3EC9A

Crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
130
structure length
130
Chain Sequence
MRTPYQIVADHYAASDRHDPAAMMADIAPAIEWTEMAGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFKLDALHDAGDTVIGVGRYSGTYRRTGKSFECRVAHVWRVDAGKIVHFEQFTDTLLVAQAMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution
rcsb
source organism Burkholderia thailandensis e264
molecule tags Unknown function
molecule keywords uncharacterized NTF2-like protein
total genus 38
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ec9A00
3MG2A 1W02A 2GBXB 3MG3A 4OVMA 4WP5A 2HMKB 1ISKA 1BUQA 2A15A 2GBWB 2QIYA 1GY5A 3FH1A 3GRDA 2BMQB 1OF5A 4WYKB 4XDVA 4HM8B 4MJDA 3JUPA 1AR0A 4KVHA 1JB5A 1DMQA 2R4IA 4FCJA 3DMCA 4XBXA 4R1KA 5G2GA 2JQ5A 4U13A 2YFJB 4WYKA 5EVHA 5CXOA 3GZYB 5CF1A 3B4OA 2OWPA 3NHXA 5IF6A 1ZO2A 4J8TA 3B4PA 3K7CA 1OHOA 3NV0A 3RGAA 5BXQA 1NDOB 4RZMA 3EBTA 1STDA 1W6YA 3KSPA 4IIAA 3LYGA 3CU3A 2K54A 4XB5A 5STDA 2HMOB 4XDWA 3F7SA 5FW5A 2INXA 2HMMB 1OUNA 4XBTA 1GY6A 4K1VA 4PEJA 2HMNB 5AIHA 3EN8A 4X2OA 1TUHA 5AEUB 1EA2A 2RCDA 2GXFA 2HMLB 5D83A 3MG1A 2QGUA 3T8UA 3LZAA 4J9AA 1QMAA 3BLZA 2I9WA 7STDA 4HM4B 4HZ9B 3F8XA 3GZBA 3E99A 3EQQB 5TGNA 3DM8A 2BNGA 1OHPA 2XSHB 3GZXB 3OWYA 3F7XA 1ASKA 1O7NB 1OH0A 1UUWB 3MYTA 5D81A 5IEOA 3MHEA 3KKGA 3FZWA 5IENA 5AI1A 5KP4A 4H3UA 5KP1A 1JB2A 3NM2A 1HKXA 4HM1B 2BMOB 3HX8A 2GEXA 2CHCA 5IG0A 6STDA 3B7CA 5JPUA 2IMJA 2F86B 3DZLA 3EC9A 3JUNA 4XBYA 3OWUA 3STDA 2XSOB 3DXOA 4L8OA 1SJWA 3NXJA 3JUQA 1E3RA 3H3HA 4OUQA 4HM7B 1E3VA 1W00A 1UUVB 3BB9A 3EF8A 3FF2A 4LMIA 4HM3B 4X2HA 3G0KA 1WQLB 5BVBA 1ULJB 3EBYA 5CK6A 3JUMA 3WMDA 1O7WB 4STDA 2B1XB 1O7GB 1NU3A 2F98A 2YFLB 4HKVB 3ROBA 1NWWA 3F9SA 2RFRA 2W2CA 2BMRB 3KE7A 1K41A 4LGQA 1TP6A 2XR8B 3VGNA 1C7HA 5JPPA 2F99A 3I0YA 3MSOA 4HJLB 1JN5A 4R9KA 4XM4A 5DRVA 1JB4A 3NBRA 2UX0A 4L8PA 5AEWB 1DMNA 1GY7A 1O7MB 1QJGA 4HVNA 1W01A 2Z7AA 3DUKA 3FSDA 3OV4A 4HM2B 3HZPA 3F8HA 3GZRA 4HM0B 3OXAA 3FLJA 8CHOA 2YFIB 1Q40A 3ER7A 3OX9A 5AIFA 2Z76A 3IPTA 2GEYA 3ECFA 4I4KA 3NV0B 5HGRA 5KP3A 2CKFB 4HM5B 1CQSA 3KZTA 3FF0A 3CNMA 3SEDA 2HMJB 3UJMA 2PZVA 4ORLA 3S5CA 3A76A 1Z1SA 4K1UA 3EX9A 1JKGA 3SOYA 5IG5A 3FGYA 4WWUC 1OF5B 5IERA 3Q90A 3D9RA 1U5OA 5IEPA 1VZZA 3JUOA 1JN5B 3B8LA 3HK4A 1JKGB 3F40A 5IG4A 4GB5A 1ULIB 5D82A 1GS3A 4L7KA 1DMMA 3EJVA 3G16A 1Q42A 3OWSA 5CF2A 2Z77A 4R9LA 4FCMA 5AIGA 5AIIA 4CDLA 1O7HB 1ZX2A 3H51A 3CNXA 3G8ZA 3NUVA 3FKAA 4LEHA 3SOAA 4HZBB 3K0ZA 3VSYA 1O7PB 1OCVA 3UNLA 5CLKA 2RGQA 3CPOA 1A2KA 1IDPA 2XRXB 3GWRA 3RGRA 4HM6B 4Q53A 3EN1B 1OGXA 3EHCA 3F14A 3M8CA 3MKIA 1OPYA 1EG9B 1GYBA 2B24B 2STDA 1OGZA 1OHSA 1S5AA 1Q40B 3T8NA 5IG3A 5DREA 4N3VA 1E97A
chains in the Genus database with same CATH superfamily
2CX0A 1WMOA 3MG2A 5EEOA 1EKMA 3MG3A 3U1WA 2GBWB 1BVIA 1N5HA 3S27A 2GSPA 3CCV3 2BMQB 2BT3A 1FZUA 1OF5A 1RGAA 2KF3A 3ALAA 3K9MC 1BRNL 4AKZA 4MJDA 4KVHA 4XBXA 1DMQA 3S28A 3UB1A 2YFJB 3RDEA 3DGNA 3GZYB 2CWVA 1BNRA 1M1XB 4I5QA 1YJW3 2MF7A 2R41A 2W9QA 3D3LA 5STDA 2K54A 4WFOA 1W6GA 3BNCA 4XDWA 1RKYA 3LH4A 1FW7A 3Q1CA 3Q2PA 4OK0A 1BNIA 5AIHA 4BTXA 1TFKA 4BL3A 5IW9A 5BIRA 2XFTA 1UW1A 2GXFA 1W5ZA 2F5WA 1MWRA 4NREA 4KT3B 2CW9A 2OCTA 2WOFA 3BLZA 1LNHA 5M1AA 3HIGA 4HM4B 1DE3A 1NB5I 3D5GA 3E99A 1A90A 5TGNA 3CCQ3 3WHOA 2LQVA 5M18A 1IYYA 3F7XA 1OH0A 5IEOA 2F4YA 1I0XA 1GD3A 5IENA 3PYJA 5KP4A 1IT7A 5KP1A 3IJEB 4DKIA 2BMOB 1LVNA 8RNTA 1RSNA 2F86B 3AMOB 1BIRA 3DZLA 3EC9A 3CC23 1HYFA 2ML6A 2XSOB 3RNTA 1FUTA 1WMNA 4OUQA 4JRFA 3ZG5A 1E3VA 3BU4A 1V57A 3BB9A 2KAAA 3EF8A 3LT8A 1AQZA 4X2HA 3WMDA 3JUMA 2SBLA 1UCJA 4EXRA 4HKVB 3N8BA 1TTOA 3ROBA 3CCS3 3VGNA 4HBRA 1RGHA 1I0VA 1KC84 3V98A 2F99A 1DVCA 1RN1A 4J5KA 1JN5A 4XM4A 1QAFA 4K90B 3SLUA 3WODG 4L8PA 3AGNA 1DMNA 1QJGA 1RNBA 3SVAA 1I8VA 1F8NA 1W01A 3DGMA 3FSDA 3OV4A 3X40A 1M1K4 3NBJA 3F8HA 3GZRA 1A67A 3N9HA 2Z76A 3PZWA 4FR9A 3ECFA 2XF3A 1S723 3DGLA 1BRIA 1VQQA 1RMSA 1UI7A 2W0QA 2HMJB 3PCSA 2PZVA 3N54B 3GAXA 3A76A 1Z1SA 3S5CA 1X1UA 1ROAA 2FXTA 3SOYA 4BTWA 5RNTA 2P38A 5IERA 2KF6A 4GL6A 2GU3A 1VZZA 2LYXA 1HU9A 2ZDJA 5ELUA 4CCVA 1GSPA 2QA43 4L7KA 1DMMA 1D6ZA 1T3BA 3PGBA 2IUJA 1I2GA 4MMXB 2Z77A 2P05A 5AIIA 3G713 1O7HB 2CWUA 3H51A 1VQ93 4HYZA 1RTUA 3K0ZA 1VQN3 1BNGA 2C4BA 1YIJ3 3LTDA 3S67A 4EC6A 1JZDA 2V1LA 3RGRA 2P09A 2CH9A 1B2XA 3MKIA 1M9GA 1OPYA 1BGSA 1G96A 