1LXEA

Crystal structure of the cathelicidin motif of protegrins
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
92
Chain Sequence
ALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDDITCNEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protegrin-3 precursor
publication title Structure of the cathelicidin motif of protegrin-3 precursor: structural insights into the activation mechanism of an antimicrobial protein.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Antimicrobial protein
total genus 15
structure length 92
sequence length 98
ec nomenclature
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1lxeA00
1N5HA 3NX0A 1FA3A 2W9QA 2O9UX 1EQKA 4N6MA 4EYCA 4N6NB 1N9JA 1CYVA 3Q2PA 3PYJA 2OCTA 4IT7A 1KWIA 3L0RA 5ELJA 1M9GA 1MOLA 1IV7A 3MWZA 1WNHA 1NB5I 3K9MC 1A67A 1GD4A 3S67A 1ROAA 5A0OB 1A90A 2CH9A 1LXEA 5LC7A 3UL6A 3GAXA 1CYUA 1IV9A 1RN7A 1PFPA 3PS8A 4N6OB 4ZM8A 1GD3A 3IMAB 3KFQC 3LH4A 4N6UA 1STFI 5LC6A 2KXGA 4N6LA 4LZIA 1CEWI 1R4CA 5ELUA 4TX4A 1FUWA 1NB3I 1TIJA 4CCVA 3PXMA 1YVBI 4N6TA 4N6V0 2BO9B 3UL5A 1MNLA 3SVAA 1G96A 3QRDA 2W9PA 1DVCA 3KSED 1N5PA 5EQLA 1DVDA
chains in the Genus database with same CATH superfamily
5IG3A 4HM8B 5JBSA 1UGIA 5BIRA 3NX0A 5I97A 2XFSA 3G16A 4R9LA 2W9QA 3JUQA 6STDA 2O9UX 1BNIA 3HX8A 2Z77A 3ZG5A 2MF7A 3MKIA 3V98A 1TTOA 3PZWA 3F8HA 3CCS3 2QEX3 1TJDA 4EYCA 3I563 1Q824 3LOYA 4HAAA 4EW5A 3CCJ3 3GZXB 4ORLA 1VQO3 3CC43 2L1SA 2OTJ3 1BNSA 4EXRA 4FCZA 1QAKA 1KWIA 4IT7A 2CWTA 4JF8A 3CC73 2BNGA 1B2MA 5D82A 1YJW3 1N9EA 1QALA 2JDIH 4I5QA 1IV7A 2H0IA 3H51A 4HM6B 5KP3A 1BRGA 2W56B 4HM4B 1OF5A 1WNHA 1HYFA 5AYSC 3AMOB 3SLUA 2W2CA 5CF1A 4HM0B 4R9KA 1FYSA 2XEPA 3S5CA 4BTXA 1FGTA 1BAOA 4K1UA 1PY3A 3DMCA 5CF2A 1RN1A 4O02B 1RRHA 1B2XA 5AIFA 2WGOA 1VQ43 1GD4A 3NV0A 1RGAA 5IW9A 5IF6A 3CCE3 4H3UA 4CJNA 1BSCA 4K61A 1RRLA 5BU4A 2XR8B 1I3IA 1AY7A 1LOWA 2WOHA 3F7XA 1K9M4 3ROBA 1RTUA 3X3XA 1ZS7A 3G6E3 3NUVA 1MWRA 1OHOA 1OH0A 1NNVA 1GY7A 3BLZA 4X2OA 5M18A 1CYUA 1YJ93 2INXA 3FF0A 2P0XA 3PGBA 3EB8A 3CCU3 3FZWA 3JUNA 2GU3A 3LZAA 1PU4A 1GMPA 1B27A 5FGOA 3GRDA 1QMAA 3JUPA 3DY5A 1KSIA 8CHOA 1KC84 4N3VA 2KAAA 3X3YA 4QWTA 3LTDA 5TGNA 1GD3A 1GMQA 1SQWA 2SARA 4HM5B 2CWUA 1WMOA 1JRQA 2F98A 3BNBA 3KFQC 3D3LA 3ECFA 1VZZA 1MWSA 1TRQA 3LH4A 3HZPA 1LRAA 1C54A 1DETA 1DMQA 1IVVA 1YJN3 1STFI 1AVKA 3E99A 2GSPA 2XRXB 2XGLA 2FNQA 3MSOA 3SYUA 1T2IA 3GZYB 3ZG0A 3GSPA 1BANA 1RSNA 2BIRA 2F86B 3EJVA 1R4CA 3URPA 3A76A 4KFEA 1FUWA 1TIJA 3NM2A 2GXFA 1YVBI 1YGEA 3HOHA 4HM2B 2W03A 1UUGB 3SX1A 3X42A 4N6TA 3OWSA 3WA3A 1JKGB 1E97A 2CKFB 2IY2A 1EA2A 3X40A 2BO9B 2XH9A 3A5EA 3UL5A 1F8NA 1UUVB 1MGRA 2C11A 4OVMA 3X41A 5RNTA 3I553 3HIGA 3QRDA 2UGIA 1A2VA 1V58A 2W0QA 2PNCA 2W9PA 3F9SA 1RGCA 3EN1B 3OWUA 4LGQA 3DGLA 1ASKA 3AHSA 1I0VA 3FH1A 1VQN3 4XBXA 1W6YA 1LVNA 3NXJA 3JVCA 2AAEA 1EEJA 1FUSA 1FZUA 3MWZA 1FW7A 2CFLA 5BVBA 4K1VA 5KP4A 2YFLB 5STDA 1BOXA 1B20A 4RNZA 1FA3A 3I0YA 4WYKB 2JQ5A 3UB1A 2CFWA 4MMYB 1VQ83 2BU4A 3F8XA 3N9HA 1W7CA 1EQKA 2R41A 1Q814 5CK6A 3CCM3 5GSPA 3VSYA 2FGTA 4O8SA 4XDWA 3DXOA 4N6NB 1GS3A 1UCIA 2YX9A 2CG0A 1N9JA 2RBIA 1K8A4 2H0HA 1IDPA 1DMNA 3KKGA 1LOYA 4L8PA 1LNHA 1ZGXA 1MOLA 3LT8A 3MG2A 5M1AA 3T0UA 1Q42A 3K0ZA 4FMBA 1W02A 3F14A 4HM7B 2GBWB 2C10A 2WO0A 1WMNA 1GSPA 1E3RA 4IPBA 3K9MC 4JRFA 1A67A 1W6GA 3FG1A 2OOVA 1ULJB 1UI8A 3SOAA 1BRNL 1SARA 3EN8A 1GOUA 4BTWA 1IU7A 2W04A 2KF5A 2L4VA 1MWUA 1Q7HA 1OGXA 2B1XB 1JZDA 3WDGB 1ROAA 2CX1A 3EHCA 4J8TA 3G4S3 1JBSA 4EV5A 3S27A 1A90A 1M1K4 2UUGC 3WODG 3LTAA 3FGYA 1X1WA 1VQL3 3ZFZA 2FXTA 3DGYA 4AKZA 5AIHA 1EUIC 1VQQA 3GAXA 1CQSA 3EBYA 3N8BA 1IVXA 4XM4A 1KQS2 1JJ22 1RN4A 1IV9A 4L7KA 1IVWA 1DYUA 3N54B 1ISKA 5AEUB 1BUQA 2MC8A 2AADA 3RGRA 1NO3A 2QIYA 2OQEA 1S723 1IVUA 3DUKA 3LTCA 1BRIA 1I70A 5D83A 2Q07A 1STDA 2ML6A 3BNDA 