3EC9A

Crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
MRTPYQIVADHYAASDRHDPAAMMADIAPAIEWTEMAGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFKLDALHDAGDTVIGVGRYSGTYRRTGKSFECRVAHVWRVDAGKIVHFEQFTDTLLVAQAMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
total genus 38
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ec9A00
3F9SA 2A15A 4R1KA 2K54A 5IG4A 3K7CA 5AI1A 1DMQA 2QIYA 4MJDA 1GS3A 2BMOB 2XSOB 1W01A 5DRVA 4WP5A 3BLZA 2F99A 3DMCA 3FZWA 3JUMA 4OUQA 4K1VA 5DREA 1NU3A 3DUKA 3UJMA 3OXAA 5CLKA 3MYTA 3WMDA 2Z7AA 5CF1A 4HM1B 5AIGA 2IMJA 5G2GA 3LYGA 4XBTA 5EVHA 4L8PA 4X2OA 3KE7A 5IERA 1K41A 2HMJB 3OWYA 4R9KA 2GBWB 4HM8B 3NV0B 3H51A 3ROBA 4CDLA 3FF0A 1WQLB 5TGNA 2JQ5A 3B4PA 1W00A 1OGZA 4HKVB 3FSDA 3CU3A 5IG5A 2BMQB 3NXJA 2GEYA 1ULIB 5AEUB 1EG9B 3MG1A 7STDA 4WYKA 1O7GB 2B24B 1E97A 4U13A 4HZBB 3OV4A 4J8TA 1JB5A 3F7XA 1TUHA 3DZLA 3FF2A 2W2CA 4LEHA 1S5AA 4L8OA 1ISKA 5IG3A 5KP4A 3EX9A 5IEPA 2QGUA 1SJWA 3RGAA 4GB5A 2BMRB 5BXQA 5AIHA 3MG2A 3T8UA 2YFJB 3F40A 2I9WA 4FCMA 4K1UA 2RCDA 4HM4B 1STDA 1VZZA 1ZO2A 2GEXA 4WWUC 5D83A 3F8HA 3GWRA 4FCJA 2STDA 2GXFA 4H3UA 1OUNA 4HM7B 5IEOA 3NUVA 4XBYA 1GYBA 2HMLB 3NM2A 4HJLB 3STDA 3M8CA 3D9RA 1E3VA 2F86B 3EHCA 3MKIA 3GRDA 4LMIA 3JUQA 1W02A 2F98A 3MHEA 1UUVB 4Q53A 4LGQA 3NBRA 4R9LA 4WYKB 1DMNA 2CHCA 3DM8A 5IG0A 2HMNB 3GZBA 1C7HA 1GY7A 3HX8A 4PEJA 3HZPA 3KSPA 5CK6A 3G16A 4L7KA 1QJGA 5JPUA 5STDA 5D81A 3UNLA 1TP6A 3FKAA 3F8XA 1JB4A 2HMOB 3B8LA 2Z77A 5KP3A 3EBYA 5IF6A 3FGYA 1DMMA 1Q40B 4IIAA 1A2KA 3EC9A 5AEWB 1ZX2A 5AIIA 1BUQA 5IENA 3VGNA 3OWSA 3OWUA 3SOAA 3FLJA 1ASKA 3JUNA 5CF2A 4XDWA 3JUOA 4ORLA 3K0ZA 3LZAA 1Q40A 4HM0B 4HM2B 1O7NB 2CKFB 3EN8A 1NDOB 1O7HB 2HMKB 3T8NA 2BNGA 5CXOA 5KP1A 1OH0A 4HM5B 4XM4A 2UX0A 3G0KA 3VSYA 4J9AA 1OHPA 4I4KA 3EN1B 1W6YA 3S5CA 1JKGB 2R4IA 1HKXA 3SOYA 2OWPA 5FW5A 8CHOA 1OHOA 1AR0A 3MG3A 4X2HA 3KKGA 4KVHA 4HZ9B 3SEDA 4RZMA 2HMMB 3EJVA 1O7PB 4HM6B 1E3RA 1GY5A 3DXOA 2XRXB 3FH1A 3CNMA 1OCVA 1IDPA 3ECFA 2PZVA 2XSHB 3OX9A 1EA2A 1JKGA 4OVMA 1JB2A 1CQSA 3F14A 3GZXB 5AIFA 2RFRA 4XDVA 3G8ZA 4XBXA 4N3VA 3GZRA 5JPPA 4XB5A 1ULJB 3EQQB 3E99A 3ER7A 2YFLB 5HGRA 1OHSA 3KZTA 3I0YA 4STDA 3GZYB 2GBXB 3EBTA 3CNXA 3CPOA 1OF5B 1UUWB 3Q90A 2INXA 3B7CA 1GY6A 3NV0A 1Z1SA 4HM3B 1O7WB 3MSOA 2RGQA 1O7MB 1JN5B 5D82A 3NHXA 1QMAA 3B4OA 1Q42A 5BVBA 1OGXA 3A76A 2Z76A 1U5OA 3BB9A 3H3HA 2B1XB 2XR8B 1OPYA 2YFIB 3IPTA 4HVNA 6STDA 3F7SA 1OF5A 1NWWA 3JUPA 3RGRA 3HK4A 1JN5A 3EF8A
chains in the Genus database with same CATH superfamily
1JBTA 2WO0A 3F9SA 1FA3A 1IVWA 2A15A 3IMAB 4R1KA 2K54A 5IG4A 3NQZA 1RMSA 3K7CA 1IQYA 5AI1A 1DMQA 4AKZA 1KD14 1LNIA 1RGEA 2QIYA 3LT8A 4MJDA 1GS3A 2WGOA 1ZS7A 2YX9A 2BMOB 2XSOB 4BU4A 3DGNA 1W01A 5DRVA 1X1UA 4WP5A 3BLZA 1BRNL 1T2IA 2BU4A 1WTHA 4OK0A 3LTCA 1GOUA 1Q814 1MGWA 3EE1A 3Q1CA 3G6E3 2F99A 1GMPA 4JRFA 1D6ZA 3DH2A 2UGIA 3DMCA 1A2PA 1YVSA 1RRHA 3HI7A 1VQO3 3FZWA 3JUMA 1YI23 4OUQA 4K1VA 2E2VA 2CFDA 1RJOA 2W56A 2L1SA 1Q864 5DREA 1NU3A 1IVVA 1SQWA 3DUKA 3FG3A 2IYJA 5ELJA 2CG1A 3UJMA 2KF5A 3OXAA 3QRDA 1LNHA 5CLKA 3MYTA 2CFKA 3WR2A 1TIJA 3WMDA 2Z7AA 4J5KA 4HM1B 5CF1A 1NB5I 4DKIA 1BSCA 2IMJA 2Q07A 1WMOA 2K3DA 5AIGA 1UCLA 1CYVA 5G2GA 3G4S3 3LYGA 1B20A 1I2EA 4XBTA 2RBIA 2WGQA 3X41A 5G1KA 2FNQA 1ROAA 5EVHA 2ZA4A 4L8PA 1W5ZA 2KXGA 1IV7A 3IJEB 1FGTA 2MC8A 2F5WA 4BL2A 4BL3A 1OACA 3CCR3 2QA43 1YJW3 1GD4A 2Z6BA 4X2OA 4N6MA 3KE7A 5IERA 3WDGB 4EC6A 3DGYA 1K41A 1SARA 2HMJB 1FUSA 1K9M4 4RNTA 2GU3A 3OWYA 2GBWB 4R9KA 2F4YA 2BT3A 4HM8B 4WFOA 2H0GA 3NV0B 4AEQA 1I2GA 3H51A 3LOYA 3ROBA 3WA2X 8RNTA 3KN4A 3EB8A 1BIRA 1NNVA 2W6JH 4CDLA 2R41A 4GHOA 3FF0A 4HOHA 1PY3A 1WQLB 3CCQ3 5TGNA 1UUGB 4CPKA 2V1LA 1VQQA 2JQ5A 1KSIA 3V99A 5IW9A 3B4PA 4J5GA 4K90B 2CG0A 1N5HA 1D6YA 1VQL3 4MMYB 1T3BA 1N8R4 1M1XB 1W00A 1OGZA 1Q9EA 4HKVB 7RNTA 3FSDA 1W6CA 5G1LA 4AKYA 3CU3A 3D4AA 1B21A 1AY7A 5IG5A 1UCIA 1RGAA 2SBLA 2BMQB 3HOHA 3NXJA 2GEYA 1ULIB 5AEUB 1EG9B 1DVCA 3HIIA 1BSEA 3MG1A 4EYCA 1FZUA 7STDA 4WYKA 4N6UA 4LZIA 2H0IA 3NBBA 4FMBA 1O7GB 1QALA 1E97A 2B24B 1FGOA 2K0MA 4MMZB 4U13A 5M1AA 4HZBB 1BNSA 7GSPA 4IT7A 2CWUA 3OV4A 4H61A 4J8TA 1K28A 1BSAA 1JB5A 2H0HA 3F7XA 1VQK3 1RN4A 1MNLA 1IQ8A 4MEIA 1A90A 3DGLA 1IU7A 1TTOA 4HYZA 3ZG0A 1TUHA 3DZLA 1QVG2 2E2UA 3FF2A 2P05A 2GSPA 2W2CA 