1LXEA

Crystal structure of the cathelicidin motif of protegrins
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
92
Chain Sequence
ALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDDITCNEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cathelicidin motif of protegrin-3 precursor: structural insights into the activation mechanism of an antimicrobial protein.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Antimicrobial protein
molecule keywords protegrin-3 precursor
total genus 15
structure length 92
sequence length 98
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1lxeA00
1IV9A 2W9QA 5A0OB 2CH9A 3QRDA 1A67A 1G96A 1EQKA 1FA3A 1A90A 2BO9B 4ZM8A 1FUWA 1IV7A 3PYJA 5LC6A 2W9PA 1CEWI 4N6LA 1DVDA 4EYCA 1M9GA 3KSED 5ELUA 1STFI 1DVCA 1N5HA 1ROAA 5EQLA 1NB5I 1NB3I 1MOLA 1RN7A 4N6TA 1PFPA 4CCVA 1GD3A 4IT7A 2KXGA 1MNLA 3GAXA 4N6NB 3S67A 3UL6A 4TX4A 3LH4A 3PXMA 4LZIA 1TIJA 4N6OB 5ELJA 1LXEA 3MWZA 3KFQC 1KWIA 3L0RA 3NX0A 4N6UA 3UL5A 3SVAA 1GD4A 1CYVA 1R4CA 1N9JA 3K9MC 1YVBI 3Q2PA 1N5PA 3IMAB 4N6MA 1CYUA 2O9UX 2OCTA 5LC7A 3PS8A 4N6V0 1WNHA
chains in the Genus database with same CATH superfamily
3MPHA 3AHSA 1B2ZA 2CH9A 1TUHA 1BNJA 3B4PA 3GRDA 4XM4A 2F86B 4J5KA 2Q07A 1Q7Y4 1FGQA 1LOYA 1F8NA 4HBRA 5RNTA 1UCIA 5CXOA 4ILFA 5FW5A 1TRPA 3I563 3V98A 1UCLA 5STDA 3X3YA 4EV5A 4KFEA 1KD14 1O7PB 5KP1A 5DRVA 4LGQA 1O7WB 1OH0A 5IEOA 2HMKB 3GWRA 2F99A 3MG3A 1JBTA 3CNMA 2L4VA 3LT8A 3LT9A 4KVHA 1YVBI 2Z77A 2FNQA 4GL6A 1S723 2K54A 1SPUA 3OWUA 3MG2A 3F8XA 5JPUA 3U97A 2INXA 1IV9A 1HZ1A 3Q3FA 3BNBA 5A0OB 3D3LA 3SOYA 3OWYA 1KSIA 1T5YA 3PGBA 2YX9A 4HZBB 5CLKA 2BMRB 4EYCA 1MGWA 1DVCA 4FMCA 2YFLB 1KC84 3NM2A 1MOLA 3ZFZA 1I2EA 4IPBA 1YIT3 1BRSA 1B2MA 1JKGB 1MWTA 3WOEB 3HX8A 5IG5A 2HOHA 1TIJA 5AEUB 1GY5A 4R9KA 4MEIA 3RGAA 1Q7HA 2ML5A 3CCU3 1BSDA 1CYVA 3WODG 1E97A 6RNTA 1RKYA 3B7CA 2GEYA 5AEWB 1M904 1EKMA 1JN5A 3VSYA 1UUGB 3CME3 2LQVA 5G1KA 4N6V0 1D6UA 4OUQA 1PYLA 4AKYA 5IERA 2H0HA 2ZHXB 3A5EA 3LZAA 2E2TA 4I5QA 1FA3A 2CX0A 2SARA 3NUVA 1JZOA 4FMDA 4HM3B 2MC8A 2CW9A 2P38A 4LMIA 3PZWA 1FUWA 1RNBA 1Q40B 2M7OA 5M19A 1N5HA 3WOFB 1NB3I 3EN8A 1I8VA 3FKAA 3NBBA 3UNLA 3S5CA 2CKFB 2GBXB 3Q90A 4STDA 1NJI4 2XSHB 3G16A 1OPYA 3KFQC 5AIHA 6STDA 2WOHA 1OGXA 3LTBA 1W6GA 1VQ93 1QVF2 3K0ZA 8RNTA 3NQYA 2IY2A 1OHOA 3Q2PA 4N6MA 5KP3A 4K1UA 2H0IA 3DMCA 1S5AA 2CHCA 3NHXA 1UCJA 2CG0A 2OCTA 3M8CA 4HM6B 4WP5A 1GSPA 3X40A 1TP6A 1JNQA 1K734 1WNHA 1BSAA 3N8BA 3LTAA 1DETA 2ZA4A 3B8LA 4IIAA 1K9M4 3TDGA 2WGOA 3EN1B 2W6JH 1JB4A 3Q1CA 1JB2A 3NBRA 1AR0A 2Y74A 4OK0A 5D83A 1NO3A 5LC6A 4N6LA 3BNCA 3I0YA 1UW1A 3FCSB 1PU4A 1NB5I 1RRLA 1IT8A 4HAAA 1BOXA 1LRAA 2XSOB 3DGNA 3F9SA 3STDA 3OWSA 5AIIA 4TX4A 2W0QA 1BGSA 2GU3A 3ZG5A 4KFFA 3UL5A 1IVVA 1VQK3 2FGTA 1ZGXA 3K63A 3DY5A 2AAEA 4J9AA 1KQS2 1N5PA 3IMAB 3NXJA 4DKIA 4JRFA 5IENA 1X1XA 7STDA 1RGEA 3OXAA 1LOXA 2IUKA 3K7CA 2YFJB 4LEHA 5DREA 1IK3A 1MWRA 1Q42A 2E2VA 1DYUA 2XH9A 1CEWI 4K1VA 5BXQA 3CCJ3 3ZG0A 2HMOB 3ER7A 1X1WA 3MKIA 3HI7A 4G1MB 3FLJA 4MMYB 5ELUA 1W4NA 5EQLA 5AYSC 4FCMA 4RNZA 2CFWA 5IW9A 1FGRA 1GD3A 2QEX3 1BANA 1BIRA 1FUSA 2KXGA 2RGQA 1D6YA 3EX9A 1BAOA 4LYLB 4HM2B 1LXEA 4FMBA 1STDA 3ALAA 3CC73 1MWUA 2C4BA 4O2HA 1GY7A 2BMOB 4K90B 3CMA3 5TGNA 1RGFA 2HMJB 1OF5A 4CJNA 3LOYA 4HM5B 4MJDA 2OQEC 2KRTA 3S27A 3AGNA 3DGOA 2R41A 1B20A 2W9QA 3T0UA 1QALA 2Z7AA 5G1LA 1B21A 4GHOA 4X2HA 3RNTA 4NREA 1OGZA 3KSPA 9RNTA 1VZZA 3MYTA 4O02B 1STFI 1FZUA 4FCZA 4XB5A 1IDPA 1DMMA 3EBYA 1UUWB 3OW22 1NU3A 4IT7A 2CFDA 3DH2A 3AHWA 3KCHA 3RDEA 1AVLA 3JUNA 2YFIB 3SX1A 3MWZA 1KWIA 1FGTA 1V57A 3KN4A 1GOVA 1R4CA 2BT3A 3DGMA 3LXUX 5G2GA 1FGMA 3OX9A 1TTOA 7RNTA 2CK3H 2XRXB 5HOHA 3OV4A 3X42A 1T3BA 1M1K4 2H0GA 2OTL3 4L8OA 1BRHA 2WO0A 5IG0A 2CFKA 3JUQA 3CCR3 1W6CA 3DUKA 4BL3A 1U8CB 4CPKA 5EEOA 