3EC9A

Crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
MRTPYQIVADHYAASDRHDPAAMMADIAPAIEWTEMAGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFKLDALHDAGDTVIGVGRYSGTYRRTGKSFECRVAHVWRVDAGKIVHFEQFTDTLLVAQAMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
molecule keywords uncharacterized NTF2-like protein
total genus 38
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ec9A00
3MKIA 4R9KA 4PEJA 3S5CA 1GYBA 2XSHB 4WYKB 1E97A 3UNLA 1IDPA 3KSPA 4R1KA 3H3HA 5AIHA 1W02A 4K1VA 1WQLB 3VGNA 1NDOB 1W00A 3G0KA 3VSYA 5CF1A 2A15A 2F99A 3B4OA 3T8UA 2XRXB 1OGZA 4HM0B 1A2KA 1HKXA 3DMCA 2F86B 1OHSA 2HMJB 2K54A 3CPOA 4XB5A 5IG3A 1JB2A 4HM4B 4MJDA 4HM6B 4WWUC 2XR8B 2F98A 3D9RA 2RFRA 1O7NB 3EHCA 5IEOA 5EVHA 5STDA 3OWSA 3A76A 5KP3A 1O7MB 1OH0A 1Q42A 4HM3B 3F40A 5JPPA 2B1XB 4GB5A 5IF6A 3RGRA 5IG5A 1BUQA 1GY7A 3B4PA 1EG9B 4HM8B 5AEWB 2QIYA 3OX9A 2R4IA 1EA2A 3ER7A 3HZPA 1TUHA 2GBXB 2IMJA 4WYKA 1ULIB 2RCDA 2XSOB 3CU3A 3NBRA 3B8LA 1QJGA 4L7KA 4LEHA 4STDA 2CKFB 2HMOB 3EC9A 3LZAA 4HM1B 3UJMA 4OUQA 1O7WB 3H51A 4HM5B 4XDWA 4XM4A 1VZZA 5D81A 3RGAA 2GXFA 1GY6A 3F7SA 1OPYA 2GEYA 3EN1B 5AIIA 4LGQA 5KP4A 4CDLA 5IENA 1GS3A 5HGRA 3OWYA 4KVHA 8CHOA 2W2CA 5IERA 5D82A 3MG3A 4J9AA 3EN8A 2B24B 3SOAA 3MHEA 5BXQA 3FLJA 5IEPA 1E3RA 3WMDA 3NHXA 1C7HA 2GBWB 3FSDA 3Q90A 3GWRA 4HVNA 2CHCA 3G16A 4Q53A 5D83A 5DREA 5TGNA 3F8HA 4FCMA 5CK6A 5CF2A 1NWWA 3B7CA 1ISKA 3EX9A 4WP5A 3JUNA 3BLZA 5DRVA 3HX8A 3DZLA 4N3VA 4XBTA 1DMQA 1OHOA 2HMNB 1ZO2A 3GZXB 3FF0A 3JUPA 1JN5A 3FZWA 2GEXA 2YFLB 2INXA 3F7XA 3M8CA 1OUNA 3KKGA 2HMKB 1U5OA 3DUKA 3KZTA 5CXOA 4LMIA 5AEUB 3SEDA 1K41A 5CLKA 3BB9A 1CQSA 1S5AA 3F8XA 3HK4A 4J8TA 2HMLB 4X2HA 2YFIB 1O7HB 1W6YA 2JQ5A 3GZBA 3GZRA 3IPTA 1W01A 3EF8A 3ROBA 4ORLA 3GZYB 1UUVB 3EQQB 3MYTA 4X2OA 5IG0A 1STDA 1OGXA 2Z76A 3JUOA 3OV4A 3K7CA 3G8ZA 4HJLB 4HZ9B 6STDA 1DMNA 1SJWA 3MG1A 3LYGA 1TP6A 5AI1A 5G2GA 3DM8A 3FH1A 3ECFA 1OF5B 1GY5A 3NUVA 2UX0A 3NV0B 4HZBB 4RZMA 4L8OA 4I4KA 4XBYA 1UUWB 2BNGA 3EBYA 1O7GB 3KE7A 1OCVA 2HMMB 1DMMA 4K1UA 7STDA 2Z7AA 5IG4A 2BMQB 3FGYA 4XDVA 1ULJB 2BMRB 1QMAA 1AR0A 4R9LA 4HM2B 1O7PB 5AIFA 4IIAA 2BMOB 3EBTA 3SOYA 3STDA 1JKGB 1Q40A 2RGQA 2Z77A 3GRDA 2PZVA 3FF2A 3JUMA 4HM7B 1E3VA 1OF5A 3NV0A 3OWUA 5AIGA 3EJVA 1JN5B 3NM2A 1NU3A 1JB5A 4OVMA 4U13A 1JB4A 5KP1A 2YFJB 4L8PA 3E99A 4XBXA 2STDA 4H3UA 5JPUA 3F9SA 5BVBA 3CNXA 3JUQA 3OXAA 1OHPA 3I0YA 4HKVB 5FW5A 1ZX2A 3CNMA 1ASKA 3K0ZA 3F14A 3FKAA 4FCJA 2QGUA 3T8NA 3NXJA 1JKGA 1Q40B 2I9WA 2OWPA 3MG2A 1Z1SA 3DXOA 3MSOA
chains in the Genus database with same CATH superfamily
3MKIA 4R9KA 4N6MA 2C11A 2WO0A 3PXMA 1IDPA 1YVBI 3HI7A 4HAAA 1JV2B 4J5KA 1W02A 1FA3A 2MF7A 3WA2X 3CCV3 3VSYA 2WOHA 2GU1A 2F99A 2XRXB 1OGZA 1SQWA 4EW5A 2CFWA 1WNHA 2H0HA 3NQZA 2K54A 5JBSA 3PS8A 3CC23 1X1XA 4MJDA 4WWUC 2OTJ3 1N5PA 3D9RA 2OTL3 2RFRA 1VQ83 5IEOA 5EVHA 3DGMA 3OWSA 5KP3A 1B2ZA 1IT7A 3AMOB 4HM3B 3F40A 7RNTA 5JPPA 4GB5A 5IF6A 1YIJ3 1GY7A 5AEWB 1T5YA 1G02A 2C10A 3N54B 1VQ53 2GBXB 2IMJA 1RGKA 2P09A 3G713 3B8LA 1QVF2 2CKFB 3AHSA 4KZ1A 4HM1B 1BSDA 4OUQA 1FGOA 3A5EA 1RJOA 1W6GA 4HM5B 4XDWA 2GXFA 3F7SA 2GEYA 4LGQA 4K61A 4CDLA 1ROAA 1YI23 1BUJA 5HGRA 4BTWA 3OWYA 2KXGA 4KVHA 2W2CA 4G1MB 2CG1A 2ML6A 3MG3A 2WGOA 4FCZA 1ZGXA 3MHEA 1MWTA 1E3RA 3NQYA 1RGCA 3Q90A 5D83A 4HVNA 3G16A 5TGNA 1NB5I 4N6NB 1BANA 3B7CA 1GOYA 1SARA 4GL6A 2L1SA 1C54A 1BNJA 3CME3 1HYFA 3BU4A 3DZLA 4R80A 3BNEA 3WHOA 3I563 1DE3A 1T2HA 1LXEA 3JUPA 3PCRA 4GSPA 3NBJA 2XFTA 2YFLB 1Q7Y4 2FNQA 3F7XA 3M8CA 1OUNA 3KKGA 1D6ZA 4FMDA 4O8SA 5CXOA 3S28A 1PY3A 5ELJA 3DGYA 1W6CA 3BB9A 2CH9A 1IK3A 4AKYA 4J8TA 1W4NA 1TRPA 1W2B2 2K0MA 1SIIA 4H61A 5RNTA 4IPBA 2CC3A 4RNZA 1PU4A 2SARA 4X2OA 1WMOA 1FYSA 1I2EA 3PYJA 1OGXA 4AKZA 4HJLB 3V99A 2M7OA 1I3FA 3K7CA 1VQL3 1DMNA 1SJWA 3MG1A 3LYGA 5EEOA 1BNEA 3AGNA 1GMRA 5M19A 4BL3A 2XEPA 1PYLA 4L8OA 3X40A 2W04A 3EBYA 1O7GB 3KE7A 1SPUA 3EB8A 4FMCA 2QEX3 1MNLA 1KC84 1RN7A 1QMAA 1RGEA 2UUGC 1VQM3 1VQ63 3SOYA 1RSNA 2Z77A 1FUTA 2CWTA 2PZVA 4K90B 1OF5A 5BU4A 1RGFA 2W6JH 3KN4A 1W5ZA 1LOYA 3NM2A 1NJI4 1JB5A 2KF5A 2YFJB 4L8PA 1MOLA 4H3UA 3F9SA 3I553 3CMA3 5FW5A 1ZX2A 3CNMA 1WTHA 3PCSA 4FCJA 3T8NA 3NXJA 1F8NA 1JKGA 2I9WA 2IYJA 2OWPA 4LSOA 5M1AA 1VQO3 1WMPA 1BNIA 1BRIA 2F4YA 4KFEA 2CK3H 1UGHI 1N8QA 1BRJA 5BIRA 4WYKB 