3URPA

Re-refinement of pdb entry 5rnt - ribonuclease t1 with guanosine-3',5'-diphosphate and phosphate ion bound
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'CDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title Exploiting structure similarity in refinement: automated NCS and target-structure restraints in BUSTER.
pubmed doi rcsb
molecule tags Hydrolase
total genus 26
structure length 103
sequence length 103
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3urpA00
1LNIA 1B20A 1TTOA 1X1YA 2BIRA 1BNSA 3GSPA 1GMPA 2HOHA 1X1XA 3AHSA 1BSCA 1LOYA 1BRIA 1UCJA 3D4AA 3WHOA 1RGEA 1UCKA 1RHLA 1LOVA 2F56A 1BANA 1BOXA 2F5MA 3D5GA 1FW7A 1UCIA 4RNTA 1R4YA 1UCLA 2KF4A 1GOYA 2GSPA 1BSDA 1BNIA 4GHOA 1RMSA 2RBIA 6GSPA 2KF3A 1BRHA 2AADA 3D5IA 5HOHA 1MGWA 1BRNL 1JBRA 4BU4A 1BSEA 1BSBA 1BUJA 1GOUA 1RCLA 2KF5A 1I2GA 1RN4A 3A5EA 1CH0A 3AHWA 1I3IA 9RNTA 1I0XA 1FZUA 5BIRA 1I70A 1DE3A 3HOHA 1RNTA 1FYSA 1I3FA 1B3SA 1JBSA 1PYLA 5GSPA 3URPA 1BNRA 1T2IA 1BNEA 1X1UA 1LOWA 5BU4A 4J5KA 4HOHA 1GSPA 1HYFA 1RGHA 3Q3FA 1AY7A 2RNTA 1YNVX 1BRJA 1BNJA 1X1WA 1BRKA 1RN1A 1GOVA 5RNTA 1RDSA 3SYUA 3RNTA 1GMQA 1IYYA 2F4YA 1Q9EA 3DGYA 1GMRA 1RLSA 1BIRA 4BIRA 1BAOA 1B2ZA 1B2MA 1I2EA 1LRAA 1YVSA 2AAEA 1PY3A 1MGRA 1RGKA 2KF6A 4GSPA 2BU4A 1RSNA 1BGSA 1RGFA 1I2FA 7GSPA 1DETA 1JBTA 2ZA4A 1TRPA 1RGCA 1BRSA 2C4BA 2F5WA 1BU4A 1I0VA 3DH2A 1BRGA 8RNTA 1C54A 3WR2A 1FUTA 1B21A 1B27A 3AGNA 1BNFA 1RCKA 1RGGA 6RNTA 1B2UA 1BSAA 1T2HA 1B2SA 1RGLA 4HAAA 1RNBA 1B2XA 1HZ1A 1FUSA 3AGOA 2KAAA 1AQZA 3KCHA 7RNTA 4J5GA 2SARA 1YGWA 1BNGA 1BVIA 1I8VA 1SARA 3BU4A 3BIRA 1G02A 1TRQA 1ZGXA 1RGAA 1A2PA 1RTUA
chains in the Genus database with same CATH superfamily
2CFDA 1B20A 1TTOA 4Q53A 3WDGB 3DMCA 1BNSA 1VQN3 3MG1A 1NU3A 3N9HA 1Q42A 1X1XA 4MMZB 1SIIA 4J9AA 1BRIA 1TFOA 3D4AA 4AEQA 1YGEA 2Z77A 2FXTA 4ORLA 3OWYA 4CDLA 1UCKA 1BANA 3NBBA 3DM8A 3EE1A 2GBXB 3Q1CA 2KXGA 1WTHA 4HM4B 5STDA 1UCLA 5AEWB 1J2BA 1LQGC 2CWVA 1DMQA 3EC9A 1MWTA 4LSOA 2XFTA 2L4VA 2HMNB 3FF0A 3Q2PA 3WODG 3NV0A 2KF3A 3OWUA 1FGRA 3CME3 3D5IA 3X3ZA 5HOHA 2OQEC 1BSEA 1BSBA 2XH9A 4KT3B 4K90B 4OVMA 3A5EA 4KFDA 3PCSA 1UI8A 2YFIB 5BXQA 1T5YA 3HI7A 1W02A 1FGQA 1FZUA 1DE3A 1JJ22 5KP1A 1U5OA 4U13A 3NUVA 5AYRB 1JV2B 4J8TA 4OUQA 2CX0A 5D83A 1SIHA 1BNEA 1T2IA 2Z6BA 4H61A 2OTJ3 3MSOA 4J5KA 4N6MA 3D79A 4HOHA 1W4NA 3Q3FA 2RNTA 5AIHA 1YNVX 1YIJ3 2WGOA 1IVXA 4RNYA 3CCL3 1BNJA 1W00A 1BRKA 2Z76A 4WP5A 1GOVA 3MG3A 5RNTA 3ER7A 4WYKA 2GEYA 3DUKA 4O3VA 1PU4A 1K41A 3J7Yd 1GYBA 1Q814 1OHPA 1GY7A 2B24B 2F4YA 1QMAA 2W9PA 4JF8A 4FCMA 1OH0A 1EG9B 3LOYA 1RLSA 3SEDA 4R9KA 4NREA 2UX0A 2W56A 3FSDA 3X41A 1JB5A 3A76A 2CFLA 3DY5A 5M19A 5IEOA 3I563 3FGYA 3GAXA 1PY3A 2Y73A 2CW9A 4I4KA 2XF3A 5DREA 4JRFA 2KF6A 2MC8A 2OOVA 1JBTA 2XGLA 3DXOA 1F8NA 3LTDA 2C4BA 3FCSB 