3EC9A

Crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
MRTPYQIVADHYAASDRHDPAAMMADIAPAIEWTEMAGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFKLDALHDAGDTVIGVGRYSGTYRRTGKSFECRVAHVWRVDAGKIVHFEQFTDTLLVAQAMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
source organism Burkholderia thailandensis e264
total genus 38
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ec9A00
3FKAA 3KE7A 5AEUB 4U13A 1W01A 4IIAA 1UUVB 4WYKB 4WP5A 1W6YA 3BB9A 3STDA 5IENA 5CF2A 4LEHA 1OGZA 2UX0A 3MG3A 2YFJB 1GY5A 1OCVA 2HMNB 3G16A 5D82A 4H3UA 3D9RA 3T8NA 2GXFA 3B7CA 2IMJA 3F7XA 3FGYA 5CLKA 5DREA 5G2GA 5IG0A 4OVMA 1AR0A 3OXAA 2OWPA 3NHXA 4LMIA 4WYKA 3GZRA 4J9AA 1W02A 3MKIA 3NXJA 5KP1A 1A2KA 2PZVA 1NDOB 4I4KA 3CPOA 2CKFB 3F8XA 4XDWA 1OHSA 4HM5B 2GBWB 1QJGA 2QGUA 3E99A 3UNLA 1O7PB 1JN5B 3FLJA 5IERA 4XBTA 3NM2A 2XSOB 3VSYA 5AIHA 1E3VA 1OGXA 3WMDA 3GRDA 3JUOA 1JB4A 4HKVB 3K7CA 1TP6A 1STDA 2BNGA 3MG1A 1C7HA 1EA2A 1O7WB 4L8PA 1CQSA 3OWUA 4J8TA 3SEDA 3FSDA 3KKGA 4R9LA 2GEXA 1OHPA 3ER7A 2HMMB 4XB5A 4KVHA 3DM8A 3F40A 4L7KA 1W00A 1JN5A 3M8CA 1UUWB 3K0ZA 2Z76A 3GZBA 5BXQA 2HMLB 3EN1B 3OV4A 1ULIB 2BMQB 1O7MB 2B24B 2QIYA 4X2OA 4N3VA 3KSPA 1BUQA 3F8HA 4HM4B 3CNMA 3I0YA 5IEPA 2HMOB 2GEYA 3MG2A 3KZTA 4WWUC 3NV0B 5AIIA 4HM3B 4HZBB 2BMOB 5KP3A 1Z1SA 3LZAA 3EJVA 1JB5A 2JQ5A 3UJMA 1GS3A 5EVHA 1TUHA 5CK6A 3JUQA 1VZZA 3H51A 1QMAA 1ISKA 2RCDA 3IPTA 1Q40B 3EHCA 3G8ZA 5AIFA 3HX8A 1S5AA 3EQQB 1JKGB 4GB5A 3NV0A 1ULJB 4X2HA 3RGAA 2INXA 4K1UA 1SJWA 5KP4A 1K41A 5JPUA 4HJLB 2Z7AA 1DMQA 2HMJB 7STDA 2R4IA 3JUNA 1EG9B 3MYTA 8CHOA 3EN8A 1Q40A 5IG5A 1IDPA 4LGQA 1NWWA 2F99A 1JKGA 1ZX2A 1OH0A 3JUPA 3MHEA 1HKXA 4ORLA 3SOYA 4HM1B 4HM7B 1U5OA 2I9WA 2RFRA 4HM8B 1E3RA 5D81A 1ZO2A 2GBXB 3FH1A 4HZ9B 3F14A 3NBRA 3DXOA 1DMNA 1O7GB 2BMRB 3JUMA 3OWYA 3B8LA 4HM6B 4XDVA 4XM4A 5IEOA 3NUVA 5IG4A 3VGNA 4OUQA 3CU3A 3GZYB 3EF8A 5TGNA 1NU3A 3CNXA 4STDA 1Q42A 4HM0B 3F9SA 5CF1A 5IF6A 3EX9A 3BLZA 3B4OA 1JB2A 3EC9A 4CDLA 1OF5B 4XBXA 1OPYA 4R1KA 2K54A 1OHOA 3A76A 1O7NB 4FCJA 2Z77A 2XSHB 2XRXB 3HK4A 2YFIB 3OX9A 5AIGA 2W2CA 4XBYA 1O7HB 3DMCA 1DMMA 2F98A 5CXOA 5BVBA 2A15A 5HGRA 3HZPA 3DZLA 3FF2A 3EBYA 3LYGA 1OF5A 5AEWB 3Q90A 2F86B 5DRVA 3FZWA 3OWSA 4L8OA 3T8UA 5D83A 2CHCA 2B1XB 1E97A 1GYBA 4PEJA 3GWRA 2STDA 5FW5A 1GY6A 2YFLB 4K1VA 2RGQA 3DUKA 6STDA 5JPPA 1OUNA 3GZXB 3FF0A 4HVNA 4FCMA 4Q53A 3F7SA 1GY7A 2HMKB 3EBTA 4MJDA 5IG3A 1ASKA 3S5CA 4R9KA 1WQLB 3B4PA 3ROBA 5STDA 4RZMA 4HM2B 3G0KA 3H3HA 3RGRA 3MSOA 3SOAA 5AI1A 2XR8B 3ECFA
chains in the Genus database with same CATH superfamily
2J8XB 3FKAA 2FNQA 1I2EA 1WMNA 1M1K4 1IQ8A 4J5GA 1BNIA 3KE7A 1DYUA 2SBLA 4RNTA 1QVG2 1VQ93 4EV2A 5AEUB 2AAEA 4U13A 1WNHA 1W01A 1HZ1A 4FMCA 4IIAA 1IV9A 1UUVB 4WYKB 1Q7Y4 4WP5A 2CWUA 1W6YA 1S723 1LOXA 2CFDA 2H0HA 2W56A 1MOLA 3BB9A 3STDA 5IENA 5CF2A 3X40A 4LEHA 5G1LA 3OW22 1X1WA 1OGZA 4O02B 2CFWA 1JNQA 2UX0A 2YFJB 3MG3A 3UL6A 1RSNA 1YNVX 1GY5A 1OCVA 1RN1A 2HMNB 3G16A 5D82A 4H3UA 3AMOA 4AEQA 8RNTA 1BVIA 1FUWA 1UI7A 3BNCA 3D9RA 9RNTA 3X41A 3T8NA 3ZFZA 2QEX3 3UL5A 4HYZA 1NO3A 2GXFA 3CCR3 3B7CA 1B2SA 1FGQA 1X1YA 3NQZA 1BNEA 1W7CA 2XGNA 3O8YA 6RNTA 3UB1A 2XEPA 2IMJA 3F7XA 3FGYA 3Q1CA 1RRLA 2RSXA 5CLKA 5DREA 3DGMA 2BIRA 5G2GA 1N5PA 3DH2A 2O9UX 1NB3I 2MC8A 1R4CA 1DE3A 5IG0A 4IPBA 4OVMA 1JZOA 1AR0A 3OXAA 3DGNA 2IA7A 2OWPA 3NHXA 4LYLB 2XFSA 4LMIA 3NX0A 4GL6A 3KSED 4WYKA 4JRFA 6GSPA 4MMZB 3SVAA 1D6ZA 2CX0A 3GZRA 4J9AA 3RDEA 3WDGB 1W02A 3MKIA 4KFDA 2WO0A 3NXJA 5KP1A 1A2KA 4EC6A 5M19A 2PZVA 1NDOB 2CFLA 3IMAB 1A67A 4I4KA 1BU4A 3CPOA 2CKFB 3WA3A 3F8XA 1U8CB 4NREA 3CXC2 4XDWA 1OHSA 4O2HA 1FZUA 4HM5B 3S27A 5JBSA 1IV7A 1FUTA 2GBWB 1QJGA 2E2TA 1BRKA 1VQ73 3CPW2 4BL3A 1I70A 2QGUA 4DKIA 4WHAA 2CFGA 2CWVA 3D4AA 3E99A 3UNLA 1O7PB 1DVDA 1D6UA 1JN5B 1BAOA 3FLJA 5IERA 4XBTA 3NM2A 2XSOB 2FXTA 1J2BA 1VQK3 3VSYA 1CYVA 3CME3 1CH0A 1RGHA 2Y73A 2C4BA 1B21A 1SIHA 1E3VA 1OGXA 1QALA 5AIHA 3WMDA 3GRDA 3JUOA 1JB4A 3DGLA 3AGOA 4HKVB 3K7CA 3PZWA 1TP6A 2M7OA 1STDA 7GSPA 1W2ZA 1UUGB 1MWSA 2BNGA 4O8SA 1UCLA 1UCKA 3MG1A 1BNGA 1C7HA 3NBJA 3URPA 1EA2A 3CCL3 3SYUA 1O7WB 4L8PA 1CQSA 3OWUA 4J8TA 3SEDA 1N8R4 1BNRA 3FSDA 1UDII 1PU4A 3G713 3KKGA 4R9LA 2GEXA 1JJ22 4BTWA 1OHPA 3DGYA 3ER7A 1RGGA 3LTCA 4BU4A 3BU4A 2HMMB 5LC6A 4XB5A 4EYCA 4KVHA 