2W0QA 4LEHA 3LTBA 1UDII 4CJNA 3PGBA 3O8YA 1YNVX 1S5AA 3K5TA 4L8OA 2CWVA 3NQYA 1ISKA 5IG3A 1LOXA 1TJDA 1BNGA 2FXTA 5KP4A 3WOFB 3EX9A 4K61A 5IEPA 2OOVC 2QGUA 1SJWA 1UGIA 2IA7A 1I2FA 2P09A 3RGAA 4GB5A 2KCDA 1B2SA 4EBGA 2ZL8A 2BMRB 1TRQA 2KF4A 2OQEC 1YIJ3 3J7Yd 1DVDA 5BXQA 1RCKA 2KF6A 4ILFA 1TRPA 3PZWA 3UL6A 1FYSA 3KCHA 5AIHA 3MG2A 3SYUA 3T8UA 3PCSA 1IYYA 2YFJB 3BNDA 4HAAA 3F40A 2I9WA 3LT9A 4FCMA 4QWTA 3L0RA 3CC23 1B2ZA 4JF8A 4K1UA 1RNTA 2RCDA 2O9UX 1D6UA 1ROVA 2CH9A 3TDGA 4N6TA 4HM4B 2FGTA 1STDA 4N6OB 2ML6A 1YGWA 1N8QA 2UUGC 1I3FA 1VZZA 1B2UA 1ZO2A 2GEXA 4WWUC 2KAAA 5D83A 3F8HA 4BIRA 3GWRA 4FCJA 2STDA 2PNCA 3DGOA 2GXFA 4H3UA 3GAXA 1MWTA 4NPBA 1RN1A 1SPUA 1X1XA 3LMLA 1OUNA 4HM7B 5IEOA 3NUVA 2W04A 1RGLA 5JPUA 3N9HA 2L4VA 2BHMA 1I8VA 3G713 4XBYA 1WMPA 3LTDA 1GD3A 1GYBA 2HMLB 4BTWA 3NM2A 4HJLB 1BNFA 3STDA 1HYFA 1MWUA 4EV2A 3SVAA 5JBSA 3M8CA 1AVLA 2M7OA 3Q2PA 3CXC2 3D9RA 1E3VA 1BANA 2F86B 1BUJA 3EHCA 4KFEA 3MKIA 1HZ1A 2J8XB 1MOLA 1MWSA 3GRDA 4LMIA 3JUQA 3U1WA 4EXRA 1RGGA 1W02A 5M18A 1V57A 3NM7A 1BSDA 1N9JA 3OW22 2F98A 3MHEA 1L5GB 3N8BA 1KQS2 1VQ43 1UUVB 1BSBA 2ML5A 3WHOA 3CD63 2QEX3 4Q53A 1AV4A 2P38A 4LGQA 1PFPA 2WOHA 1RKYA 1LOVA 3NBRA 4R9LA 4WYKB 1CYUA 1MGRA 4GSPA 2W03A 1DMNA 1K734 4FMAA 2CHCA 3DM8A 3K9MC 1QVF2 5IG0A 9RNTA 2HMNB 3HIGA 3GZBA 1UGHI 1C7HA 1GY7A 5AYSC 3HX8A 4PEJA 1YIT3 1NJI4 1T2HA 1QAKA 1VQ83 3AHWA 3HZPA 4N6NB 3KSPA 3T0UA 5CK6A 4FMDA 3G16A 1M904 4L7KA 1QJGA 1EEJA 2CX0A 3D5GA 4HBRA 1SIIA 2F5MA 3X40A 4CCVA 5LC7A 2AADA 5STDA 3X3YA 4EW5A 5D81A 1W6GA 3BU4A 2XFSA 3PS8A 1ZGXA 3U97A 4LSOA 2LQVA 3UNLA 1STFI 3ZFZA 1TP6A 3FKAA 1BRIA 3F8XA 4KZ1A 3NBJA 2IUJA 1A2VA 1RGCA 1JB4A 1VQ73 3VF1A 2AAEA 2E2TA 2HMOB 5BIRA 1RGFA 1FGRA 4FCZA 4O8SA 1DE3A 5EEOA 4RBNA 4FMCA 3B8LA 4BTXA 2Z77A 3FCSB 4N6LA 1JZOA 5ELUA 5KP3A 3CCM3 1YHQ3 3EBYA 1JZDA 2Y74A 5IF6A 1VQP3 4G1MB 3FGYA 1DMMA 1BRKA 1G96A 1GMQA 2W9PA 3WA3A 1KC84 1Q40B 1JJ22 1CH0A 1BOXA 1NO3A 4IIAA 1VQ63 1SIHA 4IPBA 2XGNA 1IVXA 1TU5A 1A2KA 3EC9A 1I3IA 5AEWB 1RDSA 1FGQA 1ZX2A 2C11A 1M1K4 4N6V0 3UL5A 5AIIA 1BUQA 1DETA 4O2HA 5IENA 1RSNA 1VQN3 3VGNA 3D3LA 3OWSA 4FR9A 1IV9A 2W9QA 2XGLA 3WOEB 3ZG5A 3OWUA 3SOAA 1Q7Y4 3BNEA 3DGMA 3SX1A 1W4NA 3FLJA 2CIUA 1ASKA 3AGOA 1I0XA 3K63A 1NB3I 1BNJA 3JUNA 5CF2A 3CC43 4XDWA 4RNZA 1AVKA 1Y4KA 3JUOA 2SARA 1RRLA 2C10A 1YJ93 3A5EA 4ORLA 2HOHA 3K0ZA 3LZAA 1Q40A 4HM0B 4HM2B 1O7NB 1UCKA 1W7CA 4KT3B 4MMXB 5A0OB 5FGOA 1W2ZA 3D79A 2OTJ3 1G02A 2CKFB 3EN8A 1X1WA 2CW9A 3S27A 1GOYA 1IT8A 1N9EA 1NDOB 2D42A 1UI7A 1O7HB 3QK9A 1B27A 3AMOB 5GSPA 2KF3A 3URPA 1BRGA 1RCLA 2HMKB 3AGNA 3UB1A 1TFKA 3T8NA 1LRAA 1FGMA 1VQM3 3N54B 2BNGA 5CXOA 5KP1A 1FUTA 1OH0A 4HM5B 1JRQA 4XM4A 2IY2A 2UX0A 3G0KA 4NHFA 1BAOA 2GU1A 3CPW2 1BU4A 1MWRA 3S29A 5AYRB 3V92A 3VSYA 1JV2B 2XH9A 4J9AA 2CX1A 1OHPA 1R4CA 1BRHA 4I4KA 1FW7A 1V58A 1UW1A 3AHSA 4O3VA 2KRTA 3EN1B 3KIIA 1PYLA 1W6YA 3S5CA 1JKGB 2R4IA 1HKXA 3KSED 4BTYA 3PCRA 3SOYA 1WMNA 1TFOA 2OWPA 1A67A 5FW5A 2LYXA 3CCU3 1B2XA 8CHOA 4GL6A 1OHOA 1AR0A 3MG3A 5I97A 4X2HA 1RGKA 3FG4A 3KKGA 1RHLA 2O3OA 4EV5A 4WHAA 5RNTA 1EUIC 3LTAA 2XF3A 3LH4A 1YGEA 3Q3FA 4HZ9B 4KVHA 3S67A 2OCTA 3AMOA 4O02B 3SEDA 1RGHA 4RZMA 2RNTA 2HMMB 3DY5A 1N5PA 1O7PB 2WOFA 3EJVA 2C4BA 4RNYA 1GMRA 2IUKA 3SXXA 3CMA3 1GOVA 1E3RA 1GY5A 1I70A 4HM6B 2P0MA 3DXOA 1I0VA 1YJN3 1LQMB 3NX0A 2XRXB 1QAFA 3FH1A 3CNMA 1IDPA 1OCVA 2BO9B 3ECFA 1C54A 1RN7A 2PZVA 2XSHB 3OX9A 1UI8A 1EA2A 1Q7HA 2D1WA 3D5IA 1JKGA 4OVMA 3CCL3 1JB2A 1CQSA 1PU4A 3F14A 3GZXB 5M19A 1IK3A 5AIFA 3CC73 2RFRA 1BRSA 3BNCA 4XDVA 3G8ZA 1X1YA 4XBXA 3KFQC 4N3VA 3GZRA 3S28A 4ZM8A 5JPPA 1GSPA 4XB5A 1ULJB 4R4KA 2ZHXB 3JVCA 3I553 1G0TA 3EQQB 4R80A 1J2BA 3X42A 3RDEA 1RLSA 3E99A 4I5QA 2CWTA 1U8CB 1JBRA 3ER7A 1F8NA 2RSXA 1DYUA 1KWIA 3PYJA 1LOYA 2YFLB 1Q824 5HGRA 3MWZA 6RNTA 2OTL3 1VQ53 1BVIA 2CFWA 1OHSA 3KZTA 3RNTA 3I0YA 4STDA 2CFGA 3GZYB 1IT7A 3BIRA 2BIRA 4TX4A 2GBXB 3EBTA 1UCJA 3CME3 1JBSA 3CNXA 3MPHA 3CPOA 2XFTA 1OF5B 1UUWB 1LQGC 3Q90A 1LXEA 1VQ93 2Y73A 3FG1A 2INXA 3B7CA 2P0XA 1K8A4 1B2MA 1GY6A 3NV0A 1Z1SA 1HU9A 1O7WB 4HM3B 2ZDJA 2CK3H 2RGQA 1O7MB 3MSOA 1JN5B 5D82A 4NREA 2MF7A 5BU4A 3CCS3 3NHXA 2CC3A 5EQLA 3ALAA 1QMAA 3B4OA 3BNBA 1M9GA 5LC6A 3CCV3 1YVBI 1US1A 3PXMA 1Q42A 4KFDA 5BVBA 1IVUA 1WNHA 1BRJA 1OGXA 2Z76A 3A76A 1U5OA 1RNBA 1R4YA 3BB9A 3H3HA 2B1XB 1EQKA 1BNEA 2XR8B 1BNIA 1AQZA 1OPYA 2F56A 1S723 1W2B2 3X3XA 6GSPA 2CFLA 2YFIB 5HOHA 4LYLB 3IPTA 4HVNA 3I563 2XEPA 6STDA 3SLUA 1FUWA 1BGSA 1JNQA 1LVNA 3F7SA 3WODG 1V74A 1CEWI 1EKMA 1T5YA 3GSPA 2OOVA 3V98A 1OF5A 3LXUX 1LOWA 2JDIH 1NWWA 2W56B 1BNRA 3JUPA 3RGRA 3X3ZA 3HK4A 2OQEA 1IQXA 4KFFA 3CCE3 1RTUA 1B3SA 1JN5A 3EF8A 3CCJ3