3VF1A 1IYYA 1BNSA 3E99A 3D5IA 1GMPA 1RN7A 1RN1A 4N6TA 1YJN3 1OACA 4EXRA 1SARA 8CHOA 1UGIA 1HU9A 3GZXB 2RSXA 3GAXA 1HYFA 1OF5B 3LH4A 3PXMA 1US1A 3FG3A 1Y4KA 5D82A 4RZMA 4XDVA 3KKGA 3SVAA 1GD4A 2BMQB 3EF8A 3FSDA 2UX0A 4X2OA 3AMOA 5AYRB 2RBIA 1AV4A 1WTHA 5M1AA 1LQGC 2W2CA 1BRGA 3HZPA 1C7HA 4J8TA 1VQL3 1VQ83 3WMDA 3JUPA 4GB5A 2B24B 1G02A 4XBYA 1G96A 1FYSA 1X1YA 2GXFA 2R4IA 2K0MA 1A2VA 2D42A 3EQQB 2WGQA 2PNCA 4BIRA 2OOVC 3HIGA 4KT3B 2QA43 2OQEA 1WMPA 5AIGA 3H3HA 1IQYA 1ROAA 3EB8A 1EA2A 1GMRA 4LSOA 4N3VA 4XBXA 1VQ43 2HMNB 1PFPA 1VQQA 3FF2A 2UUGC 3URPA 2Z6BA 1Q814 3UL6A 3BLZA 3NM7A 1G0TA 3F8HA 1M1XB 1TFOA 4L8PA 1W01A 3IJEB 3X41A 3DGLA 1J2BA 5FGOA 1JV2B 4XBTA 2F4YA 3V99A 1TRQA 1W2B2 4J5GA 5EVHA 1RCKA 2C10A 4EV2A 4ZM8A 1QVG2 5BU4A 1BRKA 1B2UA 3G4S3 1M9GA 5JPPA 3CCQ3 2RFRA 3KZTA 1BSEA 1NWWA 2P0MA 4XDWA 1VQM3 1GYBA 1ULJB 4LZIA 1LNIA 1OHSA 3DZLA 4K61A 1UDII 1ZO2A 3FG4A 4KFDA 2GEXA 1E3RA 2F98A 1O7MB 2HMLB 4HKVB 1JRQA 1RSNA 2XF3A 1DMNA 1BRJA 1QAKA 1YJW3 4L7KA 2F5WA 1VQO3 2O9UX 4R9LA 3WDGB 4H3UA 3KE7A 4NHFA 2BHMA 1EUIC 2C11A 3GZRA 1LQMB 2BO9B 2JDIH 1IV7A 2J8XB 3PYJA 4R4KA 1VQ63 5BVBA 1V74A 2CWUA 1W02A 4WYKA 2CFLA 5AIFA 3D79A 4FR9A 3SYUA 1IVUA 3G713 3AMOB 1RGGA 3D4AA 3S67A 1B2XA 1TU5A 2UGIA 2XFSA 3GSPA 3UB1A 1RGAA 1CQSA 1GY6A 1VQ73 3CC23 2W03A 1BVIA 2STDA 3RGRA 4EBGA 4R80A 1IT7A 4JF8A 1CYUA 4RNYA 3NV0A 3J7Yd 2XFTA 2XGNA 1GOYA 2FXTA 3CCE3 1MGRA 1N9EA 1ASKA 2OWPA 1RHLA 1A67A 1DE3A 2KAAA 4BTXA 4HOHA 1DVDA 1I2GA 3KSED 3LYGA 3EBTA 4HM4B 1QJGA 2OTJ3 5HGRA 3F40A 3U1WA 4FCJA 1LOVA 3SEDA 1HKXA 2B1XB 2IYJA 4RBNA 1L5GB 5IEPA 5JBSA 1BUQA 1QAFA 3NQZA 1PY3A 3JUMA 4EC6A 1BNRA 2RCDA 1VQP3 1YI23 1N9JA 2KF6A 3LTDA 3MSOA 1I3FA 1I2FA 3JUOA 1W00A 3K9MC 1AY7A 3I553 4HYZA 1LNHA 3CCV3 4WYKB 1SIIA 1BNFA 1RGCA 1Q40A 1K28A 2KF5A 2AADA 3EJVA 1BRIA 5BIRA 3G6E3 2O3OA 2CC3A 3UJMA 3CCS3 3SXXA 3EE1A 3CNXA 3WA3A 1A2PA 1N8R4 3S29A 1RNTA 1YIJ3 3NBJA 2HMMB 4CCVA 1N8QA 1WQLB 3BB9A 1GOUA 2KF4A 2I9WA 4N6NB 4N6OB 1FUTA 3WHOA 3L0RA 4BTWA 5D81A 1DMQA 1Z1SA 2ML6A 1BU4A 2RNTA 3MHEA 1RRHA 2Y73A 1JBSA 4I4KA 1Q9EA 1UI7A 2Z76A 3BNEA 3G0KA 3A76A 2E2UA 5CF2A 3MG1A 3PS8A 1BNGA 2XEPA 3N54B 2V1LA 1YNVX 2P09A 2F5MA 2XGLA 1EG9B 3S28A 2CWVA 4BU4A 1RGHA 1TJDA 1W5ZA 2W9PA 4AEQA 1BNEA 4MMXB 3VGNA 1UI8A 1UCKA 1ZX2A 3V92A 1LVNA 2P0XA 1O7NB 3FH1A 2F56A 3N9HA 3D9RA 1RGKA 1OHPA 4BTYA 1JZDA 1WMNA 1W6YA 1YGWA 4O8SA 7GSPA 1BRNL 3LTCA 4AKZA 2IA7A 2WOFA 3NX0A 3CXC2 1BUJA 1MWSA 1I0XA 2QGUA 3T8NA 1FGOA 3O8YA 1BSCA 3AGOA 2D1WA 1ZS7A 2GU1A 1I0VA 1OCVA 5CF1A 1BNIA 1A2KA 5IG3A 2P05A 1I3IA 3QRDA 3CD63 3DGYA 1IVXA 4MMZB 2OOVA 1QMAA 1RCLA 4NPBA 1B2SA 2KCDA 5IG4A 3CC43 1AQZA 2GBWB 2ZL8A 3BIRA 1W2ZA 3WR2A 3PCRA 1BSBA 5AI1A 1YHQ3 3SOAA 5KP4A 1MNLA 3FF0A 3JVCA 3GZBA 4HZ9B 2BU4A 1ISKA 2MF7A 3QK9A 3BU4A 1OUNA 5IF6A 4U13A 3CCL3 2QIYA 6GSPA 3WA2X 3HIIA 1YJ93 1CH0A 5LC7A 1YVSA 2L1SA 2PZVA 2CIUA 1U5OA 1TFKA 1Q864 3T8UA 1O7GB 1JB5A 3FZWA 1IQXA 3CCM3 1A90A 3CU3A 3F7XA 2SBLA 1RLSA 1JJ22 1SJWA 1W7CA 2CWTA 3BNDA 5M18A 3KIIA 1UGHI 2CFGA 1RJOA 4WFOA 5GSPA 1JN5B 1GMQA 3IPTA 4HM1B 2W56A 4WHAA 3NV0B 1K8A4 2BNGA 1NNVA 1IQ8A 2CX1A 1WMOA 2W56B 3EHCA 2LYXA 2ZDJA 1K41A 4HM0B 3F14A 3D5GA 1IU7A 4HM7B 1O7HB 3K5TA 4HJLB 1JKGA 1LOWA 1SIHA 5I97A 1VQ53 1ULIB 4OVMA 2XR8B 1FW7A 3DXOA 3H51A 3CPW2 1X1UA 1AVKA 1T2IA 3G8ZA 3LMLA 1IVWA 2W04A 1RMSA 4RNTA 4H61A 4QWTA 1EQKA 4EW5A 3PCSA 1RGLA 1RN4A 4HM8B 3HK4A 1NDOB 3CPOA 2A15A 2IUJA 2GSPA 3ROBA 5CK6A 2IMJA 3F7SA 1RTUA 3X3ZA 3FGYA 1YGEA 3SLUA 4BL2A 1GS3A 2JQ5A 2KF3A 4CDLA 1E3VA 3DM8A 1V58A 3FG1A 4GSPA 3ECFA 1JBRA 1RDSA 3B4OA 1B27A 4FMAA 4WWUC 5ELJA 3EC9A 4HVNA 4KZ1A 4N6UA 1UUVB 1R4YA 4Q53A 1SQWA 1B3SA 1Q824 1D6ZA 3GZYB 4PEJA 1EEJA 2CG1A 4O3VA 1VQN3 3HOHA 1C54A 1T2HA 4ORLA 1I70A 1ROVA 4R1KA 3X3XA 2K3DA 2BIRA