5G1KA 3VGNA 1B2SA 4BIRA 4Q53A 1W2ZA 3IMAB 3D5GA 3MG1A 4J5KA 1Q864 3CXC2 1ZO2A 4XBYA 3CME3 1G0TA 3KE7A 3CD63 2HMJB 2WOFA 4BTYA 1O7WB 4J5GA 3K7CA 1I8VA 1E3VA 1UUWB 2YFIB 3EE1A 1WTHA 4GB5A 1I2FA 1TRPA 1BNFA 2E2VA 3FF2A 3WOFB 1Q40B 1RGHA 5LC6A 1VQ53 4FMAA 2IYJA 4N6LA 1CEWI 2GU1A 3LT9A 1JV2B 4HKVB 1TP6A 2K0MA 4FMDA 1NU3A 3G8ZA 1NB3I 3HK4A 1FGQA 1OGZA 3VF1A 3RDEA 2XSOB 4STDA 3OV4A 2HMNB 1T2HA 1BU4A 1JN5B 2LQVA 2RGQA 3ER7A 3F40A 2A15A 2BMOB 4L8OA 1QVG2 1ULIB 1BSAA 3D9RA 3JUMA 1YNVX 1YIT3 2IUKA 4KFDA 1Q7Y4 1MNLA 1W2B2 1RGFA 5AIIA 2K3DA 1N8R4 1O7HB 4HZ9B 1QVF2 1TFKA 2CK3H 3B8LA 3KSPA 3D4AA 2XF3A 2CIUA 3EQQB 2BHMA 1W5ZA 1QAFA 1MWTA 1UDII 3WR2A 1DVDA 3CNXA 3LTBA 4XDVA 3NM7A 4LEHA 4BL2A 1MGWA 1N5HA 5DRVA 1IQ8A 2B24B 4WWUC 3BNEA 2Y74A 1GMRA 5IENA 1OUNA 4PEJA 3KZTA 3EF8A 4LSOA 1VQK3 1IT7A 3V92A 3WOEB 5AIGA 1AVLA 3SOYA 4EV2A 4N6MA 3EBTA 1JB4A 1W6CA 4R1KA 2UX0A 4BL3A 2RSXA 1RGLA 1CYVA 3Q2PA 1B2ZA 4XB5A 1OACA 1OF5B 3FG3A 1YVSA 4RNYA 3LYGA 3L0RA 5ELJA 2D42A 1BUJA 1M9GA 4HOHA 1JB2A 4CPKA 3OWYA 3CCQ3 1NB5I 1DE3A 3NQYA 3NV0B 3Q3FA 3WHOA 1D6UA 4AEQA 1D6ZA 2ZA4A 4HVNA 1SIHA 4RZMA 3GWRA 1IYYA 5G2GA 3AMOA 5IERA 4KT3B 4LMIA 3S67A 1EG9B 2RNTA 1AR0A 4MMZB 1R4YA 2STDA 3M8CA 3T8NA 5A0OB 1Y4KA 4HM3B 5JPPA 3B4OA 2CW9A 1LXEA 2F99A 1BNJA 4EBGA 1B2UA 5IG5A 2CG1A 5IEPA 5LC7A 1I0XA 3DH2A 2F56A 4FR9A 3G713 4RBNA 3DGNA 3UL6A 2HMLB 4MEIA 3D79A 2XFTA 1IT8A 1K41A 1UW1A 1BVIA 3U1WA 2GBXB 1YIJ3 1RGKA 2BMRB 4G1MB 1G02A 1UI7A 1A2PA 3SEDA 5EEOA 1GY6A 2OTL3 3Q90A 1GOYA 1X1UA 2KRTA 3UJMA 9RNTA 4HYZA 3AHWA 3STDA 1CH0A 2Z6BA 1W01A 4GL6A 1AV4A 1BNEA 5AI1A 3FCSB 3LXUX 3RGAA 1TUHA 4WFOA 2E2TA 2ZDJA 1L5GB 1UCLA 1YHQ3 3OX9A 4ILFA 4GHOA 3RNTA 5IG0A 1LOXA 2PZVA 2P05A 1RNBA 2YFJB 5AYRB 4N6UA 2IMJA 5IEOA 3FSDA 5EVHA 1RMSA 2KXGA 1ROVA 1T5YA 2GEXA 2KF3A 4AKYA 1WMPA 3DGMA 3U97A 5ELUA 2XGNA 4TX4A 1FGMA 3EX9A 1D6YA 2ML5A 4O2HA 4I4KA 3S28A 1VQ63 2XSHB 1OHPA 3NBBA 1X1XA 3K5TA 1BNRA 2OOVC 7STDA 4DKIA 1TFOA 1RGEA 3B7CA 5KP1A 1OCVA 4OUQA 1I2GA 1FUTA 5D81A 1JKGA 1Z1SA 2F4YA 1G96A 1GY5A 2Z76A 4FCMA 2P09A 3NBRA 1O7PB 5JPUA 1DVCA 2CC3A 2GEYA 3BIRA 3KSED 1O7MB 5BXQA 1N5PA 1U5OA 5CXOA 2J8XB 3S29A 2KF4A 5EQLA 1RHLA 3HIIA 1SJWA 4OK0A 5CLKA 1BGSA 3WA2X 3MPHA 3X3ZA 1RGGA 1DMMA 4RNTA 2BMQB 3UNLA 3GZBA 1TU5A 1J2BA 1VQM3 1OPYA 2OQEC 2D1WA 3ALAA 3Q1CA 5HGRA 2H0GA 3IJEB 2CFGA 2IA7A 1EKMA 1ZX2A 5M19A 4EC6A 3G0KA 4WYKA 5HOHA 3CCL3 1FGRA 1US1A 2M7OA 1RJOA 3PCSA 3WMDA 4FCJA 3PYJA 4U13A 1BRHA 2K54A 2OCTA 3KIIA 4IIAA 1AQZA 1BIRA 2ZHXB 1UCKA 2O3OA 4NREA 3CC23 1O7NB 4HM1B 1SPUA 1U8CB 3GZRA 2CFDA 3O8YA 2LYXA 3MG3A 1RCLA 1IQYA 4K90B 2HOHA 3CMA3 1PYLA 2KF6A 3H3HA 4KZ1A 4LYLB 1KD14 1BSDA 1VQ73 2HMMB 4R80A 1HU9A 1N8QA 3D5IA 5AEWB 3JUOA 7GSPA 2QGUA 3MYTA 1GOVA 1W4NA 4FMCA 2CWVA 3NBJA 1BRSA 2HMOB 4BU4A 1BRJA 5DREA 3IPTA 3QK9A 2RCDA 2CH9A 1JB5A 3MHEA 1BSBA 4HJLB 4MMXB 1HKXA 3LMLA 1S5AA 3CCV3 2F5WA 4HBRA 1O7GB 3HI7A 4WP5A 1RNTA 1X1YA 1BSEA 3AGOA 3NHXA 2Y73A 1LOVA 1RN7A 1RLSA 3DM8A 1PFPA 1W00A 1WQLB 3PS8A 3DGOA 4HZBB 4N6OB 4KFFA 2CX0A 3CPW2 2SBLA 2W56A 4ZM8A 1NWWA 3KCHA 2V1LA 4X2HA 1A2KA 3CNMA 1JBTA 3BU4A 1FGOA 1LNIA 1LQMB 6RNTA 2HMKB 2F5MA 1SIIA 1RCKA 1C7HA 2WGQA 2P0MA 6GSPA 2RFRA 1Q9EA 2CHCA 1VQ93 3BNCA 1V57A 1OHSA 2IUJA 3T8UA 4CDLA 2I9WA 5G1LA 1LQGC 4J9AA 3OXAA 1RKYA 3FG4A 3EC9A 3FLJA 1YI23 1YGWA 4LZIA 1RDSA 2R4IA 1JZOA 1JNQA 1M1XB 2OWPA 2CFKA 2P38A 3KN4A 8RNTA 4CCVA 1V74A 2C4BA 1IQXA 1Q40A 2W6JH 2BT3A 3PXMA 3DZLA 3CU3A 3PCRA 4NHFA 4NPBA 4O3VA 5FW5A 3SXXA 4GSPA 1M904 3CCR3 4KVHA 4H61A 1BRKA 3V99A 1BNGA 1NJI4 1B21A 3BB9A 4N6V0 3K63A 1NDOB 3FKAA 3OW22 1T3BA 1K734 3J7Yd 3B4PA 1I3FA 2Z7AA 2ZL8A 1JN5A 4XBTA 3TDGA 1VQP3 2E2UA 4MJDA 3SVAA 1I2EA 1IK3A 1B3SA 5IG4A 2KCDA 2QA43 1UGHI 4R4KA 1GYBA 4WHAA 3F7SA 1JBRA 3NQZA 7RNTA 3AGNA 1QJGA 1K28A 3CPOA 1HZ1A 1UCJA
