1LXEA

Crystal structure of the cathelicidin motif of protegrins
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
92
Chain Sequence
ALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDDITCNEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords protegrin-3 precursor
publication title Structure of the cathelicidin motif of protegrin-3 precursor: structural insights into the activation mechanism of an antimicrobial protein.
pubmed doi rcsb
source organism Sus scrofa
total genus 15
structure length 92
sequence length 98
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1lxeA00
3PYJA 1IV9A 1N5PA 1LXEA 3KFQC 3QRDA 1A67A 4TX4A 1R4CA 5EQLA 3SVAA 5LC7A 3PXMA 1TIJA 3L0RA 1CYUA 2W9QA 4N6V0 1STFI 1GD4A 3LH4A 3UL6A 2CH9A 1N5HA 1FUWA 2W9PA 3MWZA 5LC6A 3NX0A 1A90A 1YVBI 3UL5A 1DVCA 1NB5I 3PS8A 3K9MC 1IV7A 1NB3I 1N9JA 1MNLA 4N6MA 5ELJA 1PFPA 4LZIA 2OCTA 1DVDA 1CEWI 1M9GA 1MOLA 1KWIA 1GD3A 1G96A 1RN7A 4N6LA 4N6TA 4EYCA 4CCVA 1CYVA 3Q2PA 1EQKA 4N6NB 3KSED 3GAXA 3IMAB 1ROAA 3S67A 4N6OB 5ELUA 1WNHA 5A0OB 4IT7A 4N6UA 2KXGA 1FA3A 2O9UX 4ZM8A 2BO9B
chains in the Genus database with same CATH superfamily
1UCLA 4H61A 4HOHA 1A2PA 2CWUA 2ZHXB 1PU4A 2WOFA 1N5PA 3BIRA 3EX9A 1A2VA 3EN1B 2D42A 2GXFA 4J5KA 3CXC2 2IY2A 3B8LA 3KFQC 4R9KA 1E3VA 3BNCA 4FCZA 1K734 4I5QA 4BU4A 4EW5A 1OF5B 3GSPA 1GMPA 1BIRA 1HU9A 1OHSA 1TUHA 3JUNA 2WOHA 4R4KA 3HIIA 1R4CA 5STDA 6STDA 2MC8A 2IUKA 4NHFA 3ER7A 2UUGC 3X3XA 2JDIH 3PXMA 5JPUA 3KIIA 1GOYA 5IF6A 4FMCA 2KF4A 3TDGA 2KCDA 1VQ93 4OK0A 3S5CA 1EA2A 1MWSA 2R41A 1B2SA 1O7WB 1PY3A 1STFI 2CX1A 4HM4B 3DY5A 1TFOA 4U13A 3SYUA 2CG1A 1K8A4 3EB8A 3CCS3 1I3IA 1N5HA 2OQEC 1LNHA 1W00A 2YX9A 3DMCA 1MGWA 3JUMA 1BRKA 1V57A 1JB4A 1QAKA 2HMMB 5CXOA 2W9PA 2C10A 1SJWA 3MWZA 4RZMA 4BTYA 5BXQA 4K1VA 2L1SA 2PZVA 4O2HA 5JBSA 4HZBB 4RBNA 3HOHA 3CPOA 3NV0A 4OUQA 4JF8A 3UL5A 1NB5I 2QIYA 1GOVA 4Q53A 1GSPA 2YFIB 3K9MC 1BNIA 4RNYA 2XFTA 1YGEA 2UGIA 1NB3I 1DE3A 1JBSA 3DGNA 1RN4A 1RCKA 1AR0A 1IT8A 1N9JA 1TP6A 2H0HA 2Y73A 3B4PA 1MNLA 3Q90A 3PZWA 4LGQA 3KSPA 1RNTA 3B4OA 5ELJA 1B27A 1LOVA 2F4YA 3GRDA 2SBLA 3HZPA 3N8BA 4WP5A 2OCTA 1UUVB 5FW5A 1AVKA 1QAFA 4LSOA 1BRJA 1KWIA 2RFRA 1B21A 2P09A 1TU5A 2KF6A 5BU4A 1RN7A 2HMOB 3CCV3 1RMSA 1BNFA 4HVNA 3D9RA 4GB5A 1Q824 1GY5A 3OV4A 1BSCA 1UCKA 1UGIA 1TJDA 4I4KA 1G0TA 2Z7AA 5M1AA 1UI7A 3Q2PA 3UB1A 1KC84 4J9AA 1VQK3 4FMBA 1T5YA 1Q814 2V1LA 1W7CA 1X1WA 4AEQA 3OWYA 3GAXA 1M1XB 2ML6A 3FZWA 1DVDA 5KP4A 3MKIA 3X3YA 3ECFA 7GSPA 1BSBA 4R9LA 3CNMA 1FZUA 3BNDA 5IEPA 1ULIB 4PEJA 7STDA 1IVUA 3MHEA 4RNTA 1I2EA 2XF3A 3AHWA 1E3RA 1B20A 2D1WA 2L4VA 1GMRA 3LTBA 3F9SA 4FCJA 1VQO3 1FUTA 2AAEA 3D3LA 4JRFA 4HBRA 5ELUA 1FYSA 4K61A 4HKVB 3SEDA 3D5IA 3SOAA 3H3HA 1W4NA 3K7CA 1VQQA 3NBBA 3MYTA 3URPA 3NBRA 1OUNA 1BSDA 1HKXA 2IUJA 3PYJA 3F7XA 2OTL3 1ISKA 1RGGA 1IV9A 1BRSA 3LZAA 2K3DA 3KCHA 2MF7A 1B2MA 1BRNL 1UI8A 1WMOA 1GY7A 2CFDA 2LYXA 2P05A 4IPBA 1NU3A 5D83A 1JZDA 4BTXA 4MEIA 1BOXA 1WQLB 3DXOA 5M18A 1RGKA 1W02A 4XBYA 3CCE3 1O7MB 1SQWA 2GBWB 2RGQA 3SLUA 4ILFA 4FR9A 1RCLA 1C7HA 1OGXA 3EBTA 2B1XB 4KFFA 2RNTA 4K1UA 1RRHA 3E99A 1JBTA 5KP1A 1W6YA 3JUQA 1CYUA 1F8NA 3G4S3 2W9QA 3A76A 3FF2A 3NXJA 5M19A 1WMPA 1UUGB 1BRGA 4J5GA 3HI7A 4BIRA 3FCSB 7RNTA 3DM8A 3MPHA 5EEOA 5CK6A 1RGHA 2GBXB 3T8NA 1SIIA 1LQGC 1RGLA 3GWRA 3FH1A 4GHOA 2A15A 1ZS7A 3V92A 2BMQB 1OF5A 3DGMA 1M1K4 3D79A 2CFLA 1Q864 1AY7A 1M904 4HM1B 1IVXA 2GEYA 1YVSA 1G02A 1I0VA 2XSHB 1A90A 1TRQA 1UUWB 3CME3 1QVG2 1JB5A 3CU3A 1LQMB 3FSDA 3PS8A 4G1MB 1SARA 3SXXA 1BNRA 3FG3A 1OHPA 2Q07A 3DGYA 1RNBA 3STDA 1WTHA 2GU1A 3Q3FA 4XBTA 4N6MA 3X3ZA 2WGOA 1IT7A 4HM6B 4GL6A 4O02B 1M9GA 2UX0A 1CH0A 3EQQB 2YFLB 5G1KA 1N8R4 2Z77A 1BNJA 1OACA 1Y4KA 3EC9A 3CCU3 1PYLA 1G96A 4N6LA 3CCL3 2F5MA 8RNTA 1FGTA 3LTDA 1VQL3 2RCDA 4EYCA 