1GYBA 2B24B 2O3OA 5IG3A 1BUJA 1W02A 1ROVA 2HMKB 1ISKA 2SARA 1BUQA 1IQYA 3SXXA 3GRDA 1LOYA 1GMQA 4XDVA 1TIJA 4HM8B 3CCJ3 3X3YA 3UL5A 1I2FA 4BU4A 5G2GA 5CF1A 1GOVA 4MMZB 4R1KA 2W56A 1VQP3 1RN4A 3AHSA 1ZO2A 1OHOA 1FUSA 2K3DA 2OOVA 1YIT3 1W6YA 2P0XA 3KSPA 2OTJ3 1W7CA 3CU3A 6GSPA 2E2VA 2CFWA 3LMLA 2CK3H 5FW5A 2HMMB 4EBGA 1GMRA 2HMNB 1YGWA 4LSOA 4ZM8A 1EA2A 3DH2A 1B27A 3PCRA 1UGIA 3MG1A 3T8UA 3WDGB 1LXEA 3KFQC 2Y73A 4HZ9B 1A2VA 1RRLA 2CC3A 3AMOA 1Q7Y4 1B2UA 1R4YA 1W6CA 2XSHB 4BIRA 1KQS2 1UUWB 1BSBA 4R80A 1RRHA 1STFI 1VQ83 1JB2A 1V74A 3NM2A 1Q864 1BRJA 1T2HA 3KN4A 1NJI4 1B2SA 1VQ63 1RLSA 5IG0A 1ZS7A 2WOHA 6STDA 3B7CA 3BIRA 2IMJA 3D4AA 4N6UA 1FA3A 4XBYA 2J8XB 2OTL3 3DXOA 4L8OA 4MMYB 1SJWA 3JUQA 1E3RA 1FGRA 1PFPA 1W00A 5CK6A 1IVXA 4KZ1A 2YFLB 1SQWA 2F98A 3CC73 3ZG0A 2W2CA 3LTCA 4N6OB 2BMRB 4LGQA 1K41A 4TX4A 1TP6A 4NHFA 1BNJA 3I0YA 3MSOA 3LXUX 1K734 1M904 1BSEA 1V58A 1RGEA 4HVNA 5AEWB 1YGEA 1UI8A 1K28A 4O3VA 1T5YA 1B3SA 1UDII 2PNCA 3HI7A 1D6YA 3D79A 3FLJA 2KCDA 3KSED 2W9PA 1Q40A 5AIFA 2CWTA 2H0GA 1CEWI 2Q07A 1BSDA 3IPTA 4I4KA 1X1XA 2Z6BA 3NV0B 1MGWA 1BNEA 3J7Yd 3FF0A 3CNMA 3CMA3 1B2MA 1DYUA 1LQMB 4ORLA 2AADA 1GD4A 2RBIA 3EX9A 3MPHA 1MOLA 3VF1A 1YNVX 4FCZA 1JN5B 3B8LA 3HK4A 1BNFA 1JKGB 1BRGA 5IG4A 5D82A 1FGOA 1NB3I 3K5TA 3G16A 2YX9A 3PS8A 4N6LA 1JBSA 3CXC2 4CJNA 4IT7A 4CDLA 2K0MA 2E2TA 1LOXA 3NUVA 3WA2X 1B21A 3FKAA 7GSPA 1KD14 3VSYA 1O7PB 1OCVA 1JBTA 2FGTA 5G1LA 2CG1A 2XEPA 1RGCA 2W03A 4GHOA 2IYJA 4EW5A 1RCKA 5BU4A 1BSCA 1CYVA 4HM6B 4Q53A 1QAKA 1OGXA 2CFDA 3F14A 3O8YA 1Q40B 1OHSA 5AYRB 3S29A 1W2B2 1G0TA 1E97A 2W56B 3L0RA 4HOHA 1LOWA 2XGLA 3FH1A 4K61A 1I2EA 1VQO3 1U8CB 2HOHA 2H0HA 2IA7A 2R4IA 4MEIA 1UCIA 1B20A 2JQ5A 2XFSA 4U13A 4RBNA 4WYKA 5CXOA 5EVHA 4EYCA 3B4OA 1GOUA 3NHXA 3V99A 2F56A 1YVBI 3B4PA 5BXQA 1L5GB 4RZMA 3EBTA 1STDA 3FCSB 5ELJA 4IIAA 1TU5A 2CG0A 2HMOB 1WMPA 3KIIA 4KFEA 4LZIA 1PY3A 2INXA 3D5IA 1OUNA 4XBTA 1VQ73 4K1VA 1WTHA 4PEJA 1TRQA 3EN8A 1TUHA 5AEUB 2XGNA 3NM7A 2L4VA 2RNTA 1Q7HA 4KFFA 4O02B 5D83A 1AY7A 1RN7A 3DGOA 1JBRA 1NNVA 4J9AA 1QMAA 1DETA 3F8XA 1C54A 3EQQB 1SIHA 2KRTA 3I553 1VQK3 1EUIC 2BNGA 3OWYA 3NX0A 3MYTA 1MWUA 1YJ93 3MHEA 1UCKA 3FZWA 5AI1A 4H3UA 4WHAA 4FMCA 1FYSA 1AV4A 2GEXA 2CHCA 3HX8A 5LC7A 1X1WA 2F5MA 4EV5A 3JUNA 1BRHA 3OWUA 4R4KA 1BRSA 2M7OA 3URPA 1JRQA 3H3HA 1RHLA 1I3FA 1NO3A 1UUVB 3FF2A 4LMIA 3WR2A 3G6E3 4HM3B 1MWSA 3G0KA 1WQLB 4N6V0 3EBYA 3LOYA 3GSPA 1LNIA 1O7WB 4STDA 2B1XB 1A2PA 4J5GA 1G02A 5JPPA 3CCL3 1CYUA 1GOYA 2XR8B 1C7HA 2O9UX 5AYSC 4HJLB 1IVUA 4R9KA 3QRDA 2E2UA 3WOEB 1RDSA 2UX0A 3X42A 1O7MB 1IVVA 1PU4A 3LTAA 1YHQ3 1T2IA 2AAEA 1UUGB 4HM2B 3HZPA 3FG3A 4HM0B 3OXAA 4CPKA 2L1SA 3ER7A 3PXMA 2GEYA 1BNSA 1SIIA 5HGRA 5KP3A 2JDIH 5M19A 1QALA 4FMBA 1CQSA 1I70A 1JV2B 1N9JA 3SEDA 2Y74A 3U97A 1JKGA 1I3IA 3CCM3 3FGYA 1OF5B 2KF5A 3Q90A 1U5OA 2CIUA 2UGIA 1D6UA 3JUOA 1IV9A 1ULIB 4G1MB 2CX1A 3X41A 1IT8A 3EJVA 2C10A 1Q42A 1YVSA 3HIIA 4R9LA 3OW22 5AIGA 1ZX2A 3CNXA 3QK9A 4N6NB 3SOAA 1SARA 1W4NA 6RNTA 2BO9B 1HZ1A 5CLKA 1K8A4 4QWTA 2RGQA 4IPBA 3CPOA 1JJ22 1IQ8A 1A2KA 2XRXB 3EB8A 1VQM3 3X3ZA 2RSXA 3EN1B 3EHCA 2WGQA 1PYLA 1EG9B 2STDA 4N6TA 3T8NA 1OGZA 3X3XA 1S5AA 3RGAA 4AEQA 1SPUA 4N3VA 5DREA 2MC8A 1YI23 4OVMA 2GBXB 4WP5A 2C11A 1RGGA 2A15A 1GMPA 3HOHA 2QIYA 1GY5A 3JVCA 2WGOA 3FG4A 2OQEC 4WYKB 3SX1A 4ILFA 2QEX3 3FG1A 3JUPA 1AR0A 5A0OB 1JNQA 1UGHI 1JB5A 1W2ZA 3SYUA 4FCJA 3DMCA 1MNLA 3UL6A 5IF6A 2D1WA 2CFGA 1QVG2 2OWPA 1FGQA 4RNTA 3CCR3 4GSPA 4J8TA 3K7CA 3NV0A 1QVF2 1NDOB 2XH9A 1LRAA 2ZL8A 3CC43 2P0MA 3LYGA 4XB5A 4RNYA 5FGOA 4JF8A 3T0UA 5JBSA 1BAOA 3F7SA 1FGTA 1BSAA 1GY6A 1TFOA 1IU7A 4X2OA 1RGFA 3BNEA 2RCDA 3CME3 1TRPA 2HMLB 3MWZA 2QGUA 3LZAA 3CCE3 2I9WA 7STDA 3DY5A 3GZBA 1N8R4 5GSPA 3LT9A 3NQZA 2UUGC 3DM8A 1MWTA 1OHPA 3GZXB 1ZGXA 1ASKA 1O7NB 3LTBA 5D81A 5HOHA 1FUWA 2D42A 4NPBA 4O2HA 3KKGA 1Q814 2CFLA 3BNBA 2W6JH 1HKXA 4HM1B 1CH0A 1Q9EA 4H61A 1RCLA 5JPUA 1J2BA 2OQEA 2FNQA 3STDA 1AVKA 4HAAA 3KCHA 1RGKA 3NXJA 5DRVA 3CCU3 4HM7B 9RNTA 2H0IA 7RNTA 2CFKA 5BVBA 2GU1A 1ULJB 2IUKA 1X1YA 5G1KA 1IQXA 1N9EA 1NU3A 1O7GB 4FMAA 1NWWA 1Y4KA 2RFRA 3F9SA 4N6MA 3KE7A 4EV2A 1IVWA 1KSIA 2WO0A 1JB4A 3CPW2 3NBRA 2KF4A 1GY7A 1AVLA 3NQYA 1EQKA 1VQ53 3NBBA 1TJDA 2Z7AA 3DUKA 1BOXA 1VQ43 3BNDA 8CHOA 1DVDA 1MGRA 2YFIB 3OX9A 1OACA 3ZFZA 4O8SA 2CKFB 5LC6A 4HM5B 1RJOA 1IV7A 3KZTA 4AKYA 1N5PA 4RNZA 4BL2A 3UJMA 1EEJA 1BU4A 2BU4A 4K1UA 3A5EA 3CD63 4LYLB 1RNTA 5IG5A 1K9M4 3V92A 2W04A 4WWUC 1US1A 3D9RA 5IEPA 1BRKA 1VQL3 2KXGA 3K63A 1R4CA 3F40A 1LQGC 3AHWA 4GB5A 4BTYA 3IMAB 1GS3A 1RGLA 2ML5A 1N8QA 3G4S3 3OWSA 5CF2A 3AGOA 1IK3A 4FCMA 1B2ZA 1LOVA 2BIRA 2IY2A 3WA3A 3G8ZA 3I563 1Q824 4LEHA 5I97A 3EE1A 4FMDA 4HZBB 1KWIA 2OOVC 3DGYA 3TDGA 1YJN3 1BANA 1WNHA 2BHMA 3UNLA 3Q3FA 1IDPA 3GWRA 1JZOA 4KFDA 2ZA4A 3M8CA 3WOFB 1UCLA 1FGMA 5EQLA 2ZHXB