chains in the Genus database with same CATH topology
2WO0A 3F9SA 1FA3A 1IVWA 2A15A 3IMAB 4R1KA 2K54A 5IG4A 3NQZA 3K7CA 1IQYA 5AI1A 1DMQA 4AKZA 1KD14 2QIYA 3LT8A 4MJDA 1GS3A 2WGOA 2YX9A 2BMOB 2XSOB 3DGNA 1W01A 5DRVA 4WP5A 3BLZA 1WTHA 4OK0A 3LTCA 1Q814 3EE1A 3Q1CA 3G6E3 2F99A 4JRFA 1D6ZA 3DMCA 3HI7A 1RRHA 1VQO3 3FZWA 3JUMA 1YI23 4OUQA 4K1VA 2E2VA 2CFDA 1RJOA 2W56A 1Q864 5DREA 1NU3A 1IVVA 1SQWA 3DUKA 3FG3A 5ELJA 2CG1A 3UJMA 3OXAA 3QRDA 5CLKA 1LNHA 3MYTA 2CFKA 1TIJA 3WMDA 2Z7AA 5CF1A 4HM1B 1NB5I 5AIGA 2IMJA 2Q07A 1WMOA 5G2GA 1CYVA 3G4S3 3LYGA 4XBTA 2WGQA 3X41A 2FNQA 1ROAA 5EVHA 4L8PA 1W5ZA 2KXGA 1IV7A 3IJEB 1FGTA 2MC8A 1OACA 3CCR3 2QA43 1YJW3 1GD4A 2Z6BA 4X2OA 4N6MA 3KE7A 5IERA 3WDGB 4EC6A 1K41A 2HMJB 1K9M4 2GU3A 3OWYA 2GBWB 4R9KA 4WFOA 2BT3A 4HM8B 1YIT3 3NV0B 4AEQA 3CXC2 3H51A 3LOYA 3ROBA 3WA2X 3KN4A 3EB8A 2W6JH 4CDLA 3FF0A 1WQLB 3CCQ3 5TGNA 2V1LA 2JQ5A 1KSIA 3V99A 3B4PA 4K90B 2CG0A 1N5HA 1D6YA 1VQL3 4MMYB 1N8R4 1M1XB 1W00A 1OGZA 4HKVB 3FSDA 1W6CA 4AKYA 3CU3A 5IG5A 2SBLA 2BMQB 3NXJA 2GEYA 1ULIB 5AEUB 1EG9B 1DVCA 3HIIA 3MG1A 4EYCA 7STDA 4WYKA 4N6UA 4LZIA 3NBBA 4FMBA 1O7GB 1QALA 1E97A 2B24B 1FGOA 2K0MA 4MMZB 4U13A 4HZBB 4IT7A 2CWUA 3OV4A 4H61A 4J8TA 1K28A 1JB5A 3F7XA 1VQK3 1MNLA 1A90A 1IQ8A 4MEIA 3DGLA 1IU7A 4HYZA 1TUHA 3DZLA 1QVG2 2E2UA 3FF2A 2P05A 2W2CA 2W0QA 4LEHA 3LTBA 3PGBA 3O8YA 1S5AA 3K5TA 4L8OA 2CWVA 3NQYA 1ISKA 5IG3A 1LOXA 2FXTA 5KP4A 3WOFB 3EX9A 4K61A 5IEPA 2OOVC 2QGUA 1SJWA 2P09A 2IA7A 3RGAA 4GB5A 2KCDA 4EBGA 2ZL8A 2BMRB 2OQEC 1YIJ3 3J7Yd 1DVDA 5BXQA 3PZWA 3UL6A 5AIHA 3MG2A 3T8UA 3PCSA 2YFJB 3BNDA 3F40A 2I9WA 3LT9A 4FCMA 4QWTA 3L0RA 3CC23 4K1UA 4JF8A 2RCDA 2O9UX 1D6UA 1ROVA 2CH9A 3TDGA 4N6TA 4HM4B 2FGTA 1STDA 4N6OB 2ML6A 1N8QA 1VZZA 1ZO2A 2GEXA 4WWUC 5D83A 3F8HA 3GWRA 4FCJA 2STDA 2PNCA 3DGOA 2GXFA 4H3UA 3GAXA 1SPUA 3LMLA 1OUNA 4HM7B 5IEOA 3NUVA 2W04A 3N9HA 2L4VA 2BHMA 3G713 4XBYA 1WMPA 3LTDA 1GD3A 1GYBA 2HMLB 4BTWA 3NM2A 4HJLB 3STDA 5JBSA 4EV2A 3SVAA 3M8CA 1AVLA 2M7OA 3Q2PA 3D9RA 1E3VA 2F86B 3EHCA 4KFEA 3MKIA 1MOLA 3GRDA 4LMIA 3JUQA 3U1WA 4EXRA 1W02A 3NM7A 1N9JA 3OW22 2F98A 3MHEA 1L5GB 3N8BA 1KQS2 1VQ43 1UUVB 3CD63 2ML5A 2QEX3 4Q53A 1AV4A 2P38A 4LGQA 1PFPA 2WOHA 1RKYA 3NBRA 4R9LA 4WYKB 1CYUA 2W03A 1DMNA 1K734 4FMAA 2CHCA 3DM8A 3K9MC 1QVF2 5IG0A 2HMNB 3HIGA 3GZBA 1C7HA 1GY7A 5AYSC 3HX8A 4PEJA 1NJI4 1VQ83 1QAKA 3HZPA 4N6NB 3KSPA 3T0UA 5CK6A 4FMDA 3G16A 1M904 4L7KA 1QJGA 4HBRA 1SIIA 5IW9A 3X40A 4CCVA 5LC7A 5JPUA 5STDA 3X3YA 5D81A 1W6GA 2XFSA 3PS8A 3U97A 4LSOA 2LQVA 3UNLA 1STFI 1TP6A 3FKAA 3F8XA 4KZ1A 3NBJA 2IUJA 1A2VA 1VQ73 1JB4A 3VF1A 2E2TA 2HMOB 1FGRA 4FCZA 4O8SA 5EEOA 4RBNA 4FMCA 3B8LA 4BTXA 2Z77A 3FCSB 4N6LA 5ELUA 5KP3A 3CCM3 1YHQ3 3EBYA 2Y74A 5IF6A 1VQP3 4G1MB 3FGYA 1DMMA 2W9PA 1G96A 3WA3A 1KC84 1JJ22 1Q40B 1NO3A 4IIAA 1VQ63 1SIHA 4IPBA 2XGNA 1IVXA 1TU5A 1A2KA 3EC9A 5AEWB 1FGQA 1ZX2A 2C11A 1M1K4 4N6V0 3UL5A 5AIIA 1BUQA 4O2HA 5IENA 1VQN3 3VGNA 3D3LA 3OWSA 4FR9A 1IV9A 2W9QA 2XGLA 3WOEB 3OWUA 3SOAA 1Q7Y4 3BNEA 3DGMA 3SX1A 1W4NA 3FLJA 2CIUA 1ASKA 3K63A 1NB3I 3JUNA 5CF2A 3CC43 4XDWA 4RNZA 1AVKA 1Y4KA 3JUOA 1RRLA 2C10A 1YJ93 4ORLA 3K0ZA 3LZAA 1Q40A 4HM0B 4HM2B 1O7NB 1W7CA 4MMXB 5A0OB 5FGOA 1W2ZA 2OTJ3 2CKFB 3EN8A 2CW9A 3S27A 1IT8A 1N9EA 1NDOB 2D42A 1UI7A 1O7HB 3QK9A 3AMOB 2HMKB 3UB1A 1TFKA 3T8NA 1FGMA 1VQM3 3N54B 2BNGA 5CXOA 5KP1A 1OH0A 4HM5B 1JRQA 4XM4A 2UX0A 3G0KA 4NHFA 2GU1A 3CPW2 3S29A 5AYRB 3V92A 3VSYA 1JV2B 2XH9A 4J9AA 1OHPA 1R4CA 4I4KA 1UW1A 4O3VA 2KRTA 3EN1B 3KIIA 1W6YA 3S5CA 1JKGB 2R4IA 1HKXA 3KSED 4BTYA 3PCRA 3SOYA 1WMNA 1TFOA 2OWPA 1A67A 5FW5A 2LYXA 3CCU3 8CHOA 4GL6A 1OHOA 1AR0A 3MG3A 5I97A 4X2HA 4EV5A 3KKGA 2O3OA 4WHAA 3LTAA 2XF3A 3LH4A 1YGEA 4HZ9B 4KVHA 3S67A 3SEDA 2OCTA 3AMOA 4O02B 4RZMA 2HMMB 3DY5A 1N5PA 1O7PB 2WOFA 3EJVA 4RNYA 3SXXA 2IUKA 3CMA3 4HM6B 1E3RA 1GY5A 2P0MA 3DXOA 1YJN3 3NX0A 2XRXB 1QAFA 3FH1A 3CNMA 1IDPA 