chains in the Genus database with same CATH topology
5IG3A 4HM8B 5JBSA 3NX0A 5I97A 2XFSA 3G16A 4R9LA 2W9QA 3JUQA 6STDA 2O9UX 3HX8A 2Z77A 2MF7A 3MKIA 3V98A 3PZWA 3F8HA 3CCS3 2QEX3 3I563 4EYCA 1Q824 3LOYA 3CCJ3 3GZXB 4ORLA 1VQO3 3CC43 2OTJ3 4EXRA 3CC73 4FCZA 1QAKA 1KWIA 4IT7A 2CWTA 4JF8A 2BNGA 5D82A 1YJW3 1N9EA 1QALA 2JDIH 1IV7A 3H51A 4HM6B 5KP3A 2W56B 4HM4B 1OF5A 1WNHA 5AYSC 3AMOB 3SLUA 2W2CA 5CF1A 4HM0B 4R9KA 2XEPA 3S5CA 4BTXA 1FGTA 4K1UA 5CF2A 3DMCA 4O02B 1RRHA 5AIFA 2WGOA 1VQ43 1GD4A 3NV0A 5IW9A 5IF6A 3CCE3 4H3UA 4K61A 1RRLA 2XR8B 3F7XA 2WOHA 1K9M4 3ROBA 3X3XA 3G6E3 3NUVA 1OHOA 1OH0A 1GY7A 3BLZA 4X2OA 1CYUA 2INXA 3FF0A 2P0XA 3PGBA 3EB8A 3CCU3 3FZWA 3JUNA 2GU3A 3LZAA 1PU4A 5FGOA 3GRDA 1QMAA 3JUPA 3DY5A 1KSIA 8CHOA 1KC84 4N3VA 3X3YA 4QWTA 3LTDA 5TGNA 1GD3A 1SQWA 4HM5B 2CWUA 1WMOA 1JRQA 2F98A 3BNBA 3KFQC 3D3LA 3ECFA 1VZZA 3LH4A 3HZPA 1DMQA 1IVVA 1YJN3 1STFI 1AVKA 3E99A 2XRXB 2XGLA 2FNQA 3MSOA 3GZYB 3EJVA 2F86B 1R4CA 3A76A 4KFEA 1FUWA 1TIJA 3NM2A 2GXFA 1YVBI 1YGEA 4HM2B 2W03A 3SX1A 3X42A 4N6TA 3OWSA 3WA3A 1JKGB 1E97A 2CKFB 1EA2A 3X40A 2BO9B 2XH9A 3UL5A 1F8NA 1UUVB 2C11A 4OVMA 3X41A 3I553 3HIGA 3QRDA 1A2VA 2W0QA 2W9PA 2PNCA 3F9SA 3OWUA 3EN1B 4LGQA 3DGLA 1ASKA 3FH1A 1VQN3 4XBXA 1W6YA 1LVNA 3NXJA 3JVCA 3MWZA 2CFLA 5BVBA 4K1VA 5KP4A 2YFLB 5STDA 4RNZA 1FA3A 3I0YA 4WYKB 2JQ5A 3UB1A 2CFWA 4MMYB 1VQ83 3F8XA 3N9HA 1W7CA 1EQKA 1Q814 5CK6A 3CCM3 3VSYA 2FGTA 4O8SA 4XDWA 3DXOA 4N6NB 1GS3A 2YX9A 2CG0A 1N9JA 1K8A4 1IDPA 1DMNA 3KKGA 4L8PA 1LNHA 1MOLA 3LT8A 3MG2A 1Q42A 3K0ZA 4FMBA 1W02A 3F14A 4HM7B 2GBWB 2C10A 2WO0A 1WMNA 1E3RA 4IPBA 3K9MC 4JRFA 1A67A 1W6GA 3FG1A 2OOVA 1ULJB 1UI8A 3SOAA 3EN8A 4BTWA 1IU7A 2W04A 2L4VA 1OGXA 2B1XB 3WDGB 1ROAA 3EHCA 3G4S3 4J8TA 4EV5A 3S27A 1A90A 1M1K4 3WODG 3LTAA 3FGYA 1VQL3 2FXTA 4AKZA 5AIHA 3GAXA 4XM4A 1KQS2 1CQSA 3EBYA 3N8BA 1IVXA 1JJ22 1IV9A 4L7KA 1IVWA 1DYUA 3N54B 1ISKA 5AEUB 1BUQA 2MC8A 3RGRA 1NO3A 2QIYA 2OQEA 1S723 1IVUA 3DUKA 3LTCA 5D83A 2Q07A 1STDA 2ML6A 3BNDA 3VGNA 4Q53A 1W2ZA 3IMAB 3MG1A 1Q864 3CXC2 1ZO2A 4XBYA 3CME3 3KE7A 2HMJB 2WOFA 4BTYA 1O7WB 3K7CA 1E3VA 1UUWB 2YFIB 3EE1A 1WTHA 4GB5A 2E2VA 3FF2A 3WOFB 1Q40B 5LC6A 1VQ53 4FMAA 4N6LA 1CEWI 2GU1A 3LT9A 1JV2B 4HKVB 1TP6A 2K0MA 4FMDA 1NU3A 3G8ZA 1NB3I 3HK4A 1FGQA 1OGZA 3VF1A 3RDEA 2XSOB 4STDA 3OV4A 2HMNB 1JN5B 2LQVA 2RGQA 3ER7A 3F40A 2A15A 2BMOB 4L8OA 1QVG2 1ULIB 3D9RA 3JUMA 1YIT3 2IUKA 4KFDA 1Q7Y4 1MNLA 1W2B2 5AIIA 1N8R4 1O7HB 4HZ9B 1QVF2 1TFKA 2CK3H 3B8LA 3KSPA 3CD63 2XF3A 2CIUA 3EQQB 2BHMA 1W5ZA 1QAFA 1DVDA 3CNXA 3LTBA 4XDVA 3NM7A 4LEHA 1N5HA 5DRVA 1IQ8A 2B24B 4WWUC 3BNEA 2Y74A 5IENA 1OUNA 4PEJA 3KZTA 3EF8A 4LSOA 1VQK3 1IT7A 3V92A 3WOEB 5AIGA 1AVLA 3SOYA 4EV2A 4N6MA 3EBTA 1JB4A 1W6CA 4R1KA 2UX0A 2RSXA 1CYVA 3Q2PA 4XB5A 1OACA 1OF5B 3FG3A 4RNYA 3LYGA 3L0RA 5ELJA 2D42A 1M9GA 1JB2A 3OWYA 3CCQ3 1NB5I 3NQYA 3NV0B 4AEQA 1D6UA 1D6ZA 4HVNA 1SIHA 4RZMA 3GWRA 5G2GA 3AMOA 5IERA 4LMIA 3S67A 1EG9B 1AR0A 4MMZB 3M8CA 2STDA 3T8NA 5A0OB 1Y4KA 4HM3B 5JPPA 3B4OA 2CW9A 1LXEA 2F99A 4EBGA 1YJ93 5IG5A 1J2BA 2CG1A 5IEPA 5LC7A 3G713 4FR9A 4RBNA 3DGNA 3UL6A 2HMLB 4MEIA 2XFTA 1IT8A 1K41A 1UW1A 3U1WA 2GBXB 1YIJ3 2BMRB 4G1MB 1UI7A 3SEDA 5EEOA 1GY6A 2OTL3 3Q90A 3UJMA 2KRTA 4HYZA 3STDA 2Z6BA 1W01A 4GL6A 1AV4A 5AI1A 3RGAA 3FCSB 3LXUX 3T0UA 1TUHA 4WFOA 2E2TA 2ZDJA 1L5GB 1YHQ3 3OX9A 5IG0A 1LOXA 2PZVA 2P05A 2YFJB 5AYRB 4N6UA 2IMJA 5IEOA 3FSDA 5EVHA 2KXGA 1ROVA 1T5YA 2GEXA 1WMPA 3DGMA 3U97A 5ELUA 2XGNA 4TX4A 1FGMA 3EX9A 1D6YA 2ML5A 4I4KA 3S28A 1VQ63 2XSHB 1OHPA 3NBBA 3K5TA 2OOVC 7STDA 1TFOA 3B7CA 1OCVA 4OUQA 5D81A 1JKGA 1Z1SA 1G96A 2Z76A 1GY5A 4FCMA 2P09A 3NBRA 1O7PB 5JPUA 1DVCA 2CC3A 2GEYA 3KSED 1O7MB 5BXQA 1N5PA 1U5OA 5CXOA 3S29A 5EQLA 3HIIA 3WA2X 1SJWA 4OK0A 5CLKA 3X3ZA 3MPHA 1DMMA 2BMQB 3UNLA 3GZBA 1TU5A 1VQM3 