2BNGA 4H3UA 1EQKA 4N6NB 1RSNA 5CLKA 4FCMA 4X2OA 1US1A 2RSXA 3KSED 1IK3A 4MJDA 1JV2B 5D81A 2F98A 3EJVA 2YFJB 5I97A 3CC43 2F99A 2Z6BA 3ALAA 3UNLA 5BIRA 1OHOA 3IMAB 1LNIA 2GSPA 4QWTA 5D82A 3WOFB 4KT3B 1YJ93 3ROBA 1UCIA 3NQZA 3OX9A 1BNSA 1BRIA 1W2B2 2IA7A 2BU4A 4L8OA 1N8QA 2F86B 2SARA 4STDA 1K9M4 1N9EA 1Z1SA 2KF5A 4J8TA 5HGRA 3WA3A 1RN1A 1SPUA 3GZBA 3U97A 1I70A 2QGUA 3CMA3 2C11A 2FGTA 1U5OA 4IT7A 4N6UA 1KSIA 1OH0A 3N54B 3KN4A 1I0XA 2O9UX 1VQP3 3QK9A 1UGHI 5DRVA 1EKMA 4OVMA 2BO9B 1BRHA 3G6E3 1JN5B 5IERA 1BANA 1D6UA 2Z76A 4KZ1A 1STDA 3F40A 8CHOA 1JBRA 4FMAA 5TGNA 2W0QA 1JZOA 1JNQA 2KRTA 3BNEA 3G713 3QRDA 3EF8A 5AIGA 2CFWA 4RNZA 1I8VA 4AKYA 2J8XB 1YJW3 4CDLA 2K0MA 3DGLA 3T8UA 4TX4A 3EHCA 1RGEA 2GU3A 3RGAA 5EQLA 2F56A 2I9WA 2STDA 3S27A 1ROVA 1TIJA 3L0RA 4XBXA 2OOVA 2W03A 3FG4A 5CF2A 1O7GB 5IENA 3V98A 3CCQ3 1YI23 1EG9B 1GD4A 4XM4A 4EC6A 1JKGA 3UL6A 9RNTA 2E2UA 4EV2A 4DKIA 4HM0B 1JKGB 3DZLA 2BT3A 2CC3A 3N9HA 2CH9A 3LMLA 4HAAA 1Q9EA 5AIFA 1KQS2 1FUWA 2IMJA 1Q7HA 4N3VA 2W04A 1ASKA 1LVNA 3LXUX 1MGRA 2B24B 2E2VA 3LOYA 4XB5A 5G2GA 3T0UA 4L8PA 4NPBA 1YHQ3 3OXAA 1RKYA 1VQM3 5LC6A 3BB9A 2XRXB 2XSOB 1V74A 3V99A 1IVWA 3SX1A 4K90B 1RTUA 1D6ZA 2CFGA 1I3FA 1BNGA 5GSPA 3ZG0A 1SIHA 1JJ22 4BL2A 1DMMA 2C4BA 2ML5A 3KE7A 3LYGA 2KAAA 1HYFA 4HJLB 2F5WA 2ZDJA 4KFDA 5AI1A 3LTCA 1PFPA 3X42A 2K54A 4WYKA 3K63A 1O7HB 1RGCA 4WYKB 5AEUB 4EV5A 3VF1A 4HM2B 3OWUA 2QEX3 1VQ83 3X40A 1Q40A 3FG1A 5CF1A 1Q40B 1QALA 1D6YA 3WOEB 1BUJA 3G16A 3MG1A 1VQN3 4N6TA 2BMRB 1TTOA 5AIIA 1VZZA 4KFEA 5IG4A 1FGMA 3F8HA 4ORLA 3GZRA 3WHOA 1E97A 2P0XA 2P0MA 4HM7B 5IG3A 2LQVA 4L7KA 2CK3H 1GMQA 3ZG5A 3CC73 3I553 1YJN3 2E2TA 3JVCA 1B3SA 1AV4A 1I2GA 3JUPA 3KKGA 5FGOA 5IEOA 1BU4A 1NNVA 2HMLB 4WFOA 3VSYA 3D5GA 3IJEB 2OWPA 3LT9A 3WR2A 1UCJA 4O3VA 3NUVA 1DETA 1RJOA 1VQ43 1Q42A 4MMYB 3AMOA 3O8YA 3X41A 2XGNA 3AMOB 3HK4A 2FNQA 3S29A 6GSPA 1VQ53 3BU4A 3K0ZA 3MG2A 1K41A 3NM7A 1WNHA 5AYSC 5A0OB 1NDOB 2M7OA 3AGNA 2KXGA 2P38A 5AIHA 3OW22 1AVLA 2H0IA 1GY6A 4HYZA 2QA43 4XDVA 4HZ9B 4NREA 4GSPA 4LYLB 3FGYA 3PCRA 1GYBA 3WODG 3BNBA 5IW9A 1BSAA 1X1UA 1LXEA 1B2UA 1DMQA 3LTAA 1OGZA 2KF3A 1MWTA 1TFKA 2PNCA 2W56A 2HMKB 2GEXA 2ZL8A 3A5EA 3CNXA 3NM2A 2AADA 4XDWA 2W56B 4KVHA 1JRQA 3PCSA 3Q1CA 1GS3A 1QVF2 3MSOA 3DH2A 3RDEA 1S723 1A67A 3J7Yd 1JB2A 1IDPA 3RNTA 3AGOA 1T3BA 2XGLA 3F7SA 4CJNA 3BLZA 1W6GA 3SVAA 2H0GA 5LC7A 3NV0B 2CIUA 4FMDA 4HM8B 1FGOA 1BVIA 3NBJA 4AKZA 1RLSA 2OOVC 1FGRA 2W6JH 3WMDA 1BGSA 5JPPA 2OTJ3 2CW9A 3K5TA 1VQ63 3CD63 4N6V0 1MWRA 3B7CA 3F8XA 4IIAA 1Q7Y4 1JN5A 1W2ZA 2HOHA 3LH4A 2RBIA 2CKFB 5AEWB 1NO3A 5IG0A 3G0KA 3F14A 3U1WA 1IQXA 2OQEA 3SOYA 1ZO2A 3EE1A 4CPKA 2Y74A 1BSEA 5HOHA 4MMXB 3RGRA 1DMNA 1X1YA 3JUOA 1AQZA 1BAOA 2WGQA 3PGBA 4BTWA 1J2BA 1B2XA 5AYRB 2INXA 1K28A 1RGAA 1NWWA 2HMNB 4BL3A 1NJI4 3NX0A 3WDGB 1V58A 3VGNA 3CCR3 1IU7A 1YVBI 1IYYA 1DVCA 1KD14 1OPYA 3UJMA 5DREA 1C54A 3ZFZA 3DUKA 3FKAA 3HIGA 3DGOA 1O7PB 2ZA4A 4LMIA 1IV7A 5KP3A 2CG0A 2CWVA 2BMOB 3NQYA 1A2KA 1U8CB 1IQYA 1QMAA 1W6CA 3S28A 1YIJ3 4LEHA 3WA2X 2CHCA 3FF0A 3MG3A 1YGWA 1X1XA 1CEWI 2HMJB 1MOLA 3GZYB 4LZIA 3EBYA 5EVHA 1B2ZA 3EN8A 4WWUC 4EBGA 4EXRA 1HZ1A 1GD3A 2XEPA 2O3OA 3I0YA 4HM5B 4HM3B 3HX8A 3CC23 4X2HA 1IQ8A 3G8ZA 1EUIC 1RHLA 1W01A 1QJGA 1FUSA 1ZGXA 3NHXA 1LOYA 4R1KA 4CCVA 1RDSA 4O8SA 1BUQA 3IPTA 5IG5A 1CYVA 3H51A 5G1LA 3D4AA 1VQ73 1TRPA 1DYUA 1FW7A 1LOWA 1W5ZA 1GOUA 1LOXA 3CCM3 3I563 2WO0A 3GZXB 3OWSA 1L5GB 1I2FA 1BNEA 2XFSA 1ZX2A 1WMNA 1IVVA 1RRLA 2XH9A 2IYJA 1CQSA 1RGFA 1YNVX 1OCVA 1FGQA 2CWTA 3CCJ3 1ROAA 3M8CA 1O7NB 3LT8A 3FLJA 4MMZB 4R80A 3AHSA 1S5AA 2BIRA 3S67A 2R4IA 1EEJA 1MWUA 2W2CA 2FXTA 2CFKA 4N6OB 5RNTA 2BHMA 1T2IA 1R4YA 1UW1A 3KZTA 6RNTA 1UDII 1YIT3 4WHAA 1FA3A 2XR8B 1LRAA 3CPW2 1ULJB 2CX0A 4ZM8A 1T2HA 2JQ5A 5BVBA
chains in the Genus database with same CATH topology