chains in the Genus database with same CATH topology
5EEOA 1WMOA 3MG2A 3U1WA 1EKMA 3MG3A 2GBWB 3S27A 1N5HA 3CCV3 2BMQB 2BT3A 1OF5A 3ALAA 3K9MC 4AKZA 4MJDA 4KVHA 4XBXA 1DMQA 3S28A 3UB1A 2YFJB 3RDEA 3DGNA 3GZYB 2CWVA 1M1XB 1YJW3 2MF7A 2W9QA 3D3LA 5STDA 2K54A 4WFOA 1W6GA 3BNCA 4XDWA 1RKYA 3LH4A 3Q1CA 3Q2PA 4OK0A 5AIHA 4BTXA 1TFKA 5IW9A 2XFTA 1UW1A 2GXFA 1W5ZA 4NREA 2CW9A 2OCTA 2WOFA 3BLZA 1LNHA 3HIGA 4HM4B 1NB5I 3E99A 1A90A 5TGNA 3CCQ3 2LQVA 3F7XA 1OH0A 5IEOA 1GD3A 5IENA 3PYJA 5KP4A 1IT7A 5KP1A 3IJEB 2BMOB 1LVNA 2F86B 3AMOB 3DZLA 3EC9A 3CC23 2XSOB 2ML6A 1WMNA 4OUQA 4JRFA 1E3VA 3EF8A 3BB9A 3LT8A 4X2HA 3WMDA 3JUMA 2SBLA 4EXRA 4HKVB 3N8BA 3ROBA 3CCS3 3VGNA 4HBRA 1KC84 3V98A 2F99A 1DVCA 4XM4A 3SLUA 1JN5A 1QAFA 4K90B 3WODG 4L8PA 1DMNA 1QJGA 3SVAA 1F8NA 1W01A 3DGMA 3FSDA 3OV4A 3X40A 1M1K4 3NBJA 3F8HA 3GZRA 1A67A 3N9HA 2Z76A 3PZWA 4FR9A 3ECFA 2XF3A 1S723 3DGLA 1UI7A 2W0QA 2HMJB 3PCSA 2PZVA 3N54B 3GAXA 3A76A 1Z1SA 3S5CA 3SOYA 1ROAA 2FXTA 4BTWA 2P38A 5IERA 4GL6A 2GU3A 1VZZA 2LYXA 1HU9A 2ZDJA 5ELUA 4CCVA 2QA43 4L7KA 1DMMA 1D6ZA 3PGBA 2IUJA 4MMXB 2Z77A 2P05A 5AIIA 3G713 1O7HB 2CWUA 3H51A 1VQ93 4HYZA 3K0ZA 1VQN3 1YIJ3 3LTDA 3S67A 4EC6A 2V1LA 3RGRA 2P09A 2CH9A 3MKIA 1M9GA 1OPYA 1G96A 1GYBA 2B24B 2O3OA 5IG3A 1W02A 1ROVA 2HMKB 1ISKA 1BUQA 1IQYA 3SXXA 3GRDA 4XDVA 1TIJA 4HM8B 3CCJ3 3X3YA 3UL5A 5G2GA 4R1KA 4MMZB 2W56A 1VQP3 1ZO2A 1OHOA 2OOVA 1YIT3 1W6YA 2P0XA 3KSPA 2OTJ3 1W7CA 3CU3A 2E2VA 2CFWA 3LMLA 2CK3H 5FW5A 2HMMB 4EBGA 2HMNB 4LSOA 4ZM8A 1EA2A 3PCRA 3MG1A 3T8UA 3WDGB 1LXEA 3KFQC 2Y73A 4HZ9B 1A2VA 1RRLA 2CC3A 3AMOA 1Q7Y4 1W6CA 2XSHB 1KQS2 1UUWB 4R80A 1RRHA 1STFI 1VQ83 1JB2A 1V74A 3NM2A 1Q864 1NJI4 3KN4A 1VQ63 5IG0A 6STDA 2WOHA 3B7CA 4N6UA 2IMJA 1FA3A 4XBYA 2OTL3 3DXOA 4L8OA 4MMYB 1SJWA 3JUQA 1E3RA 1FGRA 1PFPA 1W00A 5CK6A 1IVXA 4KZ1A 2YFLB 1SQWA 2F98A 3CC73 2W2CA 3LTCA 4N6OB 2BMRB 4LGQA 1K41A 4TX4A 1TP6A 4NHFA 1K734 3I0YA 3MSOA 3LXUX 1M904 5AEWB 4HVNA 1YGEA 1UI8A 1K28A 4O3VA 1T5YA 2PNCA 3HI7A 1D6YA 3FLJA 2KCDA 3KSED 2W9PA 1Q40A 5AIFA 2CWTA 1CEWI 2Q07A 3IPTA 4I4KA 3NV0B 2Z6BA 3J7Yd 3FF0A 3CNMA 3CMA3 1DYUA 4ORLA 1GD4A 3EX9A 3MPHA 1MOLA 3VF1A 4FCZA 1JN5B 3B8LA 3HK4A 1JKGB 5IG4A 5D82A 1FGOA 1NB3I 3K5TA 3G16A 2YX9A 3PS8A 4N6LA 3CXC2 4IT7A 4CDLA 2K0MA 2E2TA 1LOXA 3NUVA 3WA2X 3FKAA 1KD14 3VSYA 1O7PB 1OCVA 2FGTA 2CG1A 2XEPA 2W03A 1CYVA 4HM6B 4Q53A 1QAKA 1OGXA 2CFDA 3F14A 3O8YA 1Q40B 1OHSA 5AYRB 3S29A 1W2B2 1E97A 2W56B 3L0RA 2XGLA 3FH1A 4K61A 1VQO3 1U8CB 2IA7A 2R4IA 4MEIA 2XFSA 4EYCA 2JQ5A 4U13A 4RBNA 4WYKA 5EVHA 5CXOA 5CF1A 3B4OA 3NHXA 3V99A 3B4PA 1YVBI 5BXQA 1L5GB 4RZMA 3EBTA 1STDA 3FCSB 5ELJA 4IIAA 1TU5A 2CG0A 2HMOB 1WMPA 3KIIA 4KFEA 4LZIA 1VQ73 2INXA 4XBTA 1OUNA 4K1VA 1WTHA 4PEJA 3EN8A 1TUHA 5AEUB 2XGNA 3NM7A 2L4VA 4KFFA 4O02B 5D83A 1RN7A 3DGOA 4J9AA 1QMAA 3F8XA 3EQQB 1SIHA 2KRTA 3I553 1VQK3 2BNGA 3OWYA 3NX0A 3MYTA 1YJ93 3MHEA 3FZWA 5AI1A 4H3UA 4WHAA 4FMCA 5LC7A 1AV4A 2GEXA 2CHCA 3HX8A 4EV5A 3JUNA 3OWUA 4R4KA 2M7OA 1JRQA 3H3HA 1NO3A 1UUVB 3FF2A 4LMIA 3G6E3 4HM3B 3G0KA 1WQLB 4N6V0 3EBYA 3LOYA 1O7WB 4STDA 2B1XB 5JPPA 3CCL3 1CYUA 2XR8B 3X3ZA 1C7HA 2O9UX 5AYSC 4HJLB 1IVUA 4R9KA 3QRDA 2E2UA 3WOEB 2UX0A 3X42A 1O7MB 1IVVA 1PU4A 3LTAA 1YHQ3 4HM2B 3HZPA 3FG3A 4HM0B 3OXAA 3ER7A 3PXMA 2GEYA 1SIIA 5KP3A 5HGRA 2JDIH 1QALA 4FMBA 1CQSA 1JV2B 1N9JA 3SEDA 2Y74A 3U97A 1JKGA 3CCM3 3FGYA 1OF5B 3Q90A 1U5OA 2CIUA 1D6UA 3JUOA 1IV9A 1ULIB 4G1MB 3X41A 1IT8A 3EJVA 2C10A 1Q42A 3HIIA 4R9LA 3OW22 5AIGA 1ZX2A 3CNXA 3QK9A 4N6NB 3SOAA 1W4NA 2BO9B 5CLKA 1K8A4 4QWTA 2RGQA 4IPBA 3CPOA 1JJ22 1IQ8A 1A2KA 2XRXB 3EB8A 1VQM3 2RSXA 3EN1B 3EHCA 2WGQA 3X3XA 1EG9B 2STDA 4N6TA 3T8NA 1OGZA 1S5AA 3RGAA 4AEQA 1SPUA 4N3VA 5DREA 2MC8A 1YI23 4OVMA 2GBXB 4WP5A 2C11A 2A15A 2QIYA 1GY5A 3JVCA 2WGOA 