3ZG5A 1E97A 1MWUA 3SYUA 1FUWA 3H3HA 1US1A 1RN1A 1NDOB 1W00A 2H0IA 1X1YA 1EKMA 2P0XA 2RBIA 4LYLB 1YNVX 2A15A 1VQN3 1LOXA 4JF8A 1IV9A 1K28A 1X1UA 2F5MA 3SVAA 3N9HA 2W56A 3CPOA 5IG3A 1JB2A 1UCJA 2GSPA 1UI7A 2JDIH 2F98A 1RRLA 6RNTA 1S723 2W9PA 5STDA 3A76A 2BU4A 2XF3A 3B4PA 1EG9B 3HIGA 2QIYA 1EEJA 3OX9A 1X1WA 2F5WA 3K9MC 1L5GB 1VQP3 3CCL3 1HZ1A 2RCDA 4L7KA 5G1LA 1QJGA 1IVXA 1I0VA 7GSPA 2HMOB 3SLUA 3UJMA 2O9UX 3RGAA 5D81A 1OPYA 3EN1B 3J7Yd 1R4CA 3LT9A 5LC6A 2OCTA 2WGQA 4EV2A 5IERA 3X41A 3WDGB 1BNRA 2HOHA 2CWUA 5IEPA 1C7HA 2GBWB 4KFFA 3GWRA 2CHCA 2W56B 3F8HA 3EE1A 3EX9A 1I8VA 5DRVA 3URPA 4O2HA 4XBTA 4N3VA 1GMPA 1DMQA 2V1LA 3FF0A 4NREA 5BVBA 3JVCA 3KZTA 3DUKA 1U5OA 1TRQA 4LMIA 1TFOA 3SEDA 1K41A 3FG4A 1Q9EA 4ILFA 5CLKA 3ZG0A 1CQSA 1S5AA 3DGOA 1K9M4 3ZFZA 3Q3FA 1CYVA 4X2HA 1UCKA 1TFKA 4EC6A 1RCLA 4N6TA 1G0TA 4ORLA 3ROBA 3GZYB 2K3DA 5LC7A 3S27A 3K63A 3VF1A 1G96A 3G8ZA 1RHLA 4HZ9B 1YJW3 3ALAA 2XH9A 3D3LA 3K5TA 3KCHA 1TP6A 2CW9A 3DM8A 1QALA 3FH1A 1LQGC 3NV0B 2BNGA 1BGSA 3PZWA 2J8XB 4JRFA 4MMXB 2HMMB 3GSPA 7STDA 3IMAB 4BTYA 5IG4A 1B2UA 1V57A 1Q824 5FGOA 4BU4A 5A0OB 2MC8A 1FGRA 1I3IA 1O7PB 3STDA 4CPKA 5CF1A 3DH2A 1GMQA 1D6UA 2RGQA 3GRDA 4NHFA 3OWUA 1N9EA 2XGLA 1NU3A 2BIRA 3BNBA 4XBXA 1DVDA 1BSBA 1KSIA 4TX4A 4MEIA 1CH0A 3JUQA 3OXAA 1OHPA 1CYUA 1FW7A 2KF6A 2Y73A 1AY7A 1ASKA 4BTXA 3F14A 2XFSA 1IVUA 2QGUA 4MMZB 1KD14 1Q40B 2LQVA 1PFPA 3X42A 1STFI 3D79A 4NPBA 1NO3A 4N6OB 2CFLA 5EQLA 1CEWI 2F56A 5AIHA 1WQLB 3G4S3 3T8UA 3S67A 4HM0B 4HYZA 1HKXA 1BU4A 1IYYA 1OHSA 3CXC2 3MWZA 2W9QA 2FGTA 2YX9A 2ZA4A 4HM4B 1VQ43 4GHOA 1YHQ3 4KT3B 2CIUA 9RNTA 5M18A 3CCR3 1Q42A 4QWTA 1BSCA 4AEQA 1BUQA 1I0XA 2R4IA 1EA2A 2CWVA 1LNHA 1TUHA 4RNYA 2KF3A 4WYKA 3CU3A 3HOHA 4WFOA 3NBRA 4WHAA 4BIRA 2ZHXB 2KCDA 3EC9A 3LZAA 2KRTA 1T2IA 1LNIA 2CG0A 1M9GA 1RGGA 3H51A 1BSAA 1VZZA 4XM4A 1SIHA 3CPW2 1BRHA 1GY6A 4N6V0 3CCS3 5AIIA 3CCU3 3RNTA 3X3XA 1A67A 2R41A 1GS3A 3LTDA 3N8BA 1K734 1D6YA 3WA3A 1RKYA 3WOFB 2P0MA 3EN8A 1TJDA 2B24B 4J9AA 2SBLA 3FLJA 3SOAA 5BXQA 3IJEB 4I5QA 3NHXA 3KFQC 2ZDJA 1NNVA 2O3OA 4FCMA 1JZOA 4KFDA 3BLZA 3LXUX 1Y4KA 3WOEB 5G1KA 1JBRA 2HMNB 1OHOA 1IVWA 1I2GA 1ZO2A 3GZXB 3LTCA 3BIRA 4HBRA 2H0GA 4EYCA 1RRHA 1JN5A 2XGNA 2GEXA 5CK6A 6STDA 1IQ8A 1J2BA 2HMKB 1EQKA 3PGBA 3U97A 1Q7HA 2AADA 1RDSA 3V92A 2IUJA 3F8XA 1MWSA 3HK4A 6GSPA 1RN4A 2D1WA 1O7HB 1W6YA 3GZBA 3GZRA 3IPTA 3L0RA 3FG1A 4EXRA 1W01A 3EF8A 2BHMA 4DKIA 3MYTA 1AV4A 1STDA 2Z76A 3JUOA 1AQZA 3O8YA 1DYUA 1BRGA 5AI1A 4EBGA 1UCIA 1B3SA 2E2VA 4FMBA 5HOHA 1OF5B 4XBYA 3NUVA 2UX0A 4HZBB 4RZMA 4I4KA 4J5GA 1K8A4 1FUSA 1OCVA 2E2UA 1BNFA 3Q1CA 1MGRA 4K1UA 1BRSA 1ZS7A 2Z7AA 5I97A 1IT8A 1RCKA 4XDVA 2BMRB 1M904 3BNCA 1AR0A 4R9LA 4HM2B 1M1K4 5AIFA 4IIAA 1BNSA 2BMOB 3EBTA 4EV5A 1JKGB 1YGWA 1KQS2 5JPUA 1E3VA 3CD63 3DGNA 2BT3A 2D42A 3D4AA 1JN5B 2CFKA 1UDII 3GAXA 3LMLA 4OVMA 1I70A 4O3VA 1MGWA 1N9JA 4U13A 1JJ22 1IQYA 5IW9A 4N6LA 1AVLA 1R4YA 1UUGB 3CNXA 1A2PA 2RNTA 3K0ZA 2ML5A 1DVCA 3FKAA 3V98A 4R4KA 1GOVA 1RGLA 3AMOA 3MG2A 3CC73 3DY5A 3NM7A 3OW22 1Z1SA 3MSOA 4RBNA 1JNQA 2IUKA 4FMAA 1QVG2 1FGTA 1B20A 1W2ZA 1UI8A 3LTAA 4PEJA 1GYBA 2XSHB 3RDEA 3S5CA 3UNLA 4R1KA 3KSPA 3WODG 2AAEA 1QAFA 2FXTA 4K1VA 1IQXA 3VGNA 1JZDA 1ROVA 3G0KA 1BSEA 1IVVA 1FZUA 2P05A 3B4OA 3Q2PA 1A2KA 3G6E3 3DMCA 2L4VA 2F86B 2HMJB 2KF4A 2PNCA 4XB5A 1RTUA 1FGMA 2OQEC 1LOVA 4HM6B 2XR8B 1O7NB 3EHCA 3AGOA 2CX0A 1RGHA 1O7MB 2OOVA 1OH0A 4OK0A 4FR9A 2B1XB 5IG5A 3RGRA 1BNGA 3CCE3 3WR2A 3CC43 1B2MA 2Q07A 4HM8B 2OQEA 3T0UA 3ER7A 3X3ZA 3HZPA 5ELUA 1JBTA 1B2SA 1UGIA 4CCVA 1ULIB 2XSOB 4LEHA 3TDGA 4RNTA 4STDA 4MMYB 1Q864 1JBSA 1V74A 2P38A 1O7WB 3FCSB 1GSPA 1I2FA 8RNTA 3SX1A 3LT8A 5KP4A 5IENA 1VQ73 1TTOA 8CHOA 5D82A 4BL2A 1WMNA 1V58A 1TU5A 3AHWA 1B27A 4IT7A 3SXXA 2OOVC 1YJN3 3WMDA 3FSDA 4N6UA 3CCJ3 1VQQA 1HU9A 4HOHA 4Q53A 1IV7A 3LOYA 5DREA 5CF2A 1MWRA 1ISKA 1NWWA 3KSED 2BO9B 4WP5A 3JUNA 2E2TA 1U8CB 3HX8A 3UL5A 1YVSA 3UB1A 1UCLA 2C4BA 2LYXA 3X3YA 1M1XB 1BRKA 1RGAA 1TIJA 3FZWA 1BRNL 1UW1A 2INXA 2WOFA 5AEUB 1W7CA 2CFGA 2CX1A 1YJ93 3S29A 3D5GA 2UGIA 3UL6A 2Z6BA 1N5HA 2HMLB 1YGEA 1IU7A 2YFIB 2IA7A 2JQ5A 3CCM3 1EUIC 3MPHA 3HIIA 2QA43 1RNTA 1UUVB 3EQQB 3QRDA 1LVNA 2IY2A 1JRQA 5IG0A 1AVKA 1NB3I 1DETA 3OV4A 1A90A 2W0QA 3BNDA 5G2GA 3ECFA 1A2VA 1LRAA 1GY5A 2GU3A 1YIT3 5AYRB 1UUWB 2KAAA 3U1WA 1RNBA 1RMSA 1DMMA 1LQMB 1VQK3 2CFDA 2BMQB 3FGYA 3KIIA 1ULJB 4LZIA 1BVIA 3LTBA 4CJNA 1T3BA 2ZL8A 1GD3A 4ZM8A 3LH4A 5AYSC 1Q40A 3JUMA 3D5IA 3FF2A 1BIRA 4HM7B 1LOWA 3NV0A 5AIGA 1KWIA 1B21A 4O02B 3EJVA 1Q814 1VQ93 1GOUA 1FGQA 5KP1A 1GD4A 1N8R4 1JB4A 3QK9A 1BAOA 1BOXA 3E99A 3NX0A 2STDA 3DGLA 1OACA 3CCQ3 2RSXA 3I0YA 4HKVB 2Y74A 2W03A 1B2XA 1RLSA 1QAKA 3FG3A 3DXOA 3NBBA 5GSPA
