  1GOV A;  1RGE A;  1YVS A;  2F56 A;  8RNT A;  1UCJ A;  1RDS A;  1B21 A;  1BNE A;  1RGC A;  1RSN A;  1RGH A;  1FUS A;  1RNB A;  1BNI A;  1RGK A;  2RBI A;  1LOW A;  1BNG A;  1B2S A;  1BNS A;  9RNT A;  1CH0 A;  5RNT A;  3D5G A;  1A2P A;  1PYL A;  1X1Y A;  1AQZ A;  1RTU A;  1JBS A;  3WHO A;  1BSC A;  1UCK A;  1RGA A;  1RLS A;  1GSP A;  7RNT A;  1FZU A;  1I3I A;  1BSA A;  1RGL A;  1G02 A;  1R4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...