1OPYA 2OQEC 2D1WA 3ALAA 3Q1CA 5HGRA 3IJEB 2CFGA 2IA7A 1EKMA 1ZX2A 4EC6A 3G0KA 4WYKA 3CCL3 1FGRA 1US1A 2M7OA 1RJOA 3PCSA 3WMDA 4FCJA 3PYJA 4U13A 2K54A 2OCTA 3KIIA 4IIAA 4AKYA 5KP1A 4NREA 2O3OA 3CC23 1O7NB 4HM1B 1SPUA 1U8CB 3GZRA 2CFDA 3O8YA 2LYXA 3MG3A 4K90B 1IQYA 3CMA3 3H3HA 4KZ1A 1KD14 1VQ73 2HMMB 4R80A 1HU9A 1N8QA 5AEWB 3JUOA 2QGUA 3MYTA 1W4NA 4FMCA 2CWVA 3NBJA 2HMOB 5DREA 3IPTA 2RCDA 2CH9A 1JB5A 3MHEA 4HJLB 4MMXB 1HKXA 3LMLA 1S5AA 3CCV3 4HBRA 1O7GB 3HI7A 4WP5A 3NHXA 2Y73A 1RN7A 3DM8A 1PFPA 1W00A 1WQLB 3PS8A 3DGOA 4HZBB 4N6OB 4KFFA 3CPW2 2SBLA 2W56A 4ZM8A 1NWWA 4X2HA 2V1LA 1A2KA 3CNMA 1FGOA 2HMKB 1SIIA 1C7HA 2WGQA 2P0MA 2RFRA 2CHCA 1VQ93 3BNCA 2IUJA 1OHSA 4CDLA 3T8UA 2I9WA 4J9AA 3OXAA 1RKYA 3FG4A 3EC9A 1YI23 4LZIA 2R4IA 1M1XB 1JNQA 2OWPA 2CFKA 2P38A 3KN4A 4CCVA 1V74A 3PXMA 1IQXA 1Q40A 2W6JH 2BT3A 3QK9A 3DZLA 3CU3A 3PCRA 4NHFA 4O2HA 4O3VA 5FW5A 3SXXA 1M904 3CCR3 4KVHA 4H61A 3V99A 1NJI4 3BB9A 4N6V0 3K63A 1NDOB 3FKAA 3OW22 1K734 3J7Yd 3B4PA 2Z7AA 2ZL8A 1JN5A 4XBTA 3TDGA 1VQP3 2E2UA 4MJDA 3SVAA 1IK3A 5IG4A 2KCDA 2QA43 4R4KA 1GYBA 4WHAA 3F7SA 3NQZA 1QJGA 1K28A 3CPOA 3FLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5H A;  3NX0 A;  1FA3 A;  2W9Q A;  2O9U X;  1EQK A;  4N6M A;  4EYC A;  4N6N B;  1N9J A;  1CYV A;  3Q2P A;  3PYJ A;  2OCT A;  4IT7 A;  1KWI A;  3L0R A;  5ELJ A;  1M9G A;  1MOL A;  1IV7 A;  3MWZ A;  1WNH A;  1NB5 I;  3K9M C;  1A67 A;  1GD4 A;  3S67 A;  1ROA A;  5A0O B;  1A90 A;  2CH9 A;  1LXE A;  5LC7 A;  3UL6 A;  3GAX A;  1CYU A;  1IV9 A;  1RN7 A;  1PFP A;  3PS8 A;  4N6O B;  4ZM8 A;  1GD3 A;  3IMA B;  3KFQ C;  3LH4 A;  4N6U A;  1STF I;  5LC6 A;  2KXG A;  4N6L A;  4LZI A;  1CEW I;  1R4C A;  5ELU A;  4TX4 A;  1FUW A;  1NB3 I;  1TIJ A;  4CCV A;  3PXM A;  1YVB I;  4N6T A;  4N6V 0;  2BO9 B;  3UL5 A;  1MNL A;  3SVA A;  1G96 A;  3QRD A;  2W9P A;  1DVC A;  3KSE D;  1N5P A;  5EQL A;  1DVD A; 
#chains in the Genus database with same CATH topology
 5IG3 A;  4HM8 B;  5JBS A;  1UGI A;  5BIR A;  3NX0 A;  5I97 A;  2XFS A;  3G16 A;  4R9L A;  2W9Q A;  3JUQ A;  6STD A;  2O9U X;  1BNI A;  3HX8 A;  2Z77 A;  3ZG5 A;  2MF7 A;  3MKI A;  3V98 A;  1TTO A;  3PZW A;  3F8H A;  3CCS 3;  2QEX 3;  1TJD A;  4EYC A;  3I56 3;  1Q82 4;  3LOY A;  4HAA A;  4EW5 A;  3CCJ 3;  3GZX B;  4ORL A;  1VQO 3;  3CC4 3;  2L1S A;  2OTJ 3;  1BNS A;  4EXR A;  4FCZ A;  1QAK A;  1KWI A;  4IT7 A;  2CWT A;  4JF8 A;  3CC7 3;  2BNG A;  1B2M A;  5D82 A;  1YJW 3;  1N9E A;  1QAL A;  2JDI H;  4I5Q A;  1IV7 A;  2H0I A;  3H51 A;  4HM6 B;  5KP3 A;  1BRG A;  2W56 B;  4HM4 B;  1OF5 A;  1WNH A;  1HYF A;  5AYS C;  3AMO B;  3SLU A;  2W2C A;  5CF1 A;  4HM0 B;  4R9K A;  1FYS A;  2XEP A;  3S5C A;  4BTX A;  1FGT A;  1BAO A;  4K1U A;  1PY3 A;  3DMC A;  5CF2 A;  1RN1 A;  4O02 B;  1RRH A;  1B2X A;  5AIF A;  2WGO A;  1VQ4 3;  1GD4 A;  3NV0 A;  1RGA A;  5IW9 A;  5IF6 A;  3CCE 3;  4H3U A;  4CJN A;  1BSC A;  4K61 A;  1RRL A;  5BU4 A;  2XR8 B;  1I3I A;  1AY7 A;  1LOW A;  2WOH A;  3F7X A;  1K9M 4;  3ROB A;  1RTU A;  3X3X A;  1ZS7 A;  3G6E 3;  3NUV A;  1MWR A;  1OHO A;  1OH0 A;  1NNV A;  1GY7 A;  3BLZ A;  4X2O A;  5M18 A;  1CYU A;  1YJ9 3;  2INX A;  3FF0 A;  2P0X A;  3PGB A;  3EB8 A;  3CCU 3;  3FZW A;  3JUN A;  2GU3 A;  3LZA A;  1PU4 A;  1GMP A;  1B27 A;  5FGO A;  3GRD A;  1QMA A;  3JUP A;  3DY5 A;  1KSI A;  8CHO A;  1KC8 4;  4N3V A;  2KAA A;  3X3Y A;  4QWT A;  3LTD A;  5TGN A;  1GD3 A;  1GMQ A;  1SQW A;  2SAR A;  4HM5 B;  2CWU A;  1WMO A;  1JRQ A;  2F98 A;  3BNB A;  3KFQ C;  3D3L A;  3ECF A;  1VZZ A;  1MWS A;  1TRQ A;  3LH4 A;  3HZP A;  1LRA A;  1C54 A;  1DET A;  1DMQ A;  1IVV A;  1YJN 3;  1STF I;  1AVK A;  3E99 A;  2GSP A;  2XRX B;  2XGL A;  2FNQ A;  3MSO A;  3SYU A;  1T2I A;  3GZY B;  3ZG0 A;  3GSP A;  1BAN A;  1RSN