5FGOA 2P0MA 2YX9A 1BSDA 3DM8A 3F40A 1RTUA 4L7KA 1W00A 1JN5A 1GOUA 3M8CA 1UUWB 3K0ZA 2Z76A 2W9QA 1YHQ3 1BRHA 3CCM3 3GZBA 5BXQA 4N6NB 1RGKA 1V57A 1ZGXA 2F5MA 2W9PA 3FG1A 3BIRA 2HMLB 3EN1B 3LMLA 3OV4A 1ULIB 3A5EA 2BMQB 1IT8A 3KN4A 1MWTA 3X3XA 3VF1A 2IUJA 1O7MB 5LC7A 2B24B 1W5ZA 5GSPA 3G4S3 2QIYA 3PCSA 4FMBA 4ILFA 5AYSC 4X2OA 1BIRA 3D5IA 1LVNA 4N3VA 3EB8A 1W6GA 1STFI 3KSPA 1YJW3 1BUQA 1TRPA 1M1XB 3F8HA 1WMPA 5G1KA 1RRHA 4O3VA 1NB5I 4HM4B 1GSPA 3IJEB 1LQGC 2AADA 1HU9A 1BNSA 3CNMA 3I0YA 4QWTA 3PXMA 5IEPA 1FGMA 1UI8A 2HMOB 4I5QA 1YI23 1BSBA 2GEYA 2KCDA 1BGSA 1FA3A 3MG2A 1BSCA 1FW7A 2CG1A 1TIJA 2O3OA 2OCTA 3KZTA 4WWUC 1G96A 1VQL3 3NV0B 1IVVA 5AIIA 4LSOA 4HM3B 4HZBB 2BMOB 5KP3A 1SIIA 1Z1SA 1VQ63 1K9M4 3LZAA 4EV5A 3EJVA 1JB5A 2JQ5A 1RDSA 2CC3A 2K0MA 3UJMA 1RKYA 1W6CA 3N9HA 4OK0A 1GS3A 1LOYA 4KFEA 2KF3A 1T2IA 3SLUA 2E2VA 2GSPA 5EVHA 5M1AA 1AY7A 1I3FA 3K9MC 2ZA4A 1VQ83 1TUHA 3KFQC 1RJOA 5CK6A 3BNBA 3GSPA 5ELJA 4EW5A 3JUQA 1TTOA 4K61A 2C11A 1CYUA 1EEJA 1VZZA 1FYSA 3H51A 3S67A 1QMAA 1ISKA 2RCDA 1AVLA 1MNLA 3IPTA 1Q40B 2F4YA 3EHCA 2LYXA 3G8ZA 4HAAA 1A2PA 3KCHA 1AQZA 2CG0A 3S29A 1RNBA 1FGOA 3NBBA 4N6OB 2C10A 3HX8A 4FR9A 1S5AA 5AIFA 3CCQ3 2PNCA 3EQQB 1B2ZA 1JKGB 4GB5A 1T5YA 3V98A 3WODG 3NV0A 1ULJB 2CH9A 3EE1A 4N6V0 4X2HA 2KAAA 1IK3A 1IQXA 1Y4KA 2P09A 3RGAA 2INXA 1AV4A 1RHLA 1FGTA 4K1UA 3CD63 3WA2X 1SJWA 2F5WA 3LT8A 1QVF2 2IY2A 5KP4A 1IU7A 1K41A 2XGLA 4GSPA 5JPUA 4HJLB 1RCKA 1RGEA 2CWTA 1DMQA 1QAFA 1JRQA 2Z7AA 2HMJB 2JDIH 2KF6A 3D5GA 2OQEC 7STDA 2R4IA 1YGWA 3JUNA 3LTAA 3K63A 1RGAA 2OQEA 1Q9EA 3U1WA 1UCIA 4HOHA 1M9GA 2Z6BA 1EG9B 2SARA 3MYTA 7RNTA 8CHOA 3EN8A 1LNIA 2CK3H 4LZIA 1Q40A 1GOYA 4EBGA 4R80A 2K3DA 5IG5A 3N54B 3LH4A 2OTJ3 1VQN3 1BNJA 3NQYA 1IDPA 4MMXB 1BRIA 4LGQA 1F8NA 2ZHXB 2QA43 1NWWA 4N6LA 1M904 2F99A 1N8QA 3G6E3 1BSEA 1JKGA 1JV2B 3K5TA 2XFTA 3CCE3 1UW1A 1JBSA 5I97A 1ZX2A 2H0GA 1CEWI 3NM7A 2CX1A 3LT9A 1OH0A 3JUPA 4KFFA 4RNYA 1QAKA 2WGOA 2LQVA 1BRNL 3Q3FA 3MHEA 1RN4A 1G02A 3FG4A 1YIT3 1Q7HA 1HKXA 1BNFA 4ORLA 2WGQA 5HOHA 3SOYA 3LOYA 1SPUA 4BTXA 4HM1B 2W03A 4HM7B 1A90A 1U5OA 2I9WA 1RN7A 1BRSA 2MF7A 2RFRA 3AGNA 1W2B2 3N8BA 4CJNA 3WOEB 3WOFB 4HM8B 1ROAA 3X3ZA 1E3RA 4AKZA 5D81A 1LNHA 1ZO2A 2GBXB 1Q814 1KC84 4BTYA 1VQM3 3FH1A 3PS8A 2BO9B 3F14A 4HBRA 2KRTA 4HZ9B 2KF5A 2W04A 3NBRA 1D6YA 1TFOA 3DXOA 1EUIC 4RNZA 1DMNA 1W4NA 2UUGC 1O7GB 3FG3A 4MEIA 2L4VA 1MWRA 1I2GA 1V58A 4J5KA 2D42A 3WHOA 1YIJ3 1PYLA 1HYFA 2BMRB 3JUMA 2KXGA 1B20A 1RGLA 1DETA 3HI7A 4KT3B 3HIGA 3KIIA 1KD14 2CW9A 3T0UA 1TJDA 3OWYA 3B8LA 1EQKA 2P05A 1LRAA 4HM6B 4NHFA 4XDVA 4XM4A 5IEOA 3NUVA 1B2XA 5EQLA 1TFKA 1NJI4 1IVUA 1PY3A 5IG4A 1KWIA 2XH9A 1LQMB 2GU3A 5IW9A 3VGNA 1FUSA 4OUQA 3CU3A 4AKYA 3LTDA 3GZYB 3EF8A 1RNTA 5TGNA 1NU3A 2UGIA 3CNXA 2Y74A 3LXUX 1VQQA 1TU5A 2RBIA 3BNDA 2R41A 3PYJA 4STDA 2P0XA 5EEOA 1MWUA 1MGRA 1KSIA 1Q42A 3I563 4HM0B 1GD3A 3F9SA 1YJ93 5CF1A 3CCU3 3MPHA 1LOWA 2V1LA 5IF6A 1BOXA 3EX9A 2ML5A 2BT3A 1WMOA 3BLZA 3HIIA 3B4OA 4CCVA 1JB2A 1BSAA 3EC9A 1JBTA 3U97A 4CDLA 1YJN3 1WTHA 3QRDA 1RLSA 4FCZA 5A0OB 1GD4A 1OF5B 4XBXA 1G0TA 1N5HA 3RNTA 1OPYA 1B3SA 3D79A 3CCJ3 1GMPA 4G1MB 3CCS3 4R1KA 3CCV3 1RGCA 1OHOA 1IVXA 2K54A 3A76A 1O7NB 2BHMA 4FCJA 1ROVA 1BUJA 2Z77A 1Q824 2XSHB 2XRXB 1UCJA 4KZ1A 3HK4A 2YFIB 3OX9A 5AIGA 4EXRA 1N9EA 3JVCA 3I553 3V92A 2W2CA 5M18A 1IQYA 4GHOA 2OTL3 4XBYA 4RBNA 1B2UA 3CC23 3SX1A 3Q2PA 3MWZA 1RMSA 1SARA 2P38A 3X3YA 1O7HB 3S28A 1VQ53 3DMCA 1DMMA 1PFPA 2L1SA 2CFKA 2F98A 1B27A 1AVKA 4H61A 5CXOA 2W6JH 5BVBA 1T2HA 1SQWA 2A15A 5HGRA 1K8A4 4FMAA 1UGHI 1LXEA 1YVBI 2W0QA 1OACA 2ZDJA 1Q864 3HZPA 2GU1A 3DZLA 3FF2A 3EBYA 5BU4A 3LYGA 1BRGA 1OF5A 1X1XA 3WR2A 3ZG0A 3DGOA 2WOFA 4ZM8A 3X42A 1VQO3 1RGFA 5AEWB 1UGIA 3Q90A 3J7Yd 2F86B 2OOVC 5DRVA 1V74A 3AHWA 2H0IA 1I8VA 2IUKA 1T3BA 3FZWA 2HOHA 2OOVA 3DY5A 4BL2A 3OWSA 4L8OA 1IYYA 3T8UA 1GMRA 1KQS2 5D83A 2CHCA 3ZG5A 2B1XB 3LTBA 1E97A 3FCSB 3CC73 1GYBA 3D3LA 4PEJA 3GWRA 2STDA 4K90B 3QK9A 1I2FA 2Q07A 3AHSA 2KF4A 5FW5A 1IVWA 1I0VA 3CMA3 1GY6A 1R4YA 1MGWA 2YFLB 4K1VA 1DVCA 1ZS7A 2IYJA 2RGQA 3DUKA 6STDA 5JPPA 1GMQA 1VQP3 1C54A 1OUNA 3GZXB 1B2MA 3GAXA 1I3IA 1TRQA 1L5GB 3FF0A 2RNTA 1A2VA 1BRJA 1GOVA 4MMYB 3CC43 4HVNA 1IT7A 1YVSA 2XF3A 3PGBA 1X1UA 4N6UA 1YGEA 4FCMA 1NNVA 3HOHA 4Q53A 3F7SA 1GY7A 2D1WA 4CPKA 1I0XA 2HMKB 3EBTA 1VQ43 1EKMA 3PCRA 4IT7A 4MJDA 5RNTA 1JZDA 4FMDA 1K28A 5AYRB 2CIUA 5IG3A 1ASKA 3S5CA 4R9KA 1WQLB 3B4PA 5ELUA 5BIRA 3TDGA 1N9JA 2W56B 4N6TA 1JBRA 1BANA 3V99A 2ML6A 2BU4A 3ALAA 2FGTA 4TX4A 5STDA 3ROBA 4RZMA 4N6MA 3BNEA 3SXXA 4WFOA 4R4KA 4JF8A 4BIRA 4HM2B 2F56A 3G0KA 3H3HA 3RGRA 3MSOA 3AMOB 2ZL8A 4NPBA 3L0RA 1K734 1FGRA 1LOVA 1US1A 3SOAA 5AI1A 2E2UA 1RCLA 2WOHA 2XR8B 3ECFA