3FG4A 2OQEC 4WYKB 3SX1A 2QEX3 3FG1A 3JUPA 1AR0A 5A0OB 1JNQA 1W2ZA 1JB5A 4FCJA 3DMCA 1MNLA 3UL6A 5IF6A 2D1WA 2CFGA 1QVG2 2OWPA 1FGQA 3CCR3 1VQL3 4J8TA 3K7CA 3NV0A 1QVF2 1NDOB 2XH9A 2ZL8A 3CC43 2P0MA 3LYGA 4XB5A 4RNYA 5FGOA 4JF8A 3T0UA 5JBSA 3F7SA 1FGTA 1GY6A 1TFOA 1IU7A 4X2OA 3BNEA 2RCDA 3CME3 2HMLB 3MWZA 2QGUA 3LZAA 3CCE3 2I9WA 7STDA 3DY5A 3GZBA 1N8R4 3LT9A 3NQZA 3DM8A 3GZXB 1OHPA 1ASKA 1O7NB 3LTBA 5D81A 1FUWA 2D42A 4O2HA 3KKGA 1Q814 2CFLA 3BNBA 2W6JH 1HKXA 4HM1B 4H61A 5JPUA 1J2BA 2OQEA 2FNQA 3STDA 1AVKA 3NXJA 5DRVA 3CCU3 4HM7B 2CFKA 5BVBA 2GU1A 1ULJB 2IUKA 1IQXA 1N9EA 1NU3A 1O7GB 4FMAA 1NWWA 1Y4KA 2RFRA 3F9SA 4N6MA 3KE7A 4EV2A 1IVWA 1KSIA 2WO0A 1JB4A 3CPW2 3NBRA 1GY7A 1AVLA 3NQYA 1EQKA 1VQ53 3NBBA 3DUKA 2Z7AA 1VQ43 3BNDA 8CHOA 1DVDA 2YFIB 3OX9A 1OACA 4O8SA 2CKFB 5LC6A 4HM5B 1RJOA 1IV7A 3KZTA 4AKYA 1N5PA 4RNZA 3UJMA 4K1UA 3CD63 5IG5A 1K9M4 3V92A 2W04A 4WWUC 1US1A 3D9RA 5IEPA 2KXGA 3K63A 1R4CA 3F40A 4BTYA 4GB5A 3IMAB 1GS3A 2ML5A 1N8QA 3G4S3 3OWSA 5CF2A 1IK3A 4FCMA 3I563 3WA3A 3G8ZA 1Q824 4LEHA 5I97A 3EE1A 4FMDA 4HZBB 1KWIA 2OOVC 3TDGA 1YJN3 1WNHA 2BHMA 3UNLA 1IDPA 3GWRA 4KFDA 3M8CA 3WOFB 5EQLA 1FGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG2 A;  1W02 A;  2GBX B;  3MG3 A;  4OVM A;  4WP5 A;  2HMK B;  1ISK A;  1BUQ A;  2A15 A;  2GBW B;  2QIY A;  1GY5 A;  3FH1 A;  3GRD A;  2BMQ B;  1OF5 A;  4WYK B;  4XDV A;  4HM8 B;  4MJD A;  3JUP A;  1AR0 A;  4KVH A;  1JB5 A;  1DMQ A;  2R4I A;  4FCJ A;  3DMC A;  4XBX A;  4R1K A;  5G2G A;  2JQ5 A;  4U13 A;  2YFJ B;  4WYK A;  5EVH A;  5CXO A;  3GZY B;  5CF1 A;  3B4O A;  2OWP A;  3NHX A;  5IF6 A;  1ZO2 A;  4J8T A;  3B4P A;  3K7C A;  1OHO A;  3NV0 A;  3RGA A;  5BXQ A;  1NDO B;  4RZM A;  3EBT A;  1STD A;  1W6Y A;  3KSP A;  4IIA A;  3LYG A;  3CU3 A;  2K54 A;  4XB5 A;  5STD A;  2HMO B;  4XDW A;  3F7S A;  5FW5 A;  2INX A;  2HMM B;  1OUN A;  4XBT A;  1GY6 A;  4K1V A;  4PEJ A;  2HMN B;  5AIH A;  3EN8 A;  4X2O A;  1TUH A;  5AEU B;  1EA2 A;  2RCD A;  2GXF A;  2HML B;  5D83 A;  3MG1 A;  2QGU A;  3T8U A;  3LZA A;  4J9A A;  1QMA A;  3BLZ A;  2I9W A;  7STD A;  4HM4 B;  4HZ9 B;  3F8X A;  3GZB A;  3E99 A;  3EQQ B;  5TGN A;  3DM8 A;  2BNG A;  1OHP A;  2XSH B;  3GZX B;  3OWY A;  3F7X A;  1ASK A;  1O7N B;  1OH0 A;  1UUW B;  3MYT A;  5D81 A;  5IEO A;  3MHE A;  3KKG A;  3FZW A;  5IEN A;  5AI1 A;  5KP4 A;  4H3U A;  5KP1 A;  1JB2 A;  3NM2 A;  1HKX A;  4HM1 B;  2BMO B;  3HX8 A;  2GEX A;  2CHC A;  5IG0 A;  6STD A;  3B7C A;  5JPU A;  2IMJ A;  2F86 B;  3DZL A;  3EC9 A;  3JUN A;  4XBY A;  3OWU A;  3STD A;  2XSO B;  3DXO A;  4L8O A;  1SJW A;  3NXJ A;  3JUQ A;  1E3R A;  3H3H A;  4OUQ A;  4HM7 B;  1E3V A;  1W00 A;  1UUV B;  3BB9 A;  3EF8 A;  3FF2 A;  4LMI A;  4HM3 B;  4X2H A;  3G0K A;  1WQL B;  5BVB A;  1ULJ B;  3EBY A;  5CK6 A;  3JUM A;  3WMD A;  1O7W B;  4STD A;  2B1X B;  1O7G B;  1NU3 A;  2F98 A;  2YFL B;  4HKV B;  3ROB A;  1NWW A;  3F9S A;  2RFR A;  2W2C A;  2BMR B;  3KE7 A;  1K41 A;  4LGQ A;  1TP6 A;  2XR8 B;  3VGN A;  1C7H A;  5JPP A;  2F99 A;  3I0Y A;  3MSO A;  4HJL B;  1JN5 A;  4R9K A;  4XM4 A;  5DRV A;  1JB4 A;  3NBR A;  2UX0 A;  4L8P A;  5AEW B;  1DMN A;  1GY7 A;  1O7M B;  1QJG A;  4HVN A;  1W01 A;  2Z7A A;  3DUK A;  3FSD A;  3OV4 A;  4HM2 B;  3HZP A;  3F8H A;  3GZR A;  4HM0 B;  3OXA A;  3FLJ A;  8CHO A;  2YFI B;  1Q40 A;  3ER7 A;  3OX9 A;  5AIF A;  2Z76 A;  3IPT A;  2GEY A;  3ECF A;  4I4K A;  3NV0 B;  5HGR A;  5KP3 A;  2CKF B;  4HM5 B;  1CQS A;  3KZT A;  3FF0 A;  3CNM A;  3SED A;  2HMJ B;  3UJM A;  2PZV A;  4ORL A;  3S5C A;  3A76 A;  1Z1S A;  4K1U A;  3EX9 A;  1JKG A;  3SOY A;  5IG5 A;  3FGY A;  4WWU C;  1OF5 B;  5IER A;  3Q90 A;  3D9R A;  1U5O A;  5IEP A;  1VZZ A;  3JUO A;  1JN5 B;  3B8L A;  3HK4 A;  1JKG B;  3F40 A;  5IG4 A;  4GB5 A;  1ULI B;  5D82 A;  1GS3 A;  4L7K A;  1DMM A;  3EJV A;  3G16 A;  1Q42 A;  3OWS A;  5CF2 A;  2Z77 A;  4R9L A;  4FCM A;  5AIG A;  5AII A;  4CDL A;  1O7H B;  1ZX2 A;  3H51 A;  3CNX A;  3G8Z A;  3NUV A;  3FKA A;  4LEH A;  3SOA A;  4HZB B;  3K0Z A;  3VSY A;  1O7P B;  1OCV A;  3UNL A;  5CLK A;  2RGQ A;  3CPO A;  1A2K A;  1IDP A;  2XRX B;  3GWR A;  3RGR A;  4HM6 B;  4Q53 A;  3EN1 B;  1OGX A;  3EHC A;  3F14 A;  3M8C A;  3MKI A;  1OPY A;  1EG9 B;  1GYB A;  2B24 B;  2STD A;  1OGZ A;  1OHS A;  1S5A A;  1Q40 B;  3T8N A;  5IG3 A;  5DRE A;  4N3V A;  1E97 A; 