chains in the Genus database with same CATH topology
3MPHA 2CH9A 1TUHA 3B4PA 3GRDA 4XM4A 2F86B 2Q07A 1Q7Y4 1FGQA 1F8NA 4HBRA 5CXOA 5FW5A 3I563 3V98A 5STDA 3X3YA 4EV5A 4KFEA 1KD14 1O7PB 5KP1A 5DRVA 4LGQA 1O7WB 1OH0A 5IEOA 2HMKB 3GWRA 2F99A 3MG3A 3CNMA 2L4VA 3LT8A 3LT9A 4KVHA 1YVBI 2Z77A 2FNQA 4GL6A 1S723 2K54A 1SPUA 3OWUA 3MG2A 3F8XA 3U97A 2INXA 1IV9A 3BNBA 5A0OB 3D3LA 3SOYA 3OWYA 1KSIA 1T5YA 3PGBA 2YX9A 4HZBB 5CLKA 2BMRB 4EYCA 1DVCA 4FMCA 2YFLB 1KC84 3NM2A 1MOLA 4IPBA 1YIT3 1JKGB 3WOEB 3HX8A 5IG5A 1TIJA 5AEUB 1GY5A 4R9KA 4MEIA 3RGAA 2ML5A 3CCU3 1CYVA 3WODG 1RKYA 1E97A 1M904 3B7CA 2GEYA 5AEWB 1EKMA 1JN5A 3VSYA 3CME3 2LQVA 4AKYA 4N6V0 1D6UA 4OUQA 5IERA 5JPUA 3I553 1FA3A 3LZAA 2E2TA 4FMDA 3NUVA 4HM3B 2MC8A 2CW9A 2P38A 4LMIA 3PZWA 1FUWA 1Q40B 2M7OA 1N5HA 3WOFB 1NB3I 3EN8A 3FKAA 3NBBA 3UNLA 3S5CA 2CKFB 2GBXB 3Q90A 4STDA 1NJI4 2XSHB 3G16A 1OPYA 3KFQC 5AIHA 6STDA 2WOHA 1OGXA 3LTBA 1W6GA 1VQ93 1QVF2 3K0ZA 3NQYA 1OHOA 3Q2PA 4N6MA 5KP3A 4K1UA 3DMCA 3NHXA 1S5AA 2CHCA 4HM6B 4WP5A 2CG0A 2OCTA 3M8CA 3X40A 1TP6A 1JNQA 1K734 1WNHA 3N8BA 3LTAA 3B8LA 4IIAA 1K9M4 3TDGA 2WGOA 3EN1B 2W6JH 1JB4A 3Q1CA 1JB2A 3NBRA 1AR0A 2Y74A 4OK0A 5D83A 1NO3A 5LC6A 4N6LA 3BNCA 3I0YA 1UW1A 3FCSB 1PU4A 1NB5I 1RRLA 1IT8A 2XSOB 3DGNA 3F9SA 3STDA 3OWSA 5AIIA 4TX4A 2W0QA 2GU3A 4KFFA 3UL5A 1IVVA 1VQK3 2FGTA 3K63A 3DY5A 4J9AA 1KQS2 1N5PA 3IMAB 3NXJA 5IENA 4JRFA 7STDA 3OXAA 1LOXA 2IUKA 3K7CA 2YFJB 4LEHA 5DREA 1IK3A 1Q42A 2E2VA 1DYUA 2XH9A 1CEWI 4K1VA 5BXQA 3CCJ3 2HMOB 3ER7A 3MKIA 4G1MB 3HI7A 4MMYB 3FLJA 5ELUA 5EQLA 1W4NA 5AYSC 4FCMA 4RNZA 2CFWA 5IW9A 1FGRA 1GD3A 2QEX3 2RGQA 2KXGA 1D6YA 3EX9A 4HM2B 1LXEA 4FMBA 1STDA 3ALAA 3CC73 4O2HA 1GY7A 2BMOB 4K90B 3CMA3 5TGNA 2HMJB 1OF5A 3LOYA 4HM5B 4MJDA 2OQEC 2KRTA 3S27A 3DGOA 3T0UA 2W9QA 1QALA 2Z7AA 4X2HA 4NREA 1OGZA 3KSPA 1VZZA 3MYTA 4O02B 1STFI 4FCZA 4XB5A 1IDPA 1DMMA 3EBYA 1UUWB 3OW22 1NU3A 4IT7A 2CFDA 3RDEA 1AVLA 3JUNA 2YFIB 3SX1A 3MWZA 1KWIA 1FGTA 3KN4A 1R4CA 2BT3A 5G2GA 3DGMA 3LXUX 1FGMA 3OX9A 2CK3H 2XRXB 3OV4A 3X42A 1M1K4 2OTL3 4L8OA 2WO0A 5IG0A 2CFKA 3JUQA 3CCR3 1W6CA 3DUKA 1U8CB 5EEOA 3VF1A 3E99A 1RN7A 4N6TA 1YJN3 1OACA 4EXRA 8CHOA 3GZXB 1HU9A 2RSXA 3GAXA 1OF5B 3LH4A 3PXMA 1US1A 3FG3A 1Y4KA 5D82A 4RZMA 4XDVA 3KKGA 3SVAA 1GD4A 2BMQB 3EF8A 3FSDA 2UX0A 4X2OA 3AMOA 5AYRB 1AV4A 1WTHA 2W2CA 3HZPA 1C7HA 4J8TA 1VQL3 1VQ83 3WMDA 3JUPA 4GB5A 2B24B 4XBYA 1G96A 2GXFA 2R4IA 2K0MA 1A2VA 2D42A 3EQQB 2WGQA 2PNCA 2OOVC 3HIGA 2QA43 2OQEA 1WMPA 5AIGA 3H3HA 1IQYA 1ROAA 3EB8A 1EA2A 4LSOA 4N3VA 4XBXA 1VQ43 2HMNB 1PFPA 3FF2A 2Z6BA 1Q814 3UL6A 3BLZA 3NM7A 3F8HA 1M1XB 1TFOA 4L8PA 1W01A 3IJEB 3X41A 3DGLA 1J2BA 5FGOA 1JV2B 4XBTA 3V99A 1W2B2 5EVHA 4ZM8A 2C10A 4EV2A 1QVG2 3G4S3 1M9GA 5JPPA 3CCQ3 2RFRA 3KZTA 1NWWA 4XDWA 2P0MA 1VQM3 1GYBA 1ULJB 4LZIA 1OHSA 3DZLA 4K61A 1ZO2A 4KFDA 3FG4A 2GEXA 1E3RA 2F98A 1O7MB 2HMLB 4HKVB 1JRQA 2XF3A 1DMNA 1QAKA 1YJW3 4L7KA 1VQO3 2O9UX 4R9LA 3WDGB 4H3UA 3KE7A 4NHFA 2BHMA 2C11A 3GZRA 2BO9B 2JDIH 1IV7A 4R4KA 3PYJA 1VQ63 5BVBA 1V74A 2CWUA 1W02A 4WYKA 2CFLA 5AIFA 4FR9A 1IVUA 3G713 3AMOB 3S67A 1TU5A 2XFSA 3UB1A 1CQSA 1GY6A 1VQ73 3CC23 2W03A 2STDA 3RGRA 4EBGA 4R80A 1IT7A 4JF8A 1CYUA 4RNYA 3NV0A 3J7Yd 2XFTA 2XGNA 2FXTA 3CCE3 1N9EA 2OWPA 1ASKA 1A67A 4BTXA 1DVDA 3KSED 3LYGA 3EBTA 4HM4B 1QJGA 2OTJ3 5HGRA 3F40A 3U1WA 4FCJA 3SEDA 1HKXA 2B1XB 4RBNA 1L5GB 5IEPA 5JBSA 1BUQA 1QAFA 3NQZA 3JUMA 4EC6A 2RCDA 1VQP3 1YI23 1N9JA 3LTDA 3MSOA 3JUOA 3K9MC 1W00A 4HYZA 1LNHA 3CCV3 4WYKB 1SIIA 1Q40A 1K28A 3EJVA 3G6E3 2O3OA 2CC3A 3UJMA 3CCS3 3SXXA 3EE1A 3CNXA 3WA3A 1N8R4 3S29A 1YIJ3 3NBJA 2HMMB 4CCVA 1N8QA 1WQLB 3BB9A 4N6NB 2I9WA 4N6OB 3L0RA 4BTWA 5D81A 1DMQA 1Z1SA 2ML6A 3MHEA 1RRHA 2Y73A 4I4KA 1UI7A 2Z76A 3BNEA 3G0KA 3A76A 2E2UA 5CF2A 3PS8A 3N54B 2XEPA 2V1LA 2P09A 2XGLA 1EG9B 3S28A 2CWVA 1W5ZA 