1LXEA

Crystal structure of the cathelicidin motif of protegrins
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
92
Chain Sequence
ALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDDITCNEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protegrin-3 precursor
publication title Structure of the cathelicidin motif of protegrin-3 precursor: structural insights into the activation mechanism of an antimicrobial protein.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Antimicrobial protein
total genus 15
structure length 92
sequence length 98
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1lxeA00
1N9JA 1NB3I 4IT7A 4EYCA 1ROAA 3LH4A 4CCVA 2CH9A 1MOLA 3GAXA 1DVDA 1CEWI 3K9MC 3UL6A 3PS8A 1RN7A 1N5HA 1N5PA 1STFI 4N6MA 1M9GA 5ELUA 1WNHA 3IMAB 1FUWA 4N6V0 5LC6A 1TIJA 3PXMA 3MWZA 1G96A 4N6TA 2W9QA 4N6LA 3PYJA 5ELJA 1YVBI 1GD3A 2OCTA 2KXGA 1EQKA 3QRDA 1A90A 1CYVA 3UL5A 3L0RA 4TX4A 1NB5I 3S67A 3SVAA 1IV9A 4N6UA 5LC7A 4ZM8A 3KFQC 1A67A 1KWIA 1FA3A 5EQLA 4N6OB 1R4CA 2BO9B 1PFPA 1CYUA 2O9UX 1DVCA 4LZIA 1MNLA 1LXEA 2W9PA 3KSED 4N6NB 3NX0A 3Q2PA 1IV7A 5A0OB 1GD4A
chains in the Genus database with same CATH superfamily
1N9JA 3STDA 3EQQB 3F8HA 2SBLA 1ZGXA 1UGIA 2GEXA 4HKVB 2MC8A 4EXRA 5IW9A 1ROAA 2E2VA 1O7HB 1ISKA 2CH9A 2P0XA 1K28A 1AY7A 2KRTA 4HZBB 4EC6A 5AEWB 5CF1A 1BRHA 1FUSA 3GAXA 3JVCA 5JBSA 1M1K4 4HM2B 4FCJA 4R9KA 1I2GA 3EF8A 1BNSA 2P38A 3KIIA 3F14A 2W56A 1MWRA 3A5EA 4O3VA 1RNTA 2Q07A 2FNQA 2IY2A 4RNYA 1B21A 1A2KA 1W6GA 3PS8A 3KKGA 1RN7A 4LSOA 1BUJA 1OHSA 1RHLA 1JZOA 2XGLA 3PGBA 2HMLB 2WGOA 3WA2X 3ZG5A 1YNVX 1OGXA 1NNVA 1M9GA 3CPW2 2F98A 1RN4A 1WNHA 4GHOA 4J5KA 1KSIA 2XEPA 4N6V0 3URPA 1GMPA 5LC6A 1EKMA 3WHOA 2PNCA 4O8SA 3F9SA 2L4VA 4HBRA 3CNXA 3AGOA 3PXMA 3WR2A 2RCDA 2C11A 4FMCA 3EC9A 3QK9A 2BHMA 4MMXB 3DGMA 3DH2A 3V99A 3EBTA 2FXTA 1O7NB 3X3YA 1SPUA 4WWUC 3OWUA 5EEOA 1W2ZA 3PYJA 1N8R4 1U8CB 3X3ZA 3GZBA 3AHWA 5ELJA 2Z6BA 1S723 1LRAA 3VF1A 3CME3 3WA3A 2OCTA 5CF2A 4EBGA 1TU5A 1VQ53 3CD63 1W6CA 2CX1A 1IVWA 3G16A 5IG0A 2CFLA 2CFDA 1T5YA 1BNRA 3PCRA 1IVUA 1X1WA 1VQ73 5FGOA 2Z7AA 3PCSA 4HOHA 1UUGB 3UL5A 1BNIA 1OF5B 3B4PA 5BVBA 5AIIA 4OVMA 1IQYA 1BRSA 2W2CA 2YFLB 1DMMA 4K61A 2ML5A 4NPBA 3U97A 3ER7A 3H3HA 1Q814 3DZLA 2Y73A 4HM6B 4WFOA 2GU1A 1D6UA 4BTYA 6RNTA 1IDPA 1JKGA 1ASKA 3GZXB 2KF4A 2F5MA 1BVIA 2XSOB 2XF3A 4ZM8A 1RLSA 3FF2A 1Q40A 1I3IA 1WMNA 4HM0B 2CK3H 3IJEB 3Q1CA 1ULJB 5EQLA 2YFIB 1HKXA 5D81A 2XH9A 4N6OB 1VQN3 1K734 3CPOA 1RGAA 1R4YA 2O3OA 1B2UA 4K1VA 3MG3A 2WGQA 3KZTA 1A2PA 1X1XA 4HAAA 1DETA 1RRLA 2B24B 2D1WA 2SARA 1PFPA 5KP3A 3OWSA 5IENA 1Q7Y4 1IYYA 1E97A 1RGHA 9RNTA 4NHFA 2F99A 3JUMA 1T3BA 1K8A4 3KSED 3A76A 2XFTA 4U13A 2W56B 2D42A 2CKFB 1F8NA 4EV5A 1DMNA 4JRFA 1WTHA 3F7XA 3VGNA 1VQ93 2HMNB 1PYLA 3JUPA 3G4S3 1GD4A 1W4NA 1I0VA 5IG3A 4R4KA 1BRGA 2WO0A 4MMYB 4IT7A 1QJGA 1US1A 7RNTA 1CH0A 3NV0A 2FGTA 1X1UA 3ALAA 1BRKA 4L8PA 4EYCA 4H61A 2RFRA 2BMOB 2K3DA 3LH4A 4CCVA 1WMPA 1FGRA 3LMLA 2B1XB 2CW9A 1BSBA 3BB9A 1W01A 2GSPA 4DKIA 3D5GA 3EHCA 5STDA 1VQP3 2OOVC 8RNTA 2J8XB 2CG0A 1RGLA 2I9WA 3RGRA 5IF6A 1HYFA 1N5PA 3BNCA 3X40A 1Y4KA 1D6YA 1Q9EA 1YGWA 3CNMA 3OXAA 4HJLB 4L8OA 4N6MA 1GY5A 1BU4A 1LNIA 2RNTA 3CCQ3 1BANA 3SX1A 2YFJB 4XB5A 1BSAA 3X3XA 1VQM3 3BNDA 2AADA 2QIYA 1UDII 3NM7A 5AIFA 3IMAB 2W04A 1FUWA 1B2ZA 3Q90A 4HM3B 3G6E3 3D9RA 3DGLA 2LQVA 1MWTA 3F8XA 3Q3FA 4WYKA 1QAKA 1RGCA 2CIUA 2Y74A 7STDA 1I8VA 2RSXA 1FUTA 1UGHI 2H0HA 4L7KA 4MJDA 1G96A 1NU3A 4GB5A 4I4KA 2W9QA 1FYSA 3BLZA 3NQZA 4O2HA 3V92A 2HMJB 2KF5A 4KFEA 1JKGB 3GZYB 2ZDJA 3OWYA 1V74A 5KP4A 1RGEA 1DYUA 1Q40B 6STDA 1UI7A 1VQ83 3H51A 4JF8A 2OQEC 5AI1A 5RNTA 3DM8A 3ROBA 1RRHA 5AYRB 1JV2B 5AYSC 3OW22 1JJ22 3UB1A 1J2BA 3BNEA 1STDA 3MPHA 2CFKA 1K9M4 3CCR3 5JPPA 1ZS7A 1C54A 3VSYA 3AMOA 4HYZA 2STDA 