#chains in the Genus database with same CATH topology
 2CX0 A;  1WMO A;  3MG2 A;  5EEO A;  1EKM A;  3MG3 A;  3U1W A;  2GBW B;  1BVI A;  1N5H A;  3S27 A;  2GSP A;  3CCV 3;  2BMQ B;  2BT3 A;  1FZU A;  1OF5 A;  1RGA A;  2KF3 A;  3ALA A;  3K9M C;  1BRN L;  4AKZ A;  4MJD A;  4KVH A;  4XBX A;  1DMQ A;  3S28 A;  3UB1 A;  2YFJ B;  3RDE A;  3DGN A;  3GZY B;  2CWV A;  1BNR A;  1M1X B;  4I5Q A;  1YJW 3;  2MF7 A;  2R41 A;  2W9Q A;  3D3L A;  5STD A;  2K54 A;  4WFO A;  1W6G A;  3BNC A;  4XDW A;  1RKY A;  3LH4 A;  1FW7 A;  3Q1C A;  3Q2P A;  4OK0 A;  1BNI A;  5AIH A;  4BTX A;  1TFK A;  4BL3 A;  5IW9 A;  5BIR A;  2XFT A;  1UW1 A;  2GXF A;  1W5Z A;  2F5W A;  1MWR A;  4NRE A;  4KT3 B;  2CW9 A;  2OCT A;  2WOF A;  3BLZ A;  1LNH A;  5M1A A;  3HIG A;  4HM4 B;  1DE3 A;  1NB5 I;  3D5G A;  3E99 A;  1A90 A;  5TGN A;  3CCQ 3;  3WHO A;  2LQV A;  5M18 A;  1IYY A;  3F7X A;  1OH0 A;  5IEO A;  2F4Y A;  1I0X A;  1GD3 A;  5IEN A;  3PYJ A;  5KP4 A;  1IT7 A;  5KP1 A;  3IJE B;  4DKI A;  2BMO B;  1LVN A;  8RNT A;  1RSN A;  2F86 B;  3AMO B;  1BIR A;  3DZL A;  3EC9 A;  3CC2 3;  1HYF A;  2ML6 A;  2XSO B;  3RNT A;  1FUT A;  1WMN A;  4OUQ A;  4JRF A;  3ZG5 A;  1E3V A;  3BU4 A;  1V57 A;  3BB9 A;  2KAA A;  3EF8 A;  3LT8 A;  1AQZ A;  4X2H A;  3WMD A;  3JUM A;  2SBL A;  1UCJ A;  4EXR A;  4HKV B;  3N8B A;  1TTO A;  3ROB A;  3CCS 3;  3VGN A;  4HBR A;  1RGH A;  1I0V A;  1KC8 4;  3V98 A;  2F99 A;  1DVC A;  1RN1 A;  4J5K A;  1JN5 A;  4XM4 A;  1QAF A;  4K90 B;  3SLU A;  3WOD G;  4L8P A;  3AGN A;  1DMN A;  1QJG A;  1RNB A;  3SVA A;  1I8V A;  1F8N A;  1W01 A;  3DGM A;  3FSD A;  3OV4 A;  3X40 A;  1M1K 4;  3NBJ A;  3F8H A;  3GZR A;  1A67 A;  3N9H A;  2Z76 A;  3PZW A;  4FR9 A;  3ECF A;  2XF3 A;  1S72 3;  3DGL A;  1BRI A;  1VQQ A;  1RMS A;  1UI7 A;  2W0Q A;  2HMJ B;  3PCS A;  2PZV A;  3N54 B;  3GAX A;  3A76 A;  1Z1S A;  3S5C A;  1X1U A;  1ROA A;  2FXT A;  3SOY A;  4BTW A;  5RNT A;  2P38 A;  5IER A;  2KF6 A;  4GL6 A;  2GU3 A;  1VZZ A;  2LYX A;  1HU9 A;  2ZDJ A;  5ELU A;  4CCV A;  1GSP A;  2QA4 3;  4L7K A;  1DMM A;  1D6Z A;  1T3B A;  3PGB A;  2IUJ A;  1I2G A;  4MMX B;  2Z77 A;  2P05 A;  5AII A;  3G71 3;  1O7H B;  2CWU A;  3H51 A;  1VQ9 3;  4HYZ A;  1RTU A;  3K0Z A;  1VQN 3;  1BNG A;  2C4B A;  1YIJ 3;  3LTD A;  3S67 A;  4EC6 A;  1JZD A;  2V1L A;  3RGR A;  2P09 A;  2CH9 A;  1B2X A;  3MKI A;  1M9G A;  1OPY A;  1BGS A;  1G96 A;  1GYB A;  2B24 B;  2O3O A;  5IG3 A;  1BUJ A;  1W02 A;  1ROV A;  2HMK B;  1ISK A;  2SAR A;  1BUQ A;  1IQY A;  3SXX A;  3GRD A;  1LOY A;  1GMQ A;  4XDV A;  1TIJ A;  4HM8 B;  3CCJ 3;  3X3Y A;  3UL5 A;  1I2F A;  4BU4 A;  5G2G A;  5CF1 A;  1GOV A;  4MMZ B;  4R1K A;  2W56 A;  1VQP 3;  1RN4 A;  3AHS A;  1ZO2 A;  1OHO A;  1FUS A;  2K3D A;  2OOV A;  1YIT 3;  1W6Y A;  2P0X A;  3KSP A;  2OTJ 3;  1W7C A;  3CU3 A;  6GSP A;  2E2V A;  2CFW A;  3LML A;  2CK3 H;  5FW5 A;  2HMM B;  4EBG A;  1GMR A;  2HMN B;  1YGW A;  4LSO A;  4ZM8 A;  1EA2 A;  3DH2 A;  1B27 A;  3PCR A;  1UGI A;  3MG1 A;  3T8U A;  3WDG B;  1LXE A;  3KFQ C;  2Y73 A;  4HZ9 B;  1A2V A;  1RRL A;  2CC3 A;  3AMO A;  1Q7Y 4;  1B2U A;  1R4Y A;  1W6C A;  2XSH B;  4BIR A;  1KQS 2;  1UUW B;  1BSB A;  4R80 A;  1RRH A;  1STF I;  1VQ8 3;  1JB2 A;  1V74 A;  3NM2 A;  1Q86 4;  1BRJ A;  1T2H A;  3KN4 A;  1NJI 4;  1B2S A;  1VQ6 3;  1RLS A;  5IG0 A;  1ZS7 A;  2WOH A;  6STD A;  3B7C A;  3BIR A;  2IMJ A;  3D4A A;  4N6U A;  1FA3 A;  4XBY A;  2J8X B;  2OTL 3;  3DXO A;  4L8O A;  4MMY B;  1SJW A;  3JUQ A;  1E3R A;  1FGR A;  1PFP A;  1W00 A;  5CK6 A;  1IVX A;  4KZ1 A;  2YFL B;  1SQW A;  2F98 A;  3CC7 3;  3ZG0 A;  2W2C A;  3LTC A;  4N6O B;  2BMR B;  4LGQ A;  1K41 A;  4TX4 A;  1TP6 A;  4NHF A;  1BNJ A;  3I0Y A;  3MSO A;  3LXU X;  1K73 4;  1M90 4;  1BSE A;  1V58 A;  1RGE A;  4HVN A;  5AEW B;  1YGE A;  1UI8 A;  1K28 A;  4O3V A;  1T5Y A;  1B3S A;  1UDI I;  2PNC A;  3HI7 A;  1D6Y A;  3D79 A;  3FLJ A;  2KCD A;  3KSE D;  2W9P A;  1Q40 A;  5AIF A;  2CWT A;  2H0G A;  1CEW I;  2Q07 A;  1BSD A;  3IPT A;  4I4K A;  1X1X A;  2Z6B A;  3NV0 B;  1MGW A;  1BNE A;  3J7Y d;  3FF0 A;  3CNM A;  3CMA 3;  1B2M A;  1DYU A;  1LQM B;  4ORL A;  2AAD A;  1GD4 A;  2RBI A;  3EX9 