4H61A 1PU4A 2CWUA 2WOFA 1N5PA 3EX9A 1A2VA 3EN1B 2D42A 2GXFA 3CXC2 4R9KA 3B8LA 3KFQC 1E3VA 3BNCA 4FCZA 1K734 1OF5B 1HU9A 1TUHA 1OHSA 3JUNA 2WOHA 4R4KA 3HIIA 1R4CA 5STDA 6STDA 2MC8A 2IUKA 4NHFA 3ER7A 3X3XA 2JDIH 3PXMA 5JPUA 3KIIA 5IF6A 4FMCA 1VQ93 3TDGA 2KCDA 4OK0A 3S5CA 1EA2A 1O7WB 1STFI 4HM4B 3DY5A 1TFOA 4U13A 2CG1A 1K8A4 3EB8A 3CCS3 1N5HA 2OQEC 3DMCA 1LNHA 1W00A 2YX9A 3JUMA 1JB4A 1QAKA 2HMMB 5CXOA 2W9PA 2C10A 1SJWA 3MWZA 4RZMA 4BTYA 5BXQA 4K1VA 2PZVA 4O2HA 5JBSA 4HZBB 4RBNA 3CPOA 3NV0A 4OUQA 4JF8A 3UL5A 1NB5I 2QIYA 4Q53A 2YFIB 3K9MC 4RNYA 2XFTA 1YGEA 1NB3I 3DGNA 3B4PA 3Q90A 1AR0A 1IT8A 1N9JA 1TP6A 2Y73A 3PZWA 4LGQA 1MNLA 3KSPA 5ELJA 3B4OA 3GRDA 5FW5A 3HZPA 4WP5A 2SBLA 3N8BA 2OCTA 1UUVB 1AVKA 1QAFA 4LSOA 1KWIA 2RFRA 2P09A 1TU5A 1RN7A 2HMOB 3CCV3 4HVNA 3D9RA 4GB5A 1Q824 1GY5A 3OV4A 3UB1A 4I4KA 2Z7AA 1UI7A 3Q2PA 1KC84 4J9AA 1VQK3 4FMBA 1T5YA 1Q814 2V1LA 1W7CA 4AEQA 3OWYA 3GAXA 1M1XB 2ML6A 3FZWA 5KP4A 3MKIA 3X3YA 3ECFA 4R9LA 3CNMA 3BNDA 5IEPA 1ULIB 4PEJA 7STDA 1IVUA 3MHEA 2XF3A 1E3RA 2D1WA 2L4VA 3LTBA 3F9SA 4FCJA 1VQO3 4JRFA 3D3LA 5ELUA 4HBRA 4K61A 4HKVB 3SEDA 3SOAA 3H3HA 1W4NA 3K7CA 3NBBA 3MYTA 3NBRA 1OUNA 1HKXA 2IUJA 3PYJA 3F7XA 2OTL3 1ISKA 1IV9A 3LZAA 2MF7A 1UI8A 1WMOA 1GY7A 2CFDA 2LYXA 2P05A 4IPBA 1NU3A 5D83A 4BTXA 4MEIA 1WQLB 3DXOA 1W02A 4XBYA 3CCE3 1O7MB 1SQWA 2GBWB 2RGQA 3SLUA 4FR9A 1C7HA 1OGXA 3EBTA 2B1XB 4KFFA 4K1UA 1RRHA 3E99A 5KP1A 1W6YA 3JUQA 1CYUA 1F8NA 3G4S3 2W9QA 3A76A 3FF2A 3NXJA 1WMPA 3HI7A 3FCSB 3DM8A 3MPHA 5EEOA 5CK6A 3T8NA 2GBXB 1SIIA 3GWRA 3FH1A 2A15A 3V92A 1M1K4 2BMQB 1OF5A 3DGMA 2CFLA 1Q864 1M904 4HM1B 1IVXA 2GEYA 2XSHB 1A90A 1UUWB 3CME3 1QVG2 1JB5A 3CU3A 3FSDA 3PS8A 4G1MB 3SXXA 3FG3A 1OHPA 2Q07A 3STDA 1WTHA 2GU1A 4XBTA 4N6MA 3X3ZA 2WGOA 1IT7A 4HM6B 4GL6A 4O02B 1M9GA 2UX0A 3EQQB 2YFLB 1N8R4 2Z77A 1OACA 1Y4KA 3EC9A 3CCU3 1G96A 4N6LA 3CCL3 1FGTA 3LTDA 1VQL3 2RCDA 4EYCA 2BNGA 4H3UA 1EQKA 4N6NB 5CLKA 4FCMA 4X2OA 1US1A 2RSXA 3KSED 1IK3A 4MJDA 1JV2B 5D81A 2F98A 3EJVA 2YFJB 5I97A 3CC43 2F99A 2Z6BA 3ALAA 3UNLA 1OHOA 3IMAB 4QWTA 5D82A 3WOFB 1YJ93 3ROBA 3NQZA 3OX9A 1W2B2 2IA7A 4L8OA 1N8QA 2F86B 4STDA 1K9M4 1N9EA 1Z1SA 4J8TA 5HGRA 3WA3A 1SPUA 3GZBA 3U97A 2QGUA 3CMA3 2C11A 2FGTA 1U5OA 4IT7A 4N6UA 1KSIA 1OH0A 3N54B 3KN4A 2O9UX 1VQP3 3QK9A 5DRVA 1EKMA 4OVMA 2BO9B 3G6E3 1JN5B 5IERA 1D6UA 2Z76A 4KZ1A 1STDA 3F40A 8CHOA 4FMAA 5TGNA 2W0QA 1JNQA 2KRTA 3BNEA 3G713 3QRDA 3EF8A 5AIGA 2CFWA 4RNZA 4AKYA 1YJW3 4CDLA 2K0MA 3DGLA 3T8UA 4TX4A 3EHCA 2GU3A 3RGAA 5EQLA 2I9WA 2STDA 3S27A 1ROVA 1TIJA 3L0RA 4XBXA 2OOVA 2W03A 3FG4A 5CF2A 1O7GB 5IENA 3V98A 3CCQ3 1YI23 1EG9B 1GD4A 4XM4A 4EC6A 1JKGA 3UL6A 2E2UA 4EV2A 4HM0B 1JKGB 3DZLA 2BT3A 2CC3A 3N9HA 2CH9A 3LMLA 5AIFA 1KQS2 1FUWA 2IMJA 4N3VA 2W04A 1ASKA 1LVNA 3LXUX 2B24B 2E2VA 3LOYA 4XB5A 5G2GA 3T0UA 4L8PA 1YHQ3 3OXAA 1RKYA 1VQM3 5LC6A 3BB9A 2XRXB 2XSOB 1V74A 3V99A 1IVWA 3SX1A 4K90B 1D6ZA 2CFGA 1SIHA 1JJ22 1DMMA 2ML5A 3KE7A 3LYGA 4HJLB 2ZDJA 4KFDA 5AI1A 3LTCA 1PFPA 3X42A 2K54A 4WYKA 3K63A 1O7HB 4WYKB 5AEUB 4EV5A 3VF1A 4HM2B 3OWUA 2QEX3 1VQ83 3X40A 1Q40A 3FG1A 5CF1A 1Q40B 1QALA 1D6YA 3WOEB 3G16A 3MG1A 1VQN3 4N6TA 2BMRB 5AIIA 1VZZA 4KFEA 1FGMA 3F8HA 4ORLA 3GZRA 1E97A 2P0XA 2P0MA 4HM7B 5IG3A 2LQVA 4L7KA 2CK3H 3CC73 3I553 1YJN3 2E2TA 3JVCA 1AV4A 3JUPA 3KKGA 5FGOA 5IEOA 2HMLB 4WFOA 3VSYA 3IJEB 2OWPA 3LT9A 4O3VA 3NUVA 1VQ43 1RJOA 1Q42A 4MMYB 3AMOA 3O8YA 3X41A 3AMOB 2XGNA 3HK4A 2FNQA 3S29A 1VQ53 3K0ZA 3MG2A 1K41A 3NM7A 1WNHA 5AYSC 5A0OB 1NDOB 2M7OA 2KXGA 2P38A 5AIHA 3OW22 1AVLA 1GY6A 4HYZA 2QA43 4XDVA 4HZ9B 4NREA 3FGYA 3PCRA 1GYBA 3WODG 3BNBA 5IW9A 1LXEA 1DMQA 3LTAA 1OGZA 1TFKA 2PNCA 2W56A 2HMKB 2GEXA 2ZL8A 3NM2A 3CNXA 4XDWA 2W56B 4KVHA 1JRQA 3PCSA 3Q1CA 1GS3A 1QVF2 3MSOA 3RDEA 1S723 1A67A 3J7Yd 