chains in the Genus database with same CATH topology
3MKIA 4R9KA 4N6MA 2C11A 2WO0A 3PXMA 1IDPA 1YVBI 3HI7A 1JV2B 1W02A 1FA3A 2MF7A 3WA2X 3CCV3 3VSYA 2WOHA 2GU1A 2F99A 2XRXB 1OGZA 1SQWA 2CFWA 1WNHA 3NQZA 2K54A 5JBSA 3PS8A 3CC23 4MJDA 2OTJ3 4WWUC 1N5PA 3D9RA 2OTL3 2RFRA 1VQ83 5IEOA 5EVHA 3DGMA 3OWSA 5KP3A 1IT7A 3AMOB 4HM3B 3F40A 5JPPA 4GB5A 5IF6A 1YIJ3 1GY7A 5AEWB 1T5YA 2C10A 3N54B 1VQ53 2GBXB 2IMJA 2P09A 3G713 3B8LA 1QVF2 2CKFB 4KZ1A 4HM1B 4OUQA 1FGOA 1RJOA 1W6GA 4HM5B 4XDWA 2GXFA 3F7SA 2GEYA 4LGQA 4K61A 4CDLA 1ROAA 1YI23 5HGRA 4BTWA 3OWYA 2KXGA 4KVHA 2W2CA 4G1MB 2CG1A 2ML6A 3MG3A 2WGOA 4FCZA 3MHEA 1E3RA 3NQYA 3Q90A 5D83A 4HVNA 3G16A 5TGNA 1NB5I 4N6NB 3B7CA 4GL6A 3CME3 3DZLA 4R80A 3BNEA 3I563 3PCRA 1LXEA 3JUPA 3NBJA 2XFTA 2YFLB 1Q7Y4 2FNQA 3F7XA 3M8CA 1OUNA 3KKGA 1D6ZA 4FMDA 4O8SA 5CXOA 3S28A 5ELJA 1W6CA 3BB9A 2CH9A 1IK3A 4AKYA 4J8TA 1W4NA 1W2B2 2K0MA 1SIIA 4H61A 4IPBA 2CC3A 4RNZA 1PU4A 4X2OA 1WMOA 3PYJA 4AKZA 1VQL3 1OGXA 4HJLB 3V99A 2M7OA 3K7CA 1DMNA 1SJWA 3MG1A 3LYGA 5EEOA 2XEPA 3X40A 4L8OA 2W04A 3EBYA 1O7GB 3KE7A 1SPUA 3EB8A 4FMCA 2QEX3 1MNLA 1KC84 1RN7A 1QMAA 1VQM3 1VQ63 3SOYA 2Z77A 2CWTA 2PZVA 4K90B 1OF5A 1NJI4 3KN4A 2W6JH 3NM2A 1W5ZA 1JB5A 2YFJB 4L8PA 1MOLA 4H3UA 3F9SA 3I553 3CMA3 5FW5A 1ZX2A 3CNMA 1WTHA 3PCSA 4FCJA 3T8NA 3NXJA 1F8NA 1JKGA 2I9WA 2OWPA 1VQO3 4LSOA 1WMPA 4KFEA 2CK3H 1N8QA 4WYKB 1E97A 1FUWA 3H3HA 1US1A 1NDOB 1W00A 2P0XA 1EKMA 1VQN3 2A15A 1LOXA 4JF8A 1IV9A 1K28A 3SVAA 3N9HA 2W56A 3CPOA 5IG3A 1JB2A 1UI7A 2JDIH 2F98A 1RRLA 1S723 2W9PA 5STDA 3A76A 2XF3A 3B4PA 1EG9B 3HIGA 2QIYA 3OX9A 3K9MC 1L5GB 1VQP3 3CCL3 2RCDA 4L7KA 1QJGA 1IVXA 2HMOB 3SLUA 3UJMA 2O9UX 3RGAA 5D81A 1OPYA 3EN1B 3J7Yd 1R4CA 3LT9A 5LC6A 2OCTA 2WGQA 4EV2A 5IERA 3X41A 3WDGB 2CWUA 5IEPA 1C7HA 2GBWB 4KFFA 3GWRA 2CHCA 2W56B 3F8HA 3EE1A 3EX9A 5DRVA 4O2HA 4XBTA 4N3VA 1DMQA 2V1LA 3FF0A 4NREA 5BVBA 3JVCA 3KZTA 3DUKA 1U5OA 4LMIA 1TFOA 3SEDA 1K41A 3FG4A 5CLKA 1CQSA 1S5AA 3DGOA 1K9M4 1CYVA 4X2HA 4EC6A 1TFKA 4N6TA 3ROBA 4ORLA 3GZYB 5LC7A 3S27A 3VF1A 3K63A 1G96A 3G8ZA 1YJW3 4HZ9B 3ALAA 2XH9A 3D3LA 3K5TA 1TP6A 2CW9A 3DM8A 1QALA 3FH1A 3NV0B 2BNGA 3PZWA 4JRFA 4MMXB 2HMMB 7STDA 3IMAB 4BTYA 5IG4A 1Q824 5FGOA 5A0OB 2MC8A 1FGRA 1O7PB 3STDA 5CF1A 1D6UA 2RGQA 3GRDA 4NHFA 3OWUA 1N9EA 2XGLA 1NU3A 3BNBA 4XBXA 1DVDA 1KSIA 4TX4A 4MEIA 3JUQA 3OXAA 1OHPA 1CYUA 2Y73A 4BTXA 1ASKA 3F14A 2XFSA 1IVUA 2QGUA 4MMZB 1KD14 1Q40B 2LQVA 1PFPA 3X42A 1STFI 1NO3A 4N6OB 2CFLA 5EQLA 1CEWI 5AIHA 1WQLB 3G4S3 3T8UA 3S67A 4HM0B 4HYZA 1HKXA 1OHSA 3CXC2 3MWZA 2W9QA 2FGTA 2YX9A 4HM4B 1VQ43 1YHQ3 2CIUA 3CCR3 1Q42A 4QWTA 4AEQA 1BUQA 2R4IA 1EA2A 2CWVA 1LNHA 1TUHA 4RNYA 4WYKA 3CU3A 4WFOA 3NBRA 4WHAA 2KCDA 3EC9A 3LZAA 2KRTA 2CG0A 1M9GA 3H51A 4XM4A 1VZZA 1SIHA 1GY6A 4N6V0 3CCS3 5AIIA 1A67A 3X3XA 1GS3A 3LTDA 3N8BA 1K734 1D6YA 3WA3A 1RKYA 3WOFB 2P0MA 3EN8A 2B24B 4J9AA 3SOAA 2SBLA 3FLJA 5BXQA 3IJEB 3NHXA 3KFQC 2ZDJA 2O3OA 4FCMA 4KFDA 3BLZA 3LXUX 1Y4KA 3WOEB 2HMNB 1OHOA 1IVWA 1ZO2A 3GZXB 3LTCA 4HBRA 4EYCA 1RRHA 1JN5A 2XGNA 2GEXA 5CK6A 6STDA 1IQ8A 1J2BA 2HMKB 1EQKA 3PGBA 3U97A 3V92A 2IUJA 3F8XA 3HK4A 2D1WA 1O7HB 1W6YA 3GZBA 3GZRA 3IPTA 3L0RA 3FG1A 4EXRA 1W01A 3EF8A 2BHMA 3MYTA 1AV4A 1STDA 2Z76A 3JUOA 3O8YA 1DYUA 5AI1A 4EBGA 2E2VA 4FMBA 1OF5B 4XBYA 3NUVA 2UX0A 4HZBB 4RZMA 4I4KA 1K8A4 1OCVA 2E2UA 3Q1CA 4K1UA 2Z7AA 5I97A 1IT8A 4XDVA 2BMRB 1M904 3BNCA 1AR0A 4R9LA 4HM2B 1M1K4 5AIFA 4IIAA 2BMOB 3EBTA 4EV5A 1JKGB 1KQS2 5JPUA 1E3VA 3CD63 3DGNA 2BT3A 2D42A 1JN5B 2CFKA 3GAXA 3LMLA 4OVMA 4O3VA 4U13A 1N9JA 1JJ22 1IQYA 5IW9A 4N6LA 1AVLA 3CNXA 3K0ZA 2ML5A 1DVCA 3FKAA 3V98A 4R4KA 3AMOA 3MG2A 3CC73 3DY5A 3NM7A 3OW22 1Z1SA 3MSOA 4RBNA 2IUKA 1JNQA 4FMAA 1QVG2 1FGTA 1W2ZA 1UI8A 3LTAA 4PEJA 1GYBA 2XSHB 3RDEA 3S5CA 3UNLA 4R1KA 3KSPA 3WODG 3CCU3 1QAFA 2FXTA 4K1VA 1IQXA 3VGNA 1ROVA 3G0KA 2P05A 1IVVA 3B4OA 3Q2PA 