3EC9A

Crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
b'MRTPYQIVADHYAASDRHDPAAMMADIAPAIEWTEMAGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFKLDALHDAGDTVIGVGRYSGTYRRTGKSFECRVAHVWRVDAGKIVHFEQFTDTLLVAQAMQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
molecule tags Unknown function
source organism Burkholderia thailandensis e264
publication title Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
total genus 38
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ec9A00
1QJGA 1Q42A 2YFIB 3LZAA 3A76A 1K41A 3EC9A 3GZBA 4HJLB 4CDLA 3OWUA 3MG2A 2YFJB 5EVHA 1OGZA 5JPPA 5AIFA 5D81A 2QGUA 5AIGA 1GY7A 3WMDA 4KVHA 4ORLA 3LYGA 2BMQB 4FCMA 4LMIA 3I0YA 3OWSA 3KE7A 3ROBA 4WYKB 2RCDA 3SOAA 1OPYA 3EBTA 5D83A 1W02A 2HMLB 3T8NA 3EBYA 4HM4B 3EHCA 1ISKA 1JN5A 3B7CA 3H51A 1JB4A 1UUVB 2HMNB 3CNXA 4H3UA 1OGXA 5HGRA 3OV4A 5IEOA 1GY5A 1DMNA 3F9SA 3ECFA 1ASKA 5KP3A 5IG3A 1U5OA 2CHCA 1GYBA 1W00A 2F86B 1EG9B 1O7MB 1TUHA 2UX0A 3FLJA 3HK4A 3JUOA 2BMOB 4U13A 2RFRA 2OWPA 3M8CA 2GXFA 3S5CA 1ULJB 3FGYA 3GZRA 4STDA 5IF6A 4XDVA 4X2OA 5CF2A 4GB5A 3HZPA 2XR8B 3CNMA 1GY6A 1DMMA 4K1UA 5AIHA 4HM1B 2A15A 4MJDA 1OHPA 3F40A 1EA2A 3HX8A 4XBTA 1OHSA 4HVNA 3B4OA 3BLZA 2Z77A 3EQQB 4XBXA 5AEUB 1JB2A 1AR0A 3E99A 3MYTA 4HM6B 3RGAA 3T8UA 3JUQA 5BXQA 1W01A 1CQSA 3EN1B 2HMOB 3KZTA 4HKVB 1OHOA 2INXA 4OUQA 1OF5A 2HMJB 4R9LA 2YFLB 4XBYA 1ZX2A 2Z76A 5STDA 4WWUC 4WP5A 3UJMA 4IIAA 1BUQA 5IG5A 5IENA 2GBWB 3K7CA 1QMAA 3D9RA 5AI1A 3SOYA 1SJWA 1TP6A 3OWYA 3H3HA 1S5AA 5CXOA 1Q40B 3FF0A 4J9AA 4OVMA 3FH1A 1VZZA 3IPTA 4HM0B 3JUNA 3MG1A 5CLKA 1GS3A 3DMCA 1E97A 3EN8A 3OXAA 4L7KA 4L8PA 1JB5A 1A2KA 3GZYB 3FF2A 3NV0B 5KP4A 2GBXB 3DUKA 2B1XB 1IDPA 3FSDA 4HM8B 3ER7A 2R4IA 1DMQA 3DXOA 3NHXA 3NM2A 5AEWB 1NWWA 1OCVA 1E3VA 4R1KA 5D82A 1STDA 5TGNA 2QIYA 3KKGA 3UNLA 4HZ9B 5DREA 6STDA 1JKGB 2W2CA 3MG3A 2HMKB 4R9KA 5KP1A 2Z7AA 3FZWA 3VSYA 4X2HA 3CPOA 4HM3B 2I9WA 4FCJA 5CF1A 5BVBA 5AIIA 1ULIB 5IG0A 3GZXB 5JPUA 5CK6A 5IG4A 3DZLA 1NU3A 3FKAA 2GEXA 3B8LA 3Q90A 4J8TA 3EF8A 8CHOA 1ZO2A 3EJVA 2K54A 2F98A 3F7XA 1O7HB 3GRDA 3NV0A 3JUMA 2XSOB 4HM2B 3SEDA 3NXJA 1Z1SA 2BNGA 3EX9A 2B24B 2XSHB 3F8XA 5IEPA 1HKXA 7STDA 1OF5B 3JUPA 4XB5A 1E3RA 3MSOA 1Q40A 3NUVA 3F8HA 2STDA 3G0KA 1C7HA 3CU3A 3B4PA 5IERA 2CKFB 1JKGA 3BB9A 3NBRA 3STDA 3G16A 4LGQA 1O7PB 1W6YA 4L8OA 2F99A 1O7NB 3F7SA 3G8ZA 5FW5A 5DRVA 2BMRB 2HMMB 1O7GB 2IMJA 3F14A 4I4KA 1WQLB 4PEJA 3GWRA 3DM8A 4Q53A 3MKIA 3RGRA 3K0ZA 4HZBB 4LEHA 1JN5B 2PZVA 2RGQA 3KSPA 4HM7B 1OUNA 2GEYA 1UUWB 2XRXB 4HM5B 2JQ5A 4N3VA 4XM4A 3VGNA 4RZMA 1NDOB 3OX9A 4XDWA 1OH0A 5G2GA 1O7WB 3MHEA 4K1VA 4WYKA
chains in the Genus database with same CATH superfamily
2CH9A 1JZDA 1PYLA 3OWUA 1DYUA 1UI8A 3WMDA 2BMQB 3SLUA 3I0YA 1W2ZA 1I0XA 1RGCA 2RCDA 4N6NB 3NBJA 2HMLB 2XF3A 1OACA 4HM4B 3EHCA 3H51A 3DGNA 1M1K4 1RMSA 1Q824 1JB4A 1TFKA 5IEOA 1GMPA 3HOHA 1GY5A 3F9SA 2CX0A 1UUGB 1BRJA 2CX1A 1BSBA 3MPHA 3X40A 3ALAA 2F86B 3KCHA 3FG1A 1RGHA 3BNDA 3FLJA 3URPA 1KC84 1LXEA 5ELJA 5EQLA 1VQ63 3DGLA 3NBBA 1A2VA 3M8CA 3PYJA 3S5CA 1FUTA 3GZRA 5IF6A 1BANA 2GU1A 3CC43 2D42A 1RN4A 5CF2A 1HYFA 2O3OA 3EB8A 3LTCA 3HZPA 5G1LA 2E2UA 1QALA 9RNTA 2QEX3 1DMMA 4HM1B 2RBIA 3S27A 2RSXA 1RHLA 1T2IA 4XBTA 1V57A 3RNTA 5AEUB 1FGQA 1K28A 1LOYA 1RJOA 1WMPA 3EQQB 3OW22 3MYTA 5KP1A 3RGAA 1IQ8A 2SBLA 1FGMA 2GU3A 4EV2A 2F5WA 2HMOB 4OUQA 4XBXA 3DH2A 4R9LA 2BT3A 4XBYA 2OQEA 2Z76A 2M7OA 3CC73 3UJMA 2YX9A 5IW9A 3LH4A 2GBWB 1IU7A 3D9RA 3K7CA 1JBRA 1AQZA 1SJWA 3FF0A 4EW5A 2ML5A 1VZZA 4KFFA 1NNVA 2V1LA 1GS3A 2C4BA 3EN8A 3OXAA 4L7KA 2J8XB 3K9MC 1JB5A 3X3YA 1A2KA 3GZYB 3FF2A 3DUKA 3PS8A 2B1XB 4LEHA 5AEWB 2CWTA 3NHXA 1UCKA 1E3VA 1MWRA 4J5GA 1A67A 1BSAA 5DREA 1PY3A 1U8CB 1I2FA 3DGOA 1NB5I 2FXTA 2Z7AA 1MGRA 1MGWA 3VSYA 4BL2A 4FCJA 1HU9A 2P09A 5AIIA 1ULIB 5JPUA 5CK6A 3TDGA 1BIRA 1BRGA 3QRDA 3PXMA 2GEXA 1SIHA 3WHOA 4J8TA 3BNBA 8CHOA 1LOWA 1K9M4 3GRDA 3NV0A 3JVCA 3JUMA 1Z1SA 1D6ZA 2UUGC 2B24B 2XSHB 3A5EA 4GSPA 3PCRA 1I2GA 4I5QA 5IEPA 1E3RA 1UCJA 3MSOA 3IJEB 4AKZA 3SX1A 1L5GB 5IERA 1N8R4 1LOXA 5FGOA 1IVXA 3STDA 3NBRA 1Q7Y4 2KF3A 4LGQA 1W6YA 1SQWA 3X3XA 3ZFZA 2KF5A 4FMBA 4R80A 1FUWA 5FW5A 1N9JA 4MMZB 2C11A 1B27A 2HMMB 1O7GB 2CC3A 3F14A 1IK3A 1WQLB 2W03A 3GWRA 5M18A 3RGRA 2BIRA 3CCS3 4NPBA 1AY7A 1NO3A 2IY2A 4LZIA 3HIIA 