4WFOA 3CD63 4N6TA 8RNTA 1QVF2 5CXOA 1YIT3 3ROBA 1C54A 1IDPA 1FUTA 2PZVA 2YFJB 1A90A 1BNFA 1W01A 1UUGB 1D6YA 3CCU3 2H0GA 1O7PB 6RNTA 3L0RA 3H3HA 3F7XA 1W6GA 3H51A 3M8CA 3V92A 3G8ZA 2BMOB 3CCR3 3NV0B 3OX9A 1FUSA 3PZWA 1AQZA 3VSYA 5BVBA 1NB3I 1GY5A 2V1LA 3CNMA 2P0MA 1VQ73 1O7MB 1AV4A 3U97A 2CFWA 2IA7A 2BO9B 1UDII 2KRTA 1ZS7A 2P38A 2SARA 3F7SA 4HKVB 5EQLA 1EKMA 3MWZA 5LC7A 5KP4A 2W2CA 2J8XB 1IVUA 2UUGC 5CF2A 3LTAA 5G2GA 3RGRA 3ZG0A 2IMJA 5IW9A 3AMOA 1RGAA 1AVKA 2ZDJA 4HM7B 2E2TA 3FLJA 1X1YA 3T8UA 1IVVA 1WMOA 1V57A 5HGRA 2ZL8A 3HX8A 3KSED 4L7KA 2GU3A 1BSCA 3WHOA 1UCJA 2K54A 2Y74A 3IPTA 2MF7A 3NXJA 1OHSA 2F56A 4WYKB 2CC3A 1BOXA 3F8XA 3D5GA 3UL5A 1WMNA 3NM2A 4GL6A 4ZM8A 3WA3A 2I9WA 2W56B 2KF4A 1GOYA 2GSPA 1IK3A 4CPKA 2C11A 1HKXA 2UGIA 1NNVA 1BNIA 2P05A 1YJ93 1UW1A 3EBYA 2CFGA 6GSPA 4N6LA 2CWUA 1FGTA 2SBLA 3BB9A 4IPBA 4NPBA 1MWRA 1BRHA 4FMDA 1L5GB 1JN5A 1G0TA 1MGWA 3MPHA 4FCJA 5ELUA 3LTBA 1Q864 1IU7A 1RCLA 3QRDA 5ELJA 1RN4A 3F14A 1QVG2 4DKIA 9RNTA 3CPW2 1VQM3 3HIGA 3EN1B 1I70A 4AKYA 2OOVC 3MG2A 1CEWI 3K0ZA 1RNTA 1RKYA 1I3FA 2CFKA 1RRLA 1JBSA 4R4KA 1PYLA 3BNBA 3LTCA 3URPA 1M904 3LH4A 4LMIA 1VQ63 2M7OA 4N6NB 5CK6A 1IQXA 4EW5A 1A2KA 3G16A 3T8NA 1IQYA 1TIJA 1IV9A 2E2VA 4G1MB 3SVAA 1GS3A 2GU1A 1AVLA 1ULJB 1Q7Y4 4EXRA 2RFRA 3JUQA 1YVBI 1EA2A 1BRJA 4L8PA 1RDSA 3SYUA 1NWWA 3F40A 4L8OA 3QK9A 3UB1A 5IERA 1Q7HA 4TX4A 1Q9EA 4QWTA 1GMRA 1JZDA 2JDIH 4FCZA 1M9GA 2XRXB 4HM8B 3CC73 1GD4A 1B2MA 2OTL3 1RJOA 3AMOB 4XDVA 4MMYB 3WA2X 3DGOA 3K7CA 4N3VA 1D6ZA 2GEXA 5AIGA 5IG0A 1GD3A 1OF5A 3JUPA 1ZO2A 1I2FA 5JBSA 1DETA 3PXMA 1UUWB 4EC6A 1BU4A 1HU9A 3DH2A 1VQK3 1VQ53 5TGNA 4HM2B 1B27A 3LZAA 1FA3A 5JPPA 1OUNA 5AIIA 2HMLB 3IMAB 1FUWA 2WGQA 4NHFA 5G1LA 4CCVA 3CCM3 5D82A 1B2SA 2HMOB 4HVNA 1QAFA 1KSIA 3KE7A 5IG4A 3K5TA 3D9RA 3GWRA 3LXUX 3KSPA 4FMBA 3V98A 1JB2A 2Q07A 1DMNA 5M18A 1JN5B 3CPOA 4IIAA 3VGNA 2GBWB 1STDA 2FNQA 3S29A 4CJNA 7RNTA 3G713 1N8QA 1WNHA 1R4CA 3S27A 2XR8B 1EEJA 1OGXA 1QJGA 3X40A 1I8VA 1VQ93 4AKZA 3BIRA 2CG0A 1JKGA 1T3BA 4OK0A 1OGZA 2GXFA 1N9JA 1VQQA 3NQYA 3JUMA 2BIRA 1YI23 4O02B 4EV2A 4STDA 3S5CA 1GMPA 1E97A 4RZMA 3X42A 3AHSA 3F8HA 1LOYA 1W6YA 3NHXA 3NM7A 2XSHB 1RHLA 3ZFZA 3ECFA 3GRDA 3CXC2 1VQL3 1FW7A 1M1XB 1VQ43 1TFKA 3BNCA 3CU3A 1S5AA 4RNTA 1R4YA 2QIYA 2INXA 3TDGA 2R4IA 1D6UA 2H0HA 3FKAA 2BHMA 3WOFB 4KFFA 3K63A 1UGIA 4H3UA 1LVNA 4GHOA 1VQO3 2CH9A 3B7CA 5AYSC 3RDEA 1DVDA 1OF5B 4RNZA 3EJVA 1W2B2 3GZBA 4KVHA 2L1SA 2AADA 2W6JH 1BRNL 5AI1A 1JBRA 1A2VA 1DVCA 2CKFB 1BUJA 1IQ8A 3FG1A 2KF5A 3AHWA 4N6OB 1I2GA 4O2HA 2OQEA 2XFSA 1WMPA 2HMMB 1O7NB 2PNCA 3Q90A 5BIRA 3CCV3 1RRHA 2D1WA 1VQ83 1NDOB 1FYSA 1QALA 1NO3A 1YJN3 1O7GB 5GSPA 4R1KA 1BNRA 2CG1A 1X1UA 5I97A 1WQLB 4MJDA 1YJW3 1ASKA 1RGHA 3HK4A 1LOXA 1AY7A 3F9SA 1CQSA 2RSXA 3EHCA 3EBTA 1BUQA 3UL6A 4XB5A 1OPYA 1M1K4 