1A2KA 3G6E3 3DMCA 2L4VA 2F86B 2HMJB 2PNCA 4XB5A 1FGMA 2OQEC 4HM6B 2XR8B 1O7NB 3EHCA 1O7MB 2OOVA 1OH0A 4OK0A 4FR9A 2B1XB 5IG5A 3RGRA 3CCE3 3CC43 2Q07A 4HM8B 2OQEA 3T0UA 3ER7A 3HZPA 5ELUA 4CCVA 1ULIB 2XSOB 4LEHA 3TDGA 4STDA 4MMYB 1Q864 1V74A 2P38A 1O7WB 3FCSB 3SX1A 3LT8A 5KP4A 5IENA 1VQ73 8CHOA 5D82A 1WMNA 1TU5A 4IT7A 3SXXA 2OOVC 1YJN3 3WMDA 3FSDA 4N6UA 3CCJ3 1HU9A 5DREA 4Q53A 1IV7A 3LOYA 1ISKA 5CF2A 1NWWA 3KSED 2BO9B 4WP5A 3JUNA 2E2TA 1U8CB 3HX8A 3UL5A 2LYXA 3X3YA 1M1XB 1TIJA 3FZWA 1UW1A 2INXA 2WOFA 5AEUB 1W7CA 2CFGA 1YJ93 3S29A 3UL6A 2Z6BA 1N5HA 2HMLB 1IU7A 1YGEA 2YFIB 2IA7A 2JQ5A 3CCM3 3MPHA 3HIIA 2QA43 1UUVB 3EQQB 3QRDA 5IG0A 1LVNA 3UB1A 1JRQA 3X3ZA 1AVKA 1NB3I 3OV4A 1A90A 2W0QA 3BNDA 5G2GA 3ECFA 1A2VA 1GY5A 2GU3A 1YIT3 5AYRB 1UUWB 3U1WA 1DMMA 1VQK3 2CFDA 2BMQB 3FGYA 3KIIA 1ULJB 4LZIA 3LTBA 4ZM8A 2ZL8A 1GD3A 3LH4A 5AYSC 1Q40A 3JUMA 3FF2A 4HM7B 3CPW2 5AIGA 3NV0A 1Q814 1KWIA 4O02B 1VQ93 3EJVA 1FGQA 5KP1A 1GD4A 1N8R4 1JB4A 3QK9A 3E99A 3NX0A 2STDA 3DGLA 1OACA 3CCQ3 2RSXA 3I0YA 4HKVB 2Y74A 2W03A 3FG3A 1QAKA 3DXOA 3NBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKI A;  4R9K A;  4PEJ A;  3S5C A;  1GYB A;  2XSH B;  4WYK B;  1E97 A;  3UNL A;  1IDP A;  3KSP A;  4R1K A;  3H3H A;  5AIH A;  1W02 A;  4K1V A;  1WQL B;  3VGN A;  1NDO B;  1W00 A;  3G0K A;  3VSY A;  5CF1 A;  2A15 A;  2F99 A;  3B4O A;  3T8U A;  2XRX B;  1OGZ A;  4HM0 B;  1A2K A;  1HKX A;  3DMC A;  2F86 B;  1OHS A;  2HMJ B;  2K54 A;  3CPO A;  4XB5 A;  5IG3 A;  1JB2 A;  4HM4 B;  4MJD A;  4HM6 B;  4WWU C;  2XR8 B;  2F98 A;  3D9R A;  2RFR A;  1O7N B;  3EHC A;  5IEO A;  5EVH A;  5STD A;  3OWS A;  3A76 A;  5KP3 A;  1O7M B;  1OH0 A;  1Q42 A;  4HM3 B;  3F40 A;  5JPP A;  2B1X B;  4GB5 A;  5IF6 A;  3RGR A;  5IG5 A;  1BUQ A;  1GY7 A;  3B4P A;  1EG9 B;  4HM8 B;  5AEW B;  2QIY A;  3OX9 A;  2R4I A;  1EA2 A;  3ER7 A;  3HZP A;  1TUH A;  2GBX B;  2IMJ A;  4WYK A;  1ULI B;  2RCD A;  2XSO B;  3CU3 A;  3NBR A;  3B8L A;  1QJG A;  4L7K A;  4LEH A;  4STD A;  2CKF B;  2HMO B;  3EC9 A;  3LZA A;  4HM1 B;  3UJM A;  4OUQ A;  1O7W B;  3H51 A;  4HM5 B;  4XDW A;  4XM4 A;  1VZZ A;  5D81 A;  3RGA A;  2GXF A;  1GY6 A;  3F7S A;  1OPY A;  2GEY A;  3EN1 B;  5AII A;  4LGQ A;  5KP4 A;  4CDL A;  5IEN A;  1GS3 A;  5HGR A;  3OWY A;  4KVH A;  8CHO A;  2W2C A;  5IER A;  5D82 A;  3MG3 A;  4J9A A;  3EN8 A;  2B24 B;  3SOA A;  3MHE A;  5BXQ A;  3FLJ A;  5IEP A;  1E3R A;  3WMD A;  3NHX A;  1C7H A;  2GBW B;  3FSD A;  3Q90 A;  3GWR A;  4HVN A;  2CHC A;  3G16 A;  4Q53 A;  5D83 A;  5DRE A;  5TGN A;  3F8H A;  4FCM A;  5CK6 A;  5CF2 A;  1NWW A;  3B7C A;  1ISK A;  3EX9 A;  4WP5 A;  3JUN A;  3BLZ A;  5DRV A;  3HX8 A;  3DZL A;  4N3V A;  4XBT A;  1DMQ A;  1OHO A;  2HMN B;  1ZO2 A;  3GZX B;  3FF0 A;  3JUP A;  1JN5 A;  3FZW A;  2GEX A;  2YFL B;  2INX A;  3F7X A;  3M8C A;  1OUN A;  3KKG A;  2HMK B;  1U5O A;  3DUK A;  3KZT A;  5CXO A;  4LMI A;  5AEU B;  3SED A;  1K41 A;  5CLK A;  3BB9 A;  1CQS A;  1S5A A;  3F8X A;  3HK4 A;  4J8T A;  2HML B;  4X2H A;  2YFI B;  1O7H B;  1W6Y A;  2JQ5 A;  3GZB A;  3GZR A;  3IPT A;  1W01 A;  3EF8 A;  3ROB A;  4ORL A;  3GZY B;  1UUV B;  3EQQ B;  3MYT A;  4X2O A;  5IG0 A;  1STD A;  1OGX A;  2Z76 A;  3JUO A;  3OV4 A;  3K7C A;  3G8Z A;  4HJL B;  4HZ9 B;  6STD A;  1DMN A;  1SJW A;  3MG1 A;  3LYG A;  1TP6 A;  5AI1 A;  5G2G A;  3DM8 A;  3FH1 A;  3ECF A;  1OF5 B;  1GY5 A;  3NUV A;  2UX0 A;  3NV0 B;  4HZB B;  4RZM A;  4L8O A;  4I4K A;  4XBY A;  1UUW B;  2BNG A;  3EBY A;  1O7G B;  3KE7 A;  1OCV A;  2HMM B;  1DMM A;  4K1U A;  7STD A;  2Z7A A;  5IG4 A;  2BMQ B;  3FGY A;  4XDV A;  1ULJ B;  2BMR B;  1QMA A;  1AR0 A;  4R9L A;  4HM2 B;  1O7P B;  5AIF A;  4IIA A;  2BMO B;  3EBT A;  3SOY A;  3STD A;  1JKG B;  1Q40 A;  2RGQ A;  2Z77 A;  3GRD A;  2PZV A;  3FF2 A;  3JUM A;  4HM7 B;  1E3V A;  1OF5 A;  3NV0 A;  3OWU A;  5AIG A;  3EJV A;  1JN5 B;  3NM2 A;  1NU3 A;  1JB5 A;  4OVM A;  4U13 A;  1JB4 A;  5KP1 A;  2YFJ B;  4L8P A;  3E99 A;  4XBX A;  2STD A;  4H3U A;  5JPU A;  3F9S A;  5BVB A;  3CNX A;  3JUQ A;  3OXA A;  1OHP A;  3I0Y A;  4HKV B;  5FW5 A;  1ZX2 A;  3CNM A;  1ASK A;  3K0Z A;  3F14 A;  3FKA A;  4FCJ A;  2QGU A;  3T8N A;  3NXJ A;  1JKG A;  1Q40 B;  2I9W A;  2OWP A;  3MG2 A;  1Z1S A;  3DXO A;  3MSO A; 
#chains in the Genus database with same CATH topology
 3MKI A;  4R9K A;  4N6M A;  2C11 A;  2WO0 A;  3PXM A;  1IDP A;  1YVB I;  3HI7 A;  4HAA A;  1JV2 B;  4J5K A;  1W02 A;  1FA3 A;  2MF7 A;  3WA2 X;  3CCV 3;  3VSY A;  2WOH A;  2GU1 A;  2F99 A;  2XRX B;  1OGZ A;  1SQW A;  4EW5 A;  2CFW A;  1WNH A;  2H0H A;  3NQZ A;  2K54 A;  5JBS A;  3PS8 A;  3CC2 3;  1X1X A;  4MJD A;  4WWU C;  2OTJ 3;  1N5P A;  3D9R A;  2OTL 3;  2RFR A;  1VQ8 3;  5IEO A;  5EVH A;  3DGM A;  3OWS A;  5KP3 A;  1B2Z A;  1IT7 A;  3AMO B;  4HM3 B;  3F40 A;  7RNT A;  5JPP A;  4GB5 A;  5IF6 A;  1YIJ 3;  1GY7 A;  5AEW B;  1T5Y A;  1G02 A;  2C10 A;  3N54 B;  1VQ5 3;  2GBX B;  2IMJ A;  1RGK A;  2P09 A;  3G71 3;  3B8L A;  1QVF 2;  2CKF B;  3AHS A;  4KZ1 A;  4HM1 B;  1BSD A;  4OUQ A;  1FGO A;  3A5E A;  1RJO A;  1W6G A;  4HM5 B;  4XDW A;  2GXF A;  3F7S A;  2GEY A;  4LGQ A;  4K61 A;  4CDL A;  1ROA A;  1YI2 3;  1BUJ A;  5HGR A;  4BTW A;  3OWY A;  2KXG A;  4KVH A;  2W2C A;  4G1M B;  2CG1 A;  2ML6 A;  3MG3 A;  2WGO A;  4FCZ A;  1ZGX A;  3MHE A;  1MWT A;  1E3R A;  3NQY A;  1RGC A;  3Q90 A;  5D83 A;  4HVN A;  3G16 A;  5TGN A;  1NB5 I;  4N6N B;  1BAN A;  3B7C A;  1GOY A;  1SAR A;  4GL6 A;  2L1S A;  1C54 A;  1BNJ A;  3CME 3;  1HYF A;  3BU4 A;  3DZL A;  4R80 A;  3BNE A;  3WHO A;  3I56 3;  1DE3 A;  1T2H A;  1LXE A;  3JUP A;  3PCR A;  4GSP A;  3NBJ A;  2XFT A;  2YFL B;  1Q7Y 4;  2FNQ A;  3F7X A;  3M8C A;  1OUN A;  3KKG A;  1D6Z A;  4FMD A;  4O8S A;  5CXO A;  3S28 A;  1PY3 A;  5ELJ A;  3DGY A;  1W6C A;  3BB9 A;  2CH9 A;  1IK3 A;  4AKY A;  4J8T A;  1W4N A;  1TRP A;  1W2B 2;  2K0M A;  1SII A;  4H61 A;  5RNT A;  4IPB A;  2CC3 A;  4RNZ A;  1PU4 A;  2SAR A;  4X2O A;  1WMO A;  1FYS A;  1I2E A;  3PYJ A;  1OGX A;  4AKZ A;  4HJL B;  3V99 A;  2M7O A;  1I3F A;  3K7C A;  1VQL 3;  1DMN A;  1SJW A;  3MG1 A;  3LYG A;  5EEO A;  1BNE A;  3AGN A;  1GMR A;  5M19 A;  4BL3 A;  2XEP A;  1PYL A;  4L8O A;  3X40 A;  2W04 A;  3EBY A;  1O7G B;  3KE7 A;  1SPU A;  3EB8 A;  4FMC A;  2QEX 3;  1MNL A;  1KC8 4;  1RN7 A;  1QMA A;  1RGE A;  2UUG C;  1VQM 3;  1VQ6 3;  3SOY A;  1RSN A;  2Z77 A;  1FUT A;  2CWT A;  2PZV A;  4K90 B;  1OF5 A;  5BU4 A;  1RGF A;  2W6J H;  3KN4 A;  1W5Z A;  1LOY A;  3NM2 A;  1NJI 4;  1JB5 A;  2KF5 A;  2YFJ B;  4L8P A;  1MOL A;  4H3U A;  3F9S A;  3I55 3;  3CMA 3;  5FW5 A;  1ZX2 A;  3CNM A;  1WTH A;  3PCS A;  4FCJ A;  3T8N A;  3NXJ A;  1F8N A;  1JKG A;  2I9W A;  2IYJ A;  2OWP A;  4LSO A;  5M1A A;  1VQO 3;  1WMP A;  1BNI A;  1BRI A;  2F4Y A;  4KFE A;  2CK3 H;  1UGH I;  1N8Q A;  1BRJ A;  5BIR A;  4WYK B;  3ZG5 A;  1E97 A;  1MWU A;  3SYU A;  1FUW A;  3H3H A;  1US1 A;  1RN1 A;  1NDO B;  1W00 A;  2H0I A;  1X1Y A;  1EKM A;  2P0X A;  2RBI A;  4LYL B;  1YNV X;  2A15 A;  1VQN 3;  1LOX A;  4JF8 A;  1IV9 A;  1K28 A;  1X1U A;  2F5M A;  3SVA A;  3N9H A;  2W56 A;  3CPO A;  5IG3 A;  1JB2 A;  1UCJ A;  2GSP A;  1UI7 A;  2JDI H;  2F98 A;  1RRL A;  6RNT A;  1S72 3;  2W9P A;  5STD A;  3A76 A;  2BU4 A;  2XF3 A;  3B4P A;  1EG9 B;  3HIG A;  2QIY A;  1EEJ A;  3OX9 A;  1X1W A;  2F5W A;  3K9M C;  1L5G B;  1VQP 3;  3CCL 3;  1HZ1 A;  2RCD A;  4L7K A;  5G1L A;  1QJG A;  1IVX A;  1I0V A;  7GSP A;  2HMO B;  3SLU A;  3UJM A;  2O9U X;  3RGA A;  5D81 A;  1OPY A;  3EN1 B;  3J7Y d;  1R4C A;  3LT9 A;  5LC6 A;  2OCT A;  2WGQ A;  4EV2 A;  5IER A;  3X41 A;  3WDG B;  1BNR A;  2HOH A;  2CWU A;  5IEP A;  1C7H A;  2GBW B;  4KFF A;  3GWR A;  2CHC A;  2W56 B;  3F8H A;  3EE1 A;  3EX9 A;  1I8V A;  5DRV A;  3URP A;  4O2H A;  4XBT A;  4N3V A;  1GMP A;  1DMQ A;  2V1L A;  3FF0 A;  4NRE A;  5BVB A;  3JVC A;  3KZT A;  3DUK A;  1U5O A;  1TRQ A;  4LMI A;  1TFO A;  3SED A;  1K41 A;  3FG4 A;  1Q9E A;  4ILF A;  5CLK A;  3ZG0 A;  1CQS A;  1S5A A;  3DGO A;  1K9M 4;  3ZFZ A;  3Q3F A;  1CYV A;  4X2H A;  1UCK A;  1TFK A;  4EC6 A;  1RCL A;  4N6T A;  1G0T A;  4ORL A;  3ROB A;  3GZY B;  2K3D A;  5LC7 A;  3S27 A;  3K63 A;  3VF1 A;  1G96 A;  3G8Z A;  1RHL A;  4HZ9 B;  1YJW 3;  3ALA A;  2XH9 A;  3D3L A;  3K5T A;  3KCH A;  1TP6 A;  2CW9 A;  3DM8 A;  1QAL A;  3FH1 A;  1LQG C;  3NV0 B;  2BNG A;  1BGS A;  3PZW A;  2J8X B;  4JRF A;  4MMX B;  2HMM B;  3GSP A;  7STD A;  3IMA B;  4BTY A;  5IG4 A;  1B2U A;  1V57 A;  1Q82 