chains in the Genus database with same CATH topology
3FKAA 2FNQA 1WMNA 1M1K4 1IQ8A 3KE7A 1DYUA 2SBLA 1QVG2 1VQ93 4EV2A 5AEUB 4U13A 1WNHA 1W01A 4FMCA 4IIAA 1IV9A 1UUVB 4WYKB 1Q7Y4 4WP5A 2CWUA 1W6YA 1S723 1LOXA 2CFDA 2W56A 1MOLA 3BB9A 3STDA 5IENA 5CF2A 3X40A 4LEHA 3OW22 1OGZA 4O02B 2CFWA 1JNQA 2UX0A 2YFJB 3MG3A 3UL6A 1GY5A 1OCVA 2HMNB 3G16A 5D82A 4AEQA 4H3UA 3AMOA 1FUWA 1UI7A 3BNCA 3D9RA 3X41A 3T8NA 2QEX3 3UL5A 4HYZA 1NO3A 2GXFA 3CCR3 3B7CA 1FGQA 3NQZA 3O8YA 1W7CA 2XGNA 3UB1A 2XEPA 2IMJA 3F7XA 3FGYA 3Q1CA 1RRLA 2RSXA 5CLKA 5DREA 3DGMA 5G2GA 1N5PA 2O9UX 1NB3I 2MC8A 1R4CA 5IG0A 4IPBA 4OVMA 1AR0A 3OXAA 3DGNA 2IA7A 2OWPA 3NHXA 2XFSA 4LMIA 3NX0A 4GL6A 3KSED 4WYKA 4JRFA 4MMZB 3SVAA 1D6ZA 3GZRA 4J9AA 3RDEA 3WDGB 1W02A 3MKIA 4KFDA 2WO0A 3NXJA 5KP1A 1A2KA 4EC6A 2PZVA 1NDOB 2CFLA 3IMAB 1A67A 4I4KA 3CPOA 2CKFB 3WA3A 3F8XA 1U8CB 4NREA 3CXC2 4XDWA 1OHSA 4O2HA 4HM5B 3S27A 5JBSA 1IV7A 2GBWB 1VQ73 1QJGA 2E2TA 3CPW2 2QGUA 4WHAA 2CFGA 2CWVA 3E99A 3UNLA 1O7PB 1DVDA 1D6UA 1JN5B 3FLJA 5IERA 4XBTA 3NM2A 2XSOB 2FXTA 1J2BA 1VQK3 3VSYA 1CYVA 3CME3 2Y73A 5AIHA 1SIHA 1E3VA 1OGXA 1QALA 3WMDA 3GRDA 3JUOA 1JB4A 3DGLA 4HKVB 3K7CA 3PZWA 1TP6A 2M7OA 1STDA 1W2ZA 2BNGA 4O8SA 3MG1A 1C7HA 3NBJA 1EA2A 3CCL3 1O7WB 4L8PA 1CQSA 3OWUA 4J8TA 3SEDA 1N8R4 3FSDA 1PU4A 3G713 3KKGA 4R9LA 2GEXA 1JJ22 4BTWA 1OHPA 3ER7A 3LTCA 2HMMB 5LC6A 4XB5A 4EYCA 4KVHA 5FGOA 2P0MA 2YX9A 3DM8A 3F40A 4L7KA 1W00A 1JN5A 3M8CA 1UUWB 3K0ZA 2Z76A 2W9QA 1YHQ3 3CCM3 3GZBA 5BXQA 4N6NB 2W9PA 3FG1A 2HMLB 3EN1B 3LMLA 3OV4A 1ULIB 3KN4A 2BMQB 1IT8A 3X3XA 3VF1A 2IUJA 1O7MB 5LC7A 2B24B 1W5ZA 3G4S3 2QIYA 3PCSA 4FMBA 5AYSC 4X2OA 1LVNA 4N3VA 3EB8A 1W6GA 1STFI 3KSPA 1YJW3 1BUQA 1M1XB 3F8HA 1WMPA 1RRHA 4O3VA 1NB5I 4HM4B 3IJEB 1HU9A 3CNMA 3I0YA 4QWTA 3PXMA 5IEPA 1FGMA 1UI8A 2HMOB 1YI23 2GEYA 2KCDA 1FA3A 3MG2A 2CG1A 1TIJA 2O3OA 2OCTA 3KZTA 4WWUC 1G96A 1VQL3 3NV0B 1IVVA 5AIIA 4LSOA 4HM3B 4HZBB 2BMOB 5KP3A 1SIIA 1Z1SA 1VQ63 1K9M4 3LZAA 4EV5A 3EJVA 1JB5A 2JQ5A 2CC3A 2K0MA 3UJMA 1RKYA 1W6CA 3N9HA 4OK0A 1GS3A 4KFEA 3SLUA 2E2VA 5EVHA 3K9MC 1VQ83 1TUHA 3KFQC 1RJOA 5CK6A 3BNBA 5ELJA 3JUQA 4K61A 2C11A 1VZZA 3H51A 3S67A 1QMAA 1ISKA 2RCDA 1AVLA 1MNLA 3IPTA 1Q40B 3EHCA 2LYXA 3G8ZA 2CG0A 3S29A 1FGOA 3NBBA 4N6OB 2C10A 3HX8A 4FR9A 1S5AA 5AIFA 3CCQ3 2PNCA 3EQQB 1JKGB 4GB5A 1T5YA 3V98A 3WODG 3NV0A 1ULJB 2CH9A 3EE1A 4N6V0 4X2HA 1IK3A 1IQXA 1Y4KA 2P09A 3RGAA 2INXA 1AV4A 4K1UA 1FGTA 3CD63 3WA2X 1SJWA 3LT8A 1QVF2 5KP4A 1IU7A 2XGLA 1K41A 5JPUA 4HJLB 2Z7AA 2CWTA 1DMQA 1QAFA 1JRQA 2HMJB 2JDIH 2OQEC 7STDA 2R4IA 3LTAA 3JUNA 3K63A 2OQEA 3U1WA 1M9GA 2Z6BA 1EG9B 3MYTA 8CHOA 3EN8A 2CK3H 4LZIA 1Q40A 4EBGA 4R80A 5IG5A 3N54B 3LH4A 2OTJ3 1VQN3 3NQYA 1IDPA 4MMXB 4LGQA 1F8NA 2QA43 1M904 1NWWA 4N6LA 2F99A 1N8QA 3G6E3 1JKGA 1JV2B 3K5TA 2XFTA 3CCE3 1UW1A 5I97A 1ZX2A 3NM7A 1CEWI 4KFFA 3LT9A 1OH0A 3JUPA 4RNYA 1QAKA 2WGOA 2LQVA 3MHEA 3FG4A 1YIT3 1HKXA 4ORLA 2WGQA 3SOYA 3LOYA 1SPUA 4BTXA 4HM1B 2W03A 4HM7B 1A90A 1U5OA 2I9WA 1RN7A 1W2B2 2MF7A 2RFRA 3N8BA 3WOEB 3WOFB 4HM8B 1ROAA 3X3ZA 1E3RA 4AKZA 5D81A 1LNHA 1ZO2A 2GBXB 1Q814 1KC84 4BTYA 1VQM3 3FH1A 3PS8A 2BO9B 3F14A 4HBRA 2KRTA 4HZ9B 2W04A 3NBRA 1D6YA 1TFOA 3DXOA 4RNZA 1DMNA 1W4NA 1O7GB 3FG3A 4MEIA 2L4VA 1Q864 2D42A 1YIJ3 2BMRB 3JUMA 2KXGA 3HI7A 3HIGA 3KIIA 1KD14 2CW9A 3T0UA 3OWYA 3B8LA 1EQKA 2P05A 4HM6B 4NHFA 4XDVA 4XM4A 5IEOA 3NUVA 5EQLA 1NJI4 1TFKA 1IVUA 5IG4A 1KWIA 2XH9A 2GU3A 5IW9A 3VGNA 4OUQA 3CU3A 4AKYA 3LTDA 3GZYB 3EF8A 5TGNA 1NU3A 3CNXA 2Y74A 3LXUX 1TU5A 3BNDA 3PYJA 4STDA 2P0XA 5EEOA 1Q42A 1KSIA 3I563 4HM0B 1GD3A 3F9SA 5CF1A 3CCU3 3MPHA 2V1LA 5IF6A 3EX9A 2ML5A 2BT3A 1WMOA 3BLZA 3HIIA 3B4OA 4CCVA 1JB2A 3EC9A 3U97A 4CDLA 1YJN3 1WTHA 3QRDA 4FCZA 5A0OB 1GD4A 1OF5B 4XBXA 3CCJ3 1N5HA 1YJ93 1OPYA 4G1MB 3CCS3 4R1KA 3CCV3 2K54A 1OHOA 1IVXA 3A76A 1O7NB 2BHMA 4FCJA 1ROVA 2Z77A 1Q824 2XSHB 