3B7CA 5DREA 1LOYA 1GY6A 1DE3A 1LOWA 4BTXA 5LC7A 1OHOA 1QVF2 2INXA 1UCIA 1AQZA 1ULIB 3LT9A 2HMKB 1EEJA 4STDA 4WP5A 3DXOA 2BIRA 1JB2A 4KFDA 5G1KA 3WODG 3HIIA 1RGFA 3M8CA 2IUJA 3JUQA 3CC43 1RKYA 3G0KA 1MWUA 1Q42A 3O8YA 1BNJA 2Z77A 1IU7A 1PU4A 1AV4A 3T8NA 3D3LA 5TGNA 1GMQA 1MGRA 5CK6A 2WOHA 1EUIC 5KP1A 3CCL3 1OACA 3NV0B 4X2HA 3MG1A 1LOVA 3NBRA 5IG5A 4BL2A 2K54A 3JUNA 1BGSA 4IIAA 1GSPA 2XSHB 3CCV3 5M19A 3FKAA 4CPKA 2C4BA 2O9UX 2YX9A 3N8BA 2OOVA 6GSPA 2W6JH 4FCZA 3LT8A 1YJN3 1LQMB 2UUGC 3NUVA 5G1LA 1YIT3 1B27A 2GU3A 5AIHA 1BRJA 1UUWB 1MWSA 2W9PA 2QA43 1NWWA 3SOAA 1B2SA 4N3VA 1B2MA 4LEHA 3NX0A 1IT7A 2H0IA 2W03A 1Q7HA 3K0ZA 5A0OB 5IERA 1OHPA 1V57A 4HM8B 3GWRA 1GMRA 4LGQA 4GL6A 1SJWA 4G1MB 1SARA 1EG9B 1HZ1A 1QAFA 2HOHA 3HI7A 1LQGC 3LTCA 1VQK3 2CFWA 1FZUA 4R1KA 3HK4A 1MOLA 4HZ9B 5DRVA 3F7SA 2KCDA 2R4IA 4ORLA 4WYKB 1UW1A 1G02A 3T8UA 1UUVB 2F86B 1U5OA 2LYXA 3FCSB 3I553 1WQLB 3K9MC 3UL6A 3EJVA 1OPYA 1FW7A 3CCS3 1I70A 4IPBA 3WOEB 1RCLA 1N5HA 2BT3A 3FG1A 4BTWA 1JBTA 1STFI 1ROVA 1JN5A 1RSNA 3V98A 1IK3A 1JBRA 3G713 1UCKA 1S5AA 1IVXA 5AIGA 5FW5A 1KC84 2IUKA 2XGNA 1SQWA 3BIRA 1IT8A 3CCU3 2CFGA 1BNEA 1I2FA 5AEUB 1BRNL 1WMOA 5IG4A 4FMDA 4R80A 3AMOB 1I0XA 3B8LA 3ECFA 3NQYA 2RGQA 1M1XB 3MWZA 1YI23 5EVHA 4X2OA 4XDWA 2ZL8A 3NBJA 1IVVA 4N6LA 2OTL3 3SXXA 1D6ZA 2ZA4A 3D4AA 4AEQA 1NJI4 3KSPA 4I5QA 2ZHXB 3DY5A 3LTBA 3LYGA 2BNGA 4GSPA 3FZWA 1O7MB 3S29A 3JUOA 4RBNA 3ZG0A 2UX0A 1JNQA 3SLUA 3K63A 1QMAA 1RGGA 3UNLA 1A90A 1CYVA 1ZO2A 2BMRB 5BU4A 1W2B2 2F5WA 1IQ8A 4TX4A 1NB5I 3KE7A 3WMDA 1SIIA 3S67A 1O7GB 3DGNA 5CLKA 3PZWA 2W0QA 1Q864 1IV9A 3AGNA 3MSOA 3E99A 4N6UA 1O7WB 1GY7A 2V1LA 2QEX3 1ZX2A 4MMZB 4XBYA 5HGRA 1AR0A 2R41A 5CXOA 2E2UA 3K7CA 4FMBA 1JB4A 1A67A 2KF6A 5G2GA 2CWUA 4XDVA 4K1UA 3RNTA 3EBYA 1BSDA 3MKIA 4AKYA 1GYBA 4WHAA 4R9LA 4J9AA 3SEDA 3FG3A 1OGZA 3CMA3 2ML6A 1VQQA 1OUNA 3B4OA 2GBXB 3S5CA 1NO3A 3SYUA 4MEIA 3MYTA 1W5ZA 3K5TA 3CC23 1JB5A 3SOYA 1PY3A 2KAAA 2RBIA 1R4CA 2BO9B 3DGYA 3CU3A 1TUHA 4KVHA 3CC73 2KF3A 3FF0A 1YHQ3 3I0YA 3KCHA 1RNBA 1YVSA 1Q824 2M7OA 1N9EA 1DVCA 4KZ1A 4K90B 3S27A 4LZIA 4RNTA 1N8QA 1MNLA 3FH1A 3GRDA 3BNBA 1VZZA 2Z76A 4O02B 1LXEA 5GSPA 3TDGA 3EN1B 1B2XA 4AKZA 3FLJA 3Q2PA 4KT3B 1FGTA 1LOXA 1RMSA 1CQSA 3FSDA 4HM4B 1SIHA 1BOXA 1V58A 4J5GA 3HIGA 1JN5B 2F56A 3MHEA 2QGUA 1NB3I 2P05A 2CC3A 2CWTA 3LTAA 4FR9A 2HMMB 1JRQA 3I563 3HOHA 1RJOA 3FG4A 1YIJ3 2P09A 4EV2A 5HOHA 3EE1A 4J8TA 4RNZA 1YJ93 4XBTA 1DVDA 1QALA 4ILFA 4HM1B 1CEWI 1AVKA 2BMQB 2XFSA 3DUKA 3S28A 3X42A 3GSPA 1X1YA 3BU4A 3IPTA 4Q53A 2OWPA 3MG2A 5BIRA 3NBBA 4FMAA 1G0TA 5M1AA 1RGKA 1FGQA 1UCJA 3GZRA 1T2IA 1VQO3 1FGOA 2GBWB 1BSCA 5ELUA 3CCE3 3U1WA 8CHOA 3EB8A 4LMIA 2JDIH 3EX9A 3DGOA 1BIRA 3J7Yd 1E3RA 1B3SA 1UI8A 1TRQA 1OCVA 3HX8A 1M904 1TIJA 3UJMA 1TRPA 2E2TA 3RDEA 2GEYA 1VQ63 2OTJ3 1TFOA 1BSEA 4N6TA 1RTUA 1TFKA 1Z1SA 3HZPA 1K41A 2IMJA 3ZFZA 3WOFB 1EA2A 3D5IA 2K0MA 3NXJA 2OQEA 2C10A 1W7CA 1YVBI 3LTDA 4XBXA 1GD3A 1RN1A 5D83A 2KXGA 1BNFA 3D79A 3KN4A 3N9HA 5I97A 1JBSA 4EW5A 2GXFA 1BNGA 5IEPA 1EQKA 2PZVA 2XR8B 1I2EA 3CXC2 3RGAA 3QRDA 1RDSA 1W00A 4BIRA 5BXQA 1MGWA 2H0GA 1BAOA 3L0RA 4XM4A 1KQS2 5JPUA 3CCJ3 2AAEA 3EN8A 3SVAA 4HVNA 1IQXA 1UCLA 2BU4A 1E3VA 2JQ5A 2P0MA 4QWTA 1DMQA 3CCM3 1TTOA 5M18A 4BL3A 2CHCA 2L1SA 1LVNA 3KFQC 2CG1A 7GSPA 3LXUX 1W6YA 3LOYA 4PEJA 5IEOA 1KWIA 1VQL3 1FA3A 1BRIA 1YJW3 1GOYA 1YGEA 2XRXB 1L5GB 1A2VA 1I3FA 1GS3A 3LZAA 4NREA 4RZMA 4BU4A 3N54B 1C7HA 1LNHA 1RCKA 1OF5A 3FGYA 3T0UA 3AHSA 3G8ZA 4H3UA 1TJDA 4FCMA 2A15A 3NHXA 4KFFA 1CYUA 1B20A 1NDOB 2HMOB 2F4YA 1O7PB 3DMCA 1FGMA 2IYJA 1OH0A 3OX9A 4CJNA 1GOUA 2IA7A 1BUQA 3NM2A 3F40A 1GOVA 3OV4A 1TP6A 3WDGB 1KD14 1HU9A 4HM5B 4N6NB 4OK0A 4OUQA 1VQ43 1IV7A 4LYLB 1W02A 1QVG2 2CWVA 2MF7A 1JZDA 2CX0A 3X41A 5D82A 2WOFA 4CDLA 1T2HA 4HM7B 2UGIA 1AVLA