4;  5FGO A;  4BU4 A;  5A0O B;  2MC8 A;  1FGR A;  1I3I A;  1O7P B;  3STD A;  4CPK A;  5CF1 A;  3DH2 A;  1GMQ A;  1D6U A;  2RGQ A;  3GRD A;  4NHF A;  3OWU A;  1N9E A;  2XGL A;  1NU3 A;  2BIR A;  3BNB A;  4XBX A;  1DVD A;  1BSB A;  1KSI A;  4TX4 A;  4MEI A;  1CH0 A;  3JUQ A;  3OXA A;  1OHP A;  1CYU A;  1FW7 A;  2KF6 A;  2Y73 A;  1AY7 A;  1ASK A;  4BTX A;  3F14 A;  2XFS A;  1IVU A;  2QGU A;  4MMZ B;  1KD1 4;  1Q40 B;  2LQV A;  1PFP A;  3X42 A;  1STF I;  3D79 A;  4NPB A;  1NO3 A;  4N6O B;  2CFL A;  5EQL A;  1CEW I;  2F56 A;  5AIH A;  1WQL B;  3G4S 3;  3T8U A;  3S67 A;  4HM0 B;  4HYZ A;  1HKX A;  1BU4 A;  1IYY A;  1OHS A;  3CXC 2;  3MWZ A;  2W9Q A;  2FGT A;  2YX9 A;  2ZA4 A;  4HM4 B;  1VQ4 3;  4GHO A;  1YHQ 3;  4KT3 B;  2CIU A;  9RNT A;  5M18 A;  3CCR 3;  1Q42 A;  4QWT A;  1BSC A;  4AEQ A;  1BUQ A;  1I0X A;  2R4I A;  1EA2 A;  2CWV A;  1LNH A;  1TUH A;  4RNY A;  2KF3 A;  4WYK A;  3CU3 A;  3HOH A;  4WFO A;  3NBR A;  4WHA A;  4BIR A;  2ZHX B;  2KCD A;  3EC9 A;  3LZA A;  2KRT A;  1T2I A;  1LNI A;  2CG0 A;  1M9G A;  1RGG A;  3H51 A;  1BSA A;  1VZZ A;  4XM4 A;  1SIH A;  3CPW 2;  1BRH A;  1GY6 A;  4N6V 0;  3CCS 3;  5AII A;  3CCU 3;  3RNT A;  3X3X A;  1A67 A;  2R41 A;  1GS3 A;  3LTD A;  3N8B A;  1K73 4;  1D6Y A;  3WA3 A;  1RKY A;  3WOF B;  2P0M A;  3EN8 A;  1TJD A;  2B24 B;  4J9A A;  2SBL A;  3FLJ A;  3SOA A;  5BXQ A;  3IJE B;  4I5Q A;  3NHX A;  3KFQ C;  2ZDJ A;  1NNV A;  2O3O A;  4FCM A;  1JZO A;  4KFD A;  3BLZ A;  3LXU X;  1Y4K A;  3WOE B;  5G1K A;  1JBR A;  2HMN B;  1OHO A;  1IVW A;  1I2G A;  1ZO2 A;  3GZX B;  3LTC A;  3BIR A;  4HBR A;  2H0G A;  4EYC A;  1RRH A;  1JN5 A;  2XGN A;  2GEX A;  5CK6 A;  6STD A;  1IQ8 A;  1J2B A;  2HMK B;  1EQK A;  3PGB A;  3U97 A;  1Q7H A;  2AAD A;  1RDS A;  3V92 A;  2IUJ A;  3F8X A;  1MWS A;  3HK4 A;  6GSP A;  1RN4 A;  2D1W A;  1O7H B;  1W6Y A;  3GZB A;  3GZR A;  3IPT A;  3L0R A;  3FG1 A;  4EXR A;  1W01 A;  3EF8 A;  2BHM A;  4DKI A;  3MYT A;  1AV4 A;  1STD A;  2Z76 A;  3JUO A;  1AQZ A;  3O8Y A;  1DYU A;  1BRG A;  5AI1 A;  4EBG A;  1UCI A;  1B3S A;  2E2V A;  4FMB A;  5HOH A;  1OF5 B;  4XBY A;  3NUV A;  2UX0 A;  4HZB B;  4RZM A;  4I4K A;  4J5G A;  1K8A 4;  1FUS A;  1OCV A;  2E2U A;  1BNF A;  3Q1C A;  1MGR A;  4K1U A;  1BRS A;  1ZS7 A;  2Z7A A;  5I97 A;  1IT8 A;  1RCK A;  4XDV A;  2BMR B;  1M90 4;  3BNC A;  1AR0 A;  4R9L A;  4HM2 B;  1M1K 4;  5AIF A;  4IIA A;  1BNS A;  2BMO B;  3EBT A;  4EV5 A;  1JKG B;  1YGW A;  1KQS 2;  5JPU A;  1E3V A;  3CD6 3;  3DGN A;  2BT3 A;  2D42 A;  3D4A A;  1JN5 B;  2CFK A;  1UDI I;  3GAX A;  3LML A;  4OVM A;  1I70 A;  4O3V A;  1MGW A;  1N9J A;  4U13 A;  1JJ2 2;  1IQY A;  5IW9 A;  4N6L A;  1AVL A;  1R4Y A;  1UUG B;  3CNX A;  1A2P A;  2RNT A;  3K0Z A;  2ML5 A;  1DVC A;  3FKA A;  3V98 A;  4R4K A;  1GOV A;  1RGL A;  3AMO A;  3MG2 A;  3CC7 3;  3DY5 A;  3NM7 A;  3OW2 2;  1Z1S A;  3MSO A;  4RBN A;  1JNQ A;  2IUK A;  4FMA A;  1QVG 2;  1FGT A;  1B20 A;  1W2Z A;  1UI8 A;  3LTA A;  4PEJ A;  1GYB A;  2XSH B;  3RDE A;  3S5C A;  3UNL A;  4R1K A;  3KSP A;  3WOD G;  2AAE A;  1QAF A;  2FXT A;  4K1V A;  1IQX A;  3VGN A;  1JZD A;  1ROV A;  3G0K A;  1BSE A;  1IVV A;  1FZU A;  2P05 A;  3B4O A;  3Q2P A;  1A2K A;  3G6E 3;  3DMC A;  2L4V A;  2F86 B;  2HMJ B;  2KF4 A;  2PNC A;  4XB5 A;  1RTU A;  1FGM A;  2OQE C;  1LOV A;  4HM6 B;  2XR8 B;  1O7N B;  3EHC A;  3AGO A;  2CX0 A;  1RGH A;  1O7M B;  2OOV A;  1OH0 A;  4OK0 A;  4FR9 A;  2B1X B;  5IG5 A;  3RGR A;  1BNG A;  3CCE 3;  3WR2 A;  3CC4 3;  1B2M A;  2Q07 A;  4HM8 B;  2OQE A;  3T0U A;  3ER7 A;  3X3Z A;  3HZP A;  5ELU A;  1JBT A;  1B2S A;  1UGI A;  4CCV A;  1ULI B;  2XSO B;  4LEH A;  3TDG A;  4RNT A;  4STD A;  4MMY B;  1Q86 4;  1JBS A;  1V74 A;  2P38 A;  1O7W B;  3FCS B;  1GSP A;  1I2F A;  8RNT A;  3SX1 A;  3LT8 A;  5KP4 A;  5IEN A;  1VQ7 3;  1TTO A;  8CHO A;  5D82 A;  4BL2 A;  1WMN A;  1V58 A;  1TU5 A;  3AHW A;  1B27 A;  4IT7 A;  3SXX A;  2OOV C;  1YJN 3;  3WMD A;  3FSD A;  4N6U A;  3CCJ 3;  1VQQ A;  1HU9 A;  4HOH A;  4Q53 A;  1IV7 A;  3LOY A;  5DRE A;  5CF2 A;  1MWR A;  1ISK A;  1NWW A;  3KSE D;  2BO9 B;  4WP5 A;  3JUN A;  2E2T A;  1U8C B;  3HX8 A;  3UL5 A;  1YVS A;  3UB1 A;  1UCL A;  2C4B A;  2LYX A;  3X3Y A;  1M1X B;  1BRK