2XRXB 4KZ1A 3HK4A 2YFIB 3OX9A 5AIGA 4EXRA 1N9EA 3JVCA 3I553 3V92A 2W2CA 1IQYA 2OTL3 4XBYA 4RBNA 3CC23 3SX1A 3Q2PA 3MWZA 2P38A 3X3YA 1O7HB 3S28A 1VQ53 3DMCA 1DMMA 1PFPA 2CFKA 2F98A 5CXOA 1AVKA 4H61A 2W6JH 5BVBA 1SQWA 2A15A 5HGRA 1K8A4 4FMAA 1LXEA 1YVBI 2W0QA 1OACA 2ZDJA 3HZPA 2GU1A 3DZLA 3FF2A 3EBYA 3LYGA 1OF5A 4ZM8A 3DGOA 2WOFA 3X42A 1VQO3 5AEWB 3Q90A 3J7Yd 2F86B 2OOVC 5DRVA 1V74A 2IUKA 3FZWA 2OOVA 3DY5A 3OWSA 4L8OA 3T8UA 1KQS2 5D83A 2CHCA 2B1XB 3LTBA 1E97A 3FCSB 3CC73 1GYBA 3D3LA 4PEJA 3GWRA 2STDA 4K90B 3QK9A 5FW5A 2Q07A 1IVWA 3CMA3 1GY6A 2YFLB 4K1VA 1DVCA 2RGQA 3DUKA 1VQP3 6STDA 5JPPA 1CYUA 1OUNA 3GZXB 3GAXA 1L5GB 3FF0A 1A2VA 4MMYB 3CC43 4HVNA 1IT7A 2XF3A 3PGBA 4N6UA 1YGEA 4FCMA 4Q53A 3F7SA 1GY7A 2D1WA 2HMKB 3EBTA 1VQ43 1EKMA 3PCRA 4IT7A 4MJDA 4FMDA 1K28A 5AYRB 2CIUA 5IG3A 1ASKA 3S5CA 4R9KA 1WQLB 3B4PA 5ELUA 3TDGA 1N9JA 2W56B 4N6TA 3V99A 2ML6A 4TX4A 3ALAA 2FGTA 5STDA 3ROBA 4RZMA 4N6MA 3BNEA 3SXXA 4WFOA 4R4KA 4JF8A 4HM2B 3G0KA 3H3HA 3RGRA 3MSOA 3AMOB 2ZL8A 3L0RA 1K734 1FGRA 3SOAA 1US1A 5AI1A 2E2UA 2WOHA 2XR8B 3ECFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKA A;  3KE7 A;  5AEU B;  4U13 A;  1W01 A;  4IIA A;  1UUV B;  4WYK B;  4WP5 A;  1W6Y A;  3BB9 A;  3STD A;  5IEN A;  5CF2 A;  4LEH A;  1OGZ A;  2UX0 A;  3MG3 A;  2YFJ B;  1GY5 A;  1OCV A;  2HMN B;  3G16 A;  5D82 A;  4H3U A;  3D9R A;  3T8N A;  2GXF A;  3B7C A;  2IMJ A;  3F7X A;  3FGY A;  5CLK A;  5DRE A;  5G2G A;  5IG0 A;  4OVM A;  1AR0 A;  3OXA A;  2OWP A;  3NHX A;  4LMI A;  4WYK A;  3GZR A;  4J9A A;  1W02 A;  3MKI A;  3NXJ A;  5KP1 A;  1A2K A;  2PZV A;  1NDO B;  4I4K A;  3CPO A;  2CKF B;  3F8X A;  4XDW A;  1OHS A;  4HM5 B;  2GBW B;  1QJG A;  2QGU A;  3E99 A;  3UNL A;  1O7P B;  1JN5 B;  3FLJ A;  5IER A;  4XBT A;  3NM2 A;  2XSO B;  3VSY A;  5AIH A;  1E3V A;  1OGX A;  3WMD A;  3GRD A;  3JUO A;  1JB4 A;  4HKV B;  3K7C A;  1TP6 A;  1STD A;  2BNG A;  3MG1 A;  1C7H A;  1EA2 A;  1O7W B;  4L8P A;  1CQS A;  3OWU A;  4J8T A;  3SED A;  3FSD A;  3KKG A;  4R9L A;  2GEX A;  1OHP A;  3ER7 A;  2HMM B;  4XB5 A;  4KVH A;  3DM8 A;  3F40 A;  4L7K A;  1W00 A;  1JN5 A;  3M8C A;  1UUW B;  3K0Z A;  2Z76 A;  3GZB A;  5BXQ A;  2HML B;  3EN1 B;  3OV4 A;  1ULI B;  2BMQ B;  1O7M B;  2B24 B;  2QIY A;  4X2O A;  4N3V A;  3KSP A;  1BUQ A;  3F8H A;  4HM4 B;  3CNM A;  3I0Y A;  5IEP A;  2HMO B;  2GEY A;  3MG2 A;  3KZT A;  4WWU C;  3NV0 B;  5AII A;  4HM3 B;  4HZB B;  2BMO B;  5KP3 A;  1Z1S A;  3LZA A;  3EJV A;  1JB5 A;  2JQ5 A;  3UJM A;  1GS3 A;  5EVH A;  1TUH A;  5CK6 A;  3JUQ A;  1VZZ A;  3H51 A;  1QMA A;  1ISK A;  2RCD A;  3IPT A;  1Q40 B;  3EHC A;  3G8Z A;  5AIF A;  3HX8 A;  1S5A A;  3EQQ B;  1JKG B;  4GB5 A;  3NV0 A;  1ULJ B;  4X2H A;  3RGA A;  2INX A;  4K1U A;  1SJW A;  5KP4 A;  1K41 A;  5JPU A;  4HJL B;  2Z7A A;  1DMQ A;  2HMJ B;  7STD A;  2R4I A;  3JUN A;  1EG9 B;  3MYT A;  8CHO A;  3EN8 A;  1Q40 A;  5IG5 A;  1IDP A;  4LGQ A;  1NWW A;  2F99 A;  1JKG A;  1ZX2 A;  1OH0 A;  3JUP A;  3MHE A;  1HKX A;  4ORL A;  3SOY A;  4HM1 B;  4HM7 B;  1U5O A;  2I9W A;  2RFR A;  4HM8 B;  1E3R A;  5D81 A;  1ZO2 A;  2GBX B;  3FH1 A;  4HZ9 B;  3F14 A;  3NBR A;  3DXO A;  1DMN A;  1O7G B;  2BMR B;  3JUM A;  3OWY A;  3B8L A;  4HM6 B;  4XDV A;  4XM4 A;  5IEO A;  3NUV A;  5IG4 A;  3VGN A;  4OUQ A;  3CU3 A;  3GZY B;  3EF8 A;  5TGN A;  1NU3 A;  3CNX A;  4STD A;  1Q42 A;  4HM0 B;  3F9S A;  5CF1 A;  5IF6 A;  3EX9 A;  3BLZ A;  3B4O A;  1JB2 A;  3EC9 A;  4CDL A;  1OF5 B;  4XBX A;  1OPY A;  4R1K A;  2K54 A;  1OHO A;  3A76 A;  1O7N B;  4FCJ A;  2Z77 A;  2XSH B;  2XRX B;  3HK4 A;  2YFI B;  3OX9 A;  5AIG A;  2W2C A;  4XBY A;  1O7H B;  3DMC A;  1DMM A;  2F98 A;  5CXO A;  5BVB A;  2A15 A;  5HGR A;  3HZP A;  3DZL A;  3FF2 A;  3EBY A;  3LYG A;  1OF5 A;  5AEW B;  3Q90 A;  2F86 B;  5DRV A;  3FZW A;  3OWS A;  4L8O A;  3T8U A;  5D83 A;  2CHC A;  2B1X B;  1E97 A;  1GYB A;  4PEJ A;  3GWR A;  2STD A;  5FW5 A;  1GY6 A;  2YFL B;  4K1V A;  2RGQ A;  3DUK A;  6STD A;  5JPP A;  1OUN A;  3GZX B;  3FF0 A;  4HVN A;  4FCM A;  4Q53 A;  3F7S A;  1GY7 A;  2HMK B;  3EBT A;  4MJD A;  5IG3 A;  1ASK A;  3S5C A;  4R9K A;  1WQL B;  3B4P A;  3ROB A;  5STD A;  4RZM A;  4HM2 B;  3G0K A;  3H3H A;  3RGR A;  3MSO A;  3SOA A;  5AI1 A;  2XR8 B;  3ECF A; 