chains in the Genus database with same CATH topology
1N9JA 3STDA 3EQQB 3F8HA 2SBLA 2MC8A 2GEXA 4HKVB 5IW9A 4EXRA 1ROAA 2E2VA 1O7HB 1ISKA 2CH9A 2P0XA 1K28A 2KRTA 4HZBB 4EC6A 5AEWB 5CF1A 3GAXA 3JVCA 5JBSA 1M1K4 4HM2B 4FCJA 4R9KA 3EF8A 2P38A 3KIIA 3F14A 2W56A 4O3VA 4RNYA 2Q07A 2FNQA 1A2KA 3PS8A 1W6GA 4LSOA 3KKGA 1RN7A 1OHSA 2XGLA 3PGBA 2HMLB 2WGOA 3WA2X 1OGXA 1M9GA 3CPW2 2F98A 1WNHA 1KSIA 2XEPA 4N6V0 5LC6A 1EKMA 2PNCA 4O8SA 3F9SA 2L4VA 4HBRA 3CNXA 3PXMA 2RCDA 2C11A 4FMCA 3EC9A 3QK9A 2BHMA 4MMXB 3DGMA 3V99A 3EBTA 2FXTA 1O7NB 3X3YA 1SPUA 4WWUC 3OWUA 5EEOA 1W2ZA 3PYJA 1N8R4 1U8CB 3X3ZA 3GZBA 5ELJA 1S723 2Z6BA 3VF1A 3CME3 3WA3A 2OCTA 5CF2A 4EBGA 1TU5A 1VQ53 3CD63 1W6CA 1IVWA 3G16A 5IG0A 2CFLA 2CFDA 1T5YA 3PCRA 1IVUA 1VQ73 5FGOA 2Z7AA 3PCSA 3UL5A 1OF5B 3B4PA 5BVBA 5AIIA 4OVMA 1IQYA 2W2CA 2YFLB 1DMMA 4K61A 2ML5A 3U97A 3ER7A 3H3HA 1Q814 3DZLA 2Y73A 4HM6B 4WFOA 2GU1A 1D6UA 4BTYA 1IDPA 1JKGA 1ASKA 3GZXB 2XSOB 2XF3A 4ZM8A 3FF2A 1Q40A 1WMNA 4HM0B 2CK3H 3IJEB 3Q1CA 1ULJB 5EQLA 2YFIB 1HKXA 5D81A 2XH9A 4N6OB 1VQN3 1K734 3CPOA 2O3OA 4K1VA 3MG3A 2WGQA 3KZTA 1RRLA 2B24B 2D1WA 1PFPA 5KP3A 3OWSA 5IENA 1Q7Y4 1E97A 4NHFA 2F99A 3JUMA 1K8A4 3KSED 3A76A 2XFTA 4U13A 2W56B 2D42A 2CKFB 1F8NA 4EV5A 1DMNA 4JRFA 1WTHA 3F7XA 3VGNA 1VQ93 2HMNB 3G4S3 3JUPA 1GD4A 1W4NA 5IG3A 4R4KA 2WO0A 4MMYB 4IT7A 1QJGA 1US1A 3NV0A 2FGTA 3ALAA 4L8PA 4EYCA 4H61A 2RFRA 2BMOB 3LH4A 4CCVA 1WMPA 1FGRA 3LMLA 2B1XB 2CW9A 3BB9A 1W01A 3EHCA 5STDA 1VQP3 2OOVC 2CG0A 2I9WA 3RGRA 5IF6A 1N5PA 3BNCA 3X40A 1Y4KA 1D6YA 3CNMA 3OXAA 4L8OA 4HJLB 4N6MA 1GY5A 3CCQ3 3SX1A 2YFJB 4XB5A 3X3XA 1VQM3 3BNDA 2QIYA 3NM7A 5AIFA 3IMAB 2W04A 1FUWA 4HM3B 3Q90A 3G6E3 3D9RA 3DGLA 2LQVA 3F8XA 4WYKA 1QAKA 2CIUA 2Y74A 7STDA 2RSXA 4L7KA 4MJDA 1G96A 1NU3A 4GB5A 4I4KA 2W9QA 3BLZA 3NQZA 4O2HA 3V92A 2HMJB 4KFEA 1JKGB 3GZYB 2ZDJA 3OWYA 1V74A 5KP4A 1DYUA 1Q40B 6STDA 1UI7A 1VQ83 3H51A 4JF8A 2OQEC 5AI1A 1JJ22 3DM8A 3ROBA 1RRHA 5AYRB 1JV2B 5AYSC 3OW22 3UB1A 1J2BA 3BNEA 1STDA 3MPHA 2CFKA 1K9M4 3CCR3 5JPPA 3VSYA 3AMOA 4HYZA 2STDA 3B7CA 5DREA 1GY6A 4BTXA 5LC7A 1OHOA 1QVF2 2INXA 1ULIB 3LT9A 2HMKB 4STDA 4WP5A 3DXOA 1JB2A 4KFDA 3WODG 3HIIA 3M8CA 2IUJA 3JUQA 3CC43 1RKYA 3G0KA 1Q42A 3O8YA 1PU4A 2Z77A 1IU7A 1AV4A 3T8NA 3D3LA 5TGNA 5CK6A 2WOHA 5KP1A 3CCL3 1OACA 3NV0B 4X2HA 3MG1A 3NBRA 5IG5A 3CCV3 2K54A 3JUNA 4IIAA 2XSHB 3FKAA 2O9UX 2YX9A 3N8BA 2OOVA 2W6JH 4FCZA 3LT8A 1YJN3 3NUVA 1YIT3 2GU3A 5AIHA 1UUWB 2W9PA 2QA43 1NWWA 3SOAA 4N3VA 4LEHA 3NX0A 1IT7A 2W03A 3K0ZA 5A0OB 5IERA 1OHPA 4HM8B 3GWRA 4LGQA 4GL6A 1SJWA 4G1MB 1EG9B 1QAFA 3HI7A 3LTCA 1VQK3 2CFWA 4R1KA 3HK4A 1MOLA 4HZ9B 5DRVA 3F7SA 2KCDA 2R4IA 4ORLA 4WYKB 1UW1A 3T8UA 1UUVB 2F86B 1U5OA 2LYXA 3FCSB 3I553 1WQLB 3K9MC 3UL6A 3EJVA 1OPYA 3CCS3 4IPBA 3WOEB 3FG1A 1N5HA 2BT3A 4BTWA 1STFI 1ROVA 1JN5A 3V98A 1IK3A 3G713 5AIGA 1S5AA 1IVXA 5FW5A 1KC84 2IUKA 2XGNA 1SQWA 1IT8A 3CCU3 2CFGA 5AEUB 1WMOA 5IG4A 4FMDA 4R80A 3AMOB 3B8LA 3ECFA 3NQYA 2RGQA 1M1XB 3MWZA 1YI23 5EVHA 4X2OA 4XDWA 2ZL8A 3NBJA 1IVVA 4N6LA 2OTL3 3SXXA 1D6ZA 4AEQA 1NJI4 3KSPA 3DY5A 3LTBA 3LYGA 2BNGA 3FZWA 1O7MB 3S29A 3JUOA 4RBNA 2UX0A 1JNQA 3SLUA 3K63A 1QMAA 3UNLA 1A90A 1CYVA 1ZO2A 2BMRB 1W2B2 1IQ8A 4TX4A 1NB5I 3KE7A 3WMDA 1SIIA 3S67A 1O7GB 3DGNA 5CLKA 3PZWA 2W0QA 1Q864 1IV9A 3MSOA 4N6UA 3E99A 1O7WB 1GY7A 2V1LA 2QEX3 1ZX2A 4MMZB 4XBYA 5HGRA 1AR0A 5CXOA 2E2UA 3K7CA 4FMBA 1JB4A 1A67A 5G2GA 2CWUA 4XDVA 4K1UA 3EBYA 3MKIA 4AKYA 1GYBA 4WHAA 4R9LA 4J9AA 3SEDA 3FG3A 1OGZA 3CMA3 2ML6A 1OUNA 3B4OA 2GBXB 3S5CA 1NO3A 4MEIA 3MYTA 1W5ZA 3K5TA 3CC23 1JB5A 3SOYA 1R4CA 2BO9B 3CU3A 1TUHA 4KVHA 3CC73 3FF0A 1YHQ3 3I0YA 1Q824 2M7OA 1N9EA 1DVCA 4KZ1A 4K90B 3S27A 4LZIA 1N8QA 1MNLA 3FH1A 3GRDA 3BNBA 1VZZA 2Z76A 4O02B 1LXEA 3TDGA 3EN1B 4AKZA 3FLJA 3Q2PA 1FGTA 1LOXA 1CQSA 3FSDA 4HM4B 1SIHA 