1OCVA 2BO9B 3ECFA 1RN7A 2PZVA 2XSHB 3OX9A 1UI8A 1EA2A 2D1WA 1JKGA 4OVMA 3CCL3 1JB2A 1CQSA 1PU4A 3F14A 3GZXB 1IK3A 5AIFA 3CC73 2RFRA 3BNCA 4XDVA 3G8ZA 4XBXA 3KFQC 4N3VA 3GZRA 3S28A 4ZM8A 5JPPA 4XB5A 1ULJB 4R4KA 3I553 3JVCA 3EQQB 4R80A 1J2BA 3X42A 3RDEA 3E99A 2CWTA 1U8CB 3ER7A 1F8NA 2RSXA 1DYUA 1KWIA 3PYJA 2YFLB 1Q824 5HGRA 3MWZA 2OTL3 1VQ53 2CFWA 1OHSA 3KZTA 3I0YA 4STDA 2CFGA 3GZYB 1IT7A 4TX4A 2GBXB 3EBTA 3CME3 3CNXA 3MPHA 3CPOA 2XFTA 1OF5B 1UUWB 3Q90A 1LXEA 1VQ93 2Y73A 3FG1A 2INXA 3B7CA 2P0XA 1K8A4 1GY6A 3NV0A 1Z1SA 1HU9A 1O7WB 4HM3B 2ZDJA 2CK3H 2RGQA 1O7MB 3MSOA 1JN5B 5D82A 4NREA 2MF7A 3CCS3 3NHXA 2CC3A 5EQLA 3ALAA 1QMAA 3B4OA 3BNBA 1M9GA 5LC6A 3CCV3 1YVBI 1US1A 3PXMA 1Q42A 4KFDA 5BVBA 1IVUA 1OGXA 3A76A 2Z76A 1WNHA 1U5OA 3BB9A 3H3HA 2B1XB 1EQKA 2XR8B 1OPYA 1W2B2 1S723 3X3XA 2CFLA 2YFIB 3IPTA 4HVNA 3I563 2XEPA 6STDA 3SLUA 1FUWA 1JNQA 1LVNA 3F7SA 3WODG 1V74A 1CEWI 1EKMA 1T5YA 2OOVA 3V98A 1OF5A 3LXUX 2JDIH 1NWWA 2W56B 3JUPA 3RGRA 3X3ZA 3HK4A 2OQEA 1IQXA 4KFFA 3CCE3 3FG4A 1JN5A 3EF8A 3CCJ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9S A;  2A15 A;  4R1K A;  2K54 A;  5IG4 A;  3K7C A;  5AI1 A;  1DMQ A;  2QIY A;  4MJD A;  1GS3 A;  2BMO B;  2XSO B;  1W01 A;  5DRV A;  4WP5 A;  3BLZ A;  2F99 A;  3DMC A;  3FZW A;  3JUM A;  4OUQ A;  4K1V A;  5DRE A;  1NU3 A;  3DUK A;  3UJM A;  3OXA A;  5CLK A;  3MYT A;  3WMD A;  2Z7A A;  5CF1 A;  4HM1 B;  5AIG A;  2IMJ A;  5G2G A;  3LYG A;  4XBT A;  5EVH A;  4L8P A;  4X2O A;  3KE7 A;  5IER A;  1K41 A;  2HMJ B;  3OWY A;  4R9K A;  2GBW B;  4HM8 B;  3NV0 B;  3H51 A;  3ROB A;  4CDL A;  3FF0 A;  1WQL B;  5TGN A;  2JQ5 A;  3B4P A;  1W00 A;  1OGZ A;  4HKV B;  3FSD A;  3CU3 A;  5IG5 A;  2BMQ B;  3NXJ A;  2GEY A;  1ULI B;  5AEU B;  1EG9 B;  3MG1 A;  7STD A;  4WYK A;  1O7G B;  2B24 B;  1E97 A;  4U13 A;  4HZB B;  3OV4 A;  4J8T A;  1JB5 A;  3F7X A;  1TUH A;  3DZL A;  3FF2 A;  2W2C A;  4LEH A;  1S5A A;  4L8O A;  1ISK A;  5IG3 A;  5KP4 A;  3EX9 A;  5IEP A;  2QGU A;  1SJW A;  3RGA A;  4GB5 A;  2BMR B;  5BXQ A;  5AIH A;  3MG2 A;  3T8U A;  2YFJ B;  3F40 A;  2I9W A;  4FCM A;  4K1U A;  2RCD A;  4HM4 B;  1STD A;  1VZZ A;  1ZO2 A;  2GEX A;  4WWU C;  5D83 A;  3F8H A;  3GWR A;  4FCJ A;  2STD A;  2GXF A;  4H3U A;  1OUN A;  4HM7 B;  5IEO A;  3NUV A;  4XBY A;  1GYB A;  2HML B;  3NM2 A;  4HJL B;  3STD A;  3M8C A;  3D9R A;  1E3V A;  2F86 B;  3EHC A;  3MKI A;  3GRD A;  4LMI A;  3JUQ A;  1W02 A;  2F98 A;  3MHE A;  1UUV B;  4Q53 A;  4LGQ A;  3NBR A;  4R9L A;  4WYK B;  1DMN A;  2CHC A;  3DM8 A;  5IG0 A;  2HMN B;  3GZB A;  1C7H A;  1GY7 A;  3HX8 A;  4PEJ A;  3HZP A;  3KSP A;  5CK6 A;  3G16 A;  4L7K A;  1QJG A;  5JPU A;  5STD A;  5D81 A;  3UNL A;  1TP6 A;  3FKA A;  3F8X A;  1JB4 A;  2HMO B;  3B8L A;  2Z77 A;  5KP3 A;  3EBY A;  5IF6 A;  3FGY A;  1DMM A;  1Q40 B;  4IIA A;  1A2K A;  3EC9 A;  5AEW B;  1ZX2 A;  5AII A;  1BUQ A;  5IEN A;  3VGN A;  3OWS A;  3OWU A;  3SOA A;  3FLJ A;  1ASK A;  3JUN A;  5CF2 A;  4XDW A;  3JUO A;  4ORL A;  3K0Z A;  3LZA A;  1Q40 A;  4HM0 B;  4HM2 B;  1O7N B;  2CKF B;  3EN8 A;  1NDO B;  1O7H B;  2HMK B;  3T8N A;  2BNG A;  5CXO A;  5KP1 A;  1OH0 A;  4HM5 B;  4XM4 A;  2UX0 A;  3G0K A;  3VSY A;  4J9A A;  1OHP A;  4I4K A;  3EN1 B;  1W6Y A;  3S5C A;  1JKG B;  2R4I A;  1HKX A;  3SOY A;  2OWP A;  5FW5 A;  8CHO A;  1OHO A;  1AR0 A;  3MG3 A;  4X2H A;  3KKG A;  4KVH A;  4HZ9 B;  3SED A;  4RZM A;  2HMM B;  3EJV A;  1O7P B;  4HM6 B;  1E3R A;  1GY5 A;  3DXO A;  2XRX B;  3FH1 A;  3CNM A;  1OCV A;  1IDP A;  3ECF A;  2PZV A;  2XSH B;  3OX9 A;  1EA2 A;  1JKG A;  4OVM A;  1JB2 A;  1CQS A;  3F14 A;  3GZX B;  5AIF A;  2RFR A;  4XDV A;  3G8Z A;  4XBX A;  4N3V A;  3GZR A;  5JPP A;  4XB5 A;  1ULJ B;  3EQQ B;  3E99 A;  3ER7 A;  2YFL B;  5HGR A;  1OHS A;  3KZT A;  3I0Y A;  4STD A;  3GZY B;  2GBX B;  3EBT A;  3CNX A;  3CPO A;  1OF5 B;  1UUW B;  3Q90 A;  2INX A;  3B7C A;  1GY6 A;  3NV0 A;  1Z1S A;  4HM3 B;  1O7W B;  3MSO A;  2RGQ A;  1O7M B;  1JN5 B;  5D82 A;  3NHX A;  1QMA A;  3B4O A;  1Q42 A;  5BVB A;  1OGX A;  3A76 A;  2Z76 A;  1U5O A;  3BB9 A;  3H3H A;  2B1X B;  2XR8 B;  1OPY A;  2YFI B;  3IPT A;  4HVN A;  6STD A;  3F7S A;  1OF5 A;  1NWW A;  3JUP A;  3RGR A;  3HK4 A;  1JN5 A;  3EF8 A; 