1X1WA 4HM6B 1GY6A 1IV7A 3CNXA 1K28A 1NB5I 2C10A 3PCRA 5EVHA 2W0QA 4HZBB 3BNEA 3DGYA 4O8SA 1U8CB 1K9M4 5CF1A 1IT7A 1BIRA 1V74A 2IY2A 3DGMA 2K0MA 5IENA 1JKGB 1I2EA 2CHCA 4K61A 2AAEA 3LMLA 1MWSA 1MGRA 5EEOA 3FF2A 2HMJB 3SXXA 1ULIB 1W5ZA 3EQQB 3B4OA 2P0XA 1RGFA 1RN7A 3OWSA 3SX1A 2WOFA 4BL3A 5AEUB 1ZX2A 2W03A 5CLKA 1EUIC 1VZZA 2ZA4A 1BRSA 2F5WA 7STDA 1BRGA 1TJDA 1ROAA 1TP6A 2FGTA 2RCDA 2Z7AA 3LYGA 4XDWA 2CX1A 4FR9A 3PGBA 1B21A 3AGNA 3DGLA 1OCVA 3KZTA 1B2UA 3BLZA 1BSAA 4HM3B 3EN8A 3OV4A 4MEIA 4HZ9B 4HAAA 1K8A4 4X2OA 4N6V0 1C7HA 1W6CA 2KCDA 1RNBA 2O9UX 3G4S3 2LQVA 1JNQA 1HZ1A 4I5QA 3JVCA 2F98A 3AGOA 3MHEA 3SOYA 3X3XA 1SPUA 5FW5A 3JUOA 3LT9A 1O7HB 2F99A 1MOLA 1OHOA 4XBTA 3VF1A 3S67A 4XBYA 1IVWA 1YGWA 5IG5A 4XM4A 2OCTA 3NBRA 3DGNA 3EF8A 3BNDA 2QEX3 1BNGA 1BVIA 1Q40A 1A67A 1AR0A 1SARA 3JUNA 5DRVA 3CCS3 5BU4A 1LNIA 1JZOA 3NX0A 4R9LA 4GB5A 3GSPA 3V99A 1UUVB 2HMKB 1US1A 3LT8A 2HOHA 4HM5B 3FZWA 3ALAA 4K1UA 1N5HA 1RGEA 3N54B 2WOHA 5G1KA 1LOVA 1W2ZA 5KP3A 4IT7A 3SOAA 2A15A 2F5MA 2P09A 3PS8A 1OACA 1UCIA 4HM1B 4LYLB 5A0OB 5IG3A 5IF6A 2CIUA 4LGQA 1MWUA 3KIIA 1LNHA 4HBRA 3CCQ3 1BSDA 1E3RA 3B4PA 4EYCA 3CCJ3 4LZIA 5IEPA 5D81A 1E3VA 4ILFA 2H0IA 3S28A 2IUKA 3U1WA 1DYUA 2F86B 1RMSA 2RBIA 1CYVA 4FMCA 4K1VA 4HJLB 3G0KA 4N6UA 2ML6A 3O8YA 1JB4A 4X2HA 2XEPA 4BU4A 1FGMA 1Y4KA 1K734 1GOUA 1G96A 3ZG5A 4BL2A 1CH0A 1I3IA 2IUJA 1IT8A 1I0XA 1ISKA 1N5PA 2YX9A 3MKIA 1FGOA 3OW22 5LC6A 3HOHA 8CHOA 2BT3A 1UI7A 2XSOB 1B3SA 2LYXA 4BTWA 1VQP3 2W9QA 4WHAA 3KFQC 1LOWA 3MYTA 1Q824 3FG4A 1UGHI 1GSPA 3D3LA 1HYFA 1KWIA 3EB8A 4WWUC 3WMDA 2O3OA 1DMMA 3OXAA 1N9EA 3CMA3 1W7CA 2K3DA 2RGQA 2BMQB 3DZLA 2B1XB 1V58A 3E99A 1RN1A 3X3YA 3G6E3 2R41A 3RNTA 3HIIA 1O7WB 1GMQA 3I553 3NQZA 1IYYA 3GZXB 1KC84 1Q40B 3RGAA 4PEJA 2E2UA 5M1AA 2BNGA 4BIRA 1B2ZA 1BAOA 1N8R4 2D42A 1KD14 1PFPA 1LRAA 1YVSA 3GZRA 4KFEA 5JPUA 2CK3H 1RGKA 2IYJA 2W04A 2XGNA 4GSPA 2BU4A 3FG3A 1RSNA 1STFI 1BGSA 2ZHXB 2ML5A 4KZ1A 1MNLA 2OWPA 4LEHA 3SLUA 4BTXA 7GSPA 3GZYB 1TRPA 1TU5A 1RGCA 3I0YA 3KN4A 1CYUA 1I0VA 5AIFA 3FH1A 4XBXA 4EV5A 3WR2A 1ROVA 3K9MC 1EQKA 1RCKA 6STDA 3PYJA 1RGGA 2YFLB 3EX9A 3NBJA 1LQMB 2WO0A 1YHQ3 1T2HA 5FGOA 1RGLA 4HM0B 2BMRB 2QA43 2JQ5A 1B2XA 2KAAA 4BTYA 3KCHA 1TUHA 1NJI4 4HYZA 2CWTA 3WOEB 3N8BA 3UNLA 1KQS2 2QGUA 4J5GA 3IJEB 3CCE3 3UJMA 4R80A 3CC43 1S723 1Z1SA 3T0UA 1SQWA 4MMXB 1JRQA 4RBNA 3HZPA 3BU4A 3KKGA 1QAKA 4FMAA 1SJWA 4EBGA 1G02A 2STDA 1TRQA 3CC23 1ZGXA 3STDA 1LXEA 1A2PA 1RTUA 3B8LA
chains in the Genus database with same CATH topology