2W9PA 4AEQA 4MMXB 3VGNA 1UI8A 1ZX2A 3V92A 1LVNA 2P0XA 1O7NB 3FH1A 3N9HA 3D9RA 1OHPA 4BTYA 1WMNA 1W6YA 4O8SA 3LTCA 4AKZA 2IA7A 2WOFA 3NX0A 3CXC2 2QGUA 3T8NA 1FGOA 3O8YA 2D1WA 2GU1A 1OCVA 5CF1A 1A2KA 5IG3A 2P05A 3CD63 3QRDA 1IVXA 4MMZB 2OOVA 1QMAA 2KCDA 5IG4A 3CC43 2ZL8A 2GBWB 1W2ZA 3PCRA 5AI1A 1YHQ3 3SOAA 5KP4A 1MNLA 3FF0A 3JVCA 3GZBA 4HZ9B 1ISKA 2MF7A 3QK9A 1OUNA 5IF6A 4U13A 3CCL3 2QIYA 3WA2X 3HIIA 1YJ93 5LC7A 2PZVA 2CIUA 1U5OA 1TFKA 1Q864 3T8UA 1O7GB 1JB5A 3FZWA 1IQXA 3CCM3 1A90A 3CU3A 3F7XA 2SBLA 1JJ22 1SJWA 1W7CA 2CWTA 3BNDA 3KIIA 2CFGA 1RJOA 4WFOA 1JN5B 3IPTA 4HM1B 2W56A 4WHAA 3NV0B 1K8A4 2BNGA 1IQ8A 1WMOA 2W56B 3EHCA 2LYXA 2ZDJA 1K41A 4HM0B 3F14A 1IU7A 4HM7B 1O7HB 3K5TA 4HJLB 1JKGA 1SIHA 5I97A 1VQ53 1ULIB 4OVMA 2XR8B 3DXOA 3H51A 3CPW2 1AVKA 3G8ZA 3LMLA 1IVWA 2W04A 4H61A 4QWTA 1EQKA 3PCSA 4HM8B 3HK4A 1NDOB 3CPOA 2A15A 2IUJA 3ROBA 5CK6A 2IMJA 3F7SA 3X3ZA 3FGYA 1YGEA 3SLUA 1GS3A 2JQ5A 4CDLA 1E3VA 3DM8A 3FG1A 3ECFA 3B4OA 4FMAA 4WWUC 5ELJA 3EC9A 4HVNA 4KZ1A 4N6UA 1UUVB 4Q53A 1SQWA 1Q824 1D6ZA 3GZYB 4PEJA 2CG1A 4O3VA 1VQN3 4ORLA 3X3XA 1ROVA 4R1KA 3MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV9 A;  2W9Q A;  5A0O B;  2CH9 A;  3QRD A;  1A67 A;  1G96 A;  1EQK A;  1FA3 A;  1A90 A;  2BO9 B;  4ZM8 A;  1FUW A;  1IV7 A;  3PYJ A;  5LC6 A;  2W9P A;  1CEW I;  4N6L A;  1DVD A;  4EYC A;  1M9G A;  3KSE D;  5ELU A;  1STF I;  1DVC A;  1N5H A;  1ROA A;  5EQL A;  1NB5 I;  1NB3 I;  1MOL A;  1RN7 A;  4N6T A;  1PFP A;  4CCV A;  1GD3 A;  4IT7 A;  2KXG A;  1MNL A;  3GAX A;  4N6N B;  3S67 A;  3UL6 A;  4TX4 A;  3LH4 A;  3PXM A;  4LZI A;  1TIJ A;  4N6O B;  5ELJ A;  1LXE A;  3MWZ A;  3KFQ C;  1KWI A;  3L0R A;  3NX0 A;  4N6U A;  3UL5 A;  3SVA A;  1GD4 A;  1CYV A;  1R4C A;  1N9J A;  3K9M C;  1YVB I;  3Q2P A;  1N5P A;  3IMA B;  4N6M A;  1CYU A;  2O9U X;  2OCT A;  5LC7 A;  3PS8 A;  4N6V 0;  1WNH A; 
#chains in the Genus database with same CATH topology
 3MPH A;  3AHS A;  1B2Z A;  2CH9 A;  1TUH A;  1BNJ A;  3B4P A;  3GRD A;  4XM4 A;  2F86 B;  4J5K A;  2Q07 A;  1Q7Y 4;  1FGQ A;  1LOY A;  1F8N A;  4HBR A;  5RNT A;  1UCI A;  5CXO A;  4ILF A;  5FW5 A;  1TRP A;  3I56 3;  3V98 A;  1UCL A;  5STD A;  3X3Y A;  4EV5 A;  4KFE A;  1KD1 4;  1O7P B;  5KP1 A;  5DRV A;  4LGQ A;  1O7W B;  1OH0 A;  5IEO A;  2HMK B;  3GWR A;  2F99 A;  3MG3 A;  1JBT A;  3CNM A;  2L4V A;  3LT8 A;  3LT9 A;  4KVH A;  1YVB I;  2Z77 A;  2FNQ A;  4GL6 A;  1S72 3;  2K54 A;  1SPU A;  3OWU A;  3MG2 A;  3F8X A;  5JPU A;  3U97 A;  2INX A;  1IV9 A;  1HZ1 A;  3Q3F A;  3BNB A;  5A0O B;  3D3L A;  3SOY A;  3OWY A;  1KSI A;  1T5Y A;  3PGB A;  2YX9 A;  4HZB B;  5CLK A;  2BMR B;  4EYC A;  1MGW A;  1DVC A;  4FMC A;  2YFL B;  1KC8 4;  3NM2 A;  1MOL A;  3ZFZ A;  1I2E A;  4IPB A;  1YIT 3;  1BRS A;  1B2M A;  1JKG B;  1MWT A;  3WOE B;  3HX8 A;  5IG5 A;  2HOH A;  1TIJ A;  5AEU B;  1GY5 A;  4R9K A;  4MEI A;  3RGA A;  1Q7H A;  2ML5 A;  3CCU 3;  1BSD A;  1CYV A;  3WOD G;  1E97 A;  6RNT A;  1RKY A;  3B7C A;  2GEY A;  5AEW B;  1M90 4;  1EKM A;  1JN5 A;  3VSY A;  1UUG B;  3CME 3;  2LQV A;  5G1K A;  4N6V 0;  1D6U A;  4OUQ A;  1PYL A;  4AKY A;  5IER A;  2H0H A;  2ZHX B;  3A5E A;  3LZA A;  2E2T A;  4I5Q A;  1FA3 A;  2CX0 A;  2SAR A;  3NUV A;  1JZO A;  4FMD A;  4HM3 B;  2MC8 A;  2CW9 A;  2P38 A;  4LMI A;  3PZW A;  1FUW A;  1RNB A;  1Q40 B;  2M7O A;  5M19 A;  1N5H A;  3WOF B;  1NB3 I;  3EN8 A;  1I8V A;  3FKA A;  3NBB A;  3UNL A;  3S5C A;  2CKF B;  2GBX B;  3Q90 A;  4STD A;  1NJI 4;  2XSH B;  3G16 A;  1OPY A;  3KFQ C;  5AIH A;  6STD A;  2WOH A;  1OGX A;  3LTB A;  1W6G A;  1VQ9 3;  1QVF 2;  3K0Z A;  8RNT A;  3NQY A;  2IY2 A;  1OHO A;  3Q2P A;  4N6M A;  5KP3 A;  4K1U A;  2H0I A;  3DMC A;  1S5A A;  2CHC A;  3NHX A;  1UCJ A;  2CG0 A;  2OCT A;  