2OTJ3 4HM5B 2JQ5A 3AMOA 3VGNA 5EEOA 5I97A 3N9HA 4RZMA 5G2GA 1BRNL 5D82A 1ROVA 3MHEA 4K1VA 4XDWA 1Q42A 2W6JH 4NHFA 4CDLA 3EC9A 2WGOA 1I8VA 2CWVA 5JPPA 2YFJB 3BNCA 3KN4A 5AIFA 4KFDA 5D81A 1A2PA 1GMRA 3CME3 2CFKA 1N9EA 2P05A 3LYGA 4LMIA 3OWSA 3KE7A 3SOAA 2CWUA 2UGIA 3G4S3 3WOEB 1W02A 3T8NA 1TIJA 5G1KA 3EBYA 1LQMB 1JN5A 4N6V0 1UUVB 4H3UA 5HGRA 2P0MA 1IT8A 1UGIA 3ECFA 1JV2B 1UGHI 1RRHA 3SYUA 3G6E3 5IG3A 1LNHA 1GYBA 3PGBA 2XGLA 1W00A 3D4AA 1EG9B 1TUHA 2UX0A 3HK4A 2GSPA 1DVCA 3WOFB 1VQ53 4WHAA 2K3DA 2RFRA 2OWPA 3CCV3 2BO9B 2GXFA 2W9QA 2Z6BA 2ZL8A 1TTOA 4X2OA 1S723 3QK9A 2KXGA 1KD14 1WTHA 5AIHA 1W6GA 4MJDA 3F40A 4DKIA 1R4YA 2Y74A 1AVKA 3BLZA 2Z77A 4IPBA 2H0IA 4QWTA 1JB2A 1I3FA 5LC7A 4HM6B 4K61A 3T8UA 1VQK3 1YIT3 1CQSA 3EN1B 3KZTA 4HKVB 4MEIA 1T2HA 2IUJA 1OF5A 2HMJB 3CCR3 1BRKA 2AAEA 1JRQA 1FYSA 1LRAA 5IG5A 5AI1A 4RNTA 3BIRA 3SOYA 1B2ZA 3H3HA 5CXOA 1Q40B 3AGNA 3JUNA 3KSED 3FG3A 1E97A 2R41A 3CCU3 3NV0B 1RGAA 4HM8B 1IDPA 3FSDA 4EV5A 7RNTA 2R4IA 1BNRA 2H0GA 3RDEA 1SPUA 2D1WA 1JZOA 1STDA 4R1KA 2LQVA 3KKGA 4HZ9B 1JKGB 2W2CA 3MG3A 4FMDA 4R9KA 3T0UA 1B2XA 4FCZA 2JDIH 2O9UX 1RN1A 2OOVC 3U1WA 2RNTA 1BNIA 2I9WA 1DVDA 2F4YA 2KAAA 5IG0A 3MWZA 3GZXB 1MWUA 5BVBA 5M19A 1QVF2 1IVUA 5IG4A 3DZLA 1TU5A 2BHMA 1RSNA 4RNYA 3D3LA 3EF8A 3CD63 1I70A 2K54A 1B2UA 1JJ22 3FCSB 1RGKA 2CW9A 3GSPA 1TRQA 2BNGA 3CCE3 1BSCA 4CPKA 3JUPA 4XB5A 4EC6A 3V98A 3WA2X 7STDA 1YHQ3 3G0KA 1QAFA 1FGRA 2Y73A 1JKGA 3BB9A 4N6TA 4L8OA 3CC23 1PU4A 2MF7A 1MWTA 1O7NB 3LOYA 3F7SA 2CFDA 3V99A 4O2HA 1KWIA 1ROAA 2E2TA 2F56A 4CJNA 1I2EA 1RTUA 4AEQA 1RGLA 2XFSA 4PEJA 2KF4A 3D5IA 1Q7HA 3DM8A 3MKIA 4GHOA 4Q53A 4BU4A 1N5PA 2W04A 2CFGA 1EKMA 5M1AA 1JN5B 1V58A 1IQXA 1YVBI 4HM7B 2XRXB 3Q1CA 1IVWA 1BRHA 1TFOA 1YI23 3OX9A 1FW7A 3LTAA 4WYKA 4AKYA 1QJGA 2YFIB 3DY5A 1K41A 3GZBA 1LVNA 1W7CA 3MG2A 4RBNA 1OGZA 3G713 1UCIA 4LYLB 5AIGA 6RNTA 3SXXA 3PZWA 4KVHA 4FCMA 4ORLA 3LXUX 2QA43 3ROBA 1WNHA 2XFTA 3EBTA 4G1MB 4MMYB 5ELUA 3ZG5A 1DE3A 3LT9A 1PFPA 4ZM8A 1YIJ3 3Q2PA 3B7CA 4TX4A 1M9GA 1TRPA 2HMNB 3LT8A 3X41A 1OGXA 4EYCA 3NQZA 4BIRA 5KP3A 3AHSA 4O8SA 3SVAA 1RNTA 5AYRB 2KF6A 3HI7A 1RCKA 2HOHA 2CHCA 1STFI 3L0RA 4HYZA 2W9PA 1C54A 1D6UA 2WGQA 4XDVA 3CCQ3 3WODG 1B20A 2XR8B 1VQ73 3CNMA 3I553 3AMOB 1GY6A 4K1UA 3PCSA 4N6OB 1BGSA 1VQQA 2WOHA 3HX8A 4O3VA 4HVNA 3EE1A 3N54B 5LC6A 1AR0A 3E99A 1HZ1A 3JUQA 1YNVX 1GMQA 1GOVA 5IENA 3BNEA 2YFLB 2K0MA 1T3BA 4WWUC 4WP5A 4IIAA 7GSPA 3D79A 1W6CA 1TP6A 3OWYA 1BVIA 1VQP3 2L1SA 4R4KA 3AGOA 8RNTA 1X1WA 4OVMA 3UL5A 5AYSC 1K8A4 1B2MA 3FH1A 1SIIA 4HM0B 4RNZA 1JBSA 1FGOA 5CLKA 2ZA4A 4L8PA 2E2VA 1BRIA 3CMA3 3X42A 1RDSA 1DMQA 1LQGC 1ZS7A 1NWWA 1OCVA 1UDII 4KT3B 4LSOA 2QIYA 2F5MA 1SARA 5GSPA 3NX0A 1WMOA 2OOVA 1MOLA 1EUIC 1ZGXA 3K63A 3FZWA 3AHWA 1IT7A 4MMXB 1RLSA 1RGEA 2LYXA 3CPOA 4HM3B 4X2HA 1X1YA 5CF1A 1VQN3 1EQKA 1AVLA 1W4NA 2BU4A 2XGNA 1RRLA 3BU4A 1NU3A 1BNGA 1IQYA 3B8LA 2WO0A 1BOXA 1US1A 3EJVA 4OK0A 3F7XA 1O7HB 6GSPA 2WOFA 2XSOB 4HM2B 3SEDA 3NXJA 2FNQA 1R4CA 1FUSA 3K5TA 1I0VA 1RCLA 3X3ZA 1OF5B 2P0XA 2OCTA 2MC8A 4BTWA 3F8HA 4JF8A 3CU3A 1B3SA 3B4PA 2CKFB 4O02B 2OTL3 3V92A 1V74A 5A0OB 3G8ZA 1IV9A 2BMRB 4I4KA 2IUKA 4HBRA 2P38A 1JNQA 2XH9A 4H61A 2PZVA 1CYVA 1T5YA 3KSPA 1RKYA 1QVG2 1OUNA 2C10A 4XM4A 3D5GA 1BNEA 1NDOB 1JBTA 1OH0A 3VF1A 1GD4A 3ZG0A 3LZAA 3CCJ3 4HJLB 1M904 3A76A 1FGTA 1GOYA 5EVHA 2CG0A 3CXC2 1Q864 2QGUA 1WMNA 2AADA 4BL3A 1GY7A 1Q814 2IYJA 4WYKB 1VQ43 1OPYA 5D83A 1W5ZA 1VQ93 1BNSA 1B21A 1ISKA 1GOUA 3DGMA 3CNXA 3OV4A 1DMNA 1TJDA 1ASKA 1YGWA 1U5OA 4BTXA 4K90B 1O7MB 1DETA 1I3IA 3JUOA 4U13A 2BMOB 1BAOA 3J7Yd 2ZDJA 3IMAB 5BIRA 1ULJB 3FGYA 4STDA 1G96A 1CYUA 3LTBA 1IVVA 1RN7A 2KRTA 5RNTA 4GB5A 1BU4A 3GAXA 2CFLA 1VQO3 4KZ1A 2A15A 1OHPA 1EA2A 1OHSA 3B4OA 3LMLA 1EEJA 3S67A 1J2BA 3S29A 5BXQA 3CPW2 1W01A 2OQEC 2W56B 1N8QA 1OHOA 1D6YA 1RGGA 2CFWA 2INXA 2KCDA 4JRFA 1MNLA 1ZX2A 1NB3I 5STDA 1B2SA 1CEWI 4NREA 1YJN3 1CH0A 1G02A 3Q3FA 1BUQA 4EBGA 1QMAA 1UCLA 3U97A 1BSDA 1UW1A 5HOHA 1S5AA 4J9AA 1VQM3 1M1XB 3S28A 1YJ93 1VQL3 1Q9EA 3IPTA 4N6MA 3MG1A 3DGYA 4N6LA 3DMCA 2CK3H 2Q07A 5KP4A 4IT7A 2GBXB 1BNFA 3NQYA 3WDGB 3ER7A 3DXOA 4EXRA 1BUJA 1X1UA 3NM2A 3CCM3 2H0HA 1IYYA 4J5KA 5TGNA 1A90A 3UNLA 6STDA 1BRSA 1BSEA 4GL6A 2HMKB 1RGFA 1IV7A 1YVSA 2CIUA 3CCL3 1F8NA 1LNIA 1N5HA 1K734 1BNJA 2ML6A 2FGTA 3N8BA 4FMCA 4ILFA 1QAKA 3FKAA 3Q90A 2CG1A 1ZO2A 2F98A 4WFOA 1FA3A 1UI7A 1X1XA 1NJI4 3UB1A 1LOVA 3EX9A 3F8XA 2L4VA 2XEPA 1HKXA 4HAAA 1GSPA 1Q40A 3NUVA 2W0QA 2STDA 2PNCA 1C7HA 2SARA 3WR2A 4FMAA 3O8YA 3G16A 1O7PB 1AV4A 2F99A 3LTDA 1GD3A 1YJW3 3WA3A 1VQ83 4CCVA 1FZUA 3NM7A 1Y4KA 3UL6A 5DRVA 4HOHA 2W56A 2IMJA 4BTYA 1YGEA 3KFQC 4N6UA 2IA7A 4FR9A 3HIGA 3K0ZA 1MWSA 4HZBB 1W2B2 2RGQA 1G0TA 2ZHXB 2GEYA 1UUWB 3I563 4N3VA 5JBSA 1RNBA 1KSIA 5BU4A 3KIIA 1O7WB 4KFEA 3FG4A 1KQS2