A;  2BIR A;  2F86 B;  3EJV A;  1R4C A;  3URP A;  3A76 A;  4KFE A;  1FUW A;  1TIJ A;  3NM2 A;  2GXF A;  1YVB I;  1YGE A;  3HOH A;  4HM2 B;  2W03 A;  1UUG B;  3SX1 A;  3X42 A;  4N6T A;  3OWS A;  3WA3 A;  1JKG B;  1E97 A;  2CKF B;  2IY2 A;  1EA2 A;  3X40 A;  2BO9 B;  2XH9 A;  3A5E A;  3UL5 A;  1F8N A;  1UUV B;  1MGR A;  2C11 A;  4OVM A;  3X41 A;  5RNT A;  3I55 3;  3HIG A;  3QRD A;  2UGI A;  1A2V A;  1V58 A;  2W0Q A;  2PNC A;  2W9P A;  3F9S A;  1RGC A;  3EN1 B;  3OWU A;  4LGQ A;  3DGL A;  1ASK A;  3AHS A;  1I0V A;  3FH1 A;  1VQN 3;  4XBX A;  1W6Y A;  1LVN A;  3NXJ A;  3JVC A;  2AAE A;  1EEJ A;  1FUS A;  1FZU A;  3MWZ A;  1FW7 A;  2CFL A;  5BVB A;  4K1V A;  5KP4 A;  2YFL B;  5STD A;  1BOX A;  1B20 A;  4RNZ A;  1FA3 A;  3I0Y A;  4WYK B;  2JQ5 A;  3UB1 A;  2CFW A;  4MMY B;  1VQ8 3;  2BU4 A;  3F8X A;  3N9H A;  1W7C A;  1EQK A;  2R41 A;  1Q81 4;  5CK6 A;  3CCM 3;  5GSP A;  3VSY A;  2FGT A;  4O8S A;  4XDW A;  3DXO A;  4N6N B;  1GS3 A;  1UCI A;  2YX9 A;  2CG0 A;  1N9J A;  2RBI A;  1K8A 4;  2H0H A;  1IDP A;  1DMN A;  3KKG A;  1LOY A;  4L8P A;  1LNH A;  1ZGX A;  1MOL A;  3LT8 A;  3MG2 A;  5M1A A;  3T0U A;  1Q42 A;  3K0Z A;  4FMB A;  1W02 A;  3F14 A;  4HM7 B;  2GBW B;  2C10 A;  2WO0 A;  1WMN A;  1GSP A;  1E3R A;  4IPB A;  3K9M C;  4JRF A;  1A67 A;  1W6G A;  3FG1 A;  2OOV A;  1ULJ B;  1UI8 A;  3SOA A;  1BRN L;  1SAR A;  3EN8 A;  1GOU A;  4BTW A;  1IU7 A;  2W04 A;  2KF5 A;  2L4V A;  1MWU A;  1Q7H A;  1OGX A;  2B1X B;  1JZD A;  3WDG B;  1ROA A;  2CX1 A;  3EHC A;  4J8T A;  3G4S 3;  1JBS A;  4EV5 A;  3S27 A;  1A90 A;  1M1K 4;  2UUG C;  3WOD G;  3LTA A;  3FGY A;  1X1W A;  1VQL 3;  3ZFZ A;  2FXT A;  3DGY A;  4AKZ A;  5AIH A;  1EUI C;  1VQQ A;  3GAX A;  1CQS A;  3EBY A;  3N8B A;  1IVX A;  4XM4 A;  1KQS 2;  1JJ2 2;  1RN4 A;  1IV9 A;  4L7K A;  1IVW A;  1DYU A;  3N54 B;  1ISK A;  5AEU B;  1BUQ A;  2MC8 A;  2AAD A;  3RGR A;  1NO3 A;  2QIY A;  2OQE A;  1S72 3;  1IVU A;  3DUK A;  3LTC A;  1BRI A;  1I70 A;  5D83 A;  2Q07 A;  1STD A;  2ML6 A;  3BND A;  5G1K A;  3VGN A;  1B2S A;  4BIR A;  4Q53 A;  1W2Z A;  3IMA B;  3D5G A;  3MG1 A;  4J5K A;  1Q86 4;  3CXC 2;  1ZO2 A;  4XBY A;  3CME 3;  1G0T A;  3KE7 A;  3CD6 3;  2HMJ B;  2WOF A;  4BTY A;  1O7W B;  4J5G A;  3K7C A;  1I8V A;  1E3V A;  1UUW B;  2YFI B;  3EE1 A;  1WTH A;  4GB5 A;  1I2F A;  1TRP A;  1BNF A;  2E2V A;  3FF2 A;  3WOF B;  1Q40 B;  1RGH A;  5LC6 A;  1VQ5 3;  4FMA A;  2IYJ A;  4N6L A;  1CEW I;  2GU1 A;  3LT9 A;  1JV2 B;  4HKV B;  1TP6 A;  2K0M A;  4FMD A;  1NU3 A;  3G8Z A;  1NB3 I;  3HK4 A;  1FGQ A;  1OGZ A;  3VF1 A;  3RDE A;  2XSO B;  4STD A;  3OV4 A;  2HMN B;  1T2H A;  1BU4 A;  1JN5 B;  2LQV A;  2RGQ A;  3ER7 A;  3F40 A;  2A15 A;  2BMO B;  4L8O A;  1QVG 2;  1ULI B;  1BSA A;  3D9R A;  3JUM A;  1YNV X;  1YIT 3;  2IUK A;  4KFD A;  1Q7Y 4;  1MNL A;  1W2B 2;  1RGF A;  5AII A;  2K3D A;  1N8R 4;  1O7H B;  4HZ9 B;  1QVF 2;  1TFK A;  2CK3 H;  3B8L A;  3KSP A;  3D4A A;  2XF3 A;  2CIU A;  3EQQ B;  2BHM A;  1W5Z A;  1QAF A;  1MWT A;  1UDI I;  3WR2 A;  1DVD A;  3CNX A;  3LTB A;  4XDV A;  3NM7 A;  4LEH A;  4BL2 A;  1MGW A;  1N5H A;  5DRV A;  1IQ8 A;  2B24 B;  4WWU C;  3BNE A;  2Y74 A;  1GMR A;  5IEN A;  1OUN A;  4PEJ A;  3KZT A;  3EF8 A;  4LSO A;  1VQK 3;  1IT7 A;  3V92 A;  3WOE B;  5AIG A;  1AVL A;  3SOY A;  4EV2 A;  4N6M A;  3EBT A;  1JB4 A;  1W6C A;  4R1K A;  2UX0 A;  4BL3 A;  2RSX A;  1RGL A;  1CYV A;  3Q2P A;  1B2Z A;  4XB5 A;  1OAC A;  1OF5 B;  3FG3 A;  1YVS A;  4RNY A;  3LYG A;  3L0R A;  5ELJ A;  2D42 A;  1BUJ A;  1M9G A;  4HOH A;  1JB2 A;  4CPK A;  3OWY A;  3CCQ 3;  1NB5 I;  1DE3 A;  3NQY A;  3NV0 B;  3Q3F A;  3WHO A;  1D6U A;  4AEQ A;  1D6Z A;  2ZA4 A;  4HVN A;  1SIH A;  4RZM A;  3GWR A;  1IYY A;  5G2G A;  3AMO A;  5IER A;  