A;  3MPH A;  1MOL A;  3VF1 A;  1YNV X;  4FCZ A;  1JN5 B;  3B8L A;  3HK4 A;  1BNF A;  1JKG B;  1BRG A;  5IG4 A;  5D82 A;  1FGO A;  1NB3 I;  3K5T A;  3G16 A;  2YX9 A;  3PS8 A;  4N6L A;  1JBS A;  3CXC 2;  4CJN A;  4IT7 A;  4CDL A;  2K0M A;  2E2T A;  1LOX A;  3NUV A;  3WA2 X;  1B21 A;  3FKA A;  7GSP A;  1KD1 4;  3VSY A;  1O7P B;  1OCV A;  1JBT A;  2FGT A;  5G1L A;  2CG1 A;  2XEP A;  1RGC A;  2W03 A;  4GHO A;  2IYJ A;  4EW5 A;  1RCK A;  5BU4 A;  1BSC A;  1CYV A;  4HM6 B;  4Q53 A;  1QAK A;  1OGX A;  2CFD A;  3F14 A;  3O8Y A;  1Q40 B;  1OHS A;  5AYR B;  3S29 A;  1W2B 2;  1G0T A;  1E97 A;  2W56 B;  3L0R A;  4HOH A;  1LOW A;  2XGL A;  3FH1 A;  4K61 A;  1I2E A;  1VQO 3;  1U8C B;  2HOH A;  2H0H A;  2IA7 A;  2R4I A;  4MEI A;  1UCI A;  1B20 A;  2JQ5 A;  2XFS A;  4U13 A;  4RBN A;  4WYK A;  5CXO A;  5EVH A;  4EYC A;  3B4O A;  1GOU A;  3NHX A;  3V99 A;  2F56 A;  1YVB I;  3B4P A;  5BXQ A;  1L5G B;  4RZM A;  3EBT A;  1STD A;  3FCS B;  5ELJ A;  4IIA A;  1TU5 A;  2CG0 A;  2HMO B;  1WMP A;  3KII A;  4KFE A;  4LZI A;  1PY3 A;  2INX A;  3D5I A;  1OUN A;  4XBT A;  1VQ7 3;  4K1V A;  1WTH A;  4PEJ A;  1TRQ A;  3EN8 A;  1TUH A;  5AEU B;  2XGN A;  3NM7 A;  2L4V A;  2RNT A;  1Q7H A;  4KFF A;  4O02 B;  5D83 A;  1AY7 A;  1RN7 A;  3DGO A;  1JBR A;  1NNV A;  4J9A A;  1QMA A;  1DET A;  3F8X A;  1C54 A;  3EQQ B;  1SIH A;  2KRT A;  3I55 3;  1VQK 3;  1EUI C;  2BNG A;  3OWY A;  3NX0 A;  3MYT A;  1MWU A;  1YJ9 3;  3MHE A;  1UCK A;  3FZW A;  5AI1 A;  4H3U A;  4WHA A;  4FMC A;  1FYS A;  1AV4 A;  2GEX A;  2CHC A;  3HX8 A;  5LC7 A;  1X1W A;  2F5M A;  4EV5 A;  3JUN A;  1BRH A;  3OWU A;  4R4K A;  1BRS A;  2M7O A;  3URP A;  1JRQ A;  3H3H A;  1RHL A;  1I3F A;  1NO3 A;  1UUV B;  3FF2 A;  4LMI A;  3WR2 A;  3G6E 3;  4HM3 B;  1MWS A;  3G0K A;  1WQL B;  4N6V 0;  3EBY A;  3LOY A;  3GSP A;  1LNI A;  1O7W B;  4STD A;  2B1X B;  1A2P A;  4J5G A;  1G02 A;  5JPP A;  3CCL 3;  1CYU A;  1GOY A;  2XR8 B;  1C7H A;  2O9U X;  5AYS C;  4HJL B;  1IVU A;  4R9K A;  3QRD A;  2E2U A;  3WOE B;  1RDS A;  2UX0 A;  3X42 A;  1O7M B;  1IVV A;  1PU4 A;  3LTA A;  1YHQ 3;  1T2I A;  2AAE A;  1UUG B;  4HM2 B;  3HZP A;  3FG3 A;  4HM0 B;  3OXA A;  4CPK A;  2L1S A;  3ER7 A;  3PXM A;  2GEY A;  1BNS A;  1SII A;  5HGR A;  5KP3 A;  2JDI H;  5M19 A;  1QAL A;  4FMB A;  1CQS A;  1I70 A;  1JV2 B;  1N9J A;  3SED A;  2Y74 A;  3U97 A;  1JKG A;  1I3I A;  3CCM 3;  3FGY A;  1OF5 B;  2KF5 A;  3Q90 A;  1U5O A;  2CIU A;  2UGI A;  1D6U A;  3JUO A;  1IV9 A;  1ULI B;  4G1M B;  2CX1 A;  3X41 A;  1IT8 A;  3EJV A;  2C10 A;  1Q42 A;  1YVS A;  3HII A;  4R9L A;  3OW2 2;  5AIG A;  1ZX2 A;  3CNX A;  3QK9 A;  4N6N B;  3SOA A;  1SAR A;  1W4N A;  6RNT A;  2BO9 B;  1HZ1 A;  5CLK A;  1K8A 4;  4QWT A;  2RGQ A;  4IPB A;  3CPO A;  1JJ2 2;  1IQ8 A;  1A2K A;  2XRX B;  3EB8 A;  1VQM 3;  3X3Z A;  2RSX A;  3EN1 B;  3EHC A;  2WGQ A;  1PYL A;  1EG9 B;  2STD A;  4N6T A;  3T8N A;  1OGZ A;  3X3X A;  1S5A A;  3RGA A;  4AEQ A;  1SPU A;  4N3V A;  5DRE A;  2MC8 A;  1YI2 3;  4OVM A;  2GBX B;  4WP5 A;  2C11 A;  1RGG A;  2A15 A;  1GMP A;  3HOH A;  2QIY A;  1GY5 A;  3JVC A;  2WGO A;  3FG4 A;  2OQE C;  4WYK B;  3SX1 A;  4ILF A;  2QEX 3;  3FG1 A;  3JUP A;  1AR0 A;  5A0O B;  1JNQ A;  1UGH I;  1JB5 A;  1W2Z A;  3SYU A;  4FCJ A;  3DMC A;  1MNL A;  3UL6 A;  5IF6 A;  2D1W A;  2CFG A;  1QVG 2;  2OWP A;  1FGQ A;  4RNT A;  3CCR 3;  4GSP A;  4J8T A;  3K7C A;  3NV0 A;  1QVF 2;  1NDO B;  2XH9 A;  1LRA A;  2ZL8 A;  3CC4 3;  2P0M A;  3LYG A;  4XB5 A;  4RNY A;  5FGO A;  4JF8 A;  3T0U A;  5JBS A;  1BAO A;  3F7S A;  1FGT A;  1BSA A;  1GY6 A;  1TFO A;  1IU7 A;  4X2O A;  1RGF A;  3BNE A;  2RCD A;  3CME 3;  1TRP A;  2HML B;  3MWZ A;  2QGU A;  3LZA A;  3CCE 3;  2I9W A;  7STD A;  3DY5 A;  3GZB A;  1N8R 4;  5GSP A;  3LT9 A;  3NQZ A;  2UUG C;  3DM8 A;  1MWT A;  1OHP A;  3GZX B;  1ZGX A;  1ASK A;  1O7N B;  3LTB A;  5D81 A;  5HOH A;  1FUW A;  2D42 A;  4NPB A;  4O2H A;  3KKG A;  1Q81 4;  2CFL A;  3BNB A;  2W6J H;  1HKX A;  4HM1 B;  1CH0 A;  1Q9E A;  4H61 A;  1RCL A;  5JPU A;  1J2B A;  2OQE A;  2FNQ A;  3STD A;  1AVK A;  4HAA A;  3KCH A;  1RGK A;  3NXJ A;  5DRV A;  3CCU 3;  4HM7 B;  9RNT A;  2H0I A;  7RNT A;  2CFK A;  5BVB A;  2GU1 A;  1ULJ B;  2IUK A;  1X1Y A;  5G1K A;  