1JB2A 1IDPA 2XGLA 3F7SA 3BLZA 1W6GA 3SVAA 5LC7A 3NV0B 2CIUA 4FMDA 4HM8B 1FGOA 3NBJA 4AKZA 2OOVC 1FGRA 2W6JH 3WMDA 2OTJ3 5JPPA 2CW9A 3K5TA 1VQ63 3CD63 4N6V0 3B7CA 3F8XA 4IIAA 1Q7Y4 1JN5A 1W2ZA 3LH4A 2CKFB 5AEWB 1NO3A 5IG0A 3G0KA 3F14A 3U1WA 1IQXA 2OQEA 3SOYA 1ZO2A 3EE1A 2Y74A 4MMXB 3RGRA 1DMNA 3JUOA 2WGQA 3PGBA 4BTWA 1J2BA 5AYRB 2INXA 1K28A 1NWWA 2HMNB 1NJI4 3NX0A 3WDGB 3VGNA 3CCR3 1IU7A 1YVBI 1DVCA 1KD14 1OPYA 3UJMA 5DREA 3DUKA 3FKAA 3HIGA 3DGOA 1O7PB 4LMIA 1IV7A 5KP3A 2CG0A 2CWVA 2BMOB 3NQYA 1A2KA 1U8CB 1IQYA 1QMAA 1W6CA 3S28A 1YIJ3 4LEHA 3WA2X 2CHCA 3FF0A 3MG3A 1CEWI 2HMJB 4LZIA 1DVDA 1MOLA 3GZYB 3EBYA 5EVHA 3EN8A 4WWUC 4EBGA 4EXRA 2XEPA 1GD3A 3I0YA 2O3OA 4HM5B 4HM3B 3HX8A 3CC23 4X2HA 1IQ8A 3G8ZA 1W01A 1QJGA 3NHXA 4R1KA 4CCVA 4O8SA 1BUQA 3IPTA 5IG5A 1CYVA 3H51A 1VQ73 1DYUA 1W5ZA 1LOXA 3CCM3 3I563 2WO0A 3GZXB 3OWSA 1L5GB 2XFSA 1ZX2A 1WMNA 1IVVA 1RRLA 2XH9A 1CQSA 1OCVA 1FGQA 2CWTA 3CCJ3 1ROAA 3M8CA 1O7NB 3LT8A 3FLJA 4MMZB 4R80A 1S5AA 3S67A 2R4IA 2W2CA 2FXTA 2CFKA 4N6OB 2BHMA 1UW1A 3KZTA 1YIT3 4WHAA 1FA3A 2XR8B 3CPW2 1ULJB 4ZM8A 5IG4A 2JQ5A 5BVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYJ A;  1IV9 A;  1N5P A;  1LXE A;  3KFQ C;  3QRD A;  1A67 A;  4TX4 A;  1R4C A;  5EQL A;  3SVA A;  5LC7 A;  3PXM A;  1TIJ A;  3L0R A;  1CYU A;  2W9Q A;  4N6V 0;  1STF I;  1GD4 A;  3LH4 A;  3UL6 A;  2CH9 A;  1N5H A;  1FUW A;  2W9P A;  3MWZ A;  5LC6 A;  3NX0 A;  1A90 A;  1YVB I;  3UL5 A;  1DVC A;  1NB5 I;  3PS8 A;  3K9M C;  1IV7 A;  1NB3 I;  1N9J A;  1MNL A;  4N6M A;  5ELJ A;  1PFP A;  4LZI A;  2OCT A;  1DVD A;  1CEW I;  1M9G A;  1MOL A;  1KWI A;  1GD3 A;  1G96 A;  1RN7 A;  4N6L A;  4N6T A;  4EYC A;  4CCV A;  1CYV A;  3Q2P A;  1EQK A;  4N6N B;  3KSE D;  3GAX A;  3IMA B;  1ROA A;  3S67 A;  4N6O B;  5ELU A;  1WNH A;  5A0O B;  4IT7 A;  4N6U A;  2KXG A;  1FA3 A;  2O9U X;  4ZM8 A;  2BO9 B; 
#chains in the Genus database with same CATH topology
 1UCL A;  4H61 A;  4HOH A;  1A2P A;  2CWU A;  2ZHX B;  1PU4 A;  2WOF A;  1N5P A;  3BIR A;  3EX9 A;  1A2V A;  3EN1 B;  2D42 A;  2GXF A;  4J5K A;  3CXC 2;  2IY2 A;  3B8L A;  3KFQ C;  4R9K A;  1E3V A;  3BNC A;  4FCZ A;  1K73 4;  4I5Q A;  4BU4 A;  4EW5 A;  1OF5 B;  3GSP A;  1GMP A;  1BIR A;  1HU9 A;  1OHS A;  1TUH A;  3JUN A;  2WOH A;  4R4K A;  3HII A;  1R4C A;  5STD A;  6STD A;  2MC8 A;  2IUK A;  4NHF A;  3ER7 A;  2UUG C;  3X3X A;  2JDI H;  3PXM A;  5JPU A;  3KII A;  1GOY A;  5IF6 A;  4FMC A;  2KF4 A;  3TDG A;  2KCD A;  1VQ9 3;  4OK0 A;  3S5C A;  1EA2 A;  1MWS A;  2R41 A;  1B2S A;  1O7W B;  1PY3 A;  1STF I;  2CX1 A;  4HM4 B;  3DY5 A;  1TFO A;  4U13 A;  3SYU A;  2CG1 A;  1K8A 4;  3EB8 A;  3CCS 3;  1I3I A;  1N5H A;  2OQE C;  1LNH A;  1W00 A;  2YX9 A;  3DMC A;  1MGW A;  3JUM A;  1BRK A;  1V57 A;  1JB4 A;  1QAK A;  2HMM B;  5CXO A;  2W9P A;  2C10 A;  1SJW A;  3MWZ A;  4RZM A;  4BTY A;  5BXQ A;  4K1V A;  2L1S A;  2PZV A;  4O2H A;  5JBS A;  4HZB B;  4RBN A;  3HOH A;  3CPO A;  3NV0 A;  4OUQ A;  4JF8 A;  3UL5 A;  1NB5 I;  2QIY A;  1GOV A;  4Q53 A;  1GSP A;  2YFI B;  3K9M C;  1BNI A;  4RNY A;  2XFT A;  1YGE A;  2UGI A;  1NB3 I;  1DE3 A;  1JBS A;  3DGN A;  1RN4 A;  1RCK A;  1AR0 A;  1IT8 A;  1N9J A;  1TP6 A;  2H0H A;  2Y73 A;  3B4P A;  1MNL A;  3Q90 A;  3PZW A;  4LGQ A;  3KSP A;  1RNT A;  3B4O A;  5ELJ A;  1B27 A;  1LOV A;  2F4Y A;  3GRD A;  2SBL A;  3HZP A;  3N8B A;  4WP5 A;  2OCT A;  1UUV B;  5FW5 A;  1AVK A;  1QAF A;  4LSO A;  1BRJ A;  1KWI A;  2RFR A;  1B21 A;  2P09 A;  1TU5 A;  2KF6 A;  5BU4 A;  1RN7 A;  2HMO B;  3CCV 3;  1RMS A;  1BNF A;  4HVN A;  3D9R A;  4GB5 A;  1Q82 4;  1GY5 A;  3OV4 A;  1BSC A;  1UCK A;  1UGI A;  1TJD A;  4I4K A;  1G0T A;  2Z7A A;  5M1A A;  1UI7 A;  3Q2P A;  3UB1 A;  1KC8 4;  4J9A A;  1VQK 3;  4FMB A;  1T5Y