4KT3 B;  4LMI A;  3S67 A;  1EG9 B;  2RNT A;  1AR0 A;  4MMZ B;  1R4Y A;  2STD A;  3M8C A;  3T8N A;  5A0O B;  1Y4K A;  4HM3 B;  5JPP A;  3B4O A;  2CW9 A;  1LXE A;  2F99 A;  1BNJ A;  4EBG A;  1B2U A;  5IG5 A;  2CG1 A;  5IEP A;  5LC7 A;  1I0X A;  3DH2 A;  2F56 A;  4FR9 A;  3G71 3;  4RBN A;  3DGN A;  3UL6 A;  2HML B;  4MEI A;  3D79 A;  2XFT A;  1IT8 A;  1K41 A;  1UW1 A;  1BVI A;  3U1W A;  2GBX B;  1YIJ 3;  1RGK A;  2BMR B;  4G1M B;  1G02 A;  1UI7 A;  1A2P A;  3SED A;  5EEO A;  1GY6 A;  2OTL 3;  3Q90 A;  1GOY A;  1X1U A;  2KRT A;  3UJM A;  9RNT A;  4HYZ A;  3AHW A;  3STD A;  1CH0 A;  2Z6B A;  1W01 A;  4GL6 A;  1AV4 A;  1BNE A;  5AI1 A;  3FCS B;  3LXU X;  3RGA A;  1TUH A;  4WFO A;  2E2T A;  2ZDJ A;  1L5G B;  1UCL A;  1YHQ 3;  3OX9 A;  4ILF A;  4GHO A;  3RNT A;  5IG0 A;  1LOX A;  2PZV A;  2P05 A;  1RNB A;  2YFJ B;  5AYR B;  4N6U A;  2IMJ A;  5IEO A;  3FSD A;  5EVH A;  1RMS A;  2KXG A;  1ROV A;  1T5Y A;  2GEX A;  2KF3 A;  4AKY A;  1WMP A;  3DGM A;  3U97 A;  5ELU A;  2XGN A;  4TX4 A;  1FGM A;  3EX9 A;  1D6Y A;  2ML5 A;  4O2H A;  4I4K A;  3S28 A;  1VQ6 3;  2XSH B;  1OHP A;  3NBB A;  1X1X A;  3K5T A;  1BNR A;  2OOV C;  7STD A;  4DKI A;  1TFO A;  1RGE A;  3B7C A;  5KP1 A;  1OCV A;  4OUQ A;  1I2G A;  1FUT A;  5D81 A;  1JKG A;  1Z1S A;  2F4Y A;  1G96 A;  1GY5 A;  2Z76 A;  4FCM A;  2P09 A;  3NBR A;  1O7P B;  5JPU A;  1DVC A;  2CC3 A;  2GEY A;  3BIR A;  3KSE D;  1O7M B;  5BXQ A;  1N5P A;  1U5O A;  5CXO A;  2J8X B;  3S29 A;  2KF4 A;  5EQL A;  1RHL A;  3HII A;  1SJW A;  4OK0 A;  5CLK A;  1BGS A;  3WA2 X;  3MPH A;  3X3Z A;  1RGG A;  1DMM A;  4RNT A;  2BMQ B;  3UNL A;  3GZB A;  1TU5 A;  1J2B A;  1VQM 3;  1OPY A;  2OQE C;  2D1W A;  3ALA A;  3Q1C A;  5HGR A;  2H0G A;  3IJE B;  2CFG A;  2IA7 A;  1EKM A;  1ZX2 A;  5M19 A;  4EC6 A;  3G0K A;  4WYK A;  5HOH A;  3CCL 3;  1FGR A;  1US1 A;  2M7O A;  1RJO A;  3PCS A;  3WMD A;  4FCJ A;  3PYJ A;  4U13 A;  1BRH A;  2K54 A;  2OCT A;  3KII A;  4IIA A;  1AQZ A;  1BIR A;  2ZHX B;  1UCK A;  2O3O A;  4NRE A;  3CC2 3;  1O7N B;  4HM1 B;  1SPU A;  1U8C B;  3GZR A;  2CFD A;  3O8Y A;  2LYX A;  3MG3 A;  1RCL A;  1IQY A;  4K90 B;  2HOH A;  3CMA 3;  1PYL A;  2KF6 A;  3H3H A;  4KZ1 A;  4LYL B;  1KD1 4;  1BSD A;  1VQ7 3;  2HMM B;  4R80 A;  1HU9 A;  1N8Q A;  3D5I A;  5AEW B;  3JUO A;  7GSP A;  2QGU A;  3MYT A;  1GOV A;  1W4N A;  4FMC A;  2CWV A;  3NBJ A;  1BRS A;  2HMO B;  4BU4 A;  1BRJ A;  5DRE A;  3IPT A;  3QK9 A;  2RCD A;  2CH9 A;  1JB5 A;  3MHE A;  1BSB A;  4HJL B;  4MMX B;  1HKX A;  3LML A;  1S5A A;  3CCV 3;  2F5W A;  4HBR A;  1O7G B;  3HI7 A;  4WP5 A;  1RNT A;  1X1Y A;  1BSE A;  3AGO A;  3NHX A;  2Y73 A;  1LOV A;  1RN7 A;  1RLS A;  3DM8 A;  1PFP A;  1W00 A;  1WQL B;  3PS8 A;  3DGO A;  4HZB B;  4N6O B;  4KFF A;  2CX0 A;  3CPW 2;  2SBL A;  2W56 A;  4ZM8 A;  1NWW A;  3KCH A;  2V1L A;  4X2H A;  1A2K A;  3CNM A;  1JBT A;  3BU4 A;  1FGO A;  1LNI A;  1LQM B;  6RNT A;  2HMK B;  2F5M A;  1SII A;  1RCK A;  1C7H A;  2WGQ A;  2P0M A;  6GSP A;  2RFR A;  1Q9E A;  2CHC A;  1VQ9 3;  3BNC A;  1V57 A;  1OHS A;  2IUJ A;  3T8U A;  4CDL A;  2I9W A;  5G1L A;  1LQG C;  4J9A A;  3OXA A;  1RKY A;  3FG4 A;  3EC9 A;  3FLJ A;  1YI2 3;  1YGW A;  4LZI A;  1RDS A;  2R4I A;  1JZO A;  1JNQ A;  1M1X B;  2OWP A;  2CFK A;  2P38 A;  3KN4 A;  8RNT A;  4CCV A;  1V74 A;  2C4B A;  1IQX A;  1Q40 A;  2W6J H;  2BT3 A;  3PXM A;  3DZL A;  3CU3 A;  3PCR A;  4NHF A;  4NPB A;  4O3V A;  5FW5 A;  3SXX A;  4GSP A;  1M90 4;  3CCR 3;  4KVH A;  4H61 A;  1BRK A;  3V99 A;  1BNG A;  1NJI 4;  1B21 A;  3BB9 A;  4N6V 0;  3K63 A;  1NDO B;  3FKA A;  3OW2 2;  1T3B A;  1K73 4;  3J7Y d;  3B4P A;  1I3F A;  2Z7A A;  2ZL8 A;  1JN5 A;  4XBT A;  3TDG A;  1VQP 3;  2E2U A;  4MJD A;  3SVA A;  1I2E A;  1IK3 A;  1B3S A;  5IG4 A;  2KCD A;  2QA4 3;  1UGH I;  4R4K A;  1GYB A;  4WHA A;  3F7S A;  1JBR A;  3NQZ A;  7RNT A;  3AGN A;  1QJG A;  1K28 A;  3CPO A;  1HZ1 A;  1UCJ A; 