#chains in the Genus database with same CATH topology
 1JBT A;  2WO0 A;  3F9S A;  1FA3 A;  1IVW A;  2A15 A;  3IMA B;  4R1K A;  2K54 A;  5IG4 A;  3NQZ A;  1RMS A;  3K7C A;  1IQY A;  5AI1 A;  1DMQ A;  4AKZ A;  1KD1 4;  1LNI A;  1RGE A;  2QIY A;  3LT8 A;  4MJD A;  1GS3 A;  2WGO A;  1ZS7 A;  2YX9 A;  2BMO B;  2XSO B;  4BU4 A;  3DGN A;  1W01 A;  5DRV A;  1X1U A;  4WP5 A;  3BLZ A;  1BRN L;  1T2I A;  2BU4 A;  1WTH A;  4OK0 A;  3LTC A;  1GOU A;  1Q81 4;  1MGW A;  3EE1 A;  3Q1C A;  3G6E 3;  2F99 A;  1GMP A;  4JRF A;  1D6Z A;  3DH2 A;  2UGI A;  3DMC A;  1A2P A;  1YVS A;  1RRH A;  3HI7 A;  1VQO 3;  3FZW A;  3JUM A;  1YI2 3;  4OUQ A;  4K1V A;  2E2V A;  2CFD A;  1RJO A;  2W56 A;  2L1S A;  1Q86 4;  5DRE A;  1NU3 A;  1IVV A;  1SQW A;  3DUK A;  3FG3 A;  2IYJ A;  5ELJ A;  2CG1 A;  3UJM A;  2KF5 A;  3OXA A;  3QRD A;  1LNH A;  5CLK A;  3MYT A;  2CFK A;  3WR2 A;  1TIJ A;  3WMD A;  2Z7A A;  4J5K A;  4HM1 B;  5CF1 A;  1NB5 I;  4DKI A;  1BSC A;  2IMJ A;  2Q07 A;  1WMO A;  2K3D A;  5AIG A;  1UCL A;  1CYV A;  5G2G A;  3G4S 3;  3LYG A;  1B20 A;  1I2E A;  4XBT A;  2RBI A;  2WGQ A;  3X41 A;  5G1K A;  2FNQ A;  1ROA A;  5EVH A;  2ZA4 A;  4L8P A;  1W5Z A;  2KXG A;  1IV7 A;  3IJE B;  1FGT A;  2MC8 A;  2F5W A;  4BL2 A;  4BL3 A;  1OAC A;  3CCR 3;  2QA4 3;  1YJW 3;  1GD4 A;  2Z6B A;  4X2O A;  4N6M A;  3KE7 A;  5IER A;  3WDG B;  4EC6 A;  3DGY A;  1K41 A;  1SAR A;  2HMJ B;  1FUS A;  1K9M 4;  4RNT A;  2GU3 A;  3OWY A;  2GBW B;  4R9K A;  2F4Y A;  2BT3 A;  4HM8 B;  4WFO A;  2H0G A;  3NV0 B;  4AEQ A;  1I2G A;  3H51 A;  3LOY A;  3ROB A;  3WA2 X;  8RNT A;  3KN4 A;  3EB8 A;  1BIR A;  1NNV A;  2W6J H;  4CDL A;  2R41 A;  4GHO A;  3FF0 A;  4HOH A;  1PY3 A;  1WQL B;  3CCQ 3;  5TGN A;  1UUG B;  4CPK A;  2V1L A;  1VQQ A;  2JQ5 A;  1KSI A;  3V99 A;  5IW9 A;  3B4P A;  4J5G A;  4K90 B;  2CG0 A;  1N5H A;  1D6Y A;  1VQL 3;  4MMY B;  1T3B A;  1N8R 4;  1M1X B;  1W00 A;  1OGZ A;  1Q9E A;  4HKV B;  7RNT A;  3FSD A;  1W6C A;  5G1L A;  4AKY A;  3CU3 A;  3D4A A;  1B21 A;  1AY7 A;  5IG5 A;  1UCI A;  1RGA A;  2SBL A;  2BMQ B;  3HOH A;  3NXJ A;  2GEY A;  1ULI B;  5AEU B;  1EG9 B;  1DVC A;  3HII A;  1BSE A;  3MG1 A;  4EYC A;  1FZU A;  7STD A;  4WYK A;  4N6U A;  4LZI A;  2H0I A;  3NBB A;  4FMB A;  1O7G B;  1QAL A;  1E97 A;  2B24 B;  1FGO A;  2K0M A;  4MMZ B;  4U13 A;  5M1A A;  4HZB B;  1BNS A;  7GSP A;  4IT7 A;  2CWU A;  3OV4 A;  4H61 A;  4J8T A;  1K28 A;  1BSA A;  1JB5 A;  2H0H A;  3F7X A;  1VQK 3;  1RN4 A;  1MNL A;  1IQ8 A;  4MEI A;  1A90 A;  3DGL A;  1IU7 A;  1TTO A;  4HYZ A;  3ZG0 A;  1TUH A;  3DZL A;  1QVG 2;  2E2U A;  3FF2 A;  2P05 A;  2GSP A;  2W2C A;  2W0Q A;  4LEH A;  3LTB A;  1UDI I;  4CJN A;  3PGB A;  3O8Y A;  1YNV X;  1S5A A;  3K5T A;  4L8O A;  2CWV A;  3NQY A;  1ISK A;  5IG3 A;  1LOX A;  1TJD A;  1BNG A;  2FXT A;  5KP4 A;  3WOF B;  3EX9 A;  4K61 A;  5IEP A;  2OOV C;  2QGU A;  1SJW A;  1UGI A;  2IA7 A;  1I2F A;  2P09 A;  3RGA A;  4GB5 A;  2KCD A;  1B2S A;  4EBG A;  2ZL8 A;  2BMR B;  1TRQ A;  2KF4 A;  2OQE C;  1YIJ 3;  3J7Y d;  1DVD A;  5BXQ A;  1RCK A;  2KF6 A;  4ILF A;  1TRP A;  3PZW A;  3UL6 A;  1FYS A;  3KCH A;  5AIH A;  3MG2 A;  3SYU A;  3T8U A;  3PCS A;  1IYY A;  2YFJ B;  3BND A;  4HAA A;  3F40 A;  2I9W A;  3LT9 A;  4FCM A;  4QWT A;  3L0R A;  3CC2 3;  1B2Z A;  4JF8 A;  4K1U A;  1RNT A;  2RCD A;  2O9U X;  1D6U A;  1ROV A;  2CH9 A;  3TDG A;  4N6T A;  4HM4 B;  2FGT A;  1STD A;  4N6O B;  2ML6 A;  1YGW A;  1N8Q A;  2UUG C;  1I3F A;  1VZZ A;  1B2U A;  1ZO2 A;  2GEX A;  4WWU C;  2KAA A;  5D83 A;  3F8H A;  4BIR A;  3GWR A;  4FCJ A;  2STD A;  2PNC A;  3DGO A;  2GXF A;  4H3U A;  3GAX A;  1MWT A;  4NPB A;  1RN1 A;  1SPU A;  1X1X A;  3LML A;  1OUN A;  4HM7 B;  5IEO A;  3NUV A;  2W04 A;  1RGL A;  5JPU A;  3N9H A;  2L4V A;  2BHM A;  1I8V A;  3G71 3;  4XBY A;  1WMP A;  3LTD A;  1GD3 A;  1GYB A;  2HML B;  4BTW A;  3NM2 A;  4HJL B;  1BNF A;  3STD A;  1HYF A;  1MWU A;  4EV2 A;  3SVA A;  5JBS A;  3M8C A;  1AVL A;  2M7O A;  3Q2P A;  3CXC 2;  3D9R A;  1E3V A;  1BAN A;  2F86 B;  1BUJ A;  3EHC A;  4KFE A;  3MKI A;  1HZ1 A;  2J8X B;  1MOL A;  1MWS A;  3GRD A;  4LMI A;  3JUQ A;  3U1W A;  4EXR A;  1RGG A;  1W02 A;  5M18 A;  1V57 A;  3NM7 A;  1BSD A;  1N9J A;  3OW2 2;  