3M8C A;  4HM6 B;  4WP5 A;  1GSP A;  3X40 A;  1TP6 A;  1JNQ A;  1K73 4;  1WNH A;  1BSA A;  3N8B A;  3LTA A;  1DET A;  2ZA4 A;  3B8L A;  4IIA A;  1K9M 4;  3TDG A;  2WGO A;  3EN1 B;  2W6J H;  1JB4 A;  3Q1C A;  1JB2 A;  3NBR A;  1AR0 A;  2Y74 A;  4OK0 A;  5D83 A;  1NO3 A;  5LC6 A;  4N6L A;  3BNC A;  3I0Y A;  1UW1 A;  3FCS B;  1PU4 A;  1NB5 I;  1RRL A;  1IT8 A;  4HAA A;  1BOX A;  1LRA A;  2XSO B;  3DGN A;  3F9S A;  3STD A;  3OWS A;  5AII A;  4TX4 A;  2W0Q A;  1BGS A;  2GU3 A;  3ZG5 A;  4KFF A;  3UL5 A;  1IVV A;  1VQK 3;  2FGT A;  1ZGX A;  3K63 A;  3DY5 A;  2AAE A;  4J9A A;  1KQS 2;  1N5P A;  3IMA B;  3NXJ A;  4DKI A;  4JRF A;  5IEN A;  1X1X A;  7STD A;  1RGE A;  3OXA A;  1LOX A;  2IUK A;  3K7C A;  2YFJ B;  4LEH A;  5DRE A;  1IK3 A;  1MWR A;  1Q42 A;  2E2V A;  1DYU A;  2XH9 A;  1CEW I;  4K1V A;  5BXQ A;  3CCJ 3;  3ZG0 A;  2HMO B;  3ER7 A;  1X1W A;  3MKI A;  3HI7 A;  4G1M B;  3FLJ A;  4MMY B;  5ELU A;  1W4N A;  5EQL A;  5AYS C;  4FCM A;  4RNZ A;  2CFW A;  5IW9 A;  1FGR A;  1GD3 A;  2QEX 3;  1BAN A;  1BIR A;  1FUS A;  2KXG A;  2RGQ A;  1D6Y A;  3EX9 A;  1BAO A;  4LYL B;  4HM2 B;  1LXE A;  4FMB A;  1STD A;  3ALA A;  3CC7 3;  1MWU A;  2C4B A;  4O2H A;  1GY7 A;  2BMO B;  4K90 B;  3CMA 3;  5TGN A;  1RGF A;  2HMJ B;  1OF5 A;  4CJN A;  3LOY A;  4HM5 B;  4MJD A;  2OQE C;  2KRT A;  3S27 A;  3AGN A;  3DGO A;  2R41 A;  1B20 A;  2W9Q A;  3T0U A;  1QAL A;  2Z7A A;  5G1L A;  1B21 A;  4GHO A;  4X2H A;  3RNT A;  4NRE A;  1OGZ A;  3KSP A;  9RNT A;  1VZZ A;  3MYT A;  4O02 B;  1STF I;  1FZU A;  4FCZ A;  4XB5 A;  1IDP A;  1DMM A;  3EBY A;  1UUW B;  3OW2 2;  1NU3 A;  4IT7 A;  2CFD A;  3DH2 A;  3AHW A;  3KCH A;  3RDE A;  1AVL A;  3JUN A;  2YFI B;  3SX1 A;  3MWZ A;  1KWI A;  1FGT A;  1V57 A;  3KN4 A;  1GOV A;  1R4C A;  2BT3 A;  3DGM A;  3LXU X;  5G2G A;  1FGM A;  3OX9 A;  1TTO A;  7RNT A;  2CK3 H;  2XRX B;  5HOH A;  3OV4 A;  3X42 A;  1T3B A;  1M1K 4;  2H0G A;  2OTL 3;  4L8O A;  1BRH A;  2WO0 A;  5IG0 A;  2CFK A;  3JUQ A;  3CCR 3;  1W6C A;  3DUK A;  4BL3 A;  1U8C B;  4CPK A;  5EEO A;  3VF1 A;  1IYY A;  1BNS A;  3E99 A;  3D5I A;  1GMP A;  1RN7 A;  1RN1 A;  4N6T A;  1YJN 3;  1OAC A;  4EXR A;  1SAR A;  8CHO A;  1UGI A;  1HU9 A;  3GZX B;  2RSX A;  3GAX A;  1HYF A;  1OF5 B;  3LH4 A;  3PXM A;  1US1 A;  3FG3 A;  1Y4K A;  5D82 A;  4RZM A;  4XDV A;  3KKG A;  3SVA A;  1GD4 A;  2BMQ B;  3EF8 A;  3FSD A;  2UX0 A;  4X2O A;  3AMO A;  5AYR B;  2RBI A;  1AV4 A;  1WTH A;  5M1A A;  1LQG C;  2W2C A;  1BRG A;  3HZP A;  1C7H A;  4J8T A;  1VQL 3;  1VQ8 3;  3WMD A;  3JUP A;  4GB5 A;  2B24 B;  1G02 A;  4XBY A;  1G96 A;  1FYS A;  1X1Y A;  2GXF A;  2R4I A;  2K0M A;  1A2V A;  2D42 A;  3EQQ B;  2WGQ A;  2PNC A;  4BIR A;  2OOV C;  3HIG A;  4KT3 B;  2QA4 3;  2OQE A;  1WMP A;  5AIG A;  3H3H A;  1IQY A;  1ROA A;  3EB8 A;  1EA2 A;  1GMR A;  4LSO A;  4N3V A;  4XBX A;  1VQ4 3;  2HMN B;  1PFP A;  1VQQ A;  3FF2 A;  2UUG C;  3URP A;  2Z6B A;  1Q81 4;  3UL6 A;  3BLZ A;  3NM7 A;  1G0T A;  3F8H A;  1M1X B;  1TFO A;  4L8P A;  1W01 A;  3IJE B;  3X41 A;  3DGL A;  1J2B A;  5FGO A;  1JV2 B;  4XBT A;  2F4Y A;  3V99 A;  1TRQ A;  1W2B 2;  4J5G A;  5EVH A;  1RCK A;  2C10 A;  4EV2 A;  4ZM8 A;  1QVG 2;  5BU4 A;  1BRK A;  1B2U A;  3G4S 3;  1M9G A;  5JPP A;  3CCQ 3;  2RFR A;  3KZT A;  1BSE A;  1NWW A;  2P0M A;  4XDW A;  1VQM 3;  1GYB A;  1ULJ B;  4LZI A;  1LNI A;  1OHS A;  3DZL A;  4K61 A;  1UDI I;  1ZO2 A;  3FG4 A;  4KFD A;  2GEX A;  1E3R A;  2F98 A;  1O7M B;  2HML B;  4HKV B;  1JRQ A;  1RSN A;  2XF3 A;  1DMN A;  1BRJ A;  1QAK A;  1YJW 3;  4L7K A;  2F5W A;  1VQO 3;  2O9U X;  4R9L A;  3WDG B;  4H3U A;  3KE7 A;  4NHF A;  2BHM A;  1EUI C;  2C11 A;  3GZR A;  1LQM B;  2BO9 B;  2JDI H;  1IV7 A;  2J8X B;  3PYJ A;  4R4K A;  1VQ6 3;  5BVB