#chains in the Genus database with same CATH topology
 2J8X B;  3FKA A;  2FNQ A;  1I2E A;  1WMN A;  1M1K 4;  1IQ8 A;  4J5G A;  1BNI A;  3KE7 A;  1DYU A;  2SBL A;  4RNT A;  1QVG 2;  1VQ9 3;  4EV2 A;  5AEU B;  2AAE A;  4U13 A;  1WNH A;  1W01 A;  1HZ1 A;  4FMC A;  4IIA A;  1IV9 A;  1UUV B;  4WYK B;  1Q7Y 4;  4WP5 A;  2CWU A;  1W6Y A;  1S72 3;  1LOX A;  2CFD A;  2H0H A;  2W56 A;  1MOL A;  3BB9 A;  3STD A;  5IEN A;  5CF2 A;  3X40 A;  4LEH A;  5G1L A;  3OW2 2;  1X1W A;  1OGZ A;  4O02 B;  2CFW A;  1JNQ A;  2UX0 A;  2YFJ B;  3MG3 A;  3UL6 A;  1RSN A;  1YNV X;  1GY5 A;  1OCV A;  1RN1 A;  2HMN B;  3G16 A;  5D82 A;  4H3U A;  3AMO A;  4AEQ A;  8RNT A;  1BVI A;  1FUW A;  1UI7 A;  3BNC A;  3D9R A;  9RNT A;  3X41 A;  3T8N A;  3ZFZ A;  2QEX 3;  3UL5 A;  4HYZ A;  1NO3 A;  2GXF A;  3CCR 3;  3B7C A;  1B2S A;  1FGQ A;  1X1Y A;  3NQZ A;  1BNE A;  1W7C A;  2XGN A;  3O8Y A;  6RNT A;  3UB1 A;  2XEP A;  2IMJ A;  3F7X A;  3FGY A;  3Q1C A;  1RRL A;  2RSX A;  5CLK A;  5DRE A;  3DGM A;  2BIR A;  5G2G A;  1N5P A;  3DH2 A;  2O9U X;  1NB3 I;  2MC8 A;  1R4C A;  1DE3 A;  5IG0 A;  4IPB A;  4OVM A;  1JZO A;  1AR0 A;  3OXA A;  3DGN A;  2IA7 A;  2OWP A;  3NHX A;  4LYL B;  2XFS A;  4LMI A;  3NX0 A;  4GL6 A;  3KSE D;  4WYK A;  4JRF A;  6GSP A;  4MMZ B;  3SVA A;  1D6Z A;  2CX0 A;  3GZR A;  4J9A A;  3RDE A;  3WDG B;  1W02 A;  3MKI A;  4KFD A;  2WO0 A;  3NXJ A;  5KP1 A;  1A2K A;  4EC6 A;  5M19 A;  2PZV A;  1NDO B;  2CFL A;  3IMA B;  1A67 A;  4I4K A;  1BU4 A;  3CPO A;  2CKF B;  3WA3 A;  3F8X A;  1U8C B;  4NRE A;  3CXC 2;  4XDW A;  1OHS A;  4O2H A;  1FZU A;  4HM5 B;  3S27 A;  5JBS A;  1IV7 A;  1FUT A;  2GBW B;  1QJG A;  2E2T A;  1BRK A;  1VQ7 3;  3CPW 2;  4BL3 A;  1I70 A;  2QGU A;  4DKI A;  4WHA A;  2CFG A;  2CWV A;  3D4A A;  3E99 A;  3UNL A;  1O7P B;  1DVD A;  1D6U A;  1JN5 B;  1BAO A;  3FLJ A;  5IER A;  4XBT A;  3NM2 A;  2XSO B;  2FXT A;  1J2B A;  1VQK 3;  3VSY A;  1CYV A;  3CME 3;  1CH0 A;  1RGH A;  2Y73 A;  2C4B A;  1B21 A;  1SIH A;  1E3V A;  1OGX A;  1QAL A;  5AIH A;  3WMD A;  3GRD A;  3JUO A;  1JB4 A;  3DGL A;  3AGO A;  4HKV B;  3K7C A;  3PZW A;  1TP6 A;  2M7O A;  1STD A;  7GSP A;  1W2Z A;  1UUG B;  1MWS A;  2BNG A;  4O8S A;  1UCL A;  1UCK A;  3MG1 A;  1BNG A;  1C7H A;  3NBJ A;  3URP A;  1EA2 A;  3CCL 3;  3SYU A;  1O7W B;  4L8P A;  1CQS A;  3OWU A;  4J8T A;  3SED A;  1N8R 4;  1BNR A;  3FSD A;  1UDI I;  1PU4 A;  3G71 3;  3KKG A;  4R9L A;  2GEX A;  1JJ2 2;  4BTW A;  1OHP A;  3DGY A;  3ER7 A;  1RGG A;  3LTC A;  4BU4 A;  3BU4 A;  2HMM B;  5LC6 A;  4XB5 A;  4EYC A;  4KVH A;  5FGO A;  2P0M A;  2YX9 A;  1BSD A;  3DM8 A;  3F40 A;  1RTU A;  4L7K A;  1W00 A;  1JN5 A;  1GOU A;  3M8C A;  1UUW B;  3K0Z A;  2Z76 A;  2W9Q A;  1YHQ 3;  1BRH A;  3CCM 3;  3GZB A;  5BXQ A;  4N6N B;  1RGK A;  1V57 A;  1ZGX A;  2F5M A;  2W9P A;  3FG1 A;  3BIR A;  2HML B;  3EN1 B;  3LML A;  3OV4 A;  1ULI B;  3A5E A;  2BMQ B;  1IT8 A;  3KN4 A;  1MWT A;  3X3X A;  3VF1 A;  2IUJ A;  1O7M B;  5LC7 A;  2B24 B;  1W5Z A;  5GSP A;  3G4S 3;  2QIY A;  3PCS A;  4FMB A;  4ILF A;  5AYS C;  4X2O A;  1BIR A;  3D5I A;  1LVN A;  4N3V A;  3EB8 A;  1W6G A;  1STF I;  3KSP A;  1YJW 3;  1BUQ A;  1TRP A;  1M1X B;  3F8H A;  1WMP A;  5G1K A;  1RRH A;  4O3V A;  1NB5 I;  4HM4 B;  1GSP A;  3IJE B;  1LQG C;  2AAD A;  1HU9 A;  1BNS A;  3CNM A;  3I0Y A;  4QWT A;  3PXM A;  5IEP A;  1FGM A;  1UI8 A;  2HMO B;  4I5Q A;  1YI2 3;  1BSB A;  2GEY A;  2KCD A;  1BGS A;  1FA3 A;  3MG2 A;  1BSC A;  1FW7 A;  2CG1 A;  1TIJ A;  2O3O A;  2OCT A;  3KZT A;  4WWU C;  1G96 A;  1VQL 3;  3NV0 B;  1IVV A;  5AII A;  4LSO A;  4HM3 B;  4HZB B;  2BMO B;  5KP3 A;  1SII A;  1Z1S A;  1VQ6 3;  1K9M 4;  3LZA A;  4EV5 A;  3EJV A;  1JB5 A;  2JQ5 A;  1RDS A;  2CC3 A;  2K0M A;  3UJM A;  1RKY A;  1W6C A;  3N9H A;  4OK0 A;  1GS3 A;  1LOY A;  4KFE A;  2KF3 A;  1T2I A;  3SLU A;  2E2V A;  2GSP A;  5EVH A;  5M1A A;  1AY7 A;  1I3F A;  3K9M C;  2ZA4 A;  1VQ8 3;  1TUH A;  3KFQ C;  1RJO A;  5CK6 A;  3BNB A;  3GSP A;  5ELJ A;  4EW5 A;  3JUQ A;  1TTO A;  4K61 A;  2C11 A;  1CYU A;  1EEJ A;  1VZZ A;  1FYS A;  3H51 A;  3S67 A;  1QMA A;  1ISK A;  2RCD A;  1AVL A;  1MNL A;  3IPT A;  1Q40 B;  2F4Y A;  3EHC A;  2LYX A;  3G8Z A;  4HAA A;  