1LNIA 1B20A 1TTOA 1X1YA 2BIRA 1BNSA 3GSPA 1GMPA 2HOHA 1X1XA 3AHSA 1BSCA 1LOYA 1BRIA 1UCJA 3D4AA 3WHOA 1RGEA 1UCKA 1RHLA 1LOVA 2F56A 1BANA 1BOXA 2F5MA 3D5GA 1FW7A 1UCIA 4RNTA 1R4YA 1UCLA 2KF4A 1GOYA 2GSPA 1BSDA 1BNIA 4GHOA 1RMSA 2RBIA 6GSPA 2KF3A 1BRHA 2AADA 3D5IA 5HOHA 1MGWA 1BRNL 1JBRA 4BU4A 1BSEA 1BSBA 1BUJA 1GOUA 1RCLA 2KF5A 1I2GA 1RN4A 3A5EA 1CH0A 3AHWA 1I3IA 9RNTA 1I0XA 1FZUA 5BIRA 1I70A 1DE3A 3HOHA 1RNTA 1FYSA 1I3FA 1B3SA 1JBSA 1PYLA 5GSPA 3URPA 1BNRA 1T2IA 1BNEA 1X1UA 1LOWA 5BU4A 4J5KA 4HOHA 1GSPA 1HYFA 1RGHA 3Q3FA 1AY7A 2RNTA 1YNVX 1BRJA 1BNJA 1X1WA 1BRKA 1RN1A 1GOVA 5RNTA 1RDSA 3SYUA 3RNTA 1GMQA 1IYYA 2F4YA 1Q9EA 3DGYA 1GMRA 1RLSA 1BIRA 4BIRA 1BAOA 1B2ZA 1B2MA 1I2EA 1LRAA 1YVSA 2AAEA 1PY3A 1MGRA 1RGKA 2KF6A 4GSPA 2BU4A 1RSNA 1BGSA 1RGFA 1I2FA 7GSPA 1DETA 1JBTA 2ZA4A 1TRPA 1RGCA 1BRSA 2C4BA 2F5WA 1BU4A 1I0VA 3DH2A 1BRGA 8RNTA 1C54A 3WR2A 1FUTA 1B21A 1B27A 3AGNA 1BNFA 1RCKA 1RGGA 6RNTA 1B2UA 1BSAA 1T2HA 1B2SA 1RGLA 4HAAA 1RNBA 1B2XA 1HZ1A 1FUSA 3AGOA 2KAAA 1AQZA 3KCHA 7RNTA 4J5GA 2SARA 1YGWA 1BNGA 1BVIA 1I8VA 1SARA 3BU4A 3BIRA 1G02A 1TRQA 1ZGXA 1RGAA 1A2PA 1RTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNI A;  1B20 A;  1TTO A;  1X1Y A;  2BIR A;  1BNS A;  3GSP A;  1GMP A;  2HOH A;  1X1X A;  3AHS A;  1BSC A;  1LOY A;  1BRI A;  1UCJ A;  3D4A A;  3WHO A;  1RGE A;  1UCK A;  1RHL A;  1LOV A;  2F56 A;  1BAN A;  1BOX A;  2F5M A;  3D5G A;  1FW7 A;  1UCI A;  4RNT A;  1R4Y A;  1UCL A;  2KF4 A;  1GOY A;  2GSP A;  1BSD A;  1BNI A;  4GHO A;  1RMS A;  2RBI A;  6GSP A;  2KF3 A;  1BRH A;  2AAD A;  3D5I A;  5HOH A;  1MGW A;  1BRN L;  1JBR A;  4BU4 A;  1BSE A;  1BSB A;  1BUJ A;  1GOU A;  1RCL A;  2KF5 A;  1I2G A;  1RN4 A;  3A5E A;  1CH0 A;  3AHW A;  1I3I A;  9RNT A;  1I0X A;  1FZU A;  5BIR A;  1I70 A;  1DE3 A;  3HOH A;  1RNT A;  1FYS A;  1I3F A;  1B3S A;  1JBS A;  1PYL A;  5GSP A;  3URP A;  1BNR A;  1T2I A;  1BNE A;  1X1U A;  1LOW A;  5BU4 A;  4J5K A;  4HOH A;  1GSP A;  1HYF A;  1RGH A;  3Q3F A;  1AY7 A;  2RNT A;  1YNV X;  1BRJ A;  1BNJ A;  1X1W A;  1BRK A;  1RN1 A;  1GOV A;  5RNT A;  1RDS A;  3SYU A;  3RNT A;  1GMQ A;  1IYY A;  2F4Y A;  1Q9E A;  3DGY A;  1GMR A;  1RLS A;  1BIR A;  4BIR A;  1BAO A;  1B2Z A;  1B2M A;  1I2E A;  1LRA A;  1YVS A;  2AAE A;  1PY3 A;  1MGR A;  1RGK A;  2KF6 A;  4GSP A;  2BU4 A;  1RSN A;  1BGS A;  1RGF A;  1I2F A;  7GSP A;  1DET A;  1JBT A;  2ZA4 A;  1TRP A;  1RGC A;  1BRS A;  2C4B A;  2F5W A;  1BU4 A;  1I0V A;  3DH2 A;  1BRG A;  8RNT A;  1C54 A;  3WR2 A;  1FUT A;  1B21 A;  1B27 A;  3AGN A;  1BNF A;  1RCK A;  1RGG A;  6RNT A;  1B2U A;  1BSA A;  1T2H A;  1B2S A;  1RGL A;  4HAA A;  1RNB A;  1B2X A;  1HZ1 A;  1FUS A;  3AGO A;  2KAA A;  1AQZ A;  3KCH A;  7RNT A;  4J5G A;  2SAR A;  1YGW A;  1BNG A;  1BVI A;  1I8V A;  1SAR A;  3BU4 A;  3BIR A;  1G02 A;  1TRQ A;  1ZGX A;  1RGA A;  1A2P A;  1RTU A; 
#chains in the Genus database with same CATH topology