A;  1RGA A;  1TIJ A;  3FZW A;  1BRN L;  1UW1 A;  2INX A;  2WOF A;  5AEU B;  1W7C A;  2CFG A;  2CX1 A;  1YJ9 3;  3S29 A;  3D5G A;  2UGI A;  3UL6 A;  2Z6B A;  1N5H A;  2HML B;  1YGE A;  1IU7 A;  2YFI B;  2IA7 A;  2JQ5 A;  3CCM 3;  1EUI C;  3MPH A;  3HII A;  2QA4 3;  1RNT A;  1UUV B;  3EQQ B;  3QRD A;  1LVN A;  2IY2 A;  1JRQ A;  5IG0 A;  1AVK A;  1NB3 I;  1DET A;  3OV4 A;  1A90 A;  2W0Q A;  3BND A;  5G2G A;  3ECF A;  1A2V A;  1LRA A;  1GY5 A;  2GU3 A;  1YIT 3;  5AYR B;  1UUW B;  2KAA A;  3U1W A;  1RNB A;  1RMS A;  1DMM A;  1LQM B;  1VQK 3;  2CFD A;  2BMQ B;  3FGY A;  3KII A;  1ULJ B;  4LZI A;  1BVI A;  3LTB A;  4CJN A;  1T3B A;  2ZL8 A;  1GD3 A;  4ZM8 A;  3LH4 A;  5AYS C;  1Q40 A;  3JUM A;  3D5I A;  3FF2 A;  1BIR A;  4HM7 B;  1LOW A;  3NV0 A;  5AIG A;  1KWI A;  1B21 A;  4O02 B;  3EJV A;  1Q81 4;  1VQ9 3;  1GOU A;  1FGQ A;  5KP1 A;  1GD4 A;  1N8R 4;  1JB4 A;  3QK9 A;  1BAO A;  1BOX A;  3E99 A;  3NX0 A;  2STD A;  3DGL A;  1OAC A;  3CCQ 3;  2RSX A;  3I0Y A;  4HKV B;  2Y74 A;  2W03 A;  1B2X A;  1RLS A;  1QAK A;  3FG3 A;  3DXO A;  3NBB A;  5GSP A; 
#chains in the Genus database with same CATH homology
 3MKI A;  4R9K A;  4N6M A;  2C11 A;  2WO0 A;  3PXM A;  1IDP A;  1YVB I;  3HI7 A;  1JV2 B;  1W02 A;  1FA3 A;  2MF7 A;  3WA2 X;  3CCV 3;  3VSY A;  2WOH A;  2GU1 A;  2F99 A;  2XRX B;  1OGZ A;  1SQW A;  2CFW A;  1WNH A;  3NQZ A;  2K54 A;  5JBS A;  3PS8 A;  3CC2 3;  4MJD A;  2OTJ 3;  4WWU C;  1N5P A;  3D9R A;  2OTL 3;  2RFR A;  1VQ8 3;  5IEO A;  5EVH A;  3DGM A;  3OWS A;  5KP3 A;  1IT7 A;  3AMO B;  4HM3 B;  3F40 A;  5JPP A;  4GB5 A;  5IF6 A;  1YIJ 3;  1GY7 A;  5AEW B;  1T5Y A;  2C10 A;  3N54 B;  1VQ5 3;  2GBX B;  2IMJ A;  2P09 A;  3G71 3;  3B8L A;  1QVF 2;  2CKF B;  4KZ1 A;  4HM1 B;  4OUQ A;  1FGO A;  1RJO A;  1W6G A;  4HM5 B;  4XDW A;  2GXF A;  3F7S A;  2GEY A;  4LGQ A;  4K61 A;  4CDL A;  1ROA A;  1YI2 3;  5HGR A;  4BTW A;  3OWY A;  2KXG A;  4KVH A;  2W2C A;  4G1M B;  2CG1 A;  2ML6 A;  3MG3 A;  2WGO A;  4FCZ A;  3MHE A;  1E3R A;  3NQY A;  3Q90 A;  5D83 A;  4HVN A;  3G16 A;  5TGN A;  1NB5 I;  4N6N B;  3B7C A;  4GL6 A;  3CME 3;  3DZL A;  4R80 A;  3BNE A;  3I56 3;  3PCR A;  1LXE A;  3JUP A;  3NBJ A;  2XFT A;  2YFL B;  1Q7Y 4;  2FNQ A;  3F7X A;  3M8C A;  1OUN A;  3KKG A;  1D6Z A;  4FMD A;  4O8S A;  5CXO A;  3S28 A;  5ELJ A;  1W6C A;  3BB9 A;  2CH9 A;  1IK3 A;  4AKY A;  4J8T A;  1W4N A;  1W2B 2;  2K0M A;  1SII A;  4H61 A;  4IPB A;  2CC3 A;  4RNZ A;  1PU4 A;  4X2O A;  1WMO A;  3PYJ A;  4AKZ A;  1VQL 3;  1OGX A;  4HJL B;  3V99 A;  2M7O A;  3K7C A;  1DMN A;  1SJW A;  3MG1 A;  3LYG A;  5EEO A;  2XEP A;  3X40 A;  4L8O A;  2W04 A;  3EBY A;  1O7G B;  3KE7 A;  1SPU A;  3EB8 A;  4FMC A;  2QEX 3;  1MNL A;  1KC8 4;  1RN7 A;  1QMA A;  1VQM 3;  1VQ6 3;  3SOY A;  2Z77 A;  2CWT A;  2PZV A;  4K90 B;  1OF5 A;  1NJI 4;  3KN4 A;  2W6J H;  3NM2 A;  1W5Z A;  1JB5 A;  2YFJ B;  4L8P A;  1MOL A;  4H3U A;  3F9S A;  3I55 3;  3CMA 3;  5FW5 A;  1ZX2 A;  3CNM A;  1WTH A;  3PCS A;  4FCJ A;  3T8N A;  3NXJ A;  1F8N A;  1JKG A;  2I9W A;  2OWP A;  1VQO 3;  4LSO A;  1WMP A;  4KFE A;  2CK3 H;  1N8Q A;  4WYK B;  1E97 A;  1FUW A;  3H3H A;  1US1 A;  1NDO B;  1W00 A;  2P0X A;  1EKM A;  1VQN 3;  2A15 A;  1LOX A;  4JF8 A;  1IV9 A;  1K28 A;  3SVA A;  3N9H A;  2W56 A;  3CPO A;  5IG3 A;  1JB2 A;  1UI7 A;  2JDI H;  2F98 A;  1RRL A;  1S72 3;  2W9P A;  5STD A;  3A76 A;  2XF3 A;  3B4P A;  1EG9 B;  3HIG A;  2QIY A;  3OX9 A;  3K9M C;  1L5G B;  1VQP 3;  3CCL 3;  2RCD A;  4L7K A;  1QJG A;  1IVX A;  2HMO B;  3SLU A;  3UJM A;  2O9U X;  3RGA A;  5D81 A;  1OPY A;  3EN1 B;  3J7Y d;  1R4C A;  3LT9 A;  5LC6 A;  2OCT A;  2WGQ A;  4EV2 A;  5IER A;  3X41 A;  3WDG B;  2CWU A;  5IEP A;  1C7H A;  2GBW B;  4KFF A;  3GWR A;  2CHC A;  2W56 B;  3F8H A;  3EE1 A;  3EX9 A;  5DRV A;  4O2H A;  4XBT A;  4N3V A;  1DMQ A;  2V1L A;  3FF0 A;  4NRE A;  5BVB A;  3JVC A;  3KZT A;  3DUK A;  1U5O A;  4LMI A;  1TFO A;  3SED A;  1K41 A;  3FG4 A;  5CLK A;  1CQS A;  1S5A A;  3DGO A;  1K9M 4;  1CYV A;  4X2H A;  4EC6 A;  1TFK A;  4N6T A;  3ROB A;  4ORL A;  3GZY B;  5LC7 A;  3S27 A;  3VF1 A;  3K63 A;  1G96 A;  3G8Z A;  1YJW 3;  4HZ9 B;  3ALA A;  2XH9 A;  3D3L A;  3K5T A;  1TP6 A;  2CW9 A;  3DM8 A;  1QAL