A;  1Q81 4;  2V1L A;  1W7C A;  1X1W A;  4AEQ A;  3OWY A;  3GAX A;  1M1X B;  2ML6 A;  3FZW A;  1DVD A;  5KP4 A;  3MKI A;  3X3Y A;  3ECF A;  7GSP A;  1BSB A;  4R9L A;  3CNM A;  1FZU A;  3BND A;  5IEP A;  1ULI B;  4PEJ A;  7STD A;  1IVU A;  3MHE A;  4RNT A;  1I2E A;  2XF3 A;  3AHW A;  1E3R A;  1B20 A;  2D1W A;  2L4V A;  1GMR A;  3LTB A;  3F9S A;  4FCJ A;  1VQO 3;  1FUT A;  2AAE A;  3D3L A;  4JRF A;  4HBR A;  5ELU A;  1FYS A;  4K61 A;  4HKV B;  3SED A;  3D5I A;  3SOA A;  3H3H A;  1W4N A;  3K7C A;  1VQQ A;  3NBB A;  3MYT A;  3URP A;  3NBR A;  1OUN A;  1BSD A;  1HKX A;  2IUJ A;  3PYJ A;  3F7X A;  2OTL 3;  1ISK A;  1RGG A;  1IV9 A;  1BRS A;  3LZA A;  2K3D A;  3KCH A;  2MF7 A;  1B2M A;  1BRN L;  1UI8 A;  1WMO A;  1GY7 A;  2CFD A;  2LYX A;  2P05 A;  4IPB A;  1NU3 A;  5D83 A;  1JZD A;  4BTX A;  4MEI A;  1BOX A;  1WQL B;  3DXO A;  5M18 A;  1RGK A;  1W02 A;  4XBY A;  3CCE 3;  1O7M B;  1SQW A;  2GBW B;  2RGQ A;  3SLU A;  4ILF A;  4FR9 A;  1RCL A;  1C7H A;  1OGX A;  3EBT A;  2B1X B;  4KFF A;  2RNT A;  4K1U A;  1RRH A;  3E99 A;  1JBT A;  5KP1 A;  1W6Y A;  3JUQ A;  1CYU A;  1F8N A;  3G4S 3;  2W9Q A;  3A76 A;  3FF2 A;  3NXJ A;  5M19 A;  1WMP A;  1UUG B;  1BRG A;  4J5G A;  3HI7 A;  4BIR A;  3FCS B;  7RNT A;  3DM8 A;  3MPH A;  5EEO A;  5CK6 A;  1RGH A;  2GBX B;  3T8N A;  1SII A;  1LQG C;  1RGL A;  3GWR A;  3FH1 A;  4GHO A;  2A15 A;  1ZS7 A;  3V92 A;  2BMQ B;  1OF5 A;  3DGM A;  1M1K 4;  3D79 A;  2CFL A;  1Q86 4;  1AY7 A;  1M90 4;  4HM1 B;  1IVX A;  2GEY A;  1YVS A;  1G02 A;  1I0V A;  2XSH B;  1A90 A;  1TRQ A;  1UUW B;  3CME 3;  1QVG 2;  1JB5 A;  3CU3 A;  1LQM B;  3FSD A;  3PS8 A;  4G1M B;  1SAR A;  3SXX A;  1BNR A;  3FG3 A;  1OHP A;  2Q07 A;  3DGY A;  1RNB A;  3STD A;  1WTH A;  2GU1 A;  3Q3F A;  4XBT A;  4N6M A;  3X3Z A;  2WGO A;  1IT7 A;  4HM6 B;  4GL6 A;  4O02 B;  1M9G A;  2UX0 A;  1CH0 A;  3EQQ B;  2YFL B;  5G1K A;  1N8R 4;  2Z77 A;  1BNJ A;  1OAC A;  1Y4K A;  3EC9 A;  3CCU 3;  1PYL A;  1G96 A;  4N6L A;  3CCL 3;  2F5M A;  8RNT A;  1FGT A;  3LTD A;  1VQL 3;  2RCD A;  4EYC A;  2BNG A;  4H3U A;  1EQK A;  4N6N B;  1RSN A;  5CLK A;  4FCM A;  4X2O A;  1US1 A;  2RSX A;  3KSE D;  1IK3 A;  4MJD A;  1JV2 B;  5D81 A;  2F98 A;  3EJV A;  2YFJ B;  5I97 A;  3CC4 3;  2F99 A;  2Z6B A;  3ALA A;  3UNL A;  5BIR A;  1OHO A;  3IMA B;  1LNI A;  2GSP A;  4QWT A;  5D82 A;  3WOF B;  4KT3 B;  1YJ9 3;  3ROB A;  1UCI A;  3NQZ A;  3OX9 A;  1BNS A;  1BRI A;  1W2B 2;  2IA7 A;  2BU4 A;  4L8O A;  1N8Q A;  2F86 B;  2SAR A;  4STD A;  1K9M 4;  1N9E A;  1Z1S A;  2KF5 A;  4J8T A;  5HGR A;  3WA3 A;  1RN1 A;  1SPU A;  3GZB A;  3U97 A;  1I70 A;  2QGU A;  3CMA 3;  2C11 A;  2FGT A;  1U5O A;  4IT7 A;  4N6U A;  1KSI A;  1OH0 A;  3N54 B;  3KN4 A;  1I0X A;  2O9U X;  1VQP 3;  3QK9 A;  1UGH I;  5DRV A;  1EKM A;  4OVM A;  2BO9 B;  1BRH A;  3G6E 3;  1JN5 B;  5IER A;  1BAN A;  1D6U A;  2Z76 A;  4KZ1 A;  1STD A;  3F40 A;  8CHO A;  1JBR A;  4FMA A;  5TGN A;  2W0Q A;  1JZO A;  1JNQ A;  2KRT A;  3BNE A;  3G71 3;  3QRD A;  3EF8 A;  5AIG A;  2CFW A;  4RNZ A;  1I8V A;  4AKY A;  2J8X B;  1YJW 3;  4CDL A;  2K0M A;  3DGL A;  3T8U A;  4TX4 A;  3EHC A;  1RGE A;  2GU3 A;  3RGA A;  5EQL A;  2F56 A;  2I9W A;  2STD A;  3S27 A;  1ROV A;  1TIJ A;  3L0R A;  4XBX A;  2OOV A;  2W03 A;  3FG4 A;  5CF2 A;  1O7G B;  5IEN A;  3V98 A;  3CCQ 3;  1YI2 3;  1EG9 B;  1GD4 A;  4XM4 A;  4EC6 A;  1JKG A;  3UL6 A;  9RNT A;  2E2U A;  4EV2 A;  4DKI A;  4HM0 B;  1JKG B;  3DZL A;  2BT3 A;  2CC3 A;  3N9H A;  2CH9 A;  3LML A;  4HAA A;  1Q9E A;  5AIF A;  1KQS 2;  1FUW A;  2IMJ A;  1Q7H A;  4N3V A;  2W04 A;  1ASK A;  1LVN A;  3LXU X;  1MGR A;  2B24 B;  2E2V A;  3LOY A;  4XB5 A;  5G2G A;  3T0U A;  4L8P A;  4NPB A;  1YHQ 3;  3OXA A;  1RKY A;  1VQM 3;  5LC6 A;  