3HIGA 1JN5B 3MHEA 2QGUA 1NB3I 2P05A 2CC3A 2CWTA 3LTAA 4FR9A 2HMMB 1JRQA 3I563 1RJOA 3FG4A 1YIJ3 2P09A 4EV2A 3EE1A 4J8TA 4RNZA 1YJ93 4XBTA 1DVDA 1QALA 4HM1B 1CEWI 1AVKA 2BMQB 2XFSA 3DUKA 3S28A 3X42A 3IPTA 4Q53A 2OWPA 3MG2A 3NBBA 4FMAA 1FGQA 3GZRA 1VQO3 1FGOA 2GBWB 5ELUA 3CCE3 3U1WA 8CHOA 3EB8A 4LMIA 2JDIH 3EX9A 3DGOA 3J7Yd 1E3RA 1UI8A 1OCVA 3HX8A 1M904 1TIJA 3UJMA 2E2TA 3RDEA 2GEYA 1VQ63 2OTJ3 1TFOA 4N6TA 1TFKA 1Z1SA 3HZPA 1K41A 2IMJA 3WOFB 1EA2A 2K0MA 3NXJA 2OQEA 2C10A 1W7CA 1YVBI 3LTDA 4XBXA 1GD3A 5D83A 2KXGA 3KN4A 3N9HA 5I97A 5IEPA 2GXFA 1EQKA 2PZVA 2XR8B 3CXC2 3RGAA 3QRDA 1W00A 5BXQA 3L0RA 4XM4A 1KQS2 5JPUA 3CCJ3 3EN8A 3SVAA 4HVNA 1IQXA 4QWTA 1E3VA 2JQ5A 2P0MA 1DMQA 3CCM3 2CHCA 1LVNA 3KFQC 2CG1A 3LXUX 1W6YA 3LOYA 4PEJA 5IEOA 1KWIA 1VQL3 1FA3A 1YJW3 1YGEA 2XRXB 1L5GB 1A2VA 4RZMA 1GS3A 3LZAA 4NREA 3N54B 1C7HA 1LNHA 1OF5A 3FGYA 3T0UA 3G8ZA 4H3UA 4FCMA 2A15A 3NHXA 4KFFA 1CYUA 1NDOB 2HMOB 1O7PB 3DMCA 1FGMA 1OH0A 3OX9A 2IA7A 1BUQA 3NM2A 3F40A 3OV4A 3WDGB 1TP6A 1KD14 1HU9A 4HM5B 4N6NB 4OK0A 4OUQA 1VQ43 1IV7A 1W02A 1QVG2 2CWVA 2MF7A 3X41A 5D82A 2WOFA 4CDLA 4HM7B 1AVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9J A;  1NB3 I;  4IT7 A;  4EYC A;  1ROA A;  3LH4 A;  4CCV A;  2CH9 A;  1MOL A;  3GAX A;  1DVD A;  1CEW I;  3K9M C;  3UL6 A;  3PS8 A;  1RN7 A;  1N5H A;  1N5P A;  1STF I;  4N6M A;  1M9G A;  5ELU A;  1WNH A;  3IMA B;  1FUW A;  4N6V 0;  5LC6 A;  1TIJ A;  3PXM A;  3MWZ A;  1G96 A;  4N6T A;  2W9Q A;  4N6L A;  3PYJ A;  5ELJ A;  1YVB I;  1GD3 A;  2OCT A;  2KXG A;  1EQK A;  3QRD A;  1A90 A;  1CYV A;  3UL5 A;  3L0R A;  4TX4 A;  1NB5 I;  3S67 A;  3SVA A;  1IV9 A;  4N6U A;  5LC7 A;  4ZM8 A;  3KFQ C;  1A67 A;  1KWI A;  1FA3 A;  5EQL A;  4N6O B;  1R4C A;  2BO9 B;  1PFP A;  1CYU A;  2O9U X;  1DVC A;  4LZI A;  1MNL A;  1LXE A;  2W9P A;  3KSE D;  4N6N B;  3NX0 A;  3Q2P A;  1IV7 A;  5A0O B;  1GD4 A; 
#chains in the Genus database with same CATH topology
 1N9J A;  3STD A;  3EQQ B;  3F8H A;  2SBL A;  1ZGX A;  1UGI A;  2GEX A;  4HKV B;  2MC8 A;  4EXR A;  5IW9 A;  1ROA A;  2E2V A;  1O7H B;  1ISK A;  2CH9 A;  2P0X A;  1K28 A;  1AY7 A;  2KRT A;  4HZB B;  4EC6 A;  5AEW B;  5CF1 A;  1BRH A;  1FUS A;  3GAX A;  3JVC A;  5JBS A;  1M1K 4;  4HM2 B;  4FCJ A;  4R9K A;  1I2G A;  3EF8 A;  1BNS A;  2P38 A;  3KII A;  3F14 A;  2W56 A;  1MWR A;  3A5E A;  4O3V A;  1RNT A;  2Q07 A;  2FNQ A;  2IY2 A;  4RNY A;  1B21 A;  1A2K A;  1W6G A;  3PS8 A;  3KKG A;  1RN7 A;  4LSO A;  1BUJ A;  1OHS A;  1RHL A;  1JZO A;  2XGL A;  3PGB A;  2HML B;  2WGO A;  3WA2 X;  3ZG5 A;  1YNV X;  1OGX A;  1NNV A;  1M9G A;  3CPW 2;  2F98 A;  1RN4 A;  1WNH A;  4GHO A;  4J5K A;  1KSI A;  2XEP A;  4N6V 0;  3URP A;  1GMP A;  5LC6 A;  1EKM A;  3WHO A;  2PNC A;  4O8S A;  3F9S A;  2L4V A;  4HBR A;  3CNX A;  3AGO A;  3PXM A;  3WR2 A;  2RCD A;  2C11 A;  4FMC A;  3EC9 A;  3QK9 A;  2BHM A;  4MMX B;  3DGM A;  3DH2 A;  3V99 A;  3EBT A;  2FXT A;  1O7N B;  3X3Y A;  1SPU A;  4WWU C;  3OWU A;  5EEO A;  1W2Z A;  3PYJ A;  1N8R 4;  1U8C B;  3X3Z A;  3GZB A;  3AHW A;  5ELJ A;  2Z6B A;  1S72 3;  1LRA A;  3VF1 A;  3CME 3;  3WA3 A;  2OCT A;  5CF2 A;  4EBG A;  1TU5 A;  1VQ5 3;  3CD6 3;  1W6C A;  2CX1 A;  1IVW A;  3G16 A;  5IG0 A;  2CFL A;  2CFD A;  1T5Y A;  1BNR A;  3PCR A;  1IVU A;  1X1W A;  1VQ7 3;  5FGO A;  2Z7A A;  3PCS A;  4HOH A;  1UUG B;  3UL5 A;  1BNI A;  1OF5 B;  3B4P A;  5BVB A;  5AII A;  4OVM A;  1IQY A;  1BRS A;  2W2C A;  2YFL B;  1DMM A;  4K61 A;  2ML5 A;  4NPB A;  3U97 A;  3ER7 A;  3H3H A;  1Q81 4;  3DZL A;  2Y73 A;  4HM6 B;  4WFO A;  2GU1 A;  1D6U A;  4BTY A;  6RNT A;  1IDP A;  1JKG A;  1ASK A;  3GZX B;  2KF4 A;  2F5M A;  1BVI A;  2XSO B;  2XF3 A;  4ZM8 A;  1RLS A;  3FF2 A;  1Q40 A;  1I3I A;  1WMN A;  4HM0 B;  2CK3 H;  3IJE