#chains in the Genus database with same CATH homology
 5IG3 A;  4HM8 B;  5JBS A;  3NX0 A;  5I97 A;  2XFS A;  3G16 A;  4R9L A;  2W9Q A;  3JUQ A;  6STD A;  2O9U X;  3HX8 A;  2Z77 A;  2MF7 A;  3MKI A;  3V98 A;  3PZW A;  3F8H A;  3CCS 3;  2QEX 3;  3I56 3;  4EYC A;  1Q82 4;  3LOY A;  3CCJ 3;  3GZX B;  4ORL A;  1VQO 3;  3CC4 3;  2OTJ 3;  4EXR A;  3CC7 3;  4FCZ A;  1QAK A;  1KWI A;  4IT7 A;  2CWT A;  4JF8 A;  2BNG A;  5D82 A;  1YJW 3;  1N9E A;  1QAL A;  2JDI H;  1IV7 A;  3H51 A;  4HM6 B;  5KP3 A;  2W56 B;  4HM4 B;  1OF5 A;  1WNH A;  5AYS C;  3AMO B;  3SLU A;  2W2C A;  5CF1 A;  4HM0 B;  4R9K A;  2XEP A;  3S5C A;  4BTX A;  1FGT A;  4K1U A;  5CF2 A;  3DMC A;  4O02 B;  1RRH A;  5AIF A;  2WGO A;  1VQ4 3;  1GD4 A;  3NV0 A;  5IW9 A;  5IF6 A;  3CCE 3;  4H3U A;  4K61 A;  1RRL A;  2XR8 B;  3F7X A;  2WOH A;  1K9M 4;  3ROB A;  3X3X A;  3G6E 3;  3NUV A;  1OHO A;  1OH0 A;  1GY7 A;  3BLZ A;  4X2O A;  1CYU A;  2INX A;  3FF0 A;  2P0X A;  3PGB A;  3EB8 A;  3CCU 3;  3FZW A;  3JUN A;  2GU3 A;  3LZA A;  1PU4 A;  5FGO A;  3GRD A;  1QMA A;  3JUP A;  3DY5 A;  1KSI A;  8CHO A;  1KC8 4;  4N3V A;  3X3Y A;  4QWT A;  3LTD A;  5TGN A;  1GD3 A;  1SQW A;  4HM5 B;  2CWU A;  1WMO A;  1JRQ A;  2F98 A;  3BNB A;  3KFQ C;  3D3L A;  3ECF A;  1VZZ A;  3LH4 A;  3HZP A;  1DMQ A;  1IVV A;  1YJN 3;  1STF I;  1AVK A;  3E99 A;  2XRX B;  2XGL A;  2FNQ A;  3MSO A;  3GZY B;  3EJV A;  2F86 B;  1R4C A;  3A76 A;  4KFE A;  1FUW A;  1TIJ A;  3NM2 A;  2GXF A;  1YVB I;  1YGE A;  4HM2 B;  2W03 A;  3SX1 A;  3X42 A;  4N6T A;  3OWS A;  3WA3 A;  1JKG B;  1E97 A;  2CKF B;  1EA2 A;  3X40 A;  2BO9 B;  2XH9 A;  3UL5 A;  1F8N A;  1UUV B;  2C11 A;  4OVM A;  3X41 A;  3I55 3;  3HIG A;  3QRD A;  1A2V A;  2W0Q A;  2W9P A;  2PNC A;  3F9S A;  3OWU A;  3EN1 B;  4LGQ A;  3DGL A;  1ASK A;  3FH1 A;  1VQN 3;  4XBX A;  1W6Y A;  1LVN A;  3NXJ A;  3JVC A;  3MWZ A;  2CFL A;  5BVB A;  4K1V A;  5KP4 A;  2YFL B;  5STD A;  4RNZ A;  1FA3 A;  3I0Y A;  4WYK B;  2JQ5 A;  3UB1 A;  2CFW A;  4MMY B;  1VQ8 3;  3F8X A;  3N9H A;  1W7C A;  1EQK A;  1Q81 4;  5CK6 A;  3CCM 3;  3VSY A;  2FGT A;  4O8S A;  4XDW A;  3DXO A;  4N6N B;  1GS3 A;  2YX9 A;  2CG0 A;  1N9J A;  1K8A 4;  1IDP A;  1DMN A;  3KKG A;  4L8P A;  1LNH A;  1MOL A;  3LT8 A;  3MG2 A;  1Q42 A;  3K0Z A;  4FMB A;  1W02 A;  3F14 A;  4HM7 B;  2GBW B;  2C10 A;  2WO0 A;  1WMN A;  1E3R A;  4IPB A;  3K9M C;  4JRF A;  1A67 A;  1W6G A;  3FG1 A;  2OOV A;  1ULJ B;  1UI8 A;  3SOA A;  3EN8 A;  4BTW A;  1IU7 A;  2W04 A;  2L4V A;  1OGX A;  2B1X B;  3WDG B;  1ROA A;  3EHC A;  3G4S 3;  4J8T A;  4EV5 A;  3S27 A;  1A90 A;  1M1K 4;  3WOD G;  3LTA A;  3FGY A;  1VQL 3;  2FXT A;  4AKZ A;  5AIH A;  3GAX A;  4XM4 A;  1KQS 2;  1CQS A;  3EBY A;  3N8B A;  1IVX A;  1JJ2 2;  1IV9 A;  4L7K A;  1IVW A;  1DYU A;  3N54 B;  1ISK A;  5AEU B;  1BUQ A;  2MC8 A;  3RGR A;  1NO3 A;  2QIY A;  2OQE A;  1S72 3;  1IVU A;  3DUK A;  3LTC A;  5D83 A;  2Q07 A;  1STD A;  2ML6 A;  3BND A;  3VGN A;  4Q53 A;  1W2Z A;  3IMA B;  3MG1 A;  1Q86 4;  3CXC 2;  1ZO2 A;  4XBY A;  3CME 3;  3KE7 A;  2HMJ B;  2WOF A;  4BTY A;  1O7W B;  3K7C A;  1E3V A;  1UUW B;  2YFI B;  3EE1 A;  1WTH A;  4GB5 A;  2E2V A;  3FF2 A;  3WOF B;  1Q40 B;  5LC6 A;  1VQ5 3;  4FMA A;  4N6L A;  1CEW I;  2GU1 A;  3LT9 A;  1JV2 B;  4HKV B;  1TP6 A;  2K0M A;  4FMD A;  1NU3 A;  3G8Z A;  1NB3 I;  3HK4 A;  1FGQ A;  1OGZ A;  3VF1 A;  3RDE A;  2XSO B;  4STD A;  3OV4 A;  2HMN B;  1JN5 B;  2LQV A;  2RGQ A;  3ER7 A;  3F40 A;  2A15 A;  2BMO B;  4L8O A;  1QVG 2;  1ULI B;  3D9R A;  3JUM A;  1YIT 3;  2IUK A;  4KFD A;  1Q7Y 4;  1MNL A;  1W2B 2;  5AII