1IQX A;  1N9E A;  1NU3 A;  1O7G B;  4FMA A;  1NWW A;  1Y4K A;  2RFR A;  3F9S A;  4N6M A;  3KE7 A;  4EV2 A;  1IVW A;  1KSI A;  2WO0 A;  1JB4 A;  3CPW 2;  3NBR A;  2KF4 A;  1GY7 A;  1AVL A;  3NQY A;  1EQK A;  1VQ5 3;  3NBB A;  1TJD A;  2Z7A A;  3DUK A;  1BOX A;  1VQ4 3;  3BND A;  8CHO A;  1DVD A;  1MGR A;  2YFI B;  3OX9 A;  1OAC A;  3ZFZ A;  4O8S A;  2CKF B;  5LC6 A;  4HM5 B;  1RJO A;  1IV7 A;  3KZT A;  4AKY A;  1N5P A;  4RNZ A;  4BL2 A;  3UJM A;  1EEJ A;  1BU4 A;  2BU4 A;  4K1U A;  3A5E A;  3CD6 3;  4LYL B;  1RNT A;  5IG5 A;  1K9M 4;  3V92 A;  2W04 A;  4WWU C;  1US1 A;  3D9R A;  5IEP A;  1BRK A;  1VQL 3;  2KXG A;  3K63 A;  1R4C A;  3F40 A;  1LQG C;  3AHW A;  4GB5 A;  4BTY A;  3IMA B;  1GS3 A;  1RGL A;  2ML5 A;  1N8Q A;  3G4S 3;  3OWS A;  5CF2 A;  3AGO A;  1IK3 A;  4FCM A;  1B2Z A;  1LOV A;  2BIR A;  2IY2 A;  3WA3 A;  3G8Z A;  3I56 3;  1Q82 4;  4LEH A;  5I97 A;  3EE1 A;  4FMD A;  4HZB B;  1KWI A;  2OOV C;  3DGY A;  3TDG A;  1YJN 3;  1BAN A;  1WNH A;  2BHM A;  3UNL A;  3Q3F A;  1IDP A;  3GWR A;  1JZO A;  4KFD A;  2ZA4 A;  3M8C A;  3WOF B;  1UCL A;  1FGM A;  5EQL A;  2ZHX B; 
#chains in the Genus database with same CATH homology
 5EEO A;  1WMO A;  3MG2 A;  3U1W A;  1EKM A;  3MG3 A;  2GBW B;  3S27 A;  1N5H A;  3CCV 3;  2BMQ B;  2BT3 A;  1OF5 A;  3ALA A;  3K9M C;  4AKZ A;  4MJD A;  4KVH A;  4XBX A;  1DMQ A;  3S28 A;  3UB1 A;  2YFJ B;  3RDE A;  3DGN A;  3GZY B;  2CWV A;  1M1X B;  1YJW 3;  2MF7 A;  2W9Q A;  3D3L A;  5STD A;  2K54 A;  4WFO A;  1W6G A;  3BNC A;  4XDW A;  1RKY A;  3LH4 A;  3Q1C A;  3Q2P A;  4OK0 A;  5AIH A;  4BTX A;  1TFK A;  5IW9 A;  2XFT A;  1UW1 A;  2GXF A;  1W5Z A;  4NRE A;  2CW9 A;  2OCT A;  2WOF A;  3BLZ A;  1LNH A;  3HIG A;  4HM4 B;  1NB5 I;  3E99 A;  1A90 A;  5TGN A;  3CCQ 3;  2LQV A;  3F7X A;  1OH0 A;  5IEO A;  1GD3 A;  5IEN A;  3PYJ A;  5KP4 A;  1IT7 A;  5KP1 A;  3IJE B;  2BMO B;  1LVN A;  2F86 B;  3AMO B;  3DZL A;  3EC9 A;  3CC2 3;  2XSO B;  2ML6 A;  1WMN A;  4OUQ A;  4JRF A;  1E3V A;  3EF8 A;  3BB9 A;  3LT8 A;  4X2H A;  3WMD A;  3JUM A;  2SBL A;  4EXR A;  4HKV B;  3N8B A;  3ROB A;  3CCS 3;  3VGN A;  4HBR A;  1KC8 4;  3V98 A;  2F99 A;  1DVC A;  4XM4 A;  3SLU A;  1JN5 A;  1QAF A;  4K90 B;  3WOD G;  4L8P A;  1DMN A;  1QJG A;  3SVA A;  1F8N A;  1W01 A;  3DGM A;  3FSD A;  3OV4 A;  3X40 A;  1M1K 4;  3NBJ A;  3F8H A;  3GZR A;  1A67 A;  3N9H A;  2Z76 A;  3PZW A;  4FR9 A;  3ECF A;  2XF3 A;  1S72 3;  3DGL A;  1UI7 A;  2W0Q A;  2HMJ B;  3PCS A;  2PZV A;  3N54 B;  3GAX A;  3A76 A;  1Z1S A;  3S5C A;  3SOY A;  1ROA A;  2FXT A;  4BTW A;  2P38 A;  5IER A;  4GL6 A;  2GU3 A;  1VZZ A;  2LYX A;  1HU9 A;  2ZDJ A;  5ELU A;  4CCV A;  2QA4 3;  4L7K A;  1DMM A;  1D6Z A;  3PGB A;  2IUJ A;  4MMX B;  2Z77 A;  2P05 A;  5AII A;  3G71 3;  1O7H B;  2CWU A;  3H51 A;  1VQ9 3;  4HYZ A;  3K0Z A;  1VQN 3;  1YIJ 3;  3LTD A;  3S67 A;  4EC6 A;  2V1L A;  3RGR A;  2P09 A;  2CH9 A;  3MKI A;  1M9G A;  1OPY A;  1G96 A;  1GYB A;  2B24 B;  2O3O A;  5IG3 A;  1W02 A;  1ROV A;  2HMK B;  1ISK A;  1BUQ A;  1IQY A;  3SXX A;  3GRD A;  4XDV A;  1TIJ A;  4HM8 B;  3CCJ 3;  3X3Y A;  3UL5 A;  5G2G A;  4R1K A;  4MMZ B;  2W56 A;  1VQP 3;  1ZO2 A;  1OHO A;  2OOV A;  1YIT 3;  1W6Y A;  2P0X A;  3KSP A;  2OTJ 3;  1W7C A;  3CU3 A;  2E2V A;  2CFW A;  3LML A;  2CK3 H;  5FW5 A;  2HMM B;  4EBG A;  2HMN B;  4LSO A;  4ZM8 A;  1EA2 A;  3PCR A;  3MG1 A;  3T8U A;  3WDG B;  1LXE A;  3KFQ C;  2Y73 A;  4HZ9 B;  1A2V A;  1RRL A;  2CC3 A;  3AMO A;  1Q7Y 4;  1W6C A;  2XSH B;  1KQS 2;  1UUW B;  4R80 A;  1RRH A;  1STF I;  1VQ8 3;  1JB2 A;  1V74 A;  3NM2 A;  1Q86 4;  1NJI 4;  3KN4 A;  1VQ6 3;  5IG0 A;  6STD A;  2WOH A;  3B7C A;  4N6U A;  2IMJ A;  1FA3 A;  4XBY A;  2OTL 3;  3DXO A;  4L8O A;  4MMY B;  1SJW A;  3JUQ A;  1E3R A;  1FGR A;  1PFP A;  1W00 A;  5CK6 A;  1IVX A;  4KZ1 A;  2YFL B;  1SQW A;  2F98 A;  3CC7 3;  2W2C A;  3LTC A;  4N6O B;  2BMR B;  4LGQ A;  1K41 A;  4TX4 A;  1TP6 A;  4NHF A;  1K73 4;  3I0Y A;  3MSO A;  3LXU X;  1M90 4;  5AEW B;  4HVN A;  1YGE A;  1UI8 A;  1K28 A;  4O3V A;  1T5Y A;  2PNC A;  3HI7 A;  1D6Y A;  3FLJ A;  2KCD A;  3KSE D;  2W9P A;  1Q40 A;  5AIF A;  2CWT A;  1CEW I;  2Q07 A;  3IPT A;  4I4K A;  3NV0 B;  2Z6B A;  3J7Y d;  3FF0 A;  3CNM A;  3CMA 