2F98 A;  3MHE A;  1L5G B;  3N8B A;  1KQS 2;  1VQ4 3;  1UUV B;  1BSB A;  2ML5 A;  3WHO A;  3CD6 3;  2QEX 3;  4Q53 A;  1AV4 A;  2P38 A;  4LGQ A;  1PFP A;  2WOH A;  1RKY A;  1LOV A;  3NBR A;  4R9L A;  4WYK B;  1CYU A;  1MGR A;  4GSP A;  2W03 A;  1DMN A;  1K73 4;  4FMA A;  2CHC A;  3DM8 A;  3K9M C;  1QVF 2;  5IG0 A;  9RNT A;  2HMN B;  3HIG A;  3GZB A;  1UGH I;  1C7H A;  1GY7 A;  5AYS C;  3HX8 A;  4PEJ A;  1YIT 3;  1NJI 4;  1T2H A;  1QAK A;  1VQ8 3;  3AHW A;  3HZP A;  4N6N B;  3KSP A;  3T0U A;  5CK6 A;  4FMD A;  3G16 A;  1M90 4;  4L7K A;  1QJG A;  1EEJ A;  2CX0 A;  3D5G A;  4HBR A;  1SII A;  2F5M A;  3X40 A;  4CCV A;  5LC7 A;  2AAD A;  5STD A;  3X3Y A;  4EW5 A;  5D81 A;  1W6G A;  3BU4 A;  2XFS A;  3PS8 A;  1ZGX A;  3U97 A;  4LSO A;  2LQV A;  3UNL A;  1STF I;  3ZFZ A;  1TP6 A;  3FKA A;  1BRI A;  3F8X A;  4KZ1 A;  3NBJ A;  2IUJ A;  1A2V A;  1RGC A;  1JB4 A;  1VQ7 3;  3VF1 A;  2AAE A;  2E2T A;  2HMO B;  5BIR A;  1RGF A;  1FGR A;  4FCZ A;  4O8S A;  1DE3 A;  5EEO A;  4RBN A;  4FMC A;  3B8L A;  4BTX A;  2Z77 A;  3FCS B;  4N6L A;  1JZO A;  5ELU A;  5KP3 A;  3CCM 3;  1YHQ 3;  3EBY A;  1JZD A;  2Y74 A;  5IF6 A;  1VQP 3;  4G1M B;  3FGY A;  1DMM A;  1BRK A;  1G96 A;  1GMQ A;  2W9P A;  3WA3 A;  1KC8 4;  1Q40 B;  1JJ2 2;  1CH0 A;  1BOX A;  1NO3 A;  4IIA A;  1VQ6 3;  1SIH A;  4IPB A;  2XGN A;  1IVX A;  1TU5 A;  1A2K A;  3EC9 A;  1I3I A;  5AEW B;  1RDS A;  1FGQ A;  1ZX2 A;  2C11 A;  1M1K 4;  4N6V 0;  3UL5 A;  5AII A;  1BUQ A;  1DET A;  4O2H A;  5IEN A;  1RSN A;  1VQN 3;  3VGN A;  3D3L A;  3OWS A;  4FR9 A;  1IV9 A;  2W9Q A;  2XGL A;  3WOE B;  3ZG5 A;  3OWU A;  3SOA A;  1Q7Y 4;  3BNE A;  3DGM A;  3SX1 A;  1W4N A;  3FLJ A;  2CIU A;  1ASK A;  3AGO A;  1I0X A;  3K63 A;  1NB3 I;  1BNJ A;  3JUN A;  5CF2 A;  3CC4 3;  4XDW A;  4RNZ A;  1AVK A;  1Y4K A;  3JUO A;  2SAR A;  1RRL A;  2C10 A;  1YJ9 3;  3A5E A;  4ORL A;  2HOH A;  3K0Z A;  3LZA A;  1Q40 A;  4HM0 B;  4HM2 B;  1O7N B;  1UCK A;  1W7C A;  4KT3 B;  4MMX B;  5A0O B;  5FGO A;  1W2Z A;  3D79 A;  2OTJ 3;  1G02 A;  2CKF B;  3EN8 A;  1X1W A;  2CW9 A;  3S27 A;  1GOY A;  1IT8 A;  1N9E A;  1NDO B;  2D42 A;  1UI7 A;  1O7H B;  3QK9 A;  1B27 A;  3AMO B;  5GSP A;  2KF3 A;  3URP A;  1BRG A;  1RCL A;  2HMK B;  3AGN A;  3UB1 A;  1TFK A;  3T8N A;  1LRA A;  1FGM A;  1VQM 3;  3N54 B;  2BNG A;  5CXO A;  5KP1 A;  1FUT A;  1OH0 A;  4HM5 B;  1JRQ A;  4XM4 A;  2IY2 A;  2UX0 A;  3G0K A;  4NHF A;  1BAO A;  2GU1 A;  3CPW 2;  1BU4 A;  1MWR A;  3S29 A;  5AYR B;  3V92 A;  3VSY A;  1JV2 B;  2XH9 A;  4J9A A;  2CX1 A;  1OHP A;  1R4C A;  1BRH A;  4I4K A;  1FW7 A;  1V58 A;  1UW1 A;  3AHS A;  4O3V A;  2KRT A;  3EN1 B;  3KII A;  1PYL A;  1W6Y A;  3S5C A;  1JKG B;  2R4I A;  1HKX A;  3KSE D;  4BTY A;  3PCR A;  3SOY A;  1WMN A;  1TFO A;  2OWP A;  1A67 A;  5FW5 A;  2LYX A;  3CCU 3;  1B2X A;  8CHO A;  4GL6 A;  1OHO A;  1AR0 A;  3MG3 A;  5I97 A;  4X2H A;  1RGK A;  3FG4 A;  3KKG A;  1RHL A;  2O3O A;  4EV5 A;  4WHA A;  5RNT A;  1EUI C;  3LTA A;  2XF3 A;  3LH4 A;  1YGE A;  3Q3F A;  4HZ9 B;  4KVH A;  3S67 A;  2OCT A;  3AMO A;  4O02 B;  3SED A;  1RGH A;  4RZM A;  2RNT A;  2HMM B;  3DY5 A;  1N5P A;  1O7P B;  2WOF A;  3EJV A;  2C4B A;  4RNY A;  1GMR A;  2IUK A;  3SXX A;  3CMA 3;  1GOV A;  1E3R A;  1GY5 A;  1I70 A;  4HM6 B;  2P0M A;  3DXO A;  1I0V A;  1YJN 3;  1LQM B;  3NX0 A;  2XRX B;  1QAF A;  3FH1 A;  3CNM A;  1IDP A;  1OCV A;  2BO9 B;  3ECF A;  1C54 A;  1RN7 A;  2PZV A;  2XSH B;  3OX9 A;  1UI8 A;  1EA2 A;  1Q7H A;  2D1W A;  3D5I A;  1JKG A;  4OVM A;  3CCL 3;  1JB2 A;  1CQS A;  1PU4 A;  3F14 A;  3GZX B;  5M19 A;  1IK3 A;  5AIF A;  3CC7 3;  2RFR A;  1BRS A;  3BNC A;  4XDV A;  3G8Z A;  1X1Y A;  4XBX A;  3KFQ C;  4N3V A;  3GZR A;  3S28 A;  4ZM8 A;  5JPP A;  1GSP A;  4XB5 A;  1ULJ B;  4R4K A;  2ZHX B;  3JVC A;  3I55 3;  1G0T A;  3EQQ B;  4R80 A;  1J2B A;  3X42 A;  3RDE A;  1RLS A;  3E99 A;  4I5Q A;  2CWT A;  1U8C B;  1JBR A;  3ER7 A;  1F8N A;  2RSX A;  1DYU A;  1KWI A;  3PYJ A;  1LOY A;  2YFL B;  1Q82 4;  5HGR A;  3MWZ A;  6RNT A;  2OTL 3;  1VQ5 3;  1BVI A;  2CFW A;  1OHS A;  3KZT A;  3RNT A;  3I0Y A;  4STD A;  2CFG A;  3GZY B;  1IT7 A;  3BIR A;  2BIR A;  4TX4 A;  2GBX B;  3EBT A;  1UCJ A;  3CME 3;  1JBS A;  