A;  1N8R 4;  1O7H B;  4HZ9 B;  1QVF 2;  1TFK A;  2CK3 H;  3B8L A;  3KSP A;  3CD6 3;  2XF3 A;  2CIU A;  3EQQ B;  2BHM A;  1W5Z A;  1QAF A;  1DVD A;  3CNX A;  3LTB A;  4XDV A;  3NM7 A;  4LEH A;  1N5H A;  5DRV A;  1IQ8 A;  2B24 B;  4WWU C;  3BNE A;  2Y74 A;  5IEN A;  1OUN A;  4PEJ A;  3KZT A;  3EF8 A;  4LSO A;  1VQK 3;  1IT7 A;  3V92 A;  3WOE B;  5AIG A;  1AVL A;  3SOY A;  4EV2 A;  4N6M A;  3EBT A;  1JB4 A;  1W6C A;  4R1K A;  2UX0 A;  2RSX A;  1CYV A;  3Q2P A;  4XB5 A;  1OAC A;  1OF5 B;  3FG3 A;  4RNY A;  3LYG A;  3L0R A;  5ELJ A;  2D42 A;  1M9G A;  1JB2 A;  3OWY A;  3CCQ 3;  1NB5 I;  3NQY A;  3NV0 B;  4AEQ A;  1D6U A;  1D6Z A;  4HVN A;  1SIH A;  4RZM A;  3GWR A;  5G2G A;  3AMO A;  5IER A;  4LMI A;  3S67 A;  1EG9 B;  1AR0 A;  4MMZ B;  3M8C A;  2STD A;  3T8N A;  5A0O B;  1Y4K A;  4HM3 B;  5JPP A;  3B4O A;  2CW9 A;  1LXE A;  2F99 A;  4EBG A;  1YJ9 3;  5IG5 A;  1J2B A;  2CG1 A;  5IEP A;  5LC7 A;  3G71 3;  4FR9 A;  4RBN A;  3DGN A;  3UL6 A;  2HML B;  4MEI A;  2XFT A;  1IT8 A;  1K41 A;  1UW1 A;  3U1W A;  2GBX B;  1YIJ 3;  2BMR B;  4G1M B;  1UI7 A;  3SED A;  5EEO A;  1GY6 A;  2OTL 3;  3Q90 A;  3UJM A;  2KRT A;  4HYZ A;  3STD A;  2Z6B A;  1W01 A;  4GL6 A;  1AV4 A;  5AI1 A;  3RGA A;  3FCS B;  3LXU X;  3T0U A;  1TUH A;  4WFO A;  2E2T A;  2ZDJ A;  1L5G B;  1YHQ 3;  3OX9 A;  5IG0 A;  1LOX A;  2PZV A;  2P05 A;  2YFJ B;  5AYR B;  4N6U A;  2IMJ A;  5IEO A;  3FSD A;  5EVH A;  2KXG A;  1ROV A;  1T5Y A;  2GEX A;  1WMP A;  3DGM A;  3U97 A;  5ELU A;  2XGN A;  4TX4 A;  1FGM A;  3EX9 A;  1D6Y A;  2ML5 A;  4I4K A;  3S28 A;  1VQ6 3;  2XSH B;  1OHP A;  3NBB A;  3K5T A;  2OOV C;  7STD A;  1TFO A;  3B7C A;  1OCV A;  4OUQ A;  5D81 A;  1JKG A;  1Z1S A;  1G96 A;  2Z76 A;  1GY5 A;  4FCM A;  2P09 A;  3NBR A;  1O7P B;  5JPU A;  1DVC A;  2CC3 A;  2GEY A;  3KSE D;  1O7M B;  5BXQ A;  1N5P A;  1U5O A;  5CXO A;  3S29 A;  5EQL A;  3HII A;  3WA2 X;  1SJW A;  4OK0 A;  5CLK A;  3X3Z A;  3MPH A;  1DMM A;  2BMQ B;  3UNL A;  3GZB A;  1TU5 A;  1VQM 3;  1OPY A;  2OQE C;  2D1W A;  3ALA A;  3Q1C A;  5HGR A;  3IJE B;  2CFG A;  2IA7 A;  1EKM A;  1ZX2 A;  4EC6 A;  3G0K A;  4WYK A;  3CCL 3;  1FGR A;  1US1 A;  2M7O A;  1RJO A;  3PCS A;  3WMD A;  4FCJ A;  3PYJ A;  4U13 A;  2K54 A;  2OCT A;  3KII A;  4IIA A;  4AKY A;  5KP1 A;  4NRE A;  2O3O A;  3CC2 3;  1O7N B;  4HM1 B;  1SPU A;  1U8C B;  3GZR A;  2CFD A;  3O8Y A;  2LYX A;  3MG3 A;  4K90 B;  1IQY A;  3CMA 3;  3H3H A;  4KZ1 A;  1KD1 4;  1VQ7 3;  2HMM B;  4R80 A;  1HU9 A;  1N8Q A;  5AEW B;  3JUO A;  2QGU A;  3MYT A;  1W4N A;  4FMC A;  2CWV A;  3NBJ A;  2HMO B;  5DRE A;  3IPT A;  2RCD A;  2CH9 A;  1JB5 A;  3MHE A;  4HJL B;  4MMX B;  1HKX A;  3LML A;  1S5A A;  3CCV 3;  4HBR A;  1O7G B;  3HI7 A;  4WP5 A;  3NHX A;  2Y73 A;  1RN7 A;  3DM8 A;  1PFP A;  1W00 A;  1WQL B;  3PS8 A;  3DGO A;  4HZB B;  4N6O B;  4KFF A;  3CPW 2;  2SBL A;  2W56 A;  4ZM8 A;  1NWW A;  4X2H A;  2V1L A;  1A2K A;  3CNM A;  1FGO A;  2HMK B;  1SII A;  1C7H A;  2WGQ A;  2P0M A;  2RFR A;  2CHC A;  1VQ9 3;  3BNC A;  2IUJ A;  1OHS A;  4CDL A;  3T8U A;  2I9W A;  4J9A A;  3OXA A;  1RKY A;  3FG4 A;  3EC9 A;  1YI2 3;  4LZI A;  2R4I A;  1M1X B;  1JNQ A;  2OWP A;  2CFK A;  2P38 A;  3KN4 A;  4CCV A;  1V74 A;  3PXM A;  1IQX A;  1Q40 A;  2W6J H;  2BT3 A;  3QK9 A;  3DZL A;  3CU3 A;  3PCR A;  4NHF A;  4O2H A;  4O3V A;  5FW5 A;  3SXX A;  1M90 4;  3CCR 3;  4KVH A;  4H61 A;  3V99 A;  1NJI 4;  3BB9 A;  4N6V 0;  3K63 A;  1NDO B;  3FKA A;  3OW2 2;  1K73 4;  3J7Y d;  3B4P A;  2Z7A A;  2ZL8 A;  1JN5 A;  4XBT A;  3TDG A;  1VQP 3;  2E2U A;  4MJD A;  3SVA A;  1IK3 A;  5IG4 A;  2KCD A;  2QA4 3;  4R4K A;  1GYB A;  4WHA A;  3F7S A;  3NQZ A;  1QJG A;  1K28 A;  3CPO A;  3FLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...