3;  1DYU A;  4ORL A;  1GD4 A;  3EX9 A;  3MPH A;  1MOL A;  3VF1 A;  4FCZ A;  1JN5 B;  3B8L A;  3HK4 A;  1JKG B;  5IG4 A;  5D82 A;  1FGO A;  1NB3 I;  3K5T A;  3G16 A;  2YX9 A;  3PS8 A;  4N6L A;  3CXC 2;  4IT7 A;  4CDL A;  2K0M A;  2E2T A;  1LOX A;  3NUV A;  3WA2 X;  3FKA A;  1KD1 4;  3VSY A;  1O7P B;  1OCV A;  2FGT A;  2CG1 A;  2XEP A;  2W03 A;  1CYV A;  4HM6 B;  4Q53 A;  1QAK A;  1OGX A;  2CFD A;  3F14 A;  3O8Y A;  1Q40 B;  1OHS A;  5AYR B;  3S29 A;  1W2B 2;  1E97 A;  2W56 B;  3L0R A;  2XGL A;  3FH1 A;  4K61 A;  1VQO 3;  1U8C B;  2IA7 A;  2R4I A;  4MEI A;  2XFS A;  4EYC A;  2JQ5 A;  4U13 A;  4RBN A;  4WYK A;  5EVH A;  5CXO A;  5CF1 A;  3B4O A;  3NHX A;  3V99 A;  3B4P A;  1YVB I;  5BXQ A;  1L5G B;  4RZM A;  3EBT A;  1STD A;  3FCS B;  5ELJ A;  4IIA A;  1TU5 A;  2CG0 A;  2HMO B;  1WMP A;  3KII A;  4KFE A;  4LZI A;  1VQ7 3;  2INX A;  4XBT A;  1OUN A;  4K1V A;  1WTH A;  4PEJ A;  3EN8 A;  1TUH A;  5AEU B;  2XGN A;  3NM7 A;  2L4V A;  4KFF A;  4O02 B;  5D83 A;  1RN7 A;  3DGO A;  4J9A A;  1QMA A;  3F8X A;  3EQQ B;  1SIH A;  2KRT A;  3I55 3;  1VQK 3;  2BNG A;  3OWY A;  3NX0 A;  3MYT A;  1YJ9 3;  3MHE A;  3FZW A;  5AI1 A;  4H3U A;  4WHA A;  4FMC A;  5LC7 A;  1AV4 A;  2GEX A;  2CHC A;  3HX8 A;  4EV5 A;  3JUN A;  3OWU A;  4R4K A;  2M7O A;  1JRQ A;  3H3H A;  1NO3 A;  1UUV B;  3FF2 A;  4LMI A;  3G6E 3;  4HM3 B;  3G0K A;  1WQL B;  4N6V 0;  3EBY A;  3LOY A;  1O7W B;  4STD A;  2B1X B;  5JPP A;  3CCL 3;  1CYU A;  2XR8 B;  3X3Z A;  1C7H A;  2O9U X;  5AYS C;  4HJL B;  1IVU A;  4R9K A;  3QRD A;  2E2U A;  3WOE B;  2UX0 A;  3X42 A;  1O7M B;  1IVV A;  1PU4 A;  3LTA A;  1YHQ 3;  4HM2 B;  3HZP A;  3FG3 A;  4HM0 B;  3OXA A;  3ER7 A;  3PXM A;  2GEY A;  1SII A;  5KP3 A;  5HGR A;  2JDI H;  1QAL A;  4FMB A;  1CQS A;  1JV2 B;  1N9J A;  3SED A;  2Y74 A;  3U97 A;  1JKG A;  3CCM 3;  3FGY A;  1OF5 B;  3Q90 A;  1U5O A;  2CIU A;  1D6U A;  3JUO A;  1IV9 A;  1ULI B;  4G1M B;  3X41 A;  1IT8 A;  3EJV A;  2C10 A;  1Q42 A;  3HII A;  4R9L A;  3OW2 2;  5AIG A;  1ZX2 A;  3CNX A;  3QK9 A;  4N6N B;  3SOA A;  1W4N A;  2BO9 B;  5CLK A;  1K8A 4;  4QWT A;  2RGQ A;  4IPB A;  3CPO A;  1JJ2 2;  1IQ8 A;  1A2K A;  2XRX B;  3EB8 A;  1VQM 3;  2RSX A;  3EN1 B;  3EHC A;  2WGQ A;  3X3X A;  1EG9 B;  2STD A;  4N6T A;  3T8N A;  1OGZ A;  1S5A A;  3RGA A;  4AEQ A;  1SPU A;  4N3V A;  5DRE A;  2MC8 A;  1YI2 3;  4OVM A;  2GBX B;  4WP5 A;  2C11 A;  2A15 A;  2QIY A;  1GY5 A;  3JVC A;  2WGO A;  3FG4 A;  2OQE C;  4WYK B;  3SX1 A;  2QEX 3;  3FG1 A;  3JUP A;  1AR0 A;  5A0O B;  1JNQ A;  1W2Z A;  1JB5 A;  4FCJ A;  3DMC A;  1MNL A;  3UL6 A;  5IF6 A;  2D1W A;  2CFG A;  1QVG 2;  2OWP A;  1FGQ A;  3CCR 3;  1VQL 3;  4J8T A;  3K7C A;  3NV0 A;  1QVF 2;  1NDO B;  2XH9 A;  2ZL8 A;  3CC4 3;  2P0M A;  3LYG A;  4XB5 A;  4RNY A;  5FGO A;  4JF8 A;  3T0U A;  5JBS A;  3F7S A;  1FGT A;  1GY6 A;  1TFO A;  1IU7 A;  4X2O A;  3BNE A;  2RCD A;  3CME 3;  2HML B;  3MWZ A;  2QGU A;  3LZA A;  3CCE 3;  2I9W A;  7STD A;  3DY5 A;  3GZB A;  1N8R 4;  3LT9 A;  3NQZ A;  3DM8 A;  3GZX B;  1OHP A;  1ASK A;  1O7N B;  3LTB A;  5D81 A;  1FUW A;  2D42 A;  4O2H A;  3KKG A;  1Q81 4;  2CFL A;  3BNB A;  2W6J H;  1HKX A;  4HM1 B;  4H61 A;  5JPU A;  1J2B A;  2OQE A;  2FNQ A;  3STD A;  1AVK A;  3NXJ A;  5DRV A;  3CCU 3;  4HM7 B;  2CFK A;  5BVB A;  2GU1 A;  1ULJ B;  2IUK A;  1IQX A;  1N9E A;  1NU3 A;  1O7G B;  4FMA A;  1NWW A;  1Y4K A;  2RFR A;  3F9S A;  4N6M A;  3KE7 A;  4EV2 A;  1IVW A;  1KSI A;  2WO0 A;  1JB4 A;  3CPW 2;  3NBR A;  1GY7 A;  1AVL A;  3NQY A;  1EQK A;  1VQ5 3;  3NBB A;  3DUK A;  2Z7A A;  1VQ4 3;  3BND A;  8CHO A;  1DVD A;  2YFI B;  3OX9 A;  1OAC A;  4O8S A;  2CKF B;  5LC6 A;  4HM5 B;  1RJO A;  1IV7 A;  3KZT A;  4AKY A;  1N5P A;  4RNZ A;  3UJM A;  4K1U A;  3CD6 3;  5IG5 A;  1K9M 4;  3V92 A;  2W04 A;  4WWU C;  1US1 A;  3D9R A;  5IEP A;  2KXG A;  3K63 A;  1R4C A;  3F40 A;  4BTY A;  4GB5 A;  3IMA B;  1GS3 A;  2ML5 A;  1N8Q A;  3G4S 3;  3OWS A;  5CF2 A;  1IK3 A;  4FCM A;  3I56 3;  3WA3 A;  3G8Z A;  1Q82 4;  4LEH A;  5I97 A;  3EE1 A;  4FMD A;  4HZB B;  1KWI A;  2OOV C;  3TDG A;  1YJN 3;  1WNH A;  2BHM A;  3UNL A;  1IDP A;  3GWR A;  4KFD A;  3M8C A;  3WOF B;  5EQL A;  1FGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...