chains in the Genus database with same CATH topology
2CH9A 3OWUA 1DYUA 1UI8A 3WMDA 2BMQB 3SLUA 3I0YA 1W2ZA 4N6NB 2RCDA 3NBJA 2HMLB 2XF3A 1OACA 4HM4B 3EHCA 3H51A 3DGNA 1M1K4 1Q824 1JB4A 1TFKA 5IEOA 1GY5A 3F9SA 3MPHA 3X40A 3ALAA 2F86B 3FG1A 3FLJA 3BNDA 1KC84 1LXEA 5ELJA 5EQLA 1VQ63 3DGLA 3NBBA 1A2VA 3M8CA 3PYJA 3S5CA 3GZRA 5IF6A 2GU1A 3CC43 2D42A 5CF2A 2O3OA 3EB8A 3LTCA 3HZPA 2E2UA 1QALA 2QEX3 1DMMA 4HM1B 3S27A 2RSXA 4XBTA 3OW22 5AEUB 1FGQA 1K28A 1RJOA 1WMPA 3EQQB 3MYTA 5KP1A 3RGAA 1IQ8A 2SBLA 1FGMA 2GU3A 4EV2A 4XBXA 2HMOB 4OUQA 4XBYA 4R9LA 2BT3A 2OQEA 2Z76A 2M7OA 3CC73 3UJMA 2YX9A 5IW9A 3LH4A 2GBWB 1IU7A 3D9RA 3K7CA 1SJWA 3FF0A 2ML5A 1VZZA 4KFFA 2V1LA 1GS3A 3EN8A 3OXAA 4L7KA 3K9MC 1JB5A 3X3YA 1A2KA 3GZYB 3FF2A 3DUKA 3PS8A 2B1XB 4LEHA 5AEWB 2CWTA 3NHXA 1E3VA 1A67A 5DREA 1U8CB 3DGOA 1NB5I 2FXTA 2Z7AA 3VSYA 4FCJA 1HU9A 2P09A 5AIIA 1ULIB 5JPUA 5CK6A 3TDGA 3QRDA 3PXMA 2GEXA 1SIHA 4J8TA 3BNBA 8CHOA 1K9M4 3GRDA 3NV0A 3JVCA 3JUMA 1Z1SA 1D6ZA 2B24B 2XSHB 3PCRA 5IEPA 1E3RA 3MSOA 4AKZA 3IJEB 3SX1A 1L5GB 5IERA 1N8R4 1LOXA 5FGOA 1IVXA 3STDA 3NBRA 1Q7Y4 4LGQA 1W6YA 1SQWA 3X3XA 4FMBA 4R80A 1FUWA 5FW5A 1N9JA 4MMZB 2C11A 2HMMB 1O7GB 2CC3A 3F14A 1IK3A 1WQLB 2W03A 3GWRA 3RGRA 3CCS3 1NO3A 4LZIA 3HIIA 2OTJ3 4HM5B 2JQ5A 3AMOA 3VGNA 5EEOA 5I97A 3N9HA 4RZMA 5G2GA 5D82A 1ROVA 3MHEA 4K1VA 4XDWA 1Q42A 2W6JH 4NHFA 4CDLA 3EC9A 2WGOA 2CWVA 5JPPA 2YFJB 3BNCA 3KN4A 5AIFA 4KFDA 5D81A 3CME3 2CFKA 1N9EA 2P05A 3LYGA 4LMIA 3OWSA 3KE7A 3SOAA 2CWUA 3G4S3 3WOEB 1W02A 3T8NA 1TIJA 3EBYA 1JN5A 4N6V0 1UUVB 4H3UA 5HGRA 2P0MA 1IT8A 3ECFA 1JV2B 1RRHA 3G6E3 5IG3A 1LNHA 1GYBA 3PGBA 2XGLA 1W00A 1EG9B 1TUHA 2UX0A 3HK4A 1DVCA 3WOFB 1VQ53 4WHAA 2RFRA 2OWPA 3CCV3 2BO9B 2GXFA 2W9QA 2Z6BA 2ZL8A 4X2OA 1S723 3QK9A 2KXGA 1KD14 1WTHA 5AIHA 1W6GA 4MJDA 3F40A 2Y74A 1AVKA 3BLZA 2Z77A 4IPBA 4QWTA 1JB2A 5LC7A 4HM6B 4K61A 3T8UA 1VQK3 1YIT3 1CQSA 3EN1B 3KZTA 4HKVB 4MEIA 2IUJA 1OF5A 2HMJB 3CCR3 1JRQA 5IG5A 5AI1A 3SOYA 3H3HA 5CXOA 1Q40B 3JUNA 3KSED 3FG3A 1E97A 3CCU3 3NV0B 4HM8B 1IDPA 3FSDA 4EV5A 2R4IA 3RDEA 1SPUA 2D1WA 4R1KA 1STDA 2LQVA 3KKGA 4HZ9B 1JKGB 2W2CA 3MG3A 4FMDA 4R9KA 3T0UA 4FCZA 2JDIH 2O9UX 2OOVC 3U1WA 2I9WA 1DVDA 5BVBA 5IG0A 1QVF2 3MWZA 3GZXB 1IVUA 5IG4A 3DZLA 1TU5A 2BHMA 4RNYA 3D3LA 3EF8A 3CD63 2K54A 1JJ22 3FCSB 2CW9A 2BNGA 3CCE3 7STDA 3JUPA 4XB5A 4EC6A 3V98A 3WA2X 1YHQ3 3G0KA 1QAFA 1FGRA 2Y73A 1JKGA 3BB9A 4N6TA 4L8OA 3CC23 1PU4A 2MF7A 3LOYA 1O7NB 3V99A 3F7SA 2CFDA 4O2HA 1KWIA 1ROAA 2E2TA 4AEQA 2XFSA 4PEJA 3DM8A 4Q53A 3MKIA 1N5PA 2W04A 2CFGA 1EKMA 1JN5B 1YVBI 1IQXA 4HM7B 2XRXB 3Q1CA 1IVWA 1YI23 1TFOA 3OX9A 3LTAA 4WYKA 4AKYA 1QJGA 2YFIB 3DY5A 1K41A 3GZBA 1LVNA 1W7CA 3MG2A 4RBNA 1OGZA 3G713 5AIGA 3SXXA 3PZWA 4KVHA 4FCMA 4ORLA 3LXUX 2QA43 3ROBA 1WNHA 2XFTA 3EBTA 4G1MB 4MMYB 5ELUA 3LT9A 1PFPA 4ZM8A 1YIJ3 3Q2PA 3B7CA 4TX4A 1M9GA 2HMNB 3LT8A 3X41A 1OGXA 4EYCA 3NQZA 5KP3A 4O8SA 3SVAA 5AYRB 3HI7A 2CHCA 1STFI 3L0RA 4HYZA 2W9PA 1D6UA 2WGQA 4XDVA 3CCQ3 3WODG 2XR8B 1VQ73 3CNMA 3I553 3AMOB 1GY6A 4K1UA 3PCSA 4N6OB 2WOHA 3HX8A 4O3VA 4HVNA 3EE1A 3N54B 5LC6A 1AR0A 3E99A 3JUQA 5IENA 3BNEA 2YFLB 2K0MA 4WWUC 4WP5A 4IIAA 1W6CA 1TP6A 3OWYA 1VQP3 1K8A4 4R4KA 3UL5A 4OVMA 5AYSC 3FH1A 1SIIA 4HM0B 4RNZA 1FGOA 5CLKA 4L8PA 2E2VA 3CMA3 3X42A 1DMQA 1NWWA 1OCVA 4LSOA 2QIYA 3NX0A 1WMOA 2OOVA 1MOLA 3K63A 3FZWA 1IT7A 4MMXB 4X2HA 2LYXA 3CPOA 4HM3B 1VQN3 5CF1A 1EQKA 1AVLA 1W4NA 2XGNA 1RRLA 1NU3A 1IQYA 3B8LA 2WO0A 1US1A 3EJVA 4OK0A 3F7XA 1O7HB 2WOFA 2XSOB 4HM2B 3SEDA 3NXJA 2FNQA 1R4CA 3K5TA 3X3ZA 1OF5B 2P0XA 2OCTA 2MC8A 4BTWA 3F8HA 4JF8A 3CU3A 3B4PA 2CKFB 4O02B 2OTL3 3V92A 1V74A 5A0OB 3G8ZA 1IV9A 2BMRB 4I4KA 2IUKA 4HBRA 2P38A 1JNQA 2XH9A 4H61A 2PZVA 1CYVA 1T5YA 3KSPA 1RKYA 1QVG2 1OUNA 2C10A 4XM4A 1NDOB 1OH0A 3VF1A 1GD4A 3LZAA 3CCJ3 