 2CFD A;  1B20 A;  1TTO A;  4Q53 A;  3WDG B;  3DMC A;  1BNS A;  1VQN 3;  3MG1 A;  1NU3 A;  3N9H A;  1Q42 A;  1X1X A;  4MMZ B;  1SII A;  4J9A A;  1BRI A;  1TFO A;  3D4A A;  4AEQ A;  1YGE A;  2Z77 A;  2FXT A;  4ORL A;  3OWY A;  4CDL A;  1UCK A;  1BAN A;  3NBB A;  3DM8 A;  3EE1 A;  2GBX B;  3Q1C A;  2KXG A;  1WTH A;  4HM4 B;  5STD A;  1UCL A;  5AEW B;  1J2B A;  1LQG C;  2CWV A;  1DMQ A;  3EC9 A;  1MWT A;  4LSO A;  2XFT A;  2L4V A;  2HMN B;  3FF0 A;  3Q2P A;  3WOD G;  3NV0 A;  2KF3 A;  3OWU A;  1FGR A;  3CME 3;  3D5I A;  3X3Z A;  5HOH A;  2OQE C;  1BSE A;  1BSB A;  2XH9 A;  4KT3 B;  4K90 B;  4OVM A;  3A5E A;  4KFD A;  3PCS A;  1UI8 A;  2YFI B;  5BXQ A;  1T5Y A;  3HI7 A;  1W02 A;  1FGQ A;  1FZU A;  1DE3 A;  1JJ2 2;  5KP1 A;  1U5O A;  4U13 A;  3NUV A;  5AYR B;  1JV2 B;  4J8T A;  4OUQ A;  2CX0 A;  5D83 A;  1SIH A;  1BNE A;  1T2I A;  2Z6B A;  4H61 A;  2OTJ 3;  3MSO A;  4J5K A;  4N6M A;  3D79 A;  4HOH A;  1W4N A;  3Q3F A;  2RNT A;  5AIH A;  1YNV X;  1YIJ 3;  2WGO A;  1IVX A;  4RNY A;  3CCL 3;  1BNJ A;  1W00 A;  1BRK A;  2Z76 A;  4WP5 A;  1GOV A;  3MG3 A;  5RNT A;  3ER7 A;  4WYK A;  2GEY A;  3DUK A;  4O3V A;  1PU4 A;  1K41 A;  3J7Y d;  1GYB A;  1Q81 4;  1OHP A;  1GY7 A;  2B24 B;  2F4Y A;  1QMA A;  2W9P A;  4JF8 A;  4FCM A;  1OH0 A;  1EG9 B;  3LOY A;  1RLS A;  3SED A;  4R9K A;  4NRE A;  2UX0 A;  2W56 A;  3FSD A;  3X41 A;  1JB5 A;  3A76 A;  2CFL A;  3DY5 A;  5M19 A;  5IEO A;  3I56 3;  3FGY A;  3GAX A;  1PY3 A;  2Y73 A;  2CW9 A;  4I4K A;  2XF3 A;  5DRE A;  4JRF A;  2KF6 A;  2MC8 A;  2OOV A;  1JBT A;  2XGL A;  3DXO A;  1F8N A;  3LTD A;  2C4B A;  3FCS B;  4WFO A;  3CD6 3;  4N6T A;  8RNT A;  1QVF 2;  5CXO A;  1YIT 3;  3ROB A;  1C54 A;  1IDP A;  1FUT A;  2PZV A;  2YFJ B;  1A90 A;  1BNF A;  1W01 A;  1UUG B;  1D6Y A;  3CCU 3;  2H0G A;  1O7P B;  6RNT A;  3L0R A;  3H3H A;  3F7X A;  1W6G A;  3H51 A;  3M8C A;  3V92 A;  3G8Z A;  2BMO B;  3CCR 3;  3NV0 B;  3OX9 A;  1FUS A;  3PZW A;  1AQZ A;  3VSY A;  5BVB A;  1NB3 I;  1GY5 A;  2V1L A;  3CNM A;  2P0M A;  1VQ7 3;  1O7M B;  1AV4 A;  3U97 A;  2CFW A;  2IA7 A;  2BO9 B;  1UDI I;  2KRT A;  1ZS7 A;  2P38 A;  2SAR A;  3F7S A;  4HKV B;  5EQL A;  1EKM A;  3MWZ A;  5LC7 A;  5KP4 A;  2W2C A;  2J8X B;  1IVU A;  2UUG C;  5CF2 A;  3LTA A;  5G2G A;  3RGR A;  3ZG0 A;  2IMJ A;  5IW9 A;  3AMO A;  1RGA A;  1AVK A;  2ZDJ A;  4HM7 B;  2E2T A;  3FLJ A;  1X1Y A;  3T8U A;  1IVV A;  1WMO A;  1V57 A;  5HGR A;  2ZL8 A;  3HX8 A;  3KSE D;  4L7K A;  2GU3 A;  1BSC A;  3WHO A;  1UCJ A;  2K54 A;  2Y74 A;  3IPT A;  2MF7 A;  3NXJ A;  1OHS A;  2F56 A;  4WYK B;  2CC3 A;  1BOX A;  3F8X A;  3D5G A;  3UL5 A;  1WMN A;  3NM2 A;  4GL6 A;  4ZM8 A;  3WA3 A;  2I9W A;  2W56 B;  2KF4 A;  1GOY A;  2GSP A;  1IK3 A;  4CPK A;  2C11 A;  1HKX A;  2UGI A;  1NNV A;  1BNI A;  2P05 A;  1YJ9 3;  1UW1 A;  3EBY A;  2CFG A;  6GSP A;  4N6L A;  2CWU A;  1FGT A;  2SBL A;  3BB9 A;  4IPB A;  4NPB A;  1MWR