B;  3Q1C A;  1ULJ B;  5EQL A;  2YFI B;  1HKX A;  5D81 A;  2XH9 A;  4N6O B;  1VQN 3;  1K73 4;  3CPO A;  1RGA A;  1R4Y A;  2O3O A;  1B2U A;  4K1V A;  3MG3 A;  2WGQ A;  3KZT A;  1A2P A;  1X1X A;  4HAA A;  1DET A;  1RRL A;  2B24 B;  2D1W A;  2SAR A;  1PFP A;  5KP3 A;  3OWS A;  5IEN A;  1Q7Y 4;  1IYY A;  1E97 A;  1RGH A;  9RNT A;  4NHF A;  2F99 A;  3JUM A;  1T3B A;  1K8A 4;  3KSE D;  3A76 A;  2XFT A;  4U13 A;  2W56 B;  2D42 A;  2CKF B;  1F8N A;  4EV5 A;  1DMN A;  4JRF A;  1WTH A;  3F7X A;  3VGN A;  1VQ9 3;  2HMN B;  1PYL A;  3JUP A;  3G4S 3;  1GD4 A;  1W4N A;  1I0V A;  5IG3 A;  4R4K A;  1BRG A;  2WO0 A;  4MMY B;  4IT7 A;  1QJG A;  1US1 A;  7RNT A;  1CH0 A;  3NV0 A;  2FGT A;  1X1U A;  3ALA A;  1BRK A;  4L8P A;  4EYC A;  4H61 A;  2RFR A;  2BMO B;  2K3D A;  3LH4 A;  4CCV A;  1WMP A;  1FGR A;  3LML A;  2B1X B;  2CW9 A;  1BSB A;  3BB9 A;  1W01 A;  2GSP A;  4DKI A;  3D5G A;  3EHC A;  5STD A;  1VQP 3;  2OOV C;  8RNT A;  2J8X B;  2CG0 A;  1RGL A;  2I9W A;  3RGR A;  5IF6 A;  1HYF A;  1N5P A;  3BNC A;  3X40 A;  1Y4K A;  1D6Y A;  1Q9E A;  1YGW A;  3CNM A;  3OXA A;  4HJL B;  4L8O A;  4N6M A;  1GY5 A;  1BU4 A;  1LNI A;  2RNT A;  3CCQ 3;  1BAN A;  3SX1 A;  2YFJ B;  4XB5 A;  1BSA A;  3X3X A;  1VQM 3;  3BND A;  2AAD A;  2QIY A;  1UDI I;  3NM7 A;  5AIF A;  3IMA B;  2W04 A;  1FUW A;  1B2Z A;  3Q90 A;  4HM3 B;  3G6E 3;  3D9R A;  3DGL A;  2LQV A;  1MWT A;  3F8X A;  3Q3F A;  4WYK A;  1QAK A;  1RGC A;  2CIU A;  2Y74 A;  7STD A;  1I8V A;  2RSX A;  1FUT A;  1UGH I;  2H0H A;  4L7K A;  4MJD A;  1G96 A;  1NU3 A;  4GB5 A;  4I4K A;  2W9Q A;  1FYS A;  3BLZ A;  3NQZ A;  4O2H A;  3V92 A;  2HMJ B;  2KF5 A;  4KFE A;  1JKG B;  3GZY B;  2ZDJ A;  3OWY A;  1V74 A;  5KP4 A;  1RGE A;  1DYU A;  1Q40 B;  6STD A;  1UI7 A;  1VQ8 3;  3H51 A;  4JF8 A;  2OQE C;  5AI1 A;  5RNT A;  3DM8 A;  3ROB A;  1RRH A;  5AYR B;  1JV2 B;  5AYS C;  3OW2 2;  1JJ2 2;  3UB1 A;  1J2B A;  3BNE A;  1STD A;  3MPH A;  2CFK A;  1K9M 4;  3CCR 3;  5JPP A;  1ZS7 A;  1C54 A;  3VSY A;  3AMO A;  4HYZ A;  2STD A;  3B7C A;  5DRE A;  1LOY A;  1GY6 A;  1DE3 A;  1LOW A;  4BTX A;  5LC7 A;  1OHO A;  1QVF 2;  2INX A;  1UCI A;  1AQZ A;  1ULI B;  3LT9 A;  2HMK B;  1EEJ A;  4STD A;  4WP5 A;  3DXO A;  2BIR A;  1JB2 A;  4KFD A;  5G1K A;  3WOD G;  3HII A;  1RGF A;  3M8C A;  2IUJ A;  3JUQ A;  3CC4 3;  1RKY A;  3G0K A;  1MWU A;  1Q42 A;  3O8Y A;  1BNJ A;  2Z77 A;  1IU7 A;  1PU4 A;  1AV4 A;  3T8N A;  3D3L A;  5TGN A;  1GMQ A;  1MGR A;  5CK6 A;  2WOH A;  1EUI C;  5KP1 A;  3CCL 3;  1OAC A;  3NV0 B;  4X2H A;  3MG1 A;  1LOV A;  3NBR A;  5IG5 A;  4BL2 A;  2K54 A;  3JUN A;  1BGS A;  4IIA A;  1GSP A;  2XSH B;  3CCV 3;  5M19 A;  3FKA A;  4CPK A;  2C4B A;  2O9U X;  2YX9 A;  3N8B A;  2OOV A;  6GSP A;  2W6J H;  4FCZ A;  3LT8 A;  1YJN 3;  1LQM B;  2UUG C;  3NUV A;  5G1L A;  1YIT 3;  1B27 A;  2GU3 A;  5AIH A;  1BRJ A;  1UUW B;  1MWS A;  2W9P A;  2QA4 3;  1NWW A;  3SOA A;  1B2S A;  4N3V A;  1B2M A;  4LEH A;  3NX0 A;  1IT7 A;  2H0I A;  2W03 A;  1Q7H A;  3K0Z A;  5A0O B;  5IER A;  1OHP A;  1V57 A;  4HM8 B;  3GWR A;  1GMR A;  4LGQ A;  4GL6 A;  1SJW A;  4G1M B;  1SAR A;  1EG9 B;  1HZ1 A;  1QAF A;  2HOH A;  3HI7 A;  1LQG C;  3LTC A;  1VQK 3;  2CFW A;  1FZU A;  4R1K A;  3HK4 A;  1MOL A;  4HZ9 B;  5DRV A;  3F7S A;  2KCD A;  2R4I A;  4ORL A;  4WYK B;  1UW1 A;  1G02 A;  3T8U A;  1UUV B;  2F86 B;  1U5O A;  2LYX A;  3FCS B;  3I55 3;  1WQL B;  3K9M C;  3UL6 A;  3EJV A;  1OPY A;  1FW7 A;  3CCS 3;  1I70 A;  4IPB A;  3WOE B;  1RCL A;  1N5H A;  2BT3 A;  3FG1 A;  4BTW A;  1JBT A;  1STF I;  1ROV A;  1JN5 A;  1RSN A;  3V98 A;  1IK3 A;  1JBR A;  3G71 3;  1UCK A;  1S5A A;  1IVX A;  5AIG A;  5FW5 A;  1KC8 4;  2IUK A;  2XGN A;  1SQW A;  3BIR A;  1IT8 A;  3CCU 3;  2CFG A;  1BNE A;  