A;  1V74 A;  2CWU A;  1W02 A;  4WYK A;  2CFL A;  5AIF A;  3D79 A;  4FR9 A;  3SYU A;  1IVU A;  3G71 3;  3AMO B;  1RGG A;  3D4A A;  3S67 A;  1B2X A;  1TU5 A;  2UGI A;  2XFS A;  3GSP A;  3UB1 A;  1RGA A;  1CQS A;  1GY6 A;  1VQ7 3;  3CC2 3;  2W03 A;  1BVI A;  2STD A;  3RGR A;  4EBG A;  4R80 A;  1IT7 A;  4JF8 A;  1CYU A;  4RNY A;  3NV0 A;  3J7Y d;  2XFT A;  2XGN A;  1GOY A;  2FXT A;  3CCE 3;  1MGR A;  1N9E A;  1ASK A;  2OWP A;  1RHL A;  1A67 A;  1DE3 A;  2KAA A;  4BTX A;  4HOH A;  1DVD A;  1I2G A;  3KSE D;  3LYG A;  3EBT A;  4HM4 B;  1QJG A;  2OTJ 3;  5HGR A;  3F40 A;  3U1W A;  4FCJ A;  1LOV A;  3SED A;  1HKX A;  2B1X B;  2IYJ A;  4RBN A;  1L5G B;  5IEP A;  5JBS A;  1BUQ A;  1QAF A;  3NQZ A;  1PY3 A;  3JUM A;  4EC6 A;  1BNR A;  2RCD A;  1VQP 3;  1YI2 3;  1N9J A;  2KF6 A;  3LTD A;  3MSO A;  1I3F A;  1I2F A;  3JUO A;  1W00 A;  3K9M C;  1AY7 A;  3I55 3;  4HYZ A;  1LNH A;  3CCV 3;  4WYK B;  1SII A;  1BNF A;  1RGC A;  1Q40 A;  1K28 A;  2KF5 A;  2AAD A;  3EJV A;  1BRI A;  5BIR A;  3G6E 3;  2O3O A;  2CC3 A;  3UJM A;  3CCS 3;  3SXX A;  3EE1 A;  3CNX A;  3WA3 A;  1A2P A;  1N8R 4;  3S29 A;  1RNT A;  1YIJ 3;  3NBJ A;  2HMM B;  4CCV A;  1N8Q A;  1WQL B;  3BB9 A;  1GOU A;  2KF4 A;  2I9W A;  4N6N B;  4N6O B;  1FUT A;  3WHO A;  3L0R A;  4BTW A;  5D81 A;  1DMQ A;  1Z1S A;  2ML6 A;  1BU4 A;  2RNT A;  3MHE A;  1RRH A;  2Y73 A;  1JBS A;  4I4K A;  1Q9E A;  1UI7 A;  2Z76 A;  3BNE A;  3G0K A;  3A76 A;  2E2U A;  5CF2 A;  3MG1 A;  3PS8 A;  1BNG A;  2XEP A;  3N54 B;  2V1L A;  1YNV X;  2P09 A;  2F5M A;  2XGL A;  1EG9 B;  3S28 A;  2CWV A;  4BU4 A;  1RGH A;  1TJD A;  1W5Z A;  2W9P A;  4AEQ A;  1BNE A;  4MMX B;  3VGN A;  1UI8 A;  1UCK A;  1ZX2 A;  3V92 A;  1LVN A;  2P0X A;  1O7N B;  3FH1 A;  2F56 A;  3N9H A;  3D9R A;  1RGK A;  1OHP A;  4BTY A;  1JZD A;  1WMN A;  1W6Y A;  1YGW A;  4O8S A;  7GSP A;  1BRN L;  3LTC A;  4AKZ A;  2IA7 A;  2WOF A;  3NX0 A;  3CXC 2;  1BUJ A;  1MWS A;  1I0X A;  2QGU A;  3T8N A;  1FGO A;  3O8Y A;  1BSC A;  3AGO A;  2D1W A;  1ZS7 A;  2GU1 A;  1I0V A;  1OCV A;  5CF1 A;  1BNI A;  1A2K A;  5IG3 A;  2P05 A;  1I3I A;  3QRD A;  3CD6 3;  3DGY A;  1IVX A;  4MMZ B;  2OOV A;  1QMA A;  1RCL A;  4NPB A;  1B2S A;  2KCD A;  5IG4 A;  3CC4 3;  1AQZ A;  2GBW B;  2ZL8 A;  3BIR A;  1W2Z A;  3WR2 A;  3PCR A;  1BSB A;  5AI1 A;  1YHQ 3;  3SOA A;  5KP4 A;  1MNL A;  3FF0 A;  3JVC A;  3GZB A;  4HZ9 B;  2BU4 A;  1ISK A;  2MF7 A;  3QK9 A;  3BU4 A;  1OUN A;  5IF6 A;  4U13 A;  3CCL 3;  2QIY A;  6GSP A;  3WA2 X;  3HII A;  1YJ9 3;  1CH0 A;  5LC7 A;  1YVS A;  2L1S A;  2PZV A;  2CIU A;  1U5O A;  1TFK A;  1Q86 4;  3T8U A;  1O7G B;  1JB5 A;  3FZW A;  1IQX A;  3CCM 3;  1A90 A;  3CU3 A;  3F7X A;  2SBL A;  1RLS A;  1JJ2 2;  1SJW A;  1W7C A;  2CWT A;  3BND A;  5M18 A;  3KII A;  1UGH I;  2CFG A;  1RJO A;  4WFO A;  5GSP A;  1JN5 B;  1GMQ A;  3IPT A;  4HM1 B;  2W56 A;  4WHA A;  3NV0 B;  1K8A 4;  2BNG A;  1NNV A;  1IQ8 A;  2CX1 A;  1WMO A;  2W56 B;  3EHC A;  2LYX A;  2ZDJ A;  1K41 A;  4HM0 B;  3F14 A;  3D5G A;  1IU7 A;  4HM7 B;  1O7H B;  3K5T A;  4HJL B;  1JKG A;  1LOW A;  1SIH A;  5I97 A;  1VQ5 3;  1ULI B;  4OVM A;  2XR8 B;  1FW7 A;  3DXO A;  3H51 A;  3CPW 2;  1X1U A;  1AVK A;  1T2I A;  3G8Z A;  3LML A;  1IVW A;  2W04 A;  1RMS A;  4RNT A;  4H61 A;  4QWT A;  1EQK A;  4EW5 A;  3PCS A;  1RGL A;  1RN4 A;  4HM8 B;  3HK4 A;  1NDO B;  3CPO A;  2A15 A;  2IUJ A;  2GSP A;  3ROB A;  5CK6 A;  2IMJ A;  3F7S A;  1RTU A;  3X3Z A;  3FGY A;  1YGE A;  3SLU A;  4BL2 A;  1GS3 A;  2JQ5 A;  2KF3 A;  4CDL A;  1E3V A;  3DM8 A;  1V58 A;  3FG1 A;  4GSP A;  3ECF A;  1JBR A;  1RDS A;  3B4O A;  1B27 A;  4FMA A;  4WWU C;  5ELJ A;  3EC9 A;  4HVN A;  4KZ1 A;  4N6U A;  1UUV B;  1R4Y A;  4Q53 A;  1SQW A;  1B3S A;  1Q82 4;  1D6Z A;  3GZY B;  4PEJ A;  1EEJ A;  2CG1 A;  4O3V A;  1VQN 3;  3HOH A;  1C54 A;  1T2H A;  4ORL A;  1I70 A;  1ROV A;  4R1K A;  3X3X A;  2K3D A;  2BIR A; 