4HJLB 1M904 3A76A 1FGTA 5EVHA 2CG0A 3CXC2 1Q864 2QGUA 1WMNA 1GY7A 1Q814 4WYKB 1VQ43 1OPYA 5D83A 1W5ZA 1VQ93 1ISKA 3DGMA 3CNXA 3OV4A 1DMNA 1ASKA 1U5OA 4BTXA 4K90B 1O7MB 4U13A 3JUOA 2BMOB 3J7Yd 2ZDJA 3IMAB 1ULJB 3FGYA 4STDA 1G96A 1CYUA 3LTBA 1IVVA 1RN7A 2KRTA 4GB5A 3GAXA 2CFLA 1VQO3 4KZ1A 2A15A 1OHPA 1EA2A 1OHSA 3B4OA 3LMLA 3S67A 1J2BA 3S29A 5BXQA 3CPW2 1W01A 2OQEC 2W56B 1N8QA 1OHOA 1D6YA 2CFWA 2INXA 4JRFA 2KCDA 5STDA 1MNLA 1ZX2A 1NB3I 1CEWI 4NREA 1YJN3 1BUQA 4EBGA 1QMAA 3U97A 1UW1A 1S5AA 4J9AA 1VQM3 1M1XB 3S28A 1YJ93 1VQL3 4N6MA 3IPTA 3MG1A 4N6LA 3DMCA 2CK3H 2Q07A 5KP4A 4IT7A 2GBXB 3NQYA 3WDGB 3ER7A 3DXOA 4EXRA 3NM2A 3CCM3 5TGNA 1A90A 3UNLA 6STDA 4GL6A 2HMKB 1IV7A 2CIUA 3CCL3 1F8NA 1N5HA 1K734 2ML6A 3N8BA 2FGTA 4FMCA 1QAKA 3FKAA 3Q90A 2CG1A 1ZO2A 2F98A 4WFOA 1FA3A 1UI7A 1NJI4 3UB1A 3EX9A 3F8XA 2L4VA 2XEPA 1HKXA 1Q40A 3NUVA 2W0QA 2STDA 2PNCA 1C7HA 4FMAA 3O8YA 3G16A 1O7PB 1AV4A 2F99A 3LTDA 1GD3A 1YJW3 3WA3A 1VQ83 4CCVA 3NM7A 1Y4KA 3UL6A 5DRVA 2W56A 2IMJA 4BTYA 1YGEA 3KFQC 4N6UA 2IA7A 4FR9A 3HIGA 3K0ZA 4HZBB 1W2B2 2RGQA 2GEYA 1UUWB 3I563 4N3VA 5JBSA 1KSIA 3KIIA 1O7WB 4KFEA 3FG4A 1KQS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJG A;  1Q42 A;  2YFI B;  3LZA A;  3A76 A;  1K41 A;  3EC9 A;  3GZB A;  4HJL B;  4CDL A;  3OWU A;  3MG2 A;  2YFJ B;  5EVH A;  1OGZ A;  5JPP A;  5AIF A;  5D81 A;  2QGU A;  5AIG A;  1GY7 A;  3WMD A;  4KVH A;  4ORL A;  3LYG A;  2BMQ B;  4FCM A;  4LMI A;  3I0Y A;  3OWS A;  3KE7 A;  3ROB A;  4WYK B;  2RCD A;  3SOA A;  1OPY A;  3EBT A;  5D83 A;  1W02 A;  2HML B;  3T8N A;  3EBY A;  4HM4 B;  3EHC A;  1ISK A;  1JN5 A;  3B7C A;  3H51 A;  1JB4 A;  1UUV B;  2HMN B;  3CNX A;  4H3U A;  1OGX A;  5HGR A;  3OV4 A;  5IEO A;  1GY5 A;  1DMN A;  3F9S A;  3ECF A;  1ASK A;  5KP3 A;  5IG3 A;  1U5O A;  2CHC A;  1GYB A;  1W00 A;  2F86 B;  1EG9 B;  1O7M B;  1TUH A;  2UX0 A;  3FLJ A;  3HK4 A;  3JUO A;  2BMO B;  4U13 A;  2RFR A;  2OWP A;  3M8C A;  2GXF A;  3S5C A;  1ULJ B;  3FGY A;  3GZR A;  4STD A;  5IF6 A;  4XDV A;  4X2O A;  5CF2 A;  4GB5 A;  3HZP A;  2XR8 B;  3CNM A;  1GY6 A;  1DMM A;  4K1U A;  5AIH A;  4HM1 B;  2A15 A;  4MJD A;  1OHP A;  3F40 A;  1EA2 A;  3HX8 A;  4XBT A;  1OHS A;  4HVN A;  3B4O A;  3BLZ A;  2Z77 A;  3EQQ B;  4XBX A;  5AEU B;  1JB2 A;  1AR0 A;  3E99 A;  3MYT A;  4HM6 B;  3RGA A;  3T8U A;  3JUQ A;  5BXQ A;  1W01 A;  1CQS A;  3EN1 B;  2HMO B;  3KZT A;  4HKV B;  1OHO A;  2INX A;  4OUQ A;  1OF5 A;  2HMJ B;  4R9L A;  2YFL B;  4XBY A;  1ZX2 A;  2Z76 A;  5STD A;  4WWU C;  4WP5 A;  3UJM A;  4IIA A;  1BUQ A;  5IG5 A;  5IEN A;  2GBW B;  3K7C A;  1QMA A;  3D9R A;  5AI1 A;  3SOY A;  1SJW A;  1TP6 A;  3OWY A;  3H3H A;  1S5A A;  5CXO A;  1Q40 B;  3FF0 A;  4J9A A;  4OVM A;  3FH1 A;  1VZZ A;  3IPT A;  4HM0 B;  3JUN A;  3MG1 A;  5CLK A;  1GS3 A;  3DMC A;  1E97 A;  3EN8 A;  3OXA A;  4L7K A;  4L8P A;  1JB5 A;  1A2K A;  3GZY B;  3FF2 A;  3NV0 B;  5KP4 A;  2GBX B;  3DUK A;  2B1X B;  1IDP A;  3FSD A;  4HM8 B;  3ER7 A;  2R4I A;  1DMQ A;  3DXO A;  3NHX A;  3NM2 A;  5AEW B;  1NWW A;  1OCV A;  1E3V A;  4R1K A;  5D82 A;  1STD A;  5TGN A;  2QIY A;  3KKG A;  3UNL A;  4HZ9 B;  5DRE A;  6STD A;  1JKG B;  2W2C A;  3MG3 A;  2HMK B;  4R9K A;  5KP1 A;  2Z7A A;  3FZW A;  3VSY A;  4X2H A;  3CPO A;  4HM3 B;  2I9W A;  4FCJ A;  5CF1 A;  5BVB A;  5AII A;  1ULI B;  5IG0 A;  3GZX B;  5JPU A;  5CK6 A;  5IG4 A;  3DZL A;  1NU3 A;  3FKA A;  2GEX A;  3B8L A;  3Q90 A;  4J8T A;  3EF8 A;  8CHO A;  1ZO2 A;  3EJV A;  2K54 A;  2F98 A;  3F7X A;  1O7H B;  3GRD A;  3NV0 A;  3JUM A;  2XSO B;  4HM2 B;  3SED A;  3NXJ A;  1Z1S A;  2BNG A;  3EX9 A;  2B24 B;  2XSH B;  3F8X A;  5IEP A;  1HKX A;  7STD A;  1OF5 B;  3JUP A;  4XB5 A;  1E3R A;  3MSO A;  1Q40 A;  3NUV A;  3F8H A;  2STD A;  3G0K A;  1C7H A;  3CU3 A;  3B4P A;  5IER A;  2CKF B;  1JKG A;  3BB9 A;  3NBR A;  3STD A;  3G16 A;  4LGQ A;  1O7P B;  1W6Y A;  4L8O A;  2F99 A;  1O7N B;  3F7S A;  3G8Z A;  5FW5 A;  5DRV A;  2BMR B;  2HMM B;  1O7G B;  2IMJ A;  3F14 A;  4I4K A;  1WQL B;  4PEJ A;  3GWR A;  3DM8 A;  4Q53 A;  3MKI A;  3RGR A;  3K0Z A;  4HZB B;  4LEH A;  1JN5 B;  2PZV A;  2RGQ A;  3KSP A;  4HM7 B;  1OUN A;  2GEY A;  1UUW B;  2XRX B;  4HM5 B;  2JQ5 A;  4N3V A;  4XM4 A;  3VGN A;  4RZM A;  1NDO B;  3OX9 A;  4XDW A;  1OH0 A;  5G2G A;  1O7W B;  3MHE A;  4K1V A;  4WYK A; 