1I2F A;  5AEU B;  1BRN L;  1WMO A;  5IG4 A;  4FMD A;  4R80 A;  3AMO B;  1I0X A;  3B8L A;  3ECF A;  3NQY A;  2RGQ A;  1M1X B;  3MWZ A;  1YI2 3;  5EVH A;  4X2O A;  4XDW A;  2ZL8 A;  3NBJ A;  1IVV A;  4N6L A;  2OTL 3;  3SXX A;  1D6Z A;  2ZA4 A;  3D4A A;  4AEQ A;  1NJI 4;  3KSP A;  4I5Q A;  2ZHX B;  3DY5 A;  3LTB A;  3LYG A;  2BNG A;  4GSP A;  3FZW A;  1O7M B;  3S29 A;  3JUO A;  4RBN A;  3ZG0 A;  2UX0 A;  1JNQ A;  3SLU A;  3K63 A;  1QMA A;  1RGG A;  3UNL A;  1A90 A;  1CYV A;  1ZO2 A;  2BMR B;  5BU4 A;  1W2B 2;  2F5W A;  1IQ8 A;  4TX4 A;  1NB5 I;  3KE7 A;  3WMD A;  1SII A;  3S67 A;  1O7G B;  3DGN A;  5CLK A;  3PZW A;  2W0Q A;  1Q86 4;  1IV9 A;  3AGN A;  3MSO A;  3E99 A;  4N6U A;  1O7W B;  1GY7 A;  2V1L A;  2QEX 3;  1ZX2 A;  4MMZ B;  4XBY A;  5HGR A;  1AR0 A;  2R41 A;  5CXO A;  2E2U A;  3K7C A;  4FMB A;  1JB4 A;  1A67 A;  2KF6 A;  5G2G A;  2CWU A;  4XDV A;  4K1U A;  3RNT A;  3EBY A;  1BSD A;  3MKI A;  4AKY A;  1GYB A;  4WHA A;  4R9L A;  4J9A A;  3SED A;  3FG3 A;  1OGZ A;  3CMA 3;  2ML6 A;  1VQQ A;  1OUN A;  3B4O A;  2GBX B;  3S5C A;  1NO3 A;  3SYU A;  4MEI A;  3MYT A;  1W5Z A;  3K5T A;  3CC2 3;  1JB5 A;  3SOY A;  1PY3 A;  2KAA A;  2RBI A;  1R4C A;  2BO9 B;  3DGY A;  3CU3 A;  1TUH A;  4KVH A;  3CC7 3;  2KF3 A;  3FF0 A;  1YHQ 3;  3I0Y A;  3KCH A;  1RNB A;  1YVS A;  1Q82 4;  2M7O A;  1N9E A;  1DVC A;  4KZ1 A;  4K90 B;  3S27 A;  4LZI A;  4RNT A;  1N8Q A;  1MNL A;  3FH1 A;  3GRD A;  3BNB A;  1VZZ A;  2Z76 A;  4O02 B;  1LXE A;  5GSP A;  3TDG A;  3EN1 B;  1B2X A;  4AKZ A;  3FLJ A;  3Q2P A;  4KT3 B;  1FGT A;  1LOX A;  1RMS A;  1CQS A;  3FSD A;  4HM4 B;  1SIH A;  1BOX A;  1V58 A;  4J5G A;  3HIG A;  1JN5 B;  2F56 A;  3MHE A;  2QGU A;  1NB3 I;  2P05 A;  2CC3 A;  2CWT A;  3LTA A;  4FR9 A;  2HMM B;  1JRQ A;  3I56 3;  3HOH A;  1RJO A;  3FG4 A;  1YIJ 3;  2P09 A;  4EV2 A;  5HOH A;  3EE1 A;  4J8T A;  4RNZ A;  1YJ9 3;  4XBT A;  1DVD A;  1QAL A;  4ILF A;  4HM1 B;  1CEW I;  1AVK A;  2BMQ B;  2XFS A;  3DUK A;  3S28 A;  3X42 A;  3GSP A;  1X1Y A;  3BU4 A;  3IPT A;  4Q53 A;  2OWP A;  3MG2 A;  5BIR A;  3NBB A;  4FMA A;  1G0T A;  5M1A A;  1RGK A;  1FGQ A;  1UCJ A;  3GZR A;  1T2I A;  1VQO 3;  1FGO A;  2GBW B;  1BSC A;  5ELU A;  3CCE 3;  3U1W A;  8CHO A;  3EB8 A;  4LMI A;  2JDI H;  3EX9 A;  3DGO A;  1BIR A;  3J7Y d;  1E3R A;  1B3S A;  1UI8 A;  1TRQ A;  1OCV A;  3HX8 A;  1M90 4;  1TIJ A;  3UJM A;  1TRP A;  2E2T A;  3RDE A;  2GEY A;  1VQ6 3;  2OTJ 3;  1TFO A;  1BSE A;  4N6T A;  1RTU A;  1TFK A;  1Z1S A;  3HZP A;  1K41 A;  2IMJ A;  3ZFZ A;  3WOF B;  1EA2 A;  3D5I A;  2K0M A;  3NXJ A;  2OQE A;  2C10 A;  1W7C A;  1YVB I;  3LTD A;  4XBX A;  1GD3 A;  1RN1 A;  5D83 A;  2KXG A;  1BNF A;  3D79 A;  3KN4 A;  3N9H A;  5I97 A;  1JBS A;  4EW5 A;  2GXF A;  1BNG A;  5IEP A;  1EQK A;  2PZV A;  2XR8 B;  1I2E A;  3CXC 2;  3RGA A;  3QRD A;  1RDS A;  1W00 A;  4BIR A;  5BXQ A;  1MGW A;  2H0G A;  1BAO A;  3L0R A;  4XM4 A;  1KQS 2;  5JPU A;  3CCJ 3;  2AAE A;  3EN8 A;  3SVA A;  4HVN A;  1IQX A;  1UCL A;  2BU4 A;  1E3V A;  2JQ5 A;  2P0M A;  4QWT A;  1DMQ A;  3CCM 3;  1TTO A;  5M18 A;  4BL3 A;  2CHC A;  2L1S A;  1LVN A;  3KFQ C;  2CG1 A;  7GSP A;  3LXU X;  1W6Y A;  3LOY A;  4PEJ A;  5IEO A;  1KWI A;  1VQL 3;  1FA3 A;  1BRI A;  1YJW 3;  1GOY A;  1YGE A;  2XRX B;  1L5G B;  1A2V A;  1I3F A;  1GS3 A;  3LZA A;  4NRE A;  4RZM A;  4BU4 A;  3N54 B;  1C7H A;  1LNH A;  1RCK A;  1OF5 A;  3FGY A;  3T0U A;  3AHS A;  3G8Z A;  4H3U A;  1TJD A;  4FCM A;  2A15 A;  3NHX A;  4KFF A;  1CYU A;  1B20 A;  1NDO B;  2HMO B;  2F4Y A;  1O7P B;  3DMC A;  1FGM A;  2IYJ A;  1OH0 A;  3OX9 A;  4CJN A;  1GOU A;  2IA7 A;  1BUQ A;  3NM2 A;  3F40 A;  1GOV A;  3OV4 A;  1TP6 A;  3WDG B;  1KD1 4;  1HU9 A;  4HM5 B;  4N6N B;  4OK0 A;  4OUQ A;  1VQ4 3;  1IV7 A;  4LYL B;  1W02 A;  1QVG 2;  2CWV A;  2MF7 A;  1JZD A;  2CX0 A;  3X41 A;  5D82 A;  2WOF A;  4CDL A;  1T2H A;  4HM7 B;  2UGI A;  1AVL A; 