3BB9 A;  2XRX B;  2XSO B;  1V74 A;  3V99 A;  1IVW A;  3SX1 A;  4K90 B;  1RTU A;  1D6Z A;  2CFG A;  1I3F A;  1BNG A;  5GSP A;  3ZG0 A;  1SIH A;  1JJ2 2;  4BL2 A;  1DMM A;  2C4B A;  2ML5 A;  3KE7 A;  3LYG A;  2KAA A;  1HYF A;  4HJL B;  2F5W A;  2ZDJ A;  4KFD A;  5AI1 A;  3LTC A;  1PFP A;  3X42 A;  2K54 A;  4WYK A;  3K63 A;  1O7H B;  1RGC A;  4WYK B;  5AEU B;  4EV5 A;  3VF1 A;  4HM2 B;  3OWU A;  2QEX 3;  1VQ8 3;  3X40 A;  1Q40 A;  3FG1 A;  5CF1 A;  1Q40 B;  1QAL A;  1D6Y A;  3WOE B;  1BUJ A;  3G16 A;  3MG1 A;  1VQN 3;  4N6T A;  2BMR B;  1TTO A;  5AII A;  1VZZ A;  4KFE A;  5IG4 A;  1FGM A;  3F8H A;  4ORL A;  3GZR A;  3WHO A;  1E97 A;  2P0X A;  2P0M A;  4HM7 B;  5IG3 A;  2LQV A;  4L7K A;  2CK3 H;  1GMQ A;  3ZG5 A;  3CC7 3;  3I55 3;  1YJN 3;  2E2T A;  3JVC A;  1B3S A;  1AV4 A;  1I2G A;  3JUP A;  3KKG A;  5FGO A;  5IEO A;  1BU4 A;  1NNV A;  2HML B;  4WFO A;  3VSY A;  3D5G A;  3IJE B;  2OWP A;  3LT9 A;  3WR2 A;  1UCJ A;  4O3V A;  3NUV A;  1DET A;  1RJO A;  1VQ4 3;  1Q42 A;  4MMY B;  3AMO A;  3O8Y A;  3X41 A;  2XGN A;  3AMO B;  3HK4 A;  2FNQ A;  3S29 A;  6GSP A;  1VQ5 3;  3BU4 A;  3K0Z A;  3MG2 A;  1K41 A;  3NM7 A;  1WNH A;  5AYS C;  5A0O B;  1NDO B;  2M7O A;  3AGN A;  2KXG A;  2P38 A;  5AIH A;  3OW2 2;  1AVL A;  2H0I A;  1GY6 A;  4HYZ A;  2QA4 3;  4XDV A;  4HZ9 B;  4NRE A;  4GSP A;  4LYL B;  3FGY A;  3PCR A;  1GYB A;  3WOD G;  3BNB A;  5IW9 A;  1BSA A;  1X1U A;  1LXE A;  1B2U A;  1DMQ A;  3LTA A;  1OGZ A;  2KF3 A;  1MWT A;  1TFK A;  2PNC A;  2W56 A;  2HMK B;  2GEX A;  2ZL8 A;  3A5E A;  3CNX A;  3NM2 A;  2AAD A;  4XDW A;  2W56 B;  4KVH A;  1JRQ A;  3PCS A;  3Q1C A;  1GS3 A;  1QVF 2;  3MSO A;  3DH2 A;  3RDE A;  1S72 3;  1A67 A;  3J7Y d;  1JB2 A;  1IDP A;  3RNT A;  3AGO A;  1T3B A;  2XGL A;  3F7S A;  4CJN A;  3BLZ A;  1W6G A;  3SVA A;  2H0G A;  5LC7 A;  3NV0 B;  2CIU A;  4FMD A;  4HM8 B;  1FGO A;  1BVI A;  3NBJ A;  4AKZ A;  1RLS A;  2OOV C;  1FGR A;  2W6J H;  3WMD A;  1BGS A;  5JPP A;  2OTJ 3;  2CW9 A;  3K5T A;  1VQ6 3;  3CD6 3;  4N6V 0;  1MWR A;  3B7C A;  3F8X A;  4IIA A;  1Q7Y 4;  1JN5 A;  1W2Z A;  2HOH A;  3LH4 A;  2RBI A;  2CKF B;  5AEW B;  1NO3 A;  5IG0 A;  3G0K A;  3F14 A;  3U1W A;  1IQX A;  2OQE A;  3SOY A;  1ZO2 A;  3EE1 A;  4CPK A;  2Y74 A;  1BSE A;  5HOH A;  4MMX B;  3RGR A;  1DMN A;  1X1Y A;  3JUO A;  1AQZ A;  1BAO A;  2WGQ A;  3PGB A;  4BTW A;  1J2B A;  1B2X A;  5AYR B;  2INX A;  1K28 A;  1RGA A;  1NWW A;  2HMN B;  4BL3 A;  1NJI 4;  3NX0 A;  3WDG B;  1V58 A;  3VGN A;  3CCR 3;  1IU7 A;  1YVB I;  1IYY A;  1DVC A;  1KD1 4;  1OPY A;  3UJM A;  5DRE A;  1C54 A;  3ZFZ A;  3DUK A;  3FKA A;  3HIG A;  3DGO A;  1O7P B;  2ZA4 A;  4LMI A;  1IV7 A;  5KP3 A;  2CG0 A;  2CWV A;  2BMO B;  3NQY A;  1A2K A;  1U8C B;  1IQY A;  1QMA A;  1W6C A;  3S28 A;  1YIJ 3;  4LEH A;  3WA2 X;  2CHC A;  3FF0 A;  3MG3 A;  1YGW A;  1X1X A;  1CEW I;  2HMJ B;  1MOL A;  3GZY B;  4LZI A;  3EBY A;  5EVH A;  1B2Z A;  3EN8 A;  4WWU C;  4EBG A;  4EXR A;  1HZ1 A;  1GD3 A;  2XEP A;  2O3O A;  3I0Y A;  4HM5 B;  4HM3 B;  3HX8 A;  3CC2 3;  4X2H A;  1IQ8 A;  3G8Z A;  1EUI C;  1RHL A;  1W01 A;  1QJG A;  1FUS A;  1ZGX A;  3NHX A;  1LOY A;  4R1K A;  4CCV A;  1RDS A;  4O8S A;  1BUQ A;  3IPT A;  5IG5 A;  1CYV A;  3H51 A;  5G1L A;  3D4A A;  1VQ7 3;  1TRP A;  1DYU A;  1FW7 A;  1LOW A;  1W5Z A;  1GOU A;  1LOX A;  3CCM 3;  3I56 3;  2WO0 A;  3GZX B;  3OWS A;  1L5G B;  1I2F A;  1BNE A;  2XFS A;  1ZX2 A;  1WMN A;  1IVV A;  1RRL A;  2XH9 A;  2IYJ A;  1CQS A;  1RGF A;  1YNV X;  1OCV A;  1FGQ A;  2CWT A;  3CCJ 3;  1ROA A;  3M8C A;  1O7N B;  3LT8 A;  3FLJ A;  4MMZ B;  4R80 A;  3AHS A;  1S5A A;  2BIR A;  3S67 A;  2R4I A;  1EEJ A;  1MWU A;  2W2C A;  2FXT A;  2CFK A;  4N6O B;  5RNT A;  2BHM A;  1T2I A;  1R4Y A;  1UW1 A;  3KZT A;  6RNT A;  1UDI I;  1YIT 3;  4WHA A;  1FA3 A;  2XR8 B;  1LRA A;  3CPW 2;  1ULJ B;  2CX0 A;  4ZM8 A;  1T2H A;  2JQ5 A;  5BVB A; 