A;  1BRH A;  4FMD A;  1L5G B;  1JN5 A;  1G0T A;  1MGW A;  3MPH A;  4FCJ A;  5ELU A;  3LTB A;  1Q86 4;  1IU7 A;  1RCL A;  3QRD A;  5ELJ A;  1RN4 A;  3F14 A;  1QVG 2;  4DKI A;  9RNT A;  3CPW 2;  1VQM 3;  3HIG A;  3EN1 B;  1I70 A;  4AKY A;  2OOV C;  3MG2 A;  1CEW I;  3K0Z A;  1RNT A;  1RKY A;  1I3F A;  2CFK A;  1RRL A;  1JBS A;  4R4K A;  1PYL A;  3BNB A;  3LTC A;  3URP A;  1M90 4;  3LH4 A;  4LMI A;  1VQ6 3;  2M7O A;  4N6N B;  5CK6 A;  1IQX A;  4EW5 A;  1A2K A;  3G16 A;  3T8N A;  1IQY A;  1TIJ A;  1IV9 A;  2E2V A;  4G1M B;  3SVA A;  1GS3 A;  2GU1 A;  1AVL A;  1ULJ B;  1Q7Y 4;  4EXR A;  2RFR A;  3JUQ A;  1YVB I;  1EA2 A;  1BRJ A;  4L8P A;  1RDS A;  3SYU A;  1NWW A;  3F40 A;  4L8O A;  3QK9 A;  3UB1 A;  5IER A;  1Q7H A;  4TX4 A;  1Q9E A;  4QWT A;  1GMR A;  1JZD A;  2JDI H;  4FCZ A;  1M9G A;  2XRX B;  4HM8 B;  3CC7 3;  1GD4 A;  1B2M A;  2OTL 3;  1RJO A;  3AMO B;  4XDV A;  4MMY B;  3WA2 X;  3DGO A;  3K7C A;  4N3V A;  1D6Z A;  2GEX A;  5AIG A;  5IG0 A;  1GD3 A;  1OF5 A;  3JUP A;  1ZO2 A;  1I2F A;  5JBS A;  1DET A;  3PXM A;  1UUW B;  4EC6 A;  1BU4 A;  1HU9 A;  3DH2 A;  1VQK 3;  1VQ5 3;  5TGN A;  4HM2 B;  1B27 A;  3LZA A;  1FA3 A;  5JPP A;  1OUN A;  5AII A;  2HML B;  3IMA B;  1FUW A;  2WGQ A;  4NHF A;  5G1L A;  4CCV A;  3CCM 3;  5D82 A;  1B2S A;  2HMO B;  4HVN A;  1QAF A;  1KSI A;  3KE7 A;  5IG4 A;  3K5T A;  3D9R A;  3GWR A;  3LXU X;  3KSP A;  4FMB A;  3V98 A;  1JB2 A;  2Q07 A;  1DMN A;  5M18 A;  1JN5 B;  3CPO A;  4IIA A;  3VGN A;  2GBW B;  1STD A;  2FNQ A;  3S29 A;  4CJN A;  7RNT A;  3G71 3;  1N8Q A;  1WNH A;  1R4C A;  3S27 A;  2XR8 B;  1EEJ A;  1OGX A;  1QJG A;  3X40 A;  1I8V A;  1VQ9 3;  4AKZ A;  3BIR A;  2CG0 A;  1JKG A;  1T3B A;  4OK0 A;  1OGZ A;  2GXF A;  1N9J A;  1VQQ A;  3NQY A;  3JUM A;  2BIR A;  1YI2 3;  4O02 B;  4EV2 A;  4STD A;  3S5C A;  1GMP A;  1E97 A;  4RZM A;  3X42 A;  3AHS A;  3F8H A;  1LOY A;  1W6Y A;  3NHX A;  3NM7 A;  2XSH B;  1RHL A;  3ZFZ A;  3ECF A;  3GRD A;  3CXC 2;  1VQL 3;  1FW7 A;  1M1X B;  1VQ4 3;  1TFK A;  3BNC A;  3CU3 A;  1S5A A;  4RNT A;  1R4Y A;  2QIY A;  2INX A;  3TDG A;  2R4I A;  1D6U A;  2H0H A;  3FKA A;  2BHM A;  3WOF B;  4KFF A;  3K63 A;  1UGI A;  4H3U A;  1LVN A;  4GHO A;  1VQO 3;  2CH9 A;  3B7C A;  5AYS C;  3RDE A;  1DVD A;  1OF5 B;  4RNZ A;  3EJV A;  1W2B 2;  3GZB A;  4KVH A;  2L1S A;  2AAD A;  2W6J H;  1BRN L;  5AI1 A;  1JBR A;  1A2V A;  1DVC A;  2CKF B;  1BUJ A;  1IQ8 A;  3FG1 A;  2KF5 A;  3AHW A;  4N6O B;  1I2G A;  4O2H A;  2OQE A;  2XFS A;  1WMP A;  2HMM B;  1O7N B;  2PNC A;  3Q90 A;  5BIR A;  3CCV 3;  1RRH A;  2D1W A;  1VQ8 3;  1NDO B;  1FYS A;  1QAL A;  1NO3 A;  1YJN 3;  1O7G B;  5GSP A;  4R1K A;  1BNR A;  2CG1 A;  1X1U A;  5I97 A;  1WQL B;  4MJD A;  1YJW 3;  1ASK A;  1RGH A;  3HK4 A;  1LOX A;  1AY7 