#chains in the Genus database with same CATH topology
 2CH9 A;  1JZD A;  1PYL A;  3OWU A;  1DYU A;  1UI8 A;  3WMD A;  2BMQ B;  3SLU A;  3I0Y A;  1W2Z A;  1I0X A;  1RGC A;  2RCD A;  4N6N B;  3NBJ A;  2HML B;  2XF3 A;  1OAC A;  4HM4 B;  3EHC A;  3H51 A;  3DGN A;  1M1K 4;  1RMS A;  1Q82 4;  1JB4 A;  1TFK A;  5IEO A;  1GMP A;  3HOH A;  1GY5 A;  3F9S A;  2CX0 A;  1UUG B;  1BRJ A;  2CX1 A;  1BSB A;  3MPH A;  3X40 A;  3ALA A;  2F86 B;  3KCH A;  3FG1 A;  1RGH A;  3BND A;  3FLJ A;  3URP A;  1KC8 4;  1LXE A;  5ELJ A;  5EQL A;  1VQ6 3;  3DGL A;  3NBB A;  1A2V A;  3M8C A;  3PYJ A;  3S5C A;  1FUT A;  3GZR A;  5IF6 A;  1BAN A;  2GU1 A;  3CC4 3;  2D42 A;  1RN4 A;  5CF2 A;  1HYF A;  2O3O A;  3EB8 A;  3LTC A;  3HZP A;  5G1L A;  2E2U A;  1QAL A;  9RNT A;  2QEX 3;  1DMM A;  4HM1 B;  2RBI A;  3S27 A;  2RSX A;  1RHL A;  1T2I A;  4XBT A;  1V57 A;  3RNT A;  5AEU B;  1FGQ A;  1K28 A;  1LOY A;  1RJO A;  1WMP A;  3EQQ B;  3OW2 2;  3MYT A;  5KP1 A;  3RGA A;  1IQ8 A;  2SBL A;  1FGM A;  2GU3 A;  4EV2 A;  2F5W A;  2HMO B;  4OUQ A;  4XBX A;  3DH2 A;  4R9L A;  2BT3 A;  4XBY A;  2OQE A;  2Z76 A;  2M7O A;  3CC7 3;  3UJM A;  2YX9 A;  5IW9 A;  3LH4 A;  2GBW B;  1IU7 A;  3D9R A;  3K7C A;  1JBR A;  1AQZ A;  1SJW A;  3FF0 A;  4EW5 A;  2ML5 A;  1VZZ A;  4KFF A;  1NNV A;  2V1L A;  1GS3 A;  2C4B A;  3EN8 A;  3OXA A;  4L7K A;  2J8X B;  3K9M C;  1JB5 A;  3X3Y A;  1A2K A;  3GZY B;  3FF2 A;  3DUK A;  3PS8 A;  2B1X B;  4LEH A;  5AEW B;  2CWT A;  3NHX A;  1UCK A;  1E3V A;  1MWR A;  4J5G A;  1A67 A;  1BSA A;  5DRE A;  1PY3 A;  1U8C B;  1I2F A;  3DGO A;  1NB5 I;  2FXT A;  2Z7A A;  1MGR A;  1MGW A;  3VSY A;  4BL2 A;  4FCJ A;  1HU9 A;  2P09 A;  5AII A;  1ULI B;  5JPU A;  5CK6 A;  3TDG A;  1BIR A;  1BRG A;  3QRD A;  3PXM A;  2GEX A;  1SIH A;  3WHO A;  4J8T A;  3BNB A;  8CHO A;  1LOW A;  1K9M 4;  3GRD A;  3NV0 A;  3JVC A;  3JUM A;  1Z1S A;  1D6Z A;  2UUG C;  2B24 B;  2XSH B;  3A5E A;  4GSP A;  3PCR A;  1I2G A;  4I5Q A;  5IEP A;  1E3R A;  1UCJ A;  3MSO A;  3IJE B;  4AKZ A;  3SX1 A;  1L5G B;  5IER A;  1N8R 4;  1LOX A;  5FGO A;  1IVX A;  3STD A;  3NBR A;  1Q7Y 4;  2KF3 A;  4LGQ A;  1W6Y A;  1SQW A;  3X3X A;  3ZFZ A;  2KF5 A;  4FMB A;  4R80 A;  1FUW A;  5FW5 A;  1N9J A;  4MMZ B;  2C11 A;  1B27 A;  2HMM B;  1O7G B;  2CC3 A;  3F14 A;  1IK3 A;  1WQL B;  2W03 A;  3GWR A;  5M18 A;  3RGR A;  2BIR A;  3CCS 3;  4NPB A;  1AY7 A;  1NO3 A;  2IY2 A;  4LZI A;  3HII A;  2OTJ 3;  4HM5 B;  2JQ5 A;  3AMO A;  3VGN A;  5EEO A;  5I97 A;  3N9H A;  4RZM A;  5G2G A;  1BRN L;  5D82 A;  1ROV A;  3MHE A;  4K1V A;  4XDW A;  1Q42 A;  2W6J H;  4NHF A;  4CDL A;  3EC9 A;  2WGO A;  1I8V A;  2CWV A;  5JPP A;  2YFJ B;  3BNC A;  3KN4 A;  5AIF A;  4KFD A;  5D81 A;  1A2P A;  1GMR A;  3CME 3;  2CFK A;  1N9E A;  2P05 A;  3LYG A;  4LMI A;  3OWS A;  3KE7 A;  3SOA A;  2CWU A;  2UGI A;  3G4S 3;  3WOE B;  1W02 A;  3T8N A;  1TIJ A;  5G1K A;  3EBY A;  1LQM B;  1JN5 A;  4N6V 0;  1UUV B;  4H3U A;  5HGR A;  2P0M A;  1IT8 A;  1UGI A;  3ECF A;  1JV2 B;  1UGH I;  1RRH A;  3SYU A;  3G6E 3;  5IG3 A;  1LNH A;  1GYB A;  3PGB A;  2XGL A;  1W00 A;  3D4A A;  1EG9 B;  1TUH A;  2UX0 A;  3HK4 A;  2GSP A;  1DVC A;  3WOF B;  1VQ5 3;  4WHA A;  2K3D A;  2RFR A;  2OWP A;  3CCV 3;  2BO9 B;  2GXF A;  2W9Q A;  2Z6B A;  2ZL8 A;  1TTO A;  4X2O A;  1S72 3;  3QK9 A;  2KXG A;  1KD1 4;  1WTH A;  5AIH A;  1W6G A;  4MJD A;  3F40 A;  4DKI A;  1R4Y A;  2Y74 A;  1AVK A;  3BLZ A;  2Z77 A;  4IPB A;  2H0I A;  4QWT A;  1JB2 A;  1I3F A;  5LC7 A;  4HM6 B;  4K61 A;  3T8U A;  1VQK 3;  1YIT 3;  1CQS A;  3EN1 B;  3KZT A;  4HKV B;  4MEI A;  1T2H A;  2IUJ A;  1OF5 A;  2HMJ B;  3CCR 3;  1BRK A;  2AAE A;  1JRQ A;  1FYS A;  1LRA A;  5IG5 A;  5AI1 A;  4RNT A;  3BIR A;  3SOY A;  1B2Z A;  3H3H A;  5CXO A;  1Q40 B;  3AGN A;  3JUN A;  3KSE D;  3FG3 A;  1E97 A;  2R41 A;  3CCU 3;  3NV0 B;  1RGA A;  4HM8 B;  1IDP A;  3FSD A;  4EV5 A;  7RNT A;  2R4I A;  1BNR A;  2H0G A;  3RDE A;  1SPU A;  2D1W A;  1JZO A;  1STD A;  4R1K A;  2LQV A;  3KKG A;  4HZ9 B;  1JKG B;  2W2C A;  3MG3 A;  4FMD A;  4R9K A;  3T0U A;  1B2X A;  4FCZ A;  2JDI H;  2O9U X;  1RN1 A;  2OOV C;  3U1W A;  2RNT A;  1BNI A;  2I9W A;  1DVD