1A2P A;  3KCH A;  1AQZ A;  2CG0 A;  3S29 A;  1RNB A;  1FGO A;  3NBB A;  4N6O B;  2C10 A;  3HX8 A;  4FR9 A;  1S5A A;  5AIF A;  3CCQ 3;  2PNC A;  3EQQ B;  1B2Z A;  1JKG B;  4GB5 A;  1T5Y A;  3V98 A;  3WOD G;  3NV0 A;  1ULJ B;  2CH9 A;  3EE1 A;  4N6V 0;  4X2H A;  2KAA A;  1IK3 A;  1IQX A;  1Y4K A;  2P09 A;  3RGA A;  2INX A;  1AV4 A;  1RHL A;  1FGT A;  4K1U A;  3CD6 3;  3WA2 X;  1SJW A;  2F5W A;  3LT8 A;  1QVF 2;  2IY2 A;  5KP4 A;  1IU7 A;  1K41 A;  2XGL A;  4GSP A;  5JPU A;  4HJL B;  1RCK A;  1RGE A;  2CWT A;  1DMQ A;  1QAF A;  1JRQ A;  2Z7A A;  2HMJ B;  2JDI H;  2KF6 A;  3D5G A;  2OQE C;  7STD A;  2R4I A;  1YGW A;  3JUN A;  3LTA A;  3K63 A;  1RGA A;  2OQE A;  1Q9E A;  3U1W A;  1UCI A;  4HOH A;  1M9G A;  2Z6B A;  1EG9 B;  2SAR A;  3MYT A;  7RNT A;  8CHO A;  3EN8 A;  1LNI A;  2CK3 H;  4LZI A;  1Q40 A;  1GOY A;  4EBG A;  4R80 A;  2K3D A;  5IG5 A;  3N54 B;  3LH4 A;  2OTJ 3;  1VQN 3;  1BNJ A;  3NQY A;  1IDP A;  4MMX B;  1BRI A;  4LGQ A;  1F8N A;  2ZHX B;  2QA4 3;  1NWW A;  4N6L A;  1M90 4;  2F99 A;  1N8Q A;  3G6E 3;  1BSE A;  1JKG A;  1JV2 B;  3K5T A;  2XFT A;  3CCE 3;  1UW1 A;  1JBS A;  5I97 A;  1ZX2 A;  2H0G A;  1CEW I;  3NM7 A;  2CX1 A;  3LT9 A;  1OH0 A;  3JUP A;  4KFF A;  4RNY A;  1QAK A;  2WGO A;  2LQV A;  1BRN L;  3Q3F A;  3MHE A;  1RN4 A;  1G02 A;  3FG4 A;  1YIT 3;  1Q7H A;  1HKX A;  1BNF A;  4ORL A;  2WGQ A;  5HOH A;  3SOY A;  3LOY A;  1SPU A;  4BTX A;  4HM1 B;  2W03 A;  4HM7 B;  1A90 A;  1U5O A;  2I9W A;  1RN7 A;  1BRS A;  2MF7 A;  2RFR A;  3AGN A;  1W2B 2;  3N8B A;  4CJN A;  3WOE B;  3WOF B;  4HM8 B;  1ROA A;  3X3Z A;  1E3R A;  4AKZ A;  5D81 A;  1LNH A;  1ZO2 A;  2GBX B;  1Q81 4;  1KC8 4;  4BTY A;  1VQM 3;  3FH1 A;  3PS8 A;  2BO9 B;  3F14 A;  4HBR A;  2KRT A;  4HZ9 B;  2KF5 A;  2W04 A;  3NBR A;  1D6Y A;  1TFO A;  3DXO A;  1EUI C;  4RNZ A;  1DMN A;  1W4N A;  2UUG C;  1O7G B;  3FG3 A;  4MEI A;  2L4V A;  1MWR A;  1I2G A;  1V58 A;  4J5K A;  2D42 A;  3WHO A;  1YIJ 3;  1PYL A;  1HYF A;  2BMR B;  3JUM A;  2KXG A;  1B20 A;  1RGL A;  1DET A;  3HI7 A;  4KT3 B;  3HIG A;  3KII A;  1KD1 4;  2CW9 A;  3T0U A;  1TJD A;  3OWY A;  3B8L A;  1EQK A;  2P05 A;  1LRA A;  4HM6 B;  4NHF A;  4XDV A;  4XM4 A;  5IEO A;  3NUV A;  1B2X A;  5EQL A;  1TFK A;  1NJI 4;  1IVU A;  1PY3 A;  5IG4 A;  1KWI A;  2XH9 A;  1LQM B;  2GU3 A;  5IW9 A;  3VGN A;  1FUS A;  4OUQ A;  3CU3 A;  4AKY A;  3LTD A;  3GZY B;  3EF8 A;  1RNT A;  5TGN A;  1NU3 A;  2UGI A;  3CNX A;  2Y74 A;  3LXU X;  1VQQ A;  1TU5 A;  2RBI A;  3BND A;  2R41 A;  3PYJ A;  4STD A;  2P0X A;  5EEO A;  1MWU A;  1MGR A;  1KSI A;  1Q42 A;  3I56 3;  4HM0 B;  1GD3 A;  3F9S A;  1YJ9 3;  5CF1 A;  3CCU 3;  3MPH A;  1LOW A;  2V1L A;  5IF6 A;  1BOX A;  3EX9 A;  2ML5 A;  2BT3 A;  1WMO A;  3BLZ A;  3HII A;  3B4O A;  4CCV A;  1JB2 A;  1BSA A;  3EC9 A;  1JBT A;  3U97 A;  4CDL A;  1YJN 3;  1WTH A;  3QRD A;  1RLS A;  4FCZ A;  5A0O B;  1GD4 A;  1OF5 B;  4XBX A;  1G0T A;  1N5H A;  3RNT A;  1OPY A;  1B3S A;  3D79 A;  3CCJ 3;  1GMP A;  4G1M B;  3CCS 3;  4R1K A;  3CCV 3;  1RGC A;  1OHO A;  1IVX A;  2K54 A;  3A76 A;  1O7N B;  2BHM A;  4FCJ A;  1ROV A;  1BUJ A;  2Z77 A;  1Q82 4;  2XSH B;  2XRX B;  1UCJ A;  4KZ1 A;  3HK4 A;  2YFI B;  3OX9 A;  5AIG A;  4EXR A;  1N9E A;  3JVC A;  3I55 3;  3V92 A;  2W2C A;  5M18 A;  1IQY A;  4GHO A;  2OTL 3;  4XBY A;  4RBN A;  1B2U A;  3CC2 3;  3SX1 A;  3Q2P A;  3MWZ A;  1RMS A;  1SAR A;  2P38 A;  3X3Y A;  1O7H B;  3S28 A;  1VQ5 3;  3DMC A;  1DMM A;  1PFP A;  2L1S A;  2CFK A;  2F98 A;  1B27 A;  1AVK A;  4H61 A;  5CXO A;  2W6J H;  5BVB A;  1T2H A;  1SQW A;  2A15 A;  5HGR A;  1K8A 4;  4FMA A;  1UGH I;  1LXE A;  1YVB I;  2W0Q A;  1OAC A;  2ZDJ A;  1Q86 4;  3HZP A;  2GU1 A;  3DZL A;  3FF2 A;  3EBY A;  5BU4 A;  3LYG A;  1BRG A;  1OF5 A;  1X1X A;  3WR2 A;  3ZG0 A;  3DGO A;  2WOF A;  4ZM8 A;  3X42 A;  1VQO 3;  1RGF A;  5AEW B;  1UGI A;  3Q90 A;  3J7Y d;  2F86 B;  2OOV C;  5DRV A;  1V74 A;  3AHW A;  2H0I A;  1I8V A;  2IUK A;  1T3B A;  3FZW A;  2HOH A;  2OOV A;  3DY5 A;  4BL2 A;  3OWS A;  4L8O A;  1IYY A;  3T8U A;  1GMR A;  1KQS 2;  5D83 A;  2CHC A;  3ZG5 A;  2B1X B;  3LTB A;  1E97 A;  3FCS B;  3CC7 3;  1GYB A;  3D3L A;  4PEJ A;  3GWR A;  2STD A;  4K90 B;  3QK9 A;  1I2F A;  