A;  3F9S A;  1CQS A;  2RSX A;  3EHC A;  3EBT A;  1BUQ A;  3UL6 A;  4XB5 A;  1OPY A;  1M1K 4;  1X1W A;  4HM6 B;  1GY6 A;  1IV7 A;  3CNX A;  1K28 A;  1NB5 I;  2C10 A;  3PCR A;  5EVH A;  2W0Q A;  4HZB B;  3BNE A;  3DGY A;  4O8S A;  1U8C B;  1K9M 4;  5CF1 A;  1IT7 A;  1BIR A;  1V74 A;  2IY2 A;  3DGM A;  2K0M A;  5IEN A;  1JKG B;  1I2E A;  2CHC A;  4K61 A;  2AAE A;  3LML A;  1MWS A;  1MGR A;  5EEO A;  3FF2 A;  2HMJ B;  3SXX A;  1ULI B;  1W5Z A;  3EQQ B;  3B4O A;  2P0X A;  1RGF A;  1RN7 A;  3OWS A;  3SX1 A;  2WOF A;  4BL3 A;  5AEU B;  1ZX2 A;  2W03 A;  5CLK A;  1EUI C;  1VZZ A;  2ZA4 A;  1BRS A;  2F5W A;  7STD A;  1BRG A;  1TJD A;  1ROA A;  1TP6 A;  2FGT A;  2RCD A;  2Z7A A;  3LYG A;  4XDW A;  2CX1 A;  4FR9 A;  3PGB A;  1B21 A;  3AGN A;  3DGL A;  1OCV A;  3KZT A;  1B2U A;  3BLZ A;  1BSA A;  4HM3 B;  3EN8 A;  3OV4 A;  4MEI A;  4HZ9 B;  4HAA A;  1K8A 4;  4X2O A;  4N6V 0;  1C7H A;  1W6C A;  2KCD A;  1RNB A;  2O9U X;  3G4S 3;  2LQV A;  1JNQ A;  1HZ1 A;  4I5Q A;  3JVC A;  2F98 A;  3AGO A;  3MHE A;  3SOY A;  3X3X A;  1SPU A;  5FW5 A;  3JUO A;  3LT9 A;  1O7H B;  2F99 A;  1MOL A;  1OHO A;  4XBT A;  3VF1 A;  3S67 A;  4XBY A;  1IVW A;  1YGW A;  5IG5 A;  4XM4 A;  2OCT A;  3NBR A;  3DGN A;  3EF8 A;  3BND A;  2QEX 3;  1BNG A;  1BVI A;  1Q40 A;  1A67 A;  1AR0 A;  1SAR A;  3JUN A;  5DRV A;  3CCS 3;  5BU4 A;  1LNI A;  1JZO A;  3NX0 A;  4R9L A;  4GB5 A;  3GSP A;  3V99 A;  1UUV B;  2HMK B;  1US1 A;  3LT8 A;  2HOH A;  4HM5 B;  3FZW A;  3ALA A;  4K1U A;  1N5H A;  1RGE A;  3N54 B;  2WOH A;  5G1K A;  1LOV A;  1W2Z A;  5KP3 A;  4IT7 A;  3SOA A;  2A15 A;  2F5M A;  2P09 A;  3PS8 A;  1OAC A;  1UCI A;  4HM1 B;  4LYL B;  5A0O B;  5IG3 A;  5IF6 A;  2CIU A;  4LGQ A;  1MWU A;  3KII A;  1LNH A;  4HBR A;  3CCQ 3;  1BSD A;  1E3R A;  3B4P A;  4EYC A;  3CCJ 3;  4LZI A;  5IEP A;  5D81 A;  1E3V A;  4ILF A;  2H0I A;  3S28 A;  2IUK A;  3U1W A;  1DYU A;  2F86 B;  1RMS A;  2RBI A;  1CYV A;  4FMC A;  4K1V A;  4HJL B;  3G0K A;  4N6U A;  2ML6 A;  3O8Y A;  1JB4 A;  4X2H A;  2XEP A;  4BU4 A;  1FGM A;  1Y4K A;  1K73 4;  1GOU A;  1G96 A;  3ZG5 A;  4BL2 A;  1CH0 A;  1I3I A;  2IUJ A;  1IT8 A;  1I0X A;  1ISK A;  1N5P A;  2YX9 A;  3MKI A;  1FGO A;  3OW2 2;  5LC6 A;  3HOH A;  8CHO A;  2BT3 A;  1UI7 A;  2XSO B;  1B3S A;  2LYX A;  4BTW A;  1VQP 3;  2W9Q A;  4WHA A;  3KFQ C;  1LOW A;  3MYT A;  1Q82 4;  3FG4 A;  1UGH I;  1GSP A;  3D3L A;  1HYF A;  1KWI A;  3EB8 A;  4WWU C;  3WMD A;  2O3O A;  1DMM A;  3OXA A;  1N9E A;  3CMA 3;  1W7C A;  2K3D A;  2RGQ A;  2BMQ B;  3DZL A;  2B1X B;  1V58 A;  3E99 A;  1RN1 A;  3X3Y A;  3G6E 3;  2R41 A;  3RNT A;  3HII A;  1O7W B;  1GMQ A;  3I55 3;  3NQZ A;  1IYY A;  3GZX B;  1KC8 4;  1Q40 B;  3RGA A;  4PEJ A;  2E2U A;  5M1A A;  2BNG A;  4BIR A;  1B2Z A;  1BAO A;  