A;  2F4Y A;  2KAA A;  5IG0 A;  3MWZ A;  3GZX B;  1MWU A;  5BVB A;  5M19 A;  1QVF 2;  1IVU A;  5IG4 A;  3DZL A;  1TU5 A;  2BHM A;  1RSN A;  4RNY A;  3D3L A;  3EF8 A;  3CD6 3;  1I70 A;  2K54 A;  1B2U A;  1JJ2 2;  3FCS B;  1RGK A;  2CW9 A;  3GSP A;  1TRQ A;  2BNG A;  3CCE 3;  1BSC A;  4CPK A;  3JUP A;  4XB5 A;  4EC6 A;  3V98 A;  3WA2 X;  7STD A;  1YHQ 3;  3G0K A;  1QAF A;  1FGR A;  2Y73 A;  1JKG A;  3BB9 A;  4N6T A;  4L8O A;  3CC2 3;  1PU4 A;  2MF7 A;  1MWT A;  1O7N B;  3LOY A;  3F7S A;  2CFD A;  3V99 A;  4O2H A;  1KWI A;  1ROA A;  2E2T A;  2F56 A;  4CJN A;  1I2E A;  1RTU A;  4AEQ A;  1RGL A;  2XFS A;  4PEJ A;  2KF4 A;  3D5I A;  1Q7H A;  3DM8 A;  3MKI A;  4GHO A;  4Q53 A;  4BU4 A;  1N5P A;  2W04 A;  2CFG A;  1EKM A;  5M1A A;  1JN5 B;  1V58 A;  1IQX A;  1YVB I;  4HM7 B;  2XRX B;  3Q1C A;  1IVW A;  1BRH A;  1TFO A;  1YI2 3;  3OX9 A;  1FW7 A;  3LTA A;  4WYK A;  4AKY A;  1QJG A;  2YFI B;  3DY5 A;  1K41 A;  3GZB A;  1LVN A;  1W7C A;  3MG2 A;  4RBN A;  1OGZ A;  3G71 3;  1UCI A;  4LYL B;  5AIG A;  6RNT A;  3SXX A;  3PZW A;  4KVH A;  4FCM A;  4ORL A;  3LXU X;  2QA4 3;  3ROB A;  1WNH A;  2XFT A;  3EBT A;  4G1M B;  4MMY B;  5ELU A;  3ZG5 A;  1DE3 A;  3LT9 A;  1PFP A;  4ZM8 A;  1YIJ 3;  3Q2P A;  3B7C A;  4TX4 A;  1M9G A;  1TRP A;  2HMN B;  3LT8 A;  3X41 A;  1OGX A;  4EYC A;  3NQZ A;  4BIR A;  5KP3 A;  3AHS A;  4O8S A;  3SVA A;  1RNT A;  5AYR B;  2KF6 A;  3HI7 A;  1RCK A;  2HOH A;  2CHC A;  1STF I;  3L0R A;  4HYZ A;  2W9P A;  1C54 A;  1D6U A;  2WGQ A;  4XDV A;  3CCQ 3;  3WOD G;  1B20 A;  2XR8 B;  1VQ7 3;  3CNM A;  3I55 3;  3AMO B;  1GY6 A;  4K1U A;  3PCS A;  4N6O B;  1BGS A;  1VQQ A;  2WOH A;  3HX8 A;  4O3V A;  4HVN A;  3EE1 A;  3N54 B;  5LC6 A;  1AR0 A;  3E99 A;  1HZ1 A;  3JUQ A;  1YNV X;  1GMQ A;  1GOV A;  5IEN A;  3BNE A;  2YFL B;  2K0M A;  1T3B A;  4WWU C;  4WP5 A;  4IIA A;  7GSP A;  3D79 A;  1W6C A;  1TP6 A;  3OWY A;  1BVI A;  1VQP 3;  2L1S A;  4R4K A;  3AGO A;  8RNT A;  1X1W A;  4OVM A;  3UL5 A;  5AYS C;  1K8A 4;  1B2M A;  3FH1 A;  1SII A;  4HM0 B;  4RNZ A;  1JBS A;  1FGO A;  5CLK A;  2ZA4 A;  4L8P A;  2E2V A;  1BRI A;  3CMA 3;  3X42 A;  1RDS A;  1DMQ A;  1LQG C;  1ZS7 A;  1NWW A;  1OCV A;  1UDI I;  4KT3 B;  4LSO A;  2QIY A;  2F5M A;  1SAR A;  5GSP A;  3NX0 A;  1WMO A;  2OOV A;  1MOL A;  1EUI C;  1ZGX A;  3K63 A;  3FZW A;  3AHW A;  1IT7 A;  4MMX B;  1RLS A;  1RGE A;  2LYX A;  3CPO A;  4HM3 B;  4X2H A;  1X1Y A;  5CF1 A;  1VQN 3;  1EQK A;  1AVL A;  1W4N A;  2BU4 A;  2XGN A;  1RRL A;  3BU4 A;  1NU3 A;  1BNG A;  1IQY A;  3B8L A;  2WO0 A;  1BOX A;  1US1 A;  3EJV A;  4OK0 A;  3F7X A;  1O7H B;  6GSP A;  2WOF A;  2XSO B;  4HM2 B;  3SED A;  3NXJ A;  2FNQ A;  1R4C A;  1FUS A;  3K5T A;  1I0V A;  1RCL A;  3X3Z A;  1OF5 B;  2P0X A;  2OCT A;  2MC8 A;  4BTW A;  3F8H A;  4JF8 A;  3CU3 A;  1B3S A;  3B4P A;  2CKF B;  4O02 B;  2OTL 3;  3V92 A;  1V74 A;  5A0O B;  3G8Z A;  1IV9 A;  2BMR B;  4I4K A;  2IUK A;  4HBR A;  2P38 A;  1JNQ A;  2XH9 A;  4H61 A;  2PZV A;  1CYV A;  1T5Y A;  3KSP A;  1RKY A;  1QVG 2;  1OUN A;  2C10 A;  4XM4 A;  3D5G A;  1BNE A;  1NDO B;  1JBT A;  1OH0 A;  3VF1 A;  1GD4 A;  3ZG0 A;  3LZA A;  3CCJ 3;  4HJL B;  1M90 4;  3A76 A;  1FGT A;  1GOY A;  5EVH A;  2CG0 A;  3CXC 2;  1Q86 4;  2QGU A;  1WMN A;  2AAD A;  4BL3 A;  1GY7 A;  1Q81 4;  2IYJ A;  4WYK B;  1VQ4 3;  1OPY A;  5D83 A;  1W5Z A;  1VQ9 3;  1BNS A;  1B21 A;  1ISK A;  1GOU A;  3DGM A;  3CNX A;  3OV4 A;  1DMN A;  1TJD A;  1ASK A;  1YGW A;  1U5O A;  4BTX A;  4K90 B;  1O7M B;  1DET A;  1I3I A;  3JUO A;  4U13 A;  2BMO B;  1BAO A;  3J7Y d;  2ZDJ A;  3IMA B;  5BIR A;  1ULJ B;  3FGY A;  4STD A;  1G96 A;  1CYU A;  3LTB A;  1IVV A;  1RN7 A;  2KRT A;  5RNT A;  4GB5 A;  1BU4 A;  3GAX A;  2CFL A;  1VQO 3;  4KZ1 A;  2A15 A;  1OHP A;  1EA2 A;  1OHS A;  3B4O A;  3LML A;  1EEJ A;  3S67 A;  1J2B A;  3S29 A;  5BXQ A;  3CPW 2;  1W01 A;  2OQE C;  2W56 B;  1N8Q A;  1OHO A;  1D6Y A;  1RGG A;  2CFW A;  2INX A;  2KCD A;  4JRF A;  1MNL A;  1ZX2 A;  1NB3 I;  5STD A;  1B2S A;  1CEW I;  4NRE A;  1YJN 3;  1CH0 A;  1G02 A;  3Q3F A;  1BUQ A;  4EBG A;  1QMA A;  1UCL A;  3U97 A;  1BSD A;  1UW1 A;  5HOH A;  1S5A A;  4J9A A;  1VQM 3;  1M1X B;  3S28 A;  1YJ9 3;  1VQL 3;  1Q9E A;  3IPT A;  4N6M A;  