3CNX A;  3MPH A;  3CPO A;  2XFT A;  1OF5 B;  1UUW B;  1LQG C;  3Q90 A;  1LXE A;  1VQ9 3;  2Y73 A;  3FG1 A;  2INX A;  3B7C A;  2P0X A;  1K8A 4;  1B2M A;  1GY6 A;  3NV0 A;  1Z1S A;  1HU9 A;  1O7W B;  4HM3 B;  2ZDJ A;  2CK3 H;  2RGQ A;  1O7M B;  3MSO A;  1JN5 B;  5D82 A;  4NRE A;  2MF7 A;  5BU4 A;  3CCS 3;  3NHX A;  2CC3 A;  5EQL A;  3ALA A;  1QMA A;  3B4O A;  3BNB A;  1M9G A;  5LC6 A;  3CCV 3;  1YVB I;  1US1 A;  3PXM A;  1Q42 A;  4KFD A;  5BVB A;  1IVU A;  1WNH A;  1BRJ A;  1OGX A;  2Z76 A;  3A76 A;  1U5O A;  1RNB A;  1R4Y A;  3BB9 A;  3H3H A;  2B1X B;  1EQK A;  1BNE A;  2XR8 B;  1BNI A;  1AQZ A;  1OPY A;  2F56 A;  1S72 3;  1W2B 2;  3X3X A;  6GSP A;  2CFL A;  2YFI B;  5HOH A;  4LYL B;  3IPT A;  4HVN A;  3I56 3;  2XEP A;  6STD A;  3SLU A;  1FUW A;  1BGS A;  1JNQ A;  1LVN A;  3F7S A;  3WOD G;  1V74 A;  1CEW I;  1EKM A;  1T5Y A;  3GSP A;  2OOV A;  3V98 A;  1OF5 A;  3LXU X;  1LOW A;  2JDI H;  1NWW A;  2W56 B;  1BNR A;  3JUP A;  3RGR A;  3X3Z A;  3HK4 A;  2OQE A;  1IQX A;  4KFF A;  3CCE 3;  1RTU A;  1B3S A;  1JN5 A;  3EF8 A;  3CCJ 3; 
#chains in the Genus database with same CATH homology
 2WO0 A;  3F9S A;  1FA3 A;  1IVW A;  2A15 A;  3IMA B;  4R1K A;  2K54 A;  5IG4 A;  3NQZ A;  3K7C A;  1IQY A;  5AI1 A;  1DMQ A;  4AKZ A;  1KD1 4;  2QIY A;  3LT8 A;  4MJD A;  1GS3 A;  2WGO A;  2YX9 A;  2BMO B;  2XSO B;  3DGN A;  1W01 A;  5DRV A;  4WP5 A;  3BLZ A;  1WTH A;  4OK0 A;  3LTC A;  1Q81 4;  3EE1 A;  3Q1C A;  3G6E 3;  2F99 A;  4JRF A;  1D6Z A;  3DMC A;  3HI7 A;  1RRH A;  1VQO 3;  3FZW A;  3JUM A;  1YI2 3;  4OUQ A;  4K1V A;  2E2V A;  2CFD A;  1RJO A;  2W56 A;  1Q86 4;  5DRE A;  1NU3 A;  1IVV A;  1SQW A;  3DUK A;  3FG3 A;  5ELJ A;  2CG1 A;  3UJM A;  3OXA A;  3QRD A;  5CLK A;  1LNH A;  3MYT A;  2CFK A;  1TIJ A;  3WMD A;  2Z7A A;  5CF1 A;  4HM1 B;  1NB5 I;  5AIG A;  2IMJ A;  2Q07 A;  1WMO A;  5G2G A;  1CYV A;  3G4S 3;  3LYG A;  4XBT A;  2WGQ A;  3X41 A;  2FNQ A;  1ROA A;  5EVH A;  4L8P A;  1W5Z A;  2KXG A;  1IV7 A;  3IJE B;  1FGT A;  2MC8 A;  1OAC A;  3CCR 3;  2QA4 3;  1YJW 3;  1GD4 A;  2Z6B A;  4X2O A;  4N6M A;  3KE7 A;  5IER A;  3WDG B;  4EC6 A;  1K41 A;  2HMJ B;  1K9M 4;  2GU3 A;  3OWY A;  2GBW B;  4R9K A;  4WFO A;  2BT3 A;  4HM8 B;  1YIT 3;  3NV0 B;  4AEQ A;  3CXC 2;  3H51 A;  3LOY A;  3ROB A;  3WA2 X;  3KN4 A;  3EB8 A;  2W6J H;  4CDL A;  3FF0 A;  1WQL B;  3CCQ 3;  5TGN A;  2V1L A;  2JQ5 A;  1KSI A;  3V99 A;  3B4P A;  4K90 B;  2CG0 A;  1N5H A;  1D6Y A;  1VQL 3;  4MMY B;  1N8R 4;  1M1X B;  1W00 A;  1OGZ A;  4HKV B;  3FSD A;  1W6C A;  4AKY A;  3CU3 A;  5IG5 A;  2SBL A;  2BMQ B;  3NXJ A;  2GEY A;  1ULI B;  5AEU B;  1EG9 B;  1DVC A;  3HII A;  3MG1 A;  4EYC A;  7STD A;  4WYK A;  4N6U A;  4LZI A;  3NBB A;  4FMB A;  1O7G B;  1QAL A;  1E97 A;  2B24 B;  1FGO A;  2K0M A;  4MMZ B;  4U13 A;  4HZB B;  4IT7 A;  2CWU A;  3OV4 A;  4H61 A;  4J8T A;  1K28 A;  1JB5 A;  3F7X A;  1VQK 3;  1MNL A;  1A90 A;  1IQ8 A;  4MEI A;  3DGL A;  1IU7 A;  4HYZ A;  1TUH A;  3DZL A;  1QVG 2;  2E2U A;  3FF2 A;  2P05 A;  2W2C A;  2W0Q A;  4LEH A;  3LTB A;  3PGB A;  3O8Y A;  1S5A A;  3K5T A;  4L8O A;  2CWV A;  3NQY A;  1ISK A;  5IG3 A;  1LOX A;  2FXT A;  5KP4 A;  3WOF B;  3EX9 A;  4K61 A;  5IEP A;  2OOV C;  2QGU A;  1SJW A;  2P09 A;  2IA7 A;  3RGA A;  4GB5 A;  2KCD A;  4EBG A;  2ZL8 A;  2BMR B;  2OQE C;  1YIJ 3;  3J7Y d;  1DVD A;  5BXQ A;  3PZW A;  3UL6 A;  5AIH A;  3MG2 A;  3T8U A;  3PCS A;  2YFJ B;  3BND A;  3F40 A;  2I9W A;  3LT9 A;  4FCM A;  4QWT A;  3L0R A;  3CC2 3;  4K1U A;  4JF8 A;  2RCD A;  2O9U X;  1D6U A;  1ROV A;  2CH9 A;  3TDG A;  4N6T A;  4HM4 B;  2FGT A;  1STD A;  4N6O B;  2ML6 A;  1N8Q A;  1VZZ A;  1ZO2 A;  2GEX A;  4WWU C;  5D83 A;  3F8H A;  3GWR A;  4FCJ A;  2STD A;  2PNC A;  3DGO A;  2GXF A;  4H3U A;  3GAX A;  1SPU A;  3LML A;  1OUN A;  4HM7 B;  5IEO A;  3NUV A;  2W04 A;  3N9H A;  2L4V A;  2BHM A;  3G71 3;  4XBY A;  1WMP A;  3LTD A;  1GD3 A;  1GYB A;  2HML B;  4BTW A;  3NM2 A;  4HJL B;  3STD A;  5JBS A;  4EV2 A;  3SVA A;  3M8C A;  1AVL A;  2M7O A;  3Q2P A;  3D9R A;  1E3V A;  2F86 B;  3EHC A;  4KFE A;  3MKI A;  1MOL A;  3GRD A;  4LMI A;  3JUQ A;  3U1W A;  4EXR A;  1W02 A;  3NM7 A;  1N9J A;  3OW2 2;  2F98 A;  3MHE A;  1L5G B;  3N8B