2Q07 A;  3AHS A;  2KF4 A;  5FW5 A;  1IVW A;  1I0V A;  3CMA 3;  1GY6 A;  1R4Y A;  1MGW A;  2YFL B;  4K1V A;  1DVC A;  1ZS7 A;  2IYJ A;  2RGQ A;  3DUK A;  6STD A;  5JPP A;  1GMQ A;  1VQP 3;  1C54 A;  1OUN A;  3GZX B;  1B2M A;  3GAX A;  1I3I A;  1TRQ A;  1L5G B;  3FF0 A;  2RNT A;  1A2V A;  1BRJ A;  1GOV A;  4MMY B;  3CC4 3;  4HVN A;  1IT7 A;  1YVS A;  2XF3 A;  3PGB A;  1X1U A;  4N6U A;  1YGE A;  4FCM A;  1NNV A;  3HOH A;  4Q53 A;  3F7S A;  1GY7 A;  2D1W A;  4CPK A;  1I0X A;  2HMK B;  3EBT A;  1VQ4 3;  1EKM A;  3PCR A;  4IT7 A;  4MJD A;  5RNT A;  1JZD A;  4FMD A;  1K28 A;  5AYR B;  2CIU A;  5IG3 A;  1ASK A;  3S5C A;  4R9K A;  1WQL B;  3B4P A;  5ELU A;  5BIR A;  3TDG A;  1N9J A;  2W56 B;  4N6T A;  1JBR A;  1BAN A;  3V99 A;  2ML6 A;  2BU4 A;  3ALA A;  2FGT A;  4TX4 A;  5STD A;  3ROB A;  4RZM A;  4N6M A;  3BNE A;  3SXX A;  4WFO A;  4R4K A;  4JF8 A;  4BIR A;  4HM2 B;  2F56 A;  3G0K A;  3H3H A;  3RGR A;  3MSO A;  3AMO B;  2ZL8 A;  4NPB A;  3L0R A;  1K73 4;  1FGR A;  1LOV A;  1US1 A;  3SOA A;  5AI1 A;  2E2U A;  1RCL A;  2WOH A;  2XR8 B;  3ECF A; 
#chains in the Genus database with same CATH homology
 3FKA A;  2FNQ A;  1WMN A;  1M1K 4;  1IQ8 A;  3KE7 A;  1DYU A;  2SBL A;  1QVG 2;  1VQ9 3;  4EV2 A;  5AEU B;  4U13 A;  1WNH A;  1W01 A;  4FMC A;  4IIA A;  1IV9 A;  1UUV B;  4WYK B;  1Q7Y 4;  4WP5 A;  2CWU A;  1W6Y A;  1S72 3;  1LOX A;  2CFD A;  2W56 A;  1MOL A;  3BB9 A;  3STD A;  5IEN A;  5CF2 A;  3X40 A;  4LEH A;  3OW2 2;  1OGZ A;  4O02 B;  2CFW A;  1JNQ A;  2UX0 A;  2YFJ B;  3MG3 A;  3UL6 A;  1GY5 A;  1OCV A;  2HMN B;  3G16 A;  5D82 A;  4AEQ A;  4H3U A;  3AMO A;  1FUW A;  1UI7 A;  3BNC A;  3D9R A;  3X41 A;  3T8N A;  2QEX 3;  3UL5 A;  4HYZ A;  1NO3 A;  2GXF A;  3CCR 3;  3B7C A;  1FGQ A;  3NQZ A;  3O8Y A;  1W7C A;  2XGN A;  3UB1 A;  2XEP A;  2IMJ A;  3F7X A;  3FGY A;  3Q1C A;  1RRL A;  2RSX A;  5CLK A;  5DRE A;  3DGM A;  5G2G A;  1N5P A;  2O9U X;  1NB3 I;  2MC8 A;  1R4C A;  5IG0 A;  4IPB A;  4OVM A;  1AR0 A;  3OXA A;  3DGN A;  2IA7 A;  2OWP A;  3NHX A;  2XFS A;  4LMI A;  3NX0 A;  4GL6 A;  3KSE D;  4WYK A;  4JRF A;  4MMZ B;  3SVA A;  1D6Z A;  3GZR A;  4J9A A;  3RDE A;  3WDG B;  1W02 A;  3MKI A;  4KFD A;  2WO0 A;  3NXJ A;  5KP1 A;  1A2K A;  4EC6 A;  2PZV A;  1NDO B;  2CFL A;  3IMA B;  1A67 A;  4I4K A;  3CPO A;  2CKF B;  3WA3 A;  3F8X A;  1U8C B;  4NRE A;  3CXC 2;  4XDW A;  1OHS A;  4O2H A;  4HM5 B;  3S27 A;  5JBS A;  1IV7 A;  2GBW B;  1VQ7 3;  1QJG A;  2E2T A;  3CPW 2;  2QGU A;  4WHA A;  2CFG A;  2CWV A;  3E99 A;  3UNL A;  1O7P B;  1DVD A;  1D6U A;  1JN5 B;  3FLJ A;  5IER A;  4XBT A;  3NM2 A;  2XSO B;  2FXT A;  1J2B A;  1VQK 3;  3VSY A;  1CYV A;  3CME 3;  2Y73 A;  5AIH A;  1SIH A;  1E3V A;  1OGX A;  1QAL A;  3WMD A;  3GRD A;  3JUO A;  1JB4 A;  3DGL A;  4HKV B;  3K7C A;  3PZW A;  1TP6 A;  2M7O A;  1STD A;  1W2Z A;  2BNG A;  4O8S A;  3MG1 A;  1C7H A;  3NBJ A;  1EA2 A;  3CCL 3;  1O7W B;  4L8P A;  1CQS A;  3OWU A;  4J8T A;  3SED A;  1N8R 4;  3FSD A;  1PU4 A;  3G71 3;  3KKG A;  4R9L A;  2GEX A;  1JJ2 2;  4BTW A;  1OHP A;  3ER7 A;  3LTC A;  2HMM B;  5LC6 A;  4XB5 A;  4EYC A;  4KVH A;  5FGO A;  2P0M A;  2YX9 A;  3DM8 A;  3F40 A;  4L7K A;  1W00 A;  1JN5 A;  3M8C A;  1UUW B;  3K0Z A;  2Z76 A;  2W9Q A;  1YHQ 3;  3CCM 3;  3GZB A;  5BXQ A;  4N6N B;  2W9P A;  3FG1 A;  2HML B;  3EN1 B;  3LML A;  3OV4 A;  1ULI B;  3KN4 A;  2BMQ B;  1IT8 A;  3X3X A;  3VF1 A;  2IUJ A;  1O7M B;  5LC7 A;  2B24 B;  1W5Z A;  3G4S 3;  2QIY A;  3PCS A;  4FMB A;  5AYS C;  4X2O A;  1LVN A;  4N3V A;  3EB8 A;  1W6G A;  1STF I;  3KSP A;  1YJW 3;  1BUQ A;  1M1X B;  3F8H A;  1WMP A;  1RRH A;  4O3V A;  1NB5 I;  4HM4 B;  3IJE B;  1HU9 A;  3CNM A;  3I0Y A;  4QWT A;  3PXM A;  5IEP A;  1FGM A;  1UI8 A;  2HMO B;  1YI2 3;  2GEY A;  2KCD A;  1FA3 A;  3MG2 A;  2CG1 A;  1TIJ A;  2O3O A;  2OCT A;  3KZT A;  4WWU C;  1G96 A;  1VQL 3;  3NV0 B;  1IVV A;  5AII A;  4LSO A;  4HM3 B;  4HZB B;  2BMO B;  5KP3 A;  1SII A;  1Z1S A;  1VQ6 3;  1K9M 4;  3LZA A;  4EV5 A;  3EJV A;  1JB5 A;  2JQ5 A;  2CC3 A;  2K0M A;  3UJM A;  1RKY A;  1W6C A;  3N9H A;  4OK0 A;  1GS3 A;  4KFE A;  3SLU A;  2E2V A;  5EVH A;  3K9M C;  1VQ8 3;  1TUH A;  3KFQ C;  1RJO A;  5CK6 A;  3BNB A;  5ELJ A;  3JUQ A;  4K61 A;  2C11 A;  1VZZ A;  3H51 A;  3S67 A;  1QMA A;  1ISK A;  2RCD A;  1AVL A;  1MNL A;  3IPT A;  1Q40 B;  3EHC A;  2LYX A;  3G8Z A;  2CG0 A;  3S29 A;  1FGO A;  3NBB A;  4N6O B;  2C10 A;  3HX8 A;  4FR9 A;  1S5A A;  5AIF A;  3CCQ 3;  2PNC A;  3EQQ B;  1JKG B;  4GB5 A;  1T5Y A;  3V98 A;  3WOD G;  3NV0 A;  1ULJ B;  2CH9 A;  3EE1 A;  4N6V 0;  4X2H A;  1IK3 A;  1IQX A;  1Y4K A;  2P09 A;  3RGA A;  2INX A;  1AV4 A;  4K1U A;  1FGT A;  3CD6 3;  3WA2 X;  1SJW A;  3LT8 A;  1QVF 2;  5KP4 A;  1IU7 A;  2XGL A;  1K41 A;  5JPU A;  4HJL B;  2Z7A A;  2CWT A;  1DMQ A;  1QAF A;  1JRQ A;  2HMJ B;  2JDI H;  2OQE C;  7STD A;  2R4I A;  3LTA A;  3JUN A;  3K63 A;  2OQE A;  3U1W A;  1M9G A;  2Z6B A;  1EG9 B;  3MYT A;  8CHO A;  3EN8 A;  2CK3 H;  4LZI A;  1Q40 A;  4EBG A;  4R80 A;  5IG5 A;  3N54 B;  3LH4 A;  2OTJ 3;  1VQN 3;  3NQY A;  1IDP A;  4MMX B;  4LGQ A;  1F8N A;  2QA4 3;  1M90 4;  1NWW A;  4N6L A;  2F99 A;  1N8Q A;  3G6E 3;  1JKG A;  1JV2 B;  3K5T A;  2XFT A;  3CCE 3;  1UW1 A;  5I97 A;  1ZX2 A;  3NM7 A;  1CEW I;  4KFF A;  3LT9 A;  1OH0 A;  3JUP A;  4RNY A;  1QAK A;  2WGO A;  2LQV A;  3MHE A;  3FG4 A;  1YIT 3;  1HKX A;  4ORL A;  2WGQ A;  3SOY A;  3LOY A;  1SPU A;  4BTX A;  4HM1 B;  2W03 A;  4HM7 B;  1A90 A;  1U5O A;  2I9W A;  1RN7 A;  1W2B 2;  2MF7 A;  2RFR A;  3N8B A;  3WOE B;  3WOF B;  4HM8 B;  1ROA A;  3X3Z A;  1E3R A;  4AKZ A;  5D81 A;  1LNH A;  1ZO2 A;  2GBX B;  1Q81 4;  1KC8 4;  4BTY A;  1VQM 3;  3FH1 A;  3PS8 A;  2BO9 B;  3F14 A;  4HBR A;  2KRT A;  4HZ9 B;  2W04 A;  3NBR A;  1D6Y A;  1TFO A;  3DXO A;  4RNZ A;  1DMN A;  1W4N A;  1O7G B;  3FG3 A;  4MEI A;  2L4V A;  1Q86 4;  2D42 A;  1YIJ 3;  2BMR B;  3JUM A;  2KXG A;  3HI7 A;  3HIG A;  3KII A;  1KD1 4;  2CW9 A;  3T0U A;  3OWY A;  3B8L A;  1EQK A;  2P05 A;  4HM6 B;  4NHF A;  4XDV A;  4XM4 A;  5IEO A;  3NUV A;  5EQL A;  1NJI 4;  1TFK A;  1IVU A;  5IG4 A;  1KWI A;  2XH9 A;  2GU3 A;  5IW9 A;  3VGN A;  4OUQ A;  3CU3 A;  4AKY A;  3LTD A;  3GZY B;  3EF8 A;  5TGN A;  1NU3 A;  3CNX A;  2Y74 A;  3LXU X;  1TU5 A;  3BND A;  3PYJ A;  4STD A;  2P0X A;  5EEO A;  1Q42 A;  1KSI A;  3I56 3;  4HM0 B;  1GD3 A;  3F9S A;  5CF1 A;  3CCU 3;  3MPH A;  2V1L A;  5IF6 A;  3EX9 A;  2ML5 A;  2BT3 A;  1WMO A;  3BLZ A;  3HII A;  3B4O A;  4CCV A;  1JB2 A;  3EC9 A;  3U97 A;  4CDL A;  1YJN 3;  1WTH A;  3QRD A;  4FCZ A;  5A0O B;  1GD4 A;  1OF5 B;  4XBX A;  3CCJ 3;  1N5H A;  1YJ9 3;  1OPY A;  4G1M B;  3CCS 3;  4R1K A;  3CCV 3;  2K54 A;  1OHO A;  1IVX A;  3A76 A;  1O7N B;  2BHM A;  4FCJ A;  1ROV A;  2Z77 A;  1Q82 4;  2XSH B;  2XRX B;  4KZ1 A;  3HK4 A;  2YFI B;  3OX9 A;  5AIG A;  4EXR A;  1N9E A;  3JVC A;  3I55 3;  3V92 A;  2W2C A;  1IQY A;  2OTL 3;  4XBY A;  4RBN A;  3CC2 3;  3SX1 A;  3Q2P A;  3MWZ A;  2P38 A;  3X3Y A;  1O7H B;  3S28 A;  1VQ5 3;  3DMC A;  1DMM A;  1PFP A;  2CFK A;  2F98 A;  5CXO A;  1AVK A;  4H61 A;  2W6J H;  5BVB A;  1SQW A;  2A15 A;  5HGR A;  1K8A 4;  4FMA A;  1LXE A;  1YVB I;  2W0Q A;  1OAC A;  2ZDJ A;  3HZP A;  2GU1 A;  3DZL A;  3FF2 A;  3EBY A;  3LYG A;  1OF5 A;  4ZM8 A;  3DGO A;  2WOF A;  3X42 A;  1VQO 3;  5AEW B;  3Q90 A;  3J7Y d;  2F86 B;  2OOV C;  5DRV A;  1V74 A;  2IUK A;  3FZW A;  2OOV A;  3DY5 A;  3OWS A;  4L8O A;  3T8U A;  1KQS 2;  5D83 A;  2CHC A;  2B1X B;  3LTB A;  1E97 A;  3FCS B;  3CC7 3;  1GYB A;  3D3L A;  4PEJ A;  3GWR A;  2STD A;  4K90 B;  3QK9 A;  5FW5 A;  2Q07 A;  1IVW A;  3CMA 3;  1GY6 A;  2YFL B;  4K1V A;  1DVC A;  2RGQ A;  3DUK A;  1VQP 3;  6STD A;  5JPP A;  1CYU A;  1OUN A;  3GZX B;  3GAX A;  1L5G B;  3FF0 A;  1A2V A;  4MMY B;  3CC4 3;  4HVN A;  1IT7 A;  2XF3 A;  3PGB A;  4N6U A;  1YGE A;  4FCM A;  4Q53 A;  3F7S A;  1GY7 A;  2D1W A;  2HMK B;  3EBT A;  1VQ4 3;  1EKM A;  3PCR A;  4IT7 A;  4MJD A;  4FMD A;  1K28 A;  5AYR B;  2CIU A;  5IG3 A;  1ASK A;  3S5C A;  4R9K A;  1WQL B;  3B4P A;  5ELU A;  3TDG A;  1N9J A;  2W56 B;  4N6T A;  3V99 A;  2ML6 A;  4TX4 A;  3ALA A;  2FGT A;  5STD A;  3ROB A;  4RZM A;  4N6M A;  3BNE A;  3SXX A;  4WFO A;  4R4K A;  4JF8 A;  4HM2 B;  3G0K A;  3H3H A;  3RGR A;  3MSO A;  3AMO B;  2ZL8 A;  3L0R A;  1K73 4;  1FGR A;  3SOA A;  1US1 A;  5AI1 A;  2E2U A;  2WOH A;  2XR8 B;  3ECF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...