3MG1 A;  3DGY A;  4N6L A;  3DMC A;  2CK3 H;  2Q07 A;  5KP4 A;  4IT7 A;  2GBX B;  1BNF A;  3NQY A;  3WDG B;  3ER7 A;  3DXO A;  4EXR A;  1BUJ A;  1X1U A;  3NM2 A;  3CCM 3;  2H0H A;  1IYY A;  4J5K A;  5TGN A;  1A90 A;  3UNL A;  6STD A;  1BRS A;  1BSE A;  4GL6 A;  2HMK B;  1RGF A;  1IV7 A;  1YVS A;  2CIU A;  3CCL 3;  1F8N A;  1LNI A;  1N5H A;  1K73 4;  1BNJ A;  2ML6 A;  2FGT A;  3N8B A;  4FMC A;  4ILF A;  1QAK A;  3FKA A;  3Q90 A;  2CG1 A;  1ZO2 A;  2F98 A;  4WFO A;  1FA3 A;  1UI7 A;  1X1X A;  1NJI 4;  3UB1 A;  1LOV A;  3EX9 A;  3F8X A;  2L4V A;  2XEP A;  1HKX A;  4HAA A;  1GSP A;  1Q40 A;  3NUV A;  2W0Q A;  2STD A;  2PNC A;  1C7H A;  2SAR A;  3WR2 A;  4FMA A;  3O8Y A;  3G16 A;  1O7P B;  1AV4 A;  2F99 A;  3LTD A;  1GD3 A;  1YJW 3;  3WA3 A;  1VQ8 3;  4CCV A;  1FZU A;  3NM7 A;  1Y4K A;  3UL6 A;  5DRV A;  4HOH A;  2W56 A;  2IMJ A;  4BTY A;  1YGE A;  3KFQ C;  4N6U A;  2IA7 A;  4FR9 A;  3HIG A;  3K0Z A;  1MWS A;  4HZB B;  1W2B 2;  2RGQ A;  1G0T A;  2ZHX B;  2GEY A;  1UUW B;  3I56 3;  4N3V A;  5JBS A;  1RNB A;  1KSI A;  5BU4 A;  3KII A;  1O7W B;  4KFE A;  3FG4 A;  1KQS 2; 
#chains in the Genus database with same CATH homology
 2CH9 A;  3OWU A;  1DYU A;  1UI8 A;  3WMD A;  2BMQ B;  3SLU A;  3I0Y A;  1W2Z A;  4N6N B;  2RCD A;  3NBJ A;  2HML B;  2XF3 A;  1OAC A;  4HM4 B;  3EHC A;  3H51 A;  3DGN A;  1M1K 4;  1Q82 4;  1JB4 A;  1TFK A;  5IEO A;  1GY5 A;  3F9S A;  3MPH A;  3X40 A;  3ALA A;  2F86 B;  3FG1 A;  3FLJ A;  3BND A;  1KC8 4;  1LXE A;  5ELJ A;  5EQL A;  1VQ6 3;  3DGL A;  3NBB A;  1A2V A;  3M8C A;  3PYJ A;  3S5C A;  3GZR A;  5IF6 A;  2GU1 A;  3CC4 3;  2D42 A;  5CF2 A;  2O3O A;  3EB8 A;  3LTC A;  3HZP A;  2E2U A;  1QAL A;  2QEX 3;  1DMM A;  4HM1 B;  3S27 A;  2RSX A;  4XBT A;  3OW2 2;  5AEU B;  1FGQ A;  1K28 A;  1RJO A;  1WMP A;  3EQQ B;  3MYT A;  5KP1 A;  3RGA A;  1IQ8 A;  2SBL A;  1FGM A;  2GU3 A;  4EV2 A;  4XBX A;  2HMO B;  4OUQ A;  4XBY A;  4R9L A;  2BT3 A;  2OQE A;  2Z76 A;  2M7O A;  3CC7 3;  3UJM A;  2YX9 A;  5IW9 A;  3LH4 A;  2GBW B;  1IU7 A;  3D9R A;  3K7C A;  1SJW A;  3FF0 A;  2ML5 A;  1VZZ A;  4KFF A;  2V1L A;  1GS3 A;  3EN8 A;  3OXA A;  4L7K A;  3K9M C;  1JB5 A;  3X3Y A;  1A2K A;  3GZY B;  3FF2 A;  3DUK A;  3PS8 A;  2B1X B;  4LEH A;  5AEW B;  2CWT A;  3NHX A;  1E3V A;  1A67 A;  5DRE A;  1U8C B;  3DGO A;  1NB5 I;  2FXT A;  2Z7A A;  3VSY A;  4FCJ A;  1HU9 A;  2P09 A;  5AII A;  1ULI B;  5JPU A;  5CK6 A;  3TDG A;  3QRD A;  3PXM A;  2GEX A;  1SIH A;  4J8T A;  3BNB A;  8CHO A;  1K9M 4;  3GRD A;  3NV0 A;  3JVC A;  3JUM A;  1Z1S A;  1D6Z A;  2B24 B;  2XSH B;  3PCR A;  5IEP A;  1E3R A;  3MSO A;  4AKZ A;  3IJE B;  3SX1 A;  1L5G B;  5IER A;  1N8R 4;  1LOX A;  5FGO A;  1IVX A;  3STD A;  3NBR A;  1Q7Y 4;  4LGQ A;  1W6Y A;  1SQW A;  3X3X A;  4FMB A;  4R80 A;  1FUW A;  5FW5 A;  1N9J A;  4MMZ B;  2C11 A;  2HMM B;  1O7G B;  2CC3 A;  3F14 A;  1IK3 A;  1WQL B;  2W03 A;  3GWR A;  3RGR A;  3CCS 3;  1NO3 A;  4LZI A;  3HII A;  2OTJ 3;  4HM5 B;  2JQ5 A;  3AMO A;  3VGN A;  5EEO A;  5I97 A;  3N9H A;  4RZM A;  5G2G A;  5D82 A;  1ROV A;  3MHE A;  4K1V A;  4XDW A;  1Q42 A;  2W6J H;  4NHF A;  4CDL A;  3EC9 A;  2WGO A;  2CWV A;  5JPP A;  2YFJ B;  3BNC A;  3KN4 A;  5AIF A;  4KFD A;  5D81 A;  3CME 3;  2CFK A;  1N9E A;  2P05 A;  3LYG A;  4LMI A;  3OWS A;  3KE7 A;  3SOA A;  2CWU A;  3G4S 3;  3WOE B;  1W02 A;  3T8N A;  1TIJ A;  3EBY A;  1JN5 A;  4N6V 0;  1UUV B;  4H3U A;  5HGR A;  2P0M A;  1IT8 A;  3ECF A;  1JV2 B;  1RRH A;  3G6E 3;  5IG3 A;  1LNH A;  1GYB A;  3PGB A;  2XGL A;  1W00 A;  1EG9 B;  1TUH A;  2UX0 A;  3HK4 A;  1DVC A;  3WOF B;  1VQ5 3;  4WHA A;  2RFR A;  2OWP A;  3CCV 3;  2BO9 B;  2GXF A;  2W9Q A;  2Z6B A;  2ZL8 A;  4X2O A;  1S72 3;  3QK9 A;  2KXG A;  1KD1 4;  1WTH A;  5AIH A;  1W6G A;  4MJD A;  3F40 A;  2Y74 A;  1AVK A;  3BLZ A;  2Z77 A;  4IPB A;  4QWT A;  1JB2 A;  5LC7 A;  4HM6 B;  4K61 A;  3T8U A;  1VQK 3;  1YIT 3;  1CQS A;  3EN1 B;  3KZT A;  4HKV B;  4MEI A;  2IUJ A;  1OF5 A;  2HMJ B;  3CCR 3;  1JRQ A;  5IG5 A;  5AI1 A;  3SOY A;  3H3H A;  5CXO A;  1Q40 B;  3JUN A;  3KSE D;  3FG3 A;  1E97 A;  3CCU 3;  3NV0 B;  4HM8 B;  1IDP A;  3FSD A;  4EV5 A;  2R4I A;  3RDE A;  1SPU A;  2D1W A;  4R1K A;  1STD A;  2LQV A;  3KKG A;  4HZ9 B;  