1N8R 4;  2D42 A;  1KD1 4;  1PFP A;  1LRA A;  1YVS A;  3GZR A;  4KFE A;  5JPU A;  2CK3 H;  1RGK A;  2IYJ A;  2W04 A;  2XGN A;  4GSP A;  2BU4 A;  3FG3 A;  1RSN A;  1STF I;  1BGS A;  2ZHX B;  2ML5 A;  4KZ1 A;  1MNL A;  2OWP A;  4LEH A;  3SLU A;  4BTX A;  7GSP A;  3GZY B;  1TRP A;  1TU5 A;  1RGC A;  3I0Y A;  3KN4 A;  1CYU A;  1I0V A;  5AIF A;  3FH1 A;  4XBX A;  4EV5 A;  3WR2 A;  1ROV A;  3K9M C;  1EQK A;  1RCK A;  6STD A;  3PYJ A;  1RGG A;  2YFL B;  3EX9 A;  3NBJ A;  1LQM B;  2WO0 A;  1YHQ 3;  1T2H A;  5FGO A;  1RGL A;  4HM0 B;  2BMR B;  2QA4 3;  2JQ5 A;  1B2X A;  2KAA A;  4BTY A;  3KCH A;  1TUH A;  1NJI 4;  4HYZ A;  2CWT A;  3WOE B;  3N8B A;  3UNL A;  1KQS 2;  2QGU A;  4J5G A;  3IJE B;  3CCE 3;  3UJM A;  4R80 A;  3CC4 3;  1S72 3;  1Z1S A;  3T0U A;  1SQW A;  4MMX B;  1JRQ A;  4RBN A;  3HZP A;  3BU4 A;  3KKG A;  1QAK A;  4FMA A;  1SJW A;  4EBG A;  1G02 A;  2STD A;  1TRQ A;  3CC2 3;  1ZGX A;  3STD A;  1LXE A;  1A2P A;  1RTU A;  3B8L A; 
#chains in the Genus database with same CATH homology
 1LNI A;  1B20 A;  1TTO A;  1X1Y A;  2BIR A;  1BNS A;  3GSP A;  1GMP A;  2HOH A;  1X1X A;  3AHS A;  1BSC A;  1LOY A;  1BRI A;  1UCJ A;  3D4A A;  3WHO A;  1RGE A;  1UCK A;  1RHL A;  1LOV A;  2F56 A;  1BAN A;  1BOX A;  2F5M A;  3D5G A;  1FW7 A;  1UCI A;  4RNT A;  1R4Y A;  1UCL A;  2KF4 A;  1GOY A;  2GSP A;  1BSD A;  1BNI A;  4GHO A;  1RMS A;  2RBI A;  6GSP A;  2KF3 A;  1BRH A;  2AAD A;  3D5I A;  5HOH A;  1MGW A;  1BRN L;  1JBR A;  4BU4 A;  1BSE A;  1BSB A;  1BUJ A;  1GOU A;  1RCL A;  2KF5 A;  1I2G A;  1RN4 A;  3A5E A;  1CH0 A;  3AHW A;  1I3I A;  9RNT A;  1I0X A;  1FZU A;  5BIR A;  1I70 A;  1DE3 A;  3HOH A;  1RNT A;  1FYS A;  1I3F A;  1B3S A;  1JBS A;  1PYL A;  5GSP A;  3URP A;  1BNR A;  1T2I A;  1BNE A;  1X1U A;  1LOW A;  5BU4 A;  4J5K A;  4HOH A;  1GSP A;  1HYF A;  1RGH A;  3Q3F A;  1AY7 A;  2RNT A;  1YNV X;  1BRJ A;  1BNJ A;  1X1W A;  1BRK A;  1RN1 A;  1GOV A;  5RNT A;  1RDS A;  3SYU A;  3RNT A;  1GMQ A;  1IYY A;  2F4Y A;  1Q9E A;  3DGY A;  1GMR A;  1RLS A;  1BIR A;  4BIR A;  1BAO A;  1B2Z A;  1B2M A;  1I2E A;  1LRA A;  1YVS A;  2AAE A;  1PY3 A;  1MGR A;  1RGK A;  2KF6 A;  4GSP A;  2BU4 A;  1RSN A;  1BGS A;  1RGF A;  1I2F A;  7GSP A;  1DET A;  1JBT A;  2ZA4 A;  1TRP A;  1RGC A;  1BRS A;  2C4B A;  2F5W A;  1BU4 A;  1I0V A;  3DH2 A;  1BRG A;  8RNT A;  1C54 A;  3WR2 A;  1FUT A;  1B21 A;  1B27 A;  3AGN A;  1BNF A;  1RCK A;  1RGG A;  6RNT A;  1B2U A;  1BSA A;  1T2H A;  1B2S A;  1RGL A;  4HAA A;  1RNB A;  1B2X A;  1HZ1 A;  1FUS A;  3AGO A;  2KAA A;  1AQZ A;  3KCH A;  7RNT A;  4J5G A;  2SAR A;  1YGW A;  1BNG A;  1BVI A;  1I8V A;  1SAR A;  3BU4 A;  3BIR A;  1G02 A;  1TRQ A;  1ZGX A;  1RGA A;  1A2P A;  1RTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...