#chains in the Genus database with same CATH homology
 1N9J A;  3STD A;  3EQQ B;  3F8H A;  2SBL A;  2MC8 A;  2GEX A;  4HKV B;  5IW9 A;  4EXR A;  1ROA A;  2E2V A;  1O7H B;  1ISK A;  2CH9 A;  2P0X A;  1K28 A;  2KRT A;  4HZB B;  4EC6 A;  5AEW B;  5CF1 A;  3GAX A;  3JVC A;  5JBS A;  1M1K 4;  4HM2 B;  4FCJ A;  4R9K A;  3EF8 A;  2P38 A;  3KII A;  3F14 A;  2W56 A;  4O3V A;  4RNY A;  2Q07 A;  2FNQ A;  1A2K A;  3PS8 A;  1W6G A;  4LSO A;  3KKG A;  1RN7 A;  1OHS A;  2XGL A;  3PGB A;  2HML B;  2WGO A;  3WA2 X;  1OGX A;  1M9G A;  3CPW 2;  2F98 A;  1WNH A;  1KSI A;  2XEP A;  4N6V 0;  5LC6 A;  1EKM A;  2PNC A;  4O8S A;  3F9S A;  2L4V A;  4HBR A;  3CNX A;  3PXM A;  2RCD A;  2C11 A;  4FMC A;  3EC9 A;  3QK9 A;  2BHM A;  4MMX B;  3DGM A;  3V99 A;  3EBT A;  2FXT A;  1O7N B;  3X3Y A;  1SPU A;  4WWU C;  3OWU A;  5EEO A;  1W2Z A;  3PYJ A;  1N8R 4;  1U8C B;  3X3Z A;  3GZB A;  5ELJ A;  1S72 3;  2Z6B A;  3VF1 A;  3CME 3;  3WA3 A;  2OCT A;  5CF2 A;  4EBG A;  1TU5 A;  1VQ5 3;  3CD6 3;  1W6C A;  1IVW A;  3G16 A;  5IG0 A;  2CFL A;  2CFD A;  1T5Y A;  3PCR A;  1IVU A;  1VQ7 3;  5FGO A;  2Z7A A;  3PCS A;  3UL5 A;  1OF5 B;  3B4P A;  5BVB A;  5AII A;  4OVM A;  1IQY A;  2W2C A;  2YFL B;  1DMM A;  4K61 A;  2ML5 A;  3U97 A;  3ER7 A;  3H3H A;  1Q81 4;  3DZL A;  2Y73 A;  4HM6 B;  4WFO A;  2GU1 A;  1D6U A;  4BTY A;  1IDP A;  1JKG A;  1ASK A;  3GZX B;  2XSO B;  2XF3 A;  4ZM8 A;  3FF2 A;  1Q40 A;  1WMN A;  4HM0 B;  2CK3 H;  3IJE B;  3Q1C A;  1ULJ B;  5EQL A;  2YFI B;  1HKX A;  5D81 A;  2XH9 A;  4N6O B;  1VQN 3;  1K73 4;  3CPO A;  2O3O A;  4K1V A;  3MG3 A;  2WGQ A;  3KZT A;  1RRL A;  2B24 B;  2D1W A;  1PFP A;  5KP3 A;  3OWS A;  5IEN A;  1Q7Y 4;  1E97 A;  4NHF A;  2F99 A;  3JUM A;  1K8A 4;  3KSE D;  3A76 A;  2XFT A;  4U13 A;  2W56 B;  2D42 A;  2CKF B;  1F8N A;  4EV5 A;  1DMN A;  4JRF A;  1WTH A;  3F7X A;  3VGN A;  1VQ9 3;  2HMN B;  3G4S 3;  3JUP A;  1GD4 A;  1W4N A;  5IG3 A;  4R4K A;  2WO0 A;  4MMY B;  4IT7 A;  1QJG A;  1US1 A;  3NV0 A;  2FGT A;  3ALA A;  4L8P A;  4EYC A;  4H61 A;  2RFR A;  2BMO B;  3LH4 A;  4CCV A;  1WMP A;  1FGR A;  3LML A;  2B1X B;  2CW9 A;  3BB9 A;  1W01 A;  3EHC A;  5STD A;  1VQP 3;  2OOV C;  2CG0 A;  2I9W A;  3RGR A;  5IF6 A;  1N5P A;  3BNC A;  3X40 A;  1Y4K A;  1D6Y A;  3CNM A;  3OXA A;  4L8O A;  4HJL B;  4N6M A;  1GY5 A;  3CCQ 3;  3SX1 A;  2YFJ B;  4XB5 A;  3X3X A;  1VQM 3;  3BND A;  2QIY A;  3NM7 A;  5AIF A;  3IMA B;  2W04 A;  1FUW A;  4HM3 B;  3Q90 A;  3G6E 3;  3D9R A;  3DGL A;  2LQV A;  3F8X A;  4WYK A;  1QAK A;  2CIU A;  2Y74 A;  7STD A;  2RSX A;  4L7K A;  4MJD A;  1G96 A;  1NU3 A;  4GB5 A;  4I4K A;  2W9Q A;  3BLZ A;  3NQZ A;  4O2H A;  3V92 A;  2HMJ B;  4KFE A;  1JKG B;  3GZY B;  2ZDJ A;  3OWY A;  1V74 A;  5KP4 A;  1DYU A;  1Q40 B;  6STD A;  1UI7 A;  1VQ8 3;  3H51 A;  4JF8 A;  2OQE C;  5AI1 A;  1JJ2 2;  3DM8 A;  3ROB A;  1RRH A;  5AYR B;  1JV2 B;  5AYS C;  3OW2 2;  3UB1 A;  1J2B A;  3BNE A;  1STD A;  3MPH A;  2CFK A;  1K9M 4;  3CCR 3;  5JPP A;  3VSY A;  3AMO A;  4HYZ A;  2STD A;  3B7C A;  5DRE A;  1GY6 A;  4BTX A;  5LC7 A;  1OHO A;  1QVF 2;  2INX A;  1ULI B;  3LT9 A;  2HMK B;  4STD A;  4WP5 A;  3DXO A;  1JB2 A;  4KFD A;  3WOD G;  3HII A;  3M8C A;  2IUJ A;  3JUQ A;  3CC4 3;  1RKY A;  3G0K A;  1Q42 A;  3O8Y A;  1PU4 A;  2Z77 A;  1IU7 A;  1AV4 A;  3T8N A;  3D3L A;  5TGN A;  5CK6 A;  2WOH A;  5KP1 A;  3CCL 3;  1OAC A;  3NV0 B;  4X2H A;  3MG1 A;  3NBR A;  5IG5 A;  3CCV 3;  2K54 A;  3JUN A;  4IIA A;  2XSH B;  3FKA A;  2O9U X;  2YX9 A;  3N8B A;  2OOV A;  2W6J H;  4FCZ A;  3LT8 A;  1YJN 3;  3NUV A;  1YIT 3;  2GU3 A;  5AIH A;  