#chains in the Genus database with same CATH homology
 4H61 A;  1PU4 A;  2CWU A;  2WOF A;  1N5P A;  3EX9 A;  1A2V A;  3EN1 B;  2D42 A;  2GXF A;  3CXC 2;  4R9K A;  3B8L A;  3KFQ C;  1E3V A;  3BNC A;  4FCZ A;  1K73 4;  1OF5 B;  1HU9 A;  1TUH A;  1OHS A;  3JUN A;  2WOH A;  4R4K A;  3HII A;  1R4C A;  5STD A;  6STD A;  2MC8 A;  2IUK A;  4NHF A;  3ER7 A;  3X3X A;  2JDI H;  3PXM A;  5JPU A;  3KII A;  5IF6 A;  4FMC A;  1VQ9 3;  3TDG A;  2KCD A;  4OK0 A;  3S5C A;  1EA2 A;  1O7W B;  1STF I;  4HM4 B;  3DY5 A;  1TFO A;  4U13 A;  2CG1 A;  1K8A 4;  3EB8 A;  3CCS 3;  1N5H A;  2OQE C;  3DMC A;  1LNH A;  1W00 A;  2YX9 A;  3JUM A;  1JB4 A;  1QAK A;  2HMM B;  5CXO A;  2W9P A;  2C10 A;  1SJW A;  3MWZ A;  4RZM A;  4BTY A;  5BXQ A;  4K1V A;  2PZV A;  4O2H A;  5JBS A;  4HZB B;  4RBN A;  3CPO A;  3NV0 A;  4OUQ A;  4JF8 A;  3UL5 A;  1NB5 I;  2QIY A;  4Q53 A;  2YFI B;  3K9M C;  4RNY A;  2XFT A;  1YGE A;  1NB3 I;  3DGN A;  3B4P A;  3Q90 A;  1AR0 A;  1IT8 A;  1N9J A;  1TP6 A;  2Y73 A;  3PZW A;  4LGQ A;  1MNL A;  3KSP A;  5ELJ A;  3B4O A;  3GRD A;  5FW5 A;  3HZP A;  4WP5 A;  2SBL A;  3N8B A;  2OCT A;  1UUV B;  1AVK A;  1QAF A;  4LSO A;  1KWI A;  2RFR A;  2P09 A;  1TU5 A;  1RN7 A;  2HMO B;  3CCV 3;  4HVN A;  3D9R A;  4GB5 A;  1Q82 4;  1GY5 A;  3OV4 A;  3UB1 A;  4I4K A;  2Z7A A;  1UI7 A;  3Q2P A;  1KC8 4;  4J9A A;  1VQK 3;  4FMB A;  1T5Y A;  1Q81 4;  2V1L A;  1W7C A;  4AEQ A;  3OWY A;  3GAX A;  1M1X B;  2ML6 A;  3FZW A;  5KP4 A;  3MKI A;  3X3Y A;  3ECF A;  4R9L A;  3CNM A;  3BND A;  5IEP A;  1ULI B;  4PEJ A;  7STD A;  1IVU A;  3MHE A;  2XF3 A;  1E3R A;  2D1W A;  2L4V A;  3LTB A;  3F9S A;  4FCJ A;  1VQO 3;  4JRF A;  3D3L A;  5ELU A;  4HBR A;  4K61 A;  4HKV B;  3SED A;  3SOA A;  3H3H A;  1W4N A;  3K7C A;  3NBB A;  3MYT A;  3NBR A;  1OUN A;  1HKX A;  2IUJ A;  3PYJ A;  3F7X A;  2OTL 3;  1ISK A;  1IV9 A;  3LZA A;  2MF7 A;  1UI8 A;  1WMO A;  1GY7 A;  2CFD A;  2LYX A;  2P05 A;  4IPB A;  1NU3 A;  5D83 A;  4BTX A;  4MEI A;  1WQL B;  3DXO A;  1W02 A;  4XBY A;  3CCE 3;  1O7M B;  1SQW A;  2GBW B;  2RGQ A;  3SLU A;  4FR9 A;  1C7H A;  1OGX A;  3EBT A;  2B1X B;  4KFF A;  4K1U A;  1RRH A;  3E99 A;  5KP1 A;  1W6Y A;  3JUQ A;  1CYU A;  1F8N A;  3G4S 3;  2W9Q A;  3A76 A;  3FF2 A;  3NXJ A;  1WMP A;  3HI7 A;  3FCS B;  3DM8 A;  3MPH A;  5EEO A;  5CK6 A;  3T8N A;  2GBX B;  1SII A;  3GWR A;  3FH1 A;  2A15 A;  3V92 A;  1M1K 4;  2BMQ B;  1OF5 A;  3DGM A;  2CFL A;  1Q86 4;  1M90 4;  4HM1 B;  1IVX A;  2GEY A;  2XSH B;  1A90 A;  1UUW B;  3CME 3;  1QVG 2;  1JB5 A;  3CU3 A;  3FSD A;  3PS8 A;  4G1M B;  3SXX A;  3FG3 A;  1OHP A;  2Q07 A;  3STD A;  1WTH A;  2GU1 A;  4XBT A;  4N6M A;  3X3Z A;  2WGO A;  1IT7 A;  4HM6 B;  4GL6 A;  4O02 B;  1M9G A;  2UX0 A;  3EQQ B;  2YFL B;  1N8R 4;  2Z77 A;  1OAC A;  1Y4K A;  3EC9 A;  3CCU 3;  1G96 A;  4N6L A;  3CCL 3;  1FGT A;  3LTD A;  1VQL 3;  2RCD A;  4EYC A;  2BNG A;  4H3U A;  1EQK A;  4N6N B;  5CLK A;  4FCM A;  4X2O A;  1US1 A;  2RSX A;  3KSE D;  1IK3 A;  4MJD A;  1JV2 B;  5D81 A;  2F98 A;  3EJV A;  2YFJ B;  5I97 A;  3CC4 3;  2F99 A;  2Z6B A;  3ALA A;  3UNL A;  1OHO A;  3IMA B;  4QWT A;  5D82 A;  3WOF B;  1YJ9 3;  3ROB A;  3NQZ A;  3OX9 A;  1W2B 2;  2IA7 A;  4L8O A;  1N8Q A;  2F86 B;  4STD A;  1K9M 4;  1N9E A;  1Z1S A;  4J8T A;  5HGR A;  3WA3 A;  1SPU A;  3GZB A;  3U97 A;  2QGU A;  3CMA 3;  2C11 A;  2FGT A;  1U5O A;  4IT7 A;  4N6U A;  1KSI A;  1OH0 A;  3N54 B;  3KN4 A;  2O9U X;  1VQP 3;  3QK9 A;  5DRV A;  1EKM A;  4OVM A;  2BO9 B;  3G6E 3;  1JN5 B;  5IER A;  1D6U A;  2Z76 A;  4KZ1 A;  1STD A;  3F40 A;  8CHO A;  4FMA A;  5TGN A;  2W0Q