#chains in the Genus database with same CATH homology
 3MPH A;  2CH9 A;  1TUH A;  3B4P A;  3GRD A;  4XM4 A;  2F86 B;  2Q07 A;  1Q7Y 4;  1FGQ A;  1F8N A;  4HBR A;  5CXO A;  5FW5 A;  3I56 3;  3V98 A;  5STD A;  3X3Y A;  4EV5 A;  4KFE A;  1KD1 4;  1O7P B;  5KP1 A;  5DRV A;  4LGQ A;  1O7W B;  1OH0 A;  5IEO A;  2HMK B;  3GWR A;  2F99 A;  3MG3 A;  3CNM A;  2L4V A;  3LT8 A;  3LT9 A;  4KVH A;  1YVB I;  2Z77 A;  2FNQ A;  4GL6 A;  1S72 3;  2K54 A;  1SPU A;  3OWU A;  3MG2 A;  3F8X A;  3U97 A;  2INX A;  1IV9 A;  3BNB A;  5A0O B;  3D3L A;  3SOY A;  3OWY A;  1KSI A;  1T5Y A;  3PGB A;  2YX9 A;  4HZB B;  5CLK A;  2BMR B;  4EYC A;  1DVC A;  4FMC A;  2YFL B;  1KC8 4;  3NM2 A;  1MOL A;  4IPB A;  1YIT 3;  1JKG B;  3WOE B;  3HX8 A;  5IG5 A;  1TIJ A;  5AEU B;  1GY5 A;  4R9K A;  4MEI A;  3RGA A;  2ML5 A;  3CCU 3;  1CYV A;  3WOD G;  1RKY A;  1E97 A;  1M90 4;  3B7C A;  2GEY A;  5AEW B;  1EKM A;  1JN5 A;  3VSY A;  3CME 3;  2LQV A;  4AKY A;  4N6V 0;  1D6U A;  4OUQ A;  5IER A;  5JPU A;  3I55 3;  1FA3 A;  3LZA A;  2E2T A;  4FMD A;  3NUV A;  4HM3 B;  2MC8 A;  2CW9 A;  2P38 A;  4LMI A;  3PZW A;  1FUW A;  1Q40 B;  2M7O A;  1N5H A;  3WOF B;  1NB3 I;  3EN8 A;  3FKA A;  3NBB A;  3UNL A;  3S5C A;  2CKF B;  2GBX B;  3Q90 A;  4STD A;  1NJI 4;  2XSH B;  3G16 A;  1OPY A;  3KFQ C;  5AIH A;  6STD A;  2WOH A;  1OGX A;  3LTB A;  1W6G A;  1VQ9 3;  1QVF 2;  3K0Z A;  3NQY A;  1OHO A;  3Q2P A;  4N6M A;  5KP3 A;  4K1U A;  3DMC A;  3NHX A;  1S5A A;  2CHC A;  4HM6 B;  4WP5 A;  2CG0 A;  2OCT A;  3M8C A;  3X40 A;  1TP6 A;  1JNQ A;  1K73 4;  1WNH A;  3N8B A;  3LTA A;  3B8L A;  4IIA A;  1K9M 4;  3TDG A;  2WGO A;  3EN1 B;  2W6J H;  1JB4 A;  3Q1C A;  1JB2 A;  3NBR A;  1AR0 A;  2Y74 A;  4OK0 A;  5D83 A;  1NO3 A;  5LC6 A;  4N6L A;  3BNC A;  3I0Y A;  1UW1 A;  3FCS B;  1PU4 A;  1NB5 I;  1RRL A;  1IT8 A;  2XSO B;  3DGN A;  3F9S A;  3STD A;  3OWS A;  5AII A;  4TX4 A;  2W0Q A;  2GU3 A;  4KFF A;  3UL5 A;  1IVV A;  1VQK 3;  2FGT A;  3K63 A;  3DY5 A;  4J9A A;  1KQS 2;  1N5P A;  3IMA B;  3NXJ A;  5IEN A;  4JRF A;  7STD A;  3OXA A;  1LOX A;  2IUK A;  3K7C A;  2YFJ B;  4LEH A;  5DRE A;  1IK3 A;  1Q42 A;  2E2V A;  1DYU A;  2XH9 A;  1CEW I;  4K1V A;  5BXQ A;  3CCJ 3;  2HMO B;  3ER7 A;  3MKI A;  4G1M B;  3HI7 A;  4MMY B;  3FLJ A;  5ELU A;  5EQL A;  1W4N A;  5AYS C;  4FCM A;  4RNZ A;  2CFW A;  5IW9 A;  1FGR A;  1GD3 A;  2QEX 3;  2RGQ A;  2KXG A;  1D6Y A;  3EX9 A;  4HM2 B;  1LXE A;  4FMB A;  1STD A;  3ALA A;  3CC7 3;  4O2H A;  1GY7 A;  2BMO B;  4K90 B;  3CMA 3;  5TGN A;  2HMJ B;  1OF5 A;  3LOY A;  4HM5 B;  4MJD A;  2OQE C;  2KRT A;  3S27 A;  3DGO A;  3T0U A;  2W9Q A;  1QAL A;  2Z7A A;  4X2H A;  4NRE A;  1OGZ A;  3KSP A;  1VZZ A;  3MYT A;  4O02 B;  1STF I;  4FCZ A;  4XB5 A;  1IDP A;  1DMM A;  3EBY A;  1UUW B;  3OW2 2;  1NU3 A;  4IT7 A;  2CFD A;  3RDE A;  1AVL A;  3JUN A;  2YFI B;  3SX1 A;  3MWZ A;  1KWI A;  1FGT A;  3KN4 A;  1R4C A;  2BT3 A;  5G2G A;  3DGM A;  3LXU X;  1FGM A;  3OX9 A;  2CK3 H;  2XRX B;  3OV4 A;  3X42 A;  1M1K 4;  2OTL 3;  4L8O A;  2WO0 A;  5IG0 A;  2CFK A;  3JUQ A;  3CCR 3;  1W6C A;  3DUK A;  1U8C B;  5EEO A;  3VF1 A;  3E99 A;  1RN7 A;  4N6T A;  1YJN 3;  1OAC A;  4EXR A;  8CHO A;  3GZX B;  1HU9 A;  2RSX A;  3GAX A;  1OF5 B;  3LH4 A;  3PXM A;  1US1 A;  3FG3 A;  1Y4K A;  5D82 A;  4RZM A;  4XDV A;  3KKG A;  3SVA A;  1GD4 A;  2BMQ B;  3EF8 A;  3FSD A;  2UX0 A;  4X2O A;  3AMO A;  5AYR B;  1AV4 A;  1WTH A;  2W2C A;  3HZP A;  1C7H A;  4J8T A;  1VQL 3;  1VQ8 3;  3WMD A;  3JUP A;  4GB5 A;  2B24 B;  4XBY A;  1G96 A;  2GXF A;  2R4I A;  2K0M A;  1A2V A;  2D42 A;  3EQQ B;  