1UUW B;  2W9P A;  2QA4 3;  1NWW A;  3SOA A;  4N3V A;  4LEH A;  3NX0 A;  1IT7 A;  2W03 A;  3K0Z A;  5A0O B;  5IER A;  1OHP A;  4HM8 B;  3GWR A;  4LGQ A;  4GL6 A;  1SJW A;  4G1M B;  1EG9 B;  1QAF A;  3HI7 A;  3LTC A;  1VQK 3;  2CFW A;  4R1K A;  3HK4 A;  1MOL A;  4HZ9 B;  5DRV A;  3F7S A;  2KCD A;  2R4I A;  4ORL A;  4WYK B;  1UW1 A;  3T8U A;  1UUV B;  2F86 B;  1U5O A;  2LYX A;  3FCS B;  3I55 3;  1WQL B;  3K9M C;  3UL6 A;  3EJV A;  1OPY A;  3CCS 3;  4IPB A;  3WOE B;  3FG1 A;  1N5H A;  2BT3 A;  4BTW A;  1STF I;  1ROV A;  1JN5 A;  3V98 A;  1IK3 A;  3G71 3;  5AIG A;  1S5A A;  1IVX A;  5FW5 A;  1KC8 4;  2IUK A;  2XGN A;  1SQW A;  1IT8 A;  3CCU 3;  2CFG A;  5AEU B;  1WMO A;  5IG4 A;  4FMD A;  4R80 A;  3AMO B;  3B8L A;  3ECF A;  3NQY A;  2RGQ A;  1M1X B;  3MWZ A;  1YI2 3;  5EVH A;  4X2O A;  4XDW A;  2ZL8 A;  3NBJ A;  1IVV A;  4N6L A;  2OTL 3;  3SXX A;  1D6Z A;  4AEQ A;  1NJI 4;  3KSP A;  3DY5 A;  3LTB A;  3LYG A;  2BNG A;  3FZW A;  1O7M B;  3S29 A;  3JUO A;  4RBN A;  2UX0 A;  1JNQ A;  3SLU A;  3K63 A;  1QMA A;  3UNL A;  1A90 A;  1CYV A;  1ZO2 A;  2BMR B;  1W2B 2;  1IQ8 A;  4TX4 A;  1NB5 I;  3KE7 A;  3WMD A;  1SII A;  3S67 A;  1O7G B;  3DGN A;  5CLK A;  3PZW A;  2W0Q A;  1Q86 4;  1IV9 A;  3MSO A;  4N6U A;  3E99 A;  1O7W B;  1GY7 A;  2V1L A;  2QEX 3;  1ZX2 A;  4MMZ B;  4XBY A;  5HGR A;  1AR0 A;  5CXO A;  2E2U A;  3K7C A;  4FMB A;  1JB4 A;  1A67 A;  5G2G A;  2CWU A;  4XDV A;  4K1U A;  3EBY A;  3MKI A;  4AKY A;  1GYB A;  4WHA A;  4R9L A;  4J9A A;  3SED A;  3FG3 A;  1OGZ A;  3CMA 3;  2ML6 A;  1OUN A;  3B4O A;  2GBX B;  3S5C A;  1NO3 A;  4MEI A;  3MYT A;  1W5Z A;  3K5T A;  3CC2 3;  1JB5 A;  3SOY A;  1R4C A;  2BO9 B;  3CU3 A;  1TUH A;  4KVH A;  3CC7 3;  3FF0 A;  1YHQ 3;  3I0Y A;  1Q82 4;  2M7O A;  1N9E A;  1DVC A;  4KZ1 A;  4K90 B;  3S27 A;  4LZI A;  1N8Q A;  1MNL A;  3FH1 A;  3GRD A;  3BNB A;  1VZZ A;  2Z76 A;  4O02 B;  1LXE A;  3TDG A;  3EN1 B;  4AKZ A;  3FLJ A;  3Q2P A;  1FGT A;  1LOX A;  1CQS A;  3FSD A;  4HM4 B;  1SIH A;  3HIG A;  1JN5 B;  3MHE A;  2QGU A;  1NB3 I;  2P05 A;  2CC3 A;  2CWT A;  3LTA A;  4FR9 A;  2HMM B;  1JRQ A;  3I56 3;  1RJO A;  3FG4 A;  1YIJ 3;  2P09 A;  4EV2 A;  3EE1 A;  4J8T A;  4RNZ A;  1YJ9 3;  4XBT A;  1DVD A;  1QAL A;  4HM1 B;  1CEW I;  1AVK A;  2BMQ B;  2XFS A;  3DUK A;  3S28 A;  3X42 A;  3IPT A;  4Q53 A;  2OWP A;  3MG2 A;  3NBB A;  4FMA A;  1FGQ A;  3GZR A;  1VQO 3;  1FGO A;  2GBW B;  5ELU A;  3CCE 3;  3U1W A;  8CHO A;  3EB8 A;  4LMI A;  2JDI H;  3EX9 A;  3DGO A;  3J7Y d;  1E3R A;  1UI8 A;  1OCV A;  3HX8 A;  1M90 4;  1TIJ A;  3UJM A;  2E2T A;  3RDE A;  2GEY A;  1VQ6 3;  2OTJ 3;  1TFO A;  4N6T A;  1TFK A;  1Z1S A;  3HZP A;  1K41 A;  2IMJ A;  3WOF B;  1EA2 A;  2K0M A;  3NXJ A;  2OQE A;  2C10 A;  1W7C A;  1YVB I;  3LTD A;  4XBX A;  1GD3 A;  5D83 A;  2KXG A;  3KN4 A;  3N9H A;  5I97 A;  5IEP A;  2GXF A;  1EQK A;  2PZV A;  2XR8 B;  3CXC 2;  3RGA A;  3QRD A;  1W00 A;  5BXQ A;  3L0R A;  4XM4 A;  1KQS 2;  5JPU A;  3CCJ 3;  3EN8 A;  3SVA A;  4HVN A;  1IQX A;  4QWT A;  1E3V A;  2JQ5 A;  2P0M A;  1DMQ A;  3CCM 3;  2CHC A;  1LVN A;  3KFQ C;  2CG1 A;  3LXU X;  1W6Y A;  3LOY A;  4PEJ A;  5IEO A;  1KWI A;  1VQL 3;  1FA3 A;  1YJW 3;  1YGE A;  2XRX B;  1L5G B;  1A2V A;  4RZM A;  1GS3 A;  3LZA A;  4NRE A;  3N54 B;  1C7H A;  1LNH A;  1OF5 A;  3FGY A;  3T0U A;  3G8Z A;  4H3U A;  4FCM A;  2A15 A;  3NHX A;  4KFF A;  1CYU A;  1NDO B;  2HMO B;  1O7P B;  3DMC A;  1FGM A;  1OH0 A;  3OX9 A;  2IA7 A;  1BUQ A;  3NM2 A;  3F40 A;  3OV4 A;  3WDG B;  1TP6 A;  1KD1 4;  1HU9 A;  4HM5 B;  4N6N B;  4OK0 A;  4OUQ A;  1VQ4 3;  1IV7 A;  1W02 A;  1QVG 2;  2CWV A;  2MF7 A;  3X41 A;  5D82 A;  2WOF A;  4CDL A;  4HM7 B;  1AVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...