A;  3FH1 A;  3NV0 B;  2BNG A;  3PZW A;  4JRF A;  4MMX B;  2HMM B;  7STD A;  3IMA B;  4BTY A;  5IG4 A;  1Q82 4;  5FGO A;  5A0O B;  2MC8 A;  1FGR A;  1O7P B;  3STD A;  5CF1 A;  1D6U A;  2RGQ A;  3GRD A;  4NHF A;  3OWU A;  1N9E A;  2XGL A;  1NU3 A;  3BNB A;  4XBX A;  1DVD A;  1KSI A;  4TX4 A;  4MEI A;  3JUQ A;  3OXA A;  1OHP A;  1CYU A;  2Y73 A;  4BTX A;  1ASK A;  3F14 A;  2XFS A;  1IVU A;  2QGU A;  4MMZ B;  1KD1 4;  1Q40 B;  2LQV A;  1PFP A;  3X42 A;  1STF I;  1NO3 A;  4N6O B;  2CFL A;  5EQL A;  1CEW I;  5AIH A;  1WQL B;  3G4S 3;  3T8U A;  3S67 A;  4HM0 B;  4HYZ A;  1HKX A;  1OHS A;  3CXC 2;  3MWZ A;  2W9Q A;  2FGT A;  2YX9 A;  4HM4 B;  1VQ4 3;  1YHQ 3;  2CIU A;  3CCR 3;  1Q42 A;  4QWT A;  4AEQ A;  1BUQ A;  2R4I A;  1EA2 A;  2CWV A;  1LNH A;  1TUH A;  4RNY A;  4WYK A;  3CU3 A;  4WFO A;  3NBR A;  4WHA A;  2KCD A;  3EC9 A;  3LZA A;  2KRT A;  2CG0 A;  1M9G A;  3H51 A;  4XM4 A;  1VZZ A;  1SIH A;  1GY6 A;  4N6V 0;  3CCS 3;  5AII A;  1A67 A;  3X3X A;  1GS3 A;  3LTD A;  3N8B A;  1K73 4;  1D6Y A;  3WA3 A;  1RKY A;  3WOF B;  2P0M A;  3EN8 A;  2B24 B;  4J9A A;  3SOA A;  2SBL A;  3FLJ A;  5BXQ A;  3IJE B;  3NHX A;  3KFQ C;  2ZDJ A;  2O3O A;  4FCM A;  4KFD A;  3BLZ A;  3LXU X;  1Y4K A;  3WOE B;  2HMN B;  1OHO A;  1IVW A;  1ZO2 A;  3GZX B;  3LTC A;  4HBR A;  4EYC A;  1RRH A;  1JN5 A;  2XGN A;  2GEX A;  5CK6 A;  6STD A;  1IQ8 A;  1J2B A;  2HMK B;  1EQK A;  3PGB A;  3U97 A;  3V92 A;  2IUJ A;  3F8X A;  3HK4 A;  2D1W A;  1O7H B;  1W6Y A;  3GZB A;  3GZR A;  3IPT A;  3L0R A;  3FG1 A;  4EXR A;  1W01 A;  3EF8 A;  2BHM A;  3MYT A;  1AV4 A;  1STD A;  2Z76 A;  3JUO A;  3O8Y A;  1DYU A;  5AI1 A;  4EBG A;  2E2V A;  4FMB A;  1OF5 B;  4XBY A;  3NUV A;  2UX0 A;  4HZB B;  4RZM A;  4I4K A;  1K8A 4;  1OCV A;  2E2U A;  3Q1C A;  4K1U A;  2Z7A A;  5I97 A;  1IT8 A;  4XDV A;  2BMR B;  1M90 4;  3BNC A;  1AR0 A;  4R9L A;  4HM2 B;  1M1K 4;  5AIF A;  4IIA A;  2BMO B;  3EBT A;  4EV5 A;  1JKG B;  1KQS 2;  5JPU A;  1E3V A;  3CD6 3;  3DGN A;  2BT3 A;  2D42 A;  1JN5 B;  2CFK A;  3GAX A;  3LML A;  4OVM A;  4O3V A;  4U13 A;  1N9J A;  1JJ2 2;  1IQY A;  5IW9 A;  4N6L A;  1AVL A;  3CNX A;  3K0Z A;  2ML5 A;  1DVC A;  3FKA A;  3V98 A;  4R4K A;  3AMO A;  3MG2 A;  3CC7 3;  3DY5 A;  3NM7 A;  3OW2 2;  1Z1S A;  3MSO A;  4RBN A;  2IUK A;  1JNQ A;  4FMA A;  1QVG 2;  1FGT A;  1W2Z A;  1UI8 A;  3LTA A;  4PEJ A;  1GYB A;  2XSH B;  3RDE A;  3S5C A;  3UNL A;  4R1K A;  3KSP A;  3WOD G;  3CCU 3;  1QAF A;  2FXT A;  4K1V A;  1IQX A;  3VGN A;  1ROV A;  3G0K A;  2P05 A;  1IVV A;  3B4O A;  3Q2P A;  1A2K A;  3G6E 3;  3DMC A;  2L4V A;  2F86 B;  2HMJ B;  2PNC A;  4XB5 A;  1FGM A;  2OQE C;  4HM6 B;  2XR8 B;  1O7N B;  3EHC A;  1O7M B;  2OOV A;  1OH0 A;  4OK0 A;  4FR9 A;  2B1X B;  5IG5 A;  3RGR A;  3CCE 3;  3CC4 3;  2Q07 A;  4HM8 B;  2OQE A;  3T0U A;  3ER7 A;  3HZP A;  5ELU A;  4CCV A;  1ULI B;  2XSO B;  4LEH A;  3TDG A;  4STD A;  4MMY B;  1Q86 4;  1V74 A;  2P38 A;  1O7W B;  3FCS B;  3SX1 A;  3LT8 A;  5KP4 A;  5IEN A;  1VQ7 3;  8CHO A;  5D82 A;  1WMN A;  1TU5 A;  4IT7 A;  3SXX A;  2OOV C;  1YJN 3;  3WMD A;  3FSD A;  4N6U A;  3CCJ 3;  1HU9 A;  5DRE A;  4Q53 A;  1IV7 A;  3LOY A;  1ISK A;  5CF2 A;  1NWW A;  3KSE D;  2BO9 B;  4WP5 A;  3JUN A;  2E2T A;  1U8C B;  3HX8 A;  3UL5 A;  2LYX A;  3X3Y A;  1M1X B;  1TIJ A;  3FZW A;  1UW1 A;  2INX A;  2WOF A;  5AEU B;  1W7C A;  2CFG A;  1YJ9 3;  3S29 A;  3UL6 A;  2Z6B A;  1N5H A;  2HML B;  1IU7 A;  1YGE A;  2YFI B;  2IA7 A;  2JQ5 A;  3CCM 3;  3MPH A;  3HII A;  2QA4 3;  1UUV B;  3EQQ B;  3QRD A;  5IG0 A;  1LVN A;  3UB1 A;  1JRQ A;  3X3Z A;  1AVK A;  1NB3 I;  3OV4 A;  1A90 A;  2W0Q A;  3BND A;  5G2G A;  3ECF A;  1A2V A;  1GY5 A;  2GU3 A;  1YIT 3;  5AYR B;  1UUW B;  3U1W A;  1DMM A;  1VQK 3;  2CFD A;  2BMQ B;  3FGY A;  3KII A;  1ULJ B;  4LZI A;  3LTB A;  4ZM8 A;  2ZL8 A;  1GD3 A;  3LH4 A;  5AYS C;  1Q40 A;  3JUM A;  3FF2 A;  4HM7 B;  3CPW 2;  5AIG A;  3NV0 A;  1Q81 4;  1KWI A;  4O02 B;  1VQ9 3;  3EJV A;  1FGQ A;  5KP1 A;  1GD4 A;  1N8R 4;  1JB4 A;  3QK9 A;  3E99 A;  3NX0 A;  2STD A;  3DGL A;  1OAC A;  3CCQ 3;  2RSX A;  3I0Y A;  4HKV B;  2Y74 A;  2W03 A;  3FG3 A;  1QAK A;  3DXO A;  3NBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...