2WGQ A;  2PNC A;  2OOV C;  3HIG A;  2QA4 3;  2OQE A;  1WMP A;  5AIG A;  3H3H A;  1IQY A;  1ROA A;  3EB8 A;  1EA2 A;  4LSO A;  4N3V A;  4XBX A;  1VQ4 3;  2HMN B;  1PFP A;  3FF2 A;  2Z6B A;  1Q81 4;  3UL6 A;  3BLZ A;  3NM7 A;  3F8H A;  1M1X B;  1TFO A;  4L8P A;  1W01 A;  3IJE B;  3X41 A;  3DGL A;  1J2B A;  5FGO A;  1JV2 B;  4XBT A;  3V99 A;  1W2B 2;  5EVH A;  4ZM8 A;  2C10 A;  4EV2 A;  1QVG 2;  3G4S 3;  1M9G A;  5JPP A;  3CCQ 3;  2RFR A;  3KZT A;  1NWW A;  4XDW A;  2P0M A;  1VQM 3;  1GYB A;  1ULJ B;  4LZI A;  1OHS A;  3DZL A;  4K61 A;  1ZO2 A;  4KFD A;  3FG4 A;  2GEX A;  1E3R A;  2F98 A;  1O7M B;  2HML B;  4HKV B;  1JRQ A;  2XF3 A;  1DMN A;  1QAK A;  1YJW 3;  4L7K A;  1VQO 3;  2O9U X;  4R9L A;  3WDG B;  4H3U A;  3KE7 A;  4NHF A;  2BHM A;  2C11 A;  3GZR A;  2BO9 B;  2JDI H;  1IV7 A;  4R4K A;  3PYJ A;  1VQ6 3;  5BVB A;  1V74 A;  2CWU A;  1W02 A;  4WYK A;  2CFL A;  5AIF A;  4FR9 A;  1IVU A;  3G71 3;  3AMO B;  3S67 A;  1TU5 A;  2XFS A;  3UB1 A;  1CQS A;  1GY6 A;  1VQ7 3;  3CC2 3;  2W03 A;  2STD A;  3RGR A;  4EBG A;  4R80 A;  1IT7 A;  4JF8 A;  1CYU A;  4RNY A;  3NV0 A;  3J7Y d;  2XFT A;  2XGN A;  2FXT A;  3CCE 3;  1N9E A;  2OWP A;  1ASK A;  1A67 A;  4BTX A;  1DVD A;  3KSE D;  3LYG A;  3EBT A;  4HM4 B;  1QJG A;  2OTJ 3;  5HGR A;  3F40 A;  3U1W A;  4FCJ A;  3SED A;  1HKX A;  2B1X B;  4RBN A;  1L5G B;  5IEP A;  5JBS A;  1BUQ A;  1QAF A;  3NQZ A;  3JUM A;  4EC6 A;  2RCD A;  1VQP 3;  1YI2 3;  1N9J A;  3LTD A;  3MSO A;  3JUO A;  3K9M C;  1W00 A;  4HYZ A;  1LNH A;  3CCV 3;  4WYK B;  1SII A;  1Q40 A;  1K28 A;  3EJV A;  3G6E 3;  2O3O A;  2CC3 A;  3UJM A;  3CCS 3;  3SXX A;  3EE1 A;  3CNX A;  3WA3 A;  1N8R 4;  3S29 A;  1YIJ 3;  3NBJ A;  2HMM B;  4CCV A;  1N8Q A;  1WQL B;  3BB9 A;  4N6N B;  2I9W A;  4N6O B;  3L0R A;  4BTW A;  5D81 A;  1DMQ A;  1Z1S A;  2ML6 A;  3MHE A;  1RRH A;  2Y73 A;  4I4K A;  1UI7 A;  2Z76 A;  3BNE A;  3G0K A;  3A76 A;  2E2U A;  5CF2 A;  3PS8 A;  3N54 B;  2XEP A;  2V1L A;  2P09 A;  2XGL A;  1EG9 B;  3S28 A;  2CWV A;  1W5Z A;  2W9P A;  4AEQ A;  4MMX B;  3VGN A;  1UI8 A;  1ZX2 A;  3V92 A;  1LVN A;  2P0X A;  1O7N B;  3FH1 A;  3N9H A;  3D9R A;  1OHP A;  4BTY A;  1WMN A;  1W6Y A;  4O8S A;  3LTC A;  4AKZ A;  2IA7 A;  2WOF A;  3NX0 A;  3CXC 2;  2QGU A;  3T8N A;  1FGO A;  3O8Y A;  2D1W A;  2GU1 A;  1OCV A;  5CF1 A;  1A2K A;  5IG3 A;  2P05 A;  3CD6 3;  3QRD A;  1IVX A;  4MMZ B;  2OOV A;  1QMA A;  2KCD A;  5IG4 A;  3CC4 3;  2ZL8 A;  2GBW B;  1W2Z A;  3PCR A;  5AI1 A;  1YHQ 3;  3SOA A;  5KP4 A;  1MNL A;  3FF0 A;  3JVC A;  3GZB A;  4HZ9 B;  1ISK A;  2MF7 A;  3QK9 A;  1OUN A;  5IF6 A;  4U13 A;  3CCL 3;  2QIY A;  3WA2 X;  3HII A;  1YJ9 3;  5LC7 A;  2PZV A;  2CIU A;  1U5O A;  1TFK A;  1Q86 4;  3T8U A;  1O7G B;  1JB5 A;  3FZW A;  1IQX A;  3CCM 3;  1A90 A;  3CU3 A;  3F7X A;  2SBL A;  1JJ2 2;  1SJW A;  1W7C A;  2CWT A;  3BND A;  3KII A;  2CFG A;  1RJO A;  4WFO A;  1JN5 B;  3IPT A;  4HM1 B;  2W56 A;  4WHA A;  3NV0 B;  1K8A 4;  2BNG A;  1IQ8 A;  1WMO A;  2W56 B;  3EHC A;  2LYX A;  2ZDJ A;  1K41 A;  4HM0 B;  3F14 A;  1IU7 A;  4HM7 B;  1O7H B;  3K5T A;  4HJL B;  1JKG A;  1SIH A;  5I97 A;  1VQ5 3;  1ULI B;  4OVM A;  2XR8 B;  3DXO A;  3H51 A;  3CPW 2;  1AVK A;  3G8Z A;  3LML A;  1IVW A;  2W04 A;  4H61 A;  4QWT A;  1EQK A;  3PCS A;  4HM8 B;  3HK4 A;  1NDO B;  3CPO A;  2A15 A;  2IUJ A;  3ROB A;  5CK6 A;  2IMJ A;  3F7S A;  3X3Z A;  3FGY A;  1YGE A;  3SLU A;  1GS3 A;  2JQ5 A;  4CDL A;  1E3V A;  3DM8 A;  3FG1 A;  3ECF A;  3B4O A;  4FMA A;  4WWU C;  5ELJ A;  3EC9 A;  4HVN A;  4KZ1 A;  4N6U A;  1UUV B;  4Q53 A;  1SQW A;  1Q82 4;  1D6Z A;  3GZY B;  4PEJ A;  2CG1 A;  4O3V A;  1VQN 3;  4ORL A;  3X3X A;  1ROV A;  4R1K A;  3MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...