A;  1JNQ A;  2KRT A;  3BNE A;  3G71 3;  3QRD A;  3EF8 A;  5AIG A;  2CFW A;  4RNZ A;  4AKY A;  1YJW 3;  4CDL A;  2K0M A;  3DGL A;  3T8U A;  4TX4 A;  3EHC A;  2GU3 A;  3RGA A;  5EQL A;  2I9W A;  2STD A;  3S27 A;  1ROV A;  1TIJ A;  3L0R A;  4XBX A;  2OOV A;  2W03 A;  3FG4 A;  5CF2 A;  1O7G B;  5IEN A;  3V98 A;  3CCQ 3;  1YI2 3;  1EG9 B;  1GD4 A;  4XM4 A;  4EC6 A;  1JKG A;  3UL6 A;  2E2U A;  4EV2 A;  4HM0 B;  1JKG B;  3DZL A;  2BT3 A;  2CC3 A;  3N9H A;  2CH9 A;  3LML A;  5AIF A;  1KQS 2;  1FUW A;  2IMJ A;  4N3V A;  2W04 A;  1ASK A;  1LVN A;  3LXU X;  2B24 B;  2E2V A;  3LOY A;  4XB5 A;  5G2G A;  3T0U A;  4L8P A;  1YHQ 3;  3OXA A;  1RKY A;  1VQM 3;  5LC6 A;  3BB9 A;  2XRX B;  2XSO B;  1V74 A;  3V99 A;  1IVW A;  3SX1 A;  4K90 B;  1D6Z A;  2CFG A;  1SIH A;  1JJ2 2;  1DMM A;  2ML5 A;  3KE7 A;  3LYG A;  4HJL B;  2ZDJ A;  4KFD A;  5AI1 A;  3LTC A;  1PFP A;  3X42 A;  2K54 A;  4WYK A;  3K63 A;  1O7H B;  4WYK B;  5AEU B;  4EV5 A;  3VF1 A;  4HM2 B;  3OWU A;  2QEX 3;  1VQ8 3;  3X40 A;  1Q40 A;  3FG1 A;  5CF1 A;  1Q40 B;  1QAL A;  1D6Y A;  3WOE B;  3G16 A;  3MG1 A;  1VQN 3;  4N6T A;  2BMR B;  5AII A;  1VZZ A;  4KFE A;  1FGM A;  3F8H A;  4ORL A;  3GZR A;  1E97 A;  2P0X A;  2P0M A;  4HM7 B;  5IG3 A;  2LQV A;  4L7K A;  2CK3 H;  3CC7 3;  3I55 3;  1YJN 3;  2E2T A;  3JVC A;  1AV4 A;  3JUP A;  3KKG A;  5FGO A;  5IEO A;  2HML B;  4WFO A;  3VSY A;  3IJE B;  2OWP A;  3LT9 A;  4O3V A;  3NUV A;  1VQ4 3;  1RJO A;  1Q42 A;  4MMY B;  3AMO A;  3O8Y A;  3X41 A;  3AMO B;  2XGN A;  3HK4 A;  2FNQ A;  3S29 A;  1VQ5 3;  3K0Z A;  3MG2 A;  1K41 A;  3NM7 A;  1WNH A;  5AYS C;  5A0O B;  1NDO B;  2M7O A;  2KXG A;  2P38 A;  5AIH A;  3OW2 2;  1AVL A;  1GY6 A;  4HYZ A;  2QA4 3;  4XDV A;  4HZ9 B;  4NRE A;  3FGY A;  3PCR A;  1GYB A;  3WOD G;  3BNB A;  5IW9 A;  1LXE A;  1DMQ A;  3LTA A;  1OGZ A;  1TFK A;  2PNC A;  2W56 A;  2HMK B;  2GEX A;  2ZL8 A;  3NM2 A;  3CNX A;  4XDW A;  2W56 B;  4KVH A;  1JRQ A;  3PCS A;  3Q1C A;  1GS3 A;  1QVF 2;  3MSO A;  3RDE A;  1S72 3;  1A67 A;  3J7Y d;  1JB2 A;  1IDP A;  2XGL A;  3F7S A;  3BLZ A;  1W6G A;  3SVA A;  5LC7 A;  3NV0 B;  2CIU A;  4FMD A;  4HM8 B;  1FGO A;  3NBJ A;  4AKZ A;  2OOV C;  1FGR A;  2W6J H;  3WMD A;  2OTJ 3;  5JPP A;  2CW9 A;  3K5T A;  1VQ6 3;  3CD6 3;  4N6V 0;  3B7C A;  3F8X A;  4IIA A;  1Q7Y 4;  1JN5 A;  1W2Z A;  3LH4 A;  2CKF B;  5AEW B;  1NO3 A;  5IG0 A;  3G0K A;  3F14 A;  3U1W A;  1IQX A;  2OQE A;  3SOY A;  1ZO2 A;  3EE1 A;  2Y74 A;  4MMX B;  3RGR A;  1DMN A;  3JUO A;  2WGQ A;  3PGB A;  4BTW A;  1J2B A;  5AYR B;  2INX A;  1K28 A;  1NWW A;  2HMN B;  1NJI 4;  3NX0 A;  3WDG B;  3VGN A;  3CCR 3;  1IU7 A;  1YVB I;  1DVC A;  1KD1 4;  1OPY A;  3UJM A;  5DRE A;  3DUK A;  3FKA A;  3HIG A;  3DGO A;  1O7P B;  4LMI A;  1IV7 A;  5KP3 A;  2CG0 A;  2CWV A;  2BMO B;  3NQY A;  1A2K A;  1U8C B;  1IQY A;  1QMA A;  1W6C A;  3S28 A;  1YIJ 3;  4LEH A;  3WA2 X;  2CHC A;  3FF0 A;  3MG3 A;  1CEW I;  2HMJ B;  4LZI A;  1DVD A;  1MOL A;  3GZY B;  3EBY A;  5EVH A;  3EN8 A;  4WWU C;  4EBG A;  4EXR A;  2XEP A;  1GD3 A;  3I0Y A;  2O3O A;  4HM5 B;  4HM3 B;  3HX8 A;  3CC2 3;  4X2H A;  1IQ8 A;  3G8Z A;  1W01 A;  1QJG A;  3NHX A;  4R1K A;  4CCV A;  4O8S A;  1BUQ A;  3IPT A;  5IG5 A;  1CYV A;  3H51 A;  1VQ7 3;  1DYU A;  1W5Z A;  1LOX A;  3CCM 3;  3I56 3;  2WO0 A;  3GZX B;  3OWS A;  1L5G B;  2XFS A;  1ZX2 A;  1WMN A;  1IVV A;  1RRL A;  2XH9 A;  1CQS A;  1OCV A;  1FGQ A;  2CWT A;  3CCJ 3;  1ROA A;  3M8C A;  1O7N B;  3LT8 A;  3FLJ A;  4MMZ B;  4R80 A;  1S5A A;  3S67 A;  2R4I A;  2W2C A;  2FXT A;  2CFK A;  4N6O B;  2BHM A;  1UW1 A;  3KZT A;  1YIT 3;  4WHA A;  1FA3 A;  2XR8 B;  3CPW 2;  1ULJ B;  4ZM8 A;  5IG4 A;  2JQ5 A;  5BVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...