1JKG B;  2W2C A;  3MG3 A;  4FMD A;  4R9K A;  3T0U A;  4FCZ A;  2JDI H;  2O9U X;  2OOV C;  3U1W A;  2I9W A;  1DVD A;  5BVB A;  5IG0 A;  1QVF 2;  3MWZ A;  3GZX B;  1IVU A;  5IG4 A;  3DZL A;  1TU5 A;  2BHM A;  4RNY A;  3D3L A;  3EF8 A;  3CD6 3;  2K54 A;  1JJ2 2;  3FCS B;  2CW9 A;  2BNG A;  3CCE 3;  7STD A;  3JUP A;  4XB5 A;  4EC6 A;  3V98 A;  3WA2 X;  1YHQ 3;  3G0K A;  1QAF A;  1FGR A;  2Y73 A;  1JKG A;  3BB9 A;  4N6T A;  4L8O A;  3CC2 3;  1PU4 A;  2MF7 A;  3LOY A;  1O7N B;  3V99 A;  3F7S A;  2CFD A;  4O2H A;  1KWI A;  1ROA A;  2E2T A;  4AEQ A;  2XFS A;  4PEJ A;  3DM8 A;  4Q53 A;  3MKI A;  1N5P A;  2W04 A;  2CFG A;  1EKM A;  1JN5 B;  1YVB I;  1IQX A;  4HM7 B;  2XRX B;  3Q1C A;  1IVW A;  1YI2 3;  1TFO A;  3OX9 A;  3LTA A;  4WYK A;  4AKY A;  1QJG A;  2YFI B;  3DY5 A;  1K41 A;  3GZB A;  1LVN A;  1W7C A;  3MG2 A;  4RBN A;  1OGZ A;  3G71 3;  5AIG A;  3SXX A;  3PZW A;  4KVH A;  4FCM A;  4ORL A;  3LXU X;  2QA4 3;  3ROB A;  1WNH A;  2XFT A;  3EBT A;  4G1M B;  4MMY B;  5ELU A;  3LT9 A;  1PFP A;  4ZM8 A;  1YIJ 3;  3Q2P A;  3B7C A;  4TX4 A;  1M9G A;  2HMN B;  3LT8 A;  3X41 A;  1OGX A;  4EYC A;  3NQZ A;  5KP3 A;  4O8S A;  3SVA A;  5AYR B;  3HI7 A;  2CHC A;  1STF I;  3L0R A;  4HYZ A;  2W9P A;  1D6U A;  2WGQ A;  4XDV A;  3CCQ 3;  3WOD G;  2XR8 B;  1VQ7 3;  3CNM A;  3I55 3;  3AMO B;  1GY6 A;  4K1U A;  3PCS A;  4N6O B;  2WOH A;  3HX8 A;  4O3V A;  4HVN A;  3EE1 A;  3N54 B;  5LC6 A;  1AR0 A;  3E99 A;  3JUQ A;  5IEN A;  3BNE A;  2YFL B;  2K0M A;  4WWU C;  4WP5 A;  4IIA A;  1W6C A;  1TP6 A;  3OWY A;  1VQP 3;  1K8A 4;  4R4K A;  3UL5 A;  4OVM A;  5AYS C;  3FH1 A;  1SII A;  4HM0 B;  4RNZ A;  1FGO A;  5CLK A;  4L8P A;  2E2V A;  3CMA 3;  3X42 A;  1DMQ A;  1NWW A;  1OCV A;  4LSO A;  2QIY A;  3NX0 A;  1WMO A;  2OOV A;  1MOL A;  3K63 A;  3FZW A;  1IT7 A;  4MMX B;  4X2H A;  2LYX A;  3CPO A;  4HM3 B;  1VQN 3;  5CF1 A;  1EQK A;  1AVL A;  1W4N A;  2XGN A;  1RRL A;  1NU3 A;  1IQY A;  3B8L A;  2WO0 A;  1US1 A;  3EJV A;  4OK0 A;  3F7X A;  1O7H B;  2WOF A;  2XSO B;  4HM2 B;  3SED A;  3NXJ A;  2FNQ A;  1R4C A;  3K5T A;  3X3Z A;  1OF5 B;  2P0X A;  2OCT A;  2MC8 A;  4BTW A;  3F8H A;  4JF8 A;  3CU3 A;  3B4P A;  2CKF B;  4O02 B;  2OTL 3;  3V92 A;  1V74 A;  5A0O B;  3G8Z A;  1IV9 A;  2BMR B;  4I4K A;  2IUK A;  4HBR A;  2P38 A;  1JNQ A;  2XH9 A;  4H61 A;  2PZV A;  1CYV A;  1T5Y A;  3KSP A;  1RKY A;  1QVG 2;  1OUN A;  2C10 A;  4XM4 A;  1NDO B;  1OH0 A;  3VF1 A;  1GD4 A;  3LZA A;  3CCJ 3;  4HJL B;  1M90 4;  3A76 A;  1FGT A;  5EVH A;  2CG0 A;  3CXC 2;  1Q86 4;  2QGU A;  1WMN A;  1GY7 A;  1Q81 4;  4WYK B;  1VQ4 3;  1OPY A;  5D83 A;  1W5Z A;  1VQ9 3;  1ISK A;  3DGM A;  3CNX A;  3OV4 A;  1DMN A;  1ASK A;  1U5O A;  4BTX A;  4K90 B;  1O7M B;  4U13 A;  3JUO A;  2BMO B;  3J7Y d;  2ZDJ A;  3IMA B;  1ULJ B;  3FGY A;  4STD A;  1G96 A;  1CYU A;  3LTB A;  1IVV A;  1RN7 A;  2KRT A;  4GB5 A;  3GAX A;  2CFL A;  1VQO 3;  4KZ1 A;  2A15 A;  1OHP A;  1EA2 A;  1OHS A;  3B4O A;  3LML A;  3S67 A;  1J2B A;  3S29 A;  5BXQ A;  3CPW 2;  1W01 A;  2OQE C;  2W56 B;  1N8Q A;  1OHO A;  1D6Y A;  2CFW A;  2INX A;  4JRF A;  2KCD A;  5STD A;  1MNL A;  1ZX2 A;  1NB3 I;  1CEW I;  4NRE A;  1YJN 3;  1BUQ A;  4EBG A;  1QMA A;  3U97 A;  1UW1 A;  1S5A A;  4J9A A;  1VQM 3;  1M1X B;  3S28 A;  1YJ9 3;  1VQL 3;  4N6M A;  3IPT A;  3MG1 A;  4N6L A;  3DMC A;  2CK3 H;  2Q07 A;  5KP4 A;  4IT7 A;  2GBX B;  3NQY A;  3WDG B;  3ER7 A;  3DXO A;  4EXR A;  3NM2 A;  3CCM 3;  5TGN A;  1A90 A;  3UNL A;  6STD A;  4GL6 A;  2HMK B;  1IV7 A;  2CIU A;  3CCL 3;  1F8N A;  1N5H A;  1K73 4;  2ML6 A;  3N8B A;  2FGT A;  4FMC A;  1QAK A;  3FKA A;  3Q90 A;  2CG1 A;  1ZO2 A;  2F98 A;  4WFO A;  1FA3 A;  1UI7 A;  1NJI 4;  3UB1 A;  3EX9 A;  3F8X A;  2L4V A;  2XEP A;  1HKX A;  1Q40 A;  3NUV A;  2W0Q A;  2STD A;  2PNC A;  1C7H A;  4FMA A;  3O8Y A;  3G16 A;  1O7P B;  1AV4 A;  2F99 A;  3LTD A;  1GD3 A;  1YJW 3;  3WA3 A;  1VQ8 3;  4CCV A;  3NM7 A;  1Y4K A;  3UL6 A;  5DRV A;  2W56 A;  2IMJ A;  4BTY A;  1YGE A;  3KFQ C;  4N6U A;  2IA7 A;  4FR9 A;  3HIG A;  3K0Z A;  4HZB B;  1W2B 2;  2RGQ A;  2GEY A;  1UUW B;  3I56 3;  4N3V A;  5JBS A;  1KSI A;  3KII A;  1O7W B;  4KFE A;  3FG4 A;  1KQS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...