A;  1KQS 2;  1VQ4 3;  1UUV B;  3CD6 3;  2ML5 A;  2QEX 3;  4Q53 A;  1AV4 A;  2P38 A;  4LGQ A;  1PFP A;  2WOH A;  1RKY A;  3NBR A;  4R9L A;  4WYK B;  1CYU A;  2W03 A;  1DMN A;  1K73 4;  4FMA A;  2CHC A;  3DM8 A;  3K9M C;  1QVF 2;  5IG0 A;  2HMN B;  3HIG A;  3GZB A;  1C7H A;  1GY7 A;  5AYS C;  3HX8 A;  4PEJ A;  1NJI 4;  1VQ8 3;  1QAK A;  3HZP A;  4N6N B;  3KSP A;  3T0U A;  5CK6 A;  4FMD A;  3G16 A;  1M90 4;  4L7K A;  1QJG A;  4HBR A;  1SII A;  5IW9 A;  3X40 A;  4CCV A;  5LC7 A;  5JPU A;  5STD A;  3X3Y A;  5D81 A;  1W6G A;  2XFS A;  3PS8 A;  3U97 A;  4LSO A;  2LQV A;  3UNL A;  1STF I;  1TP6 A;  3FKA A;  3F8X A;  4KZ1 A;  3NBJ A;  2IUJ A;  1A2V A;  1VQ7 3;  1JB4 A;  3VF1 A;  2E2T A;  2HMO B;  1FGR A;  4FCZ A;  4O8S A;  5EEO A;  4RBN A;  4FMC A;  3B8L A;  4BTX A;  2Z77 A;  3FCS B;  4N6L A;  5ELU A;  5KP3 A;  3CCM 3;  1YHQ 3;  3EBY A;  2Y74 A;  5IF6 A;  1VQP 3;  4G1M B;  3FGY A;  1DMM A;  2W9P A;  1G96 A;  3WA3 A;  1KC8 4;  1JJ2 2;  1Q40 B;  1NO3 A;  4IIA A;  1VQ6 3;  1SIH A;  4IPB A;  2XGN A;  1IVX A;  1TU5 A;  1A2K A;  3EC9 A;  5AEW B;  1FGQ A;  1ZX2 A;  2C11 A;  1M1K 4;  4N6V 0;  3UL5 A;  5AII A;  1BUQ A;  4O2H A;  5IEN A;  1VQN 3;  3VGN A;  3D3L A;  3OWS A;  4FR9 A;  1IV9 A;  2W9Q A;  2XGL A;  3WOE B;  3OWU A;  3SOA A;  1Q7Y 4;  3BNE A;  3DGM A;  3SX1 A;  1W4N A;  3FLJ A;  2CIU A;  1ASK A;  3K63 A;  1NB3 I;  3JUN A;  5CF2 A;  3CC4 3;  4XDW A;  4RNZ A;  1AVK A;  1Y4K A;  3JUO A;  1RRL A;  2C10 A;  1YJ9 3;  4ORL A;  3K0Z A;  3LZA A;  1Q40 A;  4HM0 B;  4HM2 B;  1O7N B;  1W7C A;  4MMX B;  5A0O B;  5FGO A;  1W2Z A;  2OTJ 3;  2CKF B;  3EN8 A;  2CW9 A;  3S27 A;  1IT8 A;  1N9E A;  1NDO B;  2D42 A;  1UI7 A;  1O7H B;  3QK9 A;  3AMO B;  2HMK B;  3UB1 A;  1TFK A;  3T8N A;  1FGM A;  1VQM 3;  3N54 B;  2BNG A;  5CXO A;  5KP1 A;  1OH0 A;  4HM5 B;  1JRQ A;  4XM4 A;  2UX0 A;  3G0K A;  4NHF A;  2GU1 A;  3CPW 2;  3S29 A;  5AYR B;  3V92 A;  3VSY A;  1JV2 B;  2XH9 A;  4J9A A;  1OHP A;  1R4C A;  4I4K A;  1UW1 A;  4O3V A;  2KRT A;  3EN1 B;  3KII A;  1W6Y A;  3S5C A;  1JKG B;  2R4I A;  1HKX A;  3KSE D;  4BTY A;  3PCR A;  3SOY A;  1WMN A;  1TFO A;  2OWP A;  1A67 A;  5FW5 A;  2LYX A;  3CCU 3;  8CHO A;  4GL6 A;  1OHO A;  1AR0 A;  3MG3 A;  5I97 A;  4X2H A;  4EV5 A;  3KKG A;  2O3O A;  4WHA A;  3LTA A;  2XF3 A;  3LH4 A;  1YGE A;  4HZ9 B;  4KVH A;  3S67 A;  3SED A;  2OCT A;  3AMO A;  4O02 B;  4RZM A;  2HMM B;  3DY5 A;  1N5P A;  1O7P B;  2WOF A;  3EJV A;  4RNY A;  3SXX A;  2IUK A;  3CMA 3;  4HM6 B;  1E3R A;  1GY5 A;  2P0M A;  3DXO A;  1YJN 3;  3NX0 A;  2XRX B;  1QAF A;  3FH1 A;  3CNM A;  1IDP A;  1OCV A;  2BO9 B;  3ECF A;  1RN7 A;  2PZV A;  2XSH B;  3OX9 A;  1UI8 A;  1EA2 A;  2D1W A;  1JKG A;  4OVM A;  3CCL 3;  1JB2 A;  1CQS A;  1PU4 A;  3F14 A;  3GZX B;  1IK3 A;  5AIF A;  3CC7 3;  2RFR A;  3BNC A;  4XDV A;  3G8Z A;  4XBX A;  3KFQ C;  4N3V A;  3GZR A;  3S28 A;  4ZM8 A;  5JPP A;  4XB5 A;  1ULJ B;  4R4K A;  3I55 3;  3JVC A;  3EQQ B;  4R80 A;  1J2B A;  3X42 A;  3RDE A;  3E99 A;  2CWT A;  1U8C B;  3ER7 A;  1F8N A;  2RSX A;  1DYU A;  1KWI A;  3PYJ A;  2YFL B;  1Q82 4;  5HGR A;  3MWZ A;  2OTL 3;  1VQ5 3;  2CFW A;  1OHS A;  3KZT A;  3I0Y A;  4STD A;  2CFG A;  3GZY B;  1IT7 A;  4TX4 A;  2GBX B;  3EBT A;  3CME 3;  3CNX A;  3MPH A;  3CPO A;  2XFT A;  1OF5 B;  1UUW B;  3Q90 A;  1LXE A;  1VQ9 3;  2Y73 A;  3FG1 A;  2INX A;  3B7C A;  2P0X A;  1K8A 4;  1GY6 A;  3NV0 A;  1Z1S A;  1HU9 A;  1O7W B;  4HM3 B;  2ZDJ A;  2CK3 H;  2RGQ A;  1O7M B;  3MSO A;  1JN5 B;  5D82 A;  4NRE A;  2MF7 A;  3CCS 3;  3NHX A;  2CC3 A;  5EQL A;  3ALA A;  1QMA A;  3B4O A;  3BNB A;  1M9G A;  5LC6 A;  3CCV 3;  1YVB I;  1US1 A;  3PXM A;  1Q42 A;  4KFD A;  5BVB A;  1IVU A;  1OGX A;  3A76 A;  2Z76 A;  1WNH A;  1U5O A;  3BB9 A;  3H3H A;  2B1X B;  1EQK A;  2XR8 B;  1OPY A;  1W2B 2;  1S72 3;  3X3X A;  2CFL A;  2YFI B;  3IPT A;  4HVN A;  3I56 3;  2XEP A;  6STD A;  3SLU A;  1FUW A;  1JNQ A;  1LVN A;  3F7S A;  3WOD G;  1V74 A;  1CEW I;  1EKM A;  1T5Y A;  2OOV A;  3V98 A;  1OF5 A;  3LXU X;  2JDI H;  1NWW A;  2W56 B;  3JUP A;  3RGR A;  3X3Z A;  3HK4 A;  2OQE A;  1IQX A;  4KFF A;  3CCE 3;  3FG4 A;  1JN5 A;  3EF8 A;  3CCJ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...