1VQ63

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq6300
3CC43 1M1K4 1YJN3 3I553 1Q864 3CXC2 3CCE3 1W2B2 3G6E3 1K8A4 3CCV3 1VQK3 1M904 1QVF2 3CD63 1VQ83 3CMA3 3CC73 1VQO3 1KC84 1VQN3 3CCR3 1YJ93 3CCQ3 3CCS3 3G713 1VQM3 3CCU3 1S723 1K9M4 1VQ53 1VQ73 3CC23 1QVG2 3CCL3 2QA43 1NJI4 1YI23 2OTL3 1VQ63 1YIJ3 1VQP3 1VQ93 3CPW2 1JJ22 2QEX3 2OTJ3 1N8R4 1VQL3 1KQS2 1YHQ3 3CME3 1K734 3CCM3 1Q814 1Q7Y4 1YJW3 3OW22 1KD14 1YIT3 3I563 1Q824 3G4S3 3CCJ3 1VQ43
chains in the Genus database with same CATH superfamily
1I0XA 3I553 1BRGA 5TGNA 3FG3A 2E2VA 2BHMA 5JPPA 4R1KA 4MEIA 2WO0A 2P38A 3BU4A 1X1WA 1W7CA 2O9UX 3WOEB 1RGHA 2ML5A 4HM7B 1JBSA 1I8VA 2KF6A 1I70A 3HX8A 4FMDA 4XM4A 2Z6BA 2I9WA 2RFRA 1RGGA 2GU1A 3OWSA 3IMAB 3S27A 1TTOA 1HZ1A 4QWTA 1VQ73 1OHSA 3A76A 1JNQA 3BB9A 3FF0A 1BIRA 2MC8A 4HM3B 9RNTA 3X40A 1R4CA 3D79A 4LZIA 5M19A 4R9LA 4HZ9B 1G0TA 1D6YA 1SJWA 1NB3I 4OVMA 1G02A 3KKGA 1V58A 1RGCA 4N3VA 1JKGB 1B20A 1BNRA 2L1SA 1RRHA 2Z76A 1K28A 2Z77A 4XB5A 1X1UA 4BU4A 2JDIH 5IG5A 1TP6A 1UUVB 3F7XA 2PNCA 2LYXA 2RCDA 3FLJA 3BIRA 4BIRA 2OCTA 1RGEA 1DVDA 3OWUA 3LTCA 2FNQA 4X2OA 3AMOB 4O02B 2GSPA 3X3ZA 5AIGA 1DE3A 4I5QA 4XDWA 5IG4A 3MG3A 3CCL3 1YGWA 3KZTA 4FCMA 2IMJA 4XBXA 1SARA 1VQ93 1MOLA 3QRDA 5AIIA 4O3VA 2L4VA 3OXAA 2AADA 1VQL3 2W04A 1K734 3CU3A 3D3LA 3NX0A 3DUKA 3G0KA 3MWZA 5KP3A 1Q7Y4 2P09A 4KT3B 4GB5A 3T8NA 3GZRA 4HAAA 2W6JH 4BTWA 1U5OA 3JUQA 5KP1A 1TU5A 3T8UA 1A90A 1IVWA 2IYJA 1L5GB 1FA3A 2CIUA 3PCSA 2F5WA 3LTAA 5JBSA 2CX0A 5DREA 4HM2B 3URPA 1O7GB 1Q40A 2K54A 3CPOA 3F14A 6RNTA 3FG4A 3D5IA 2QIYA 2XRXB 2IA7A 3EF8A 3K9MC 3WODG 1NNVA 1MNLA 1OHOA 3S28A 1TJDA 1OHPA 2B24B 3DGNA 5D83A 1QVG2 2ML6A 2ZA4A 1GMRA 3DMCA 3UNLA 1MGWA 1YVBI 3GAXA 3IJEB 2C10A 4KZ1A 5STDA 4AKYA 1CQSA 1JRQA 1I3IA 1W4NA 2XH9A 4TX4A 3B7CA 3OV4A 1FGTA 5I97A 5LC6A 3F8XA 4K61A 3DGMA 4WYKA 2WGQA 2M7OA 1YJN3 2YX9A 4G1MB 1M9GA 1EKMA 3LH4A 3MHEA 4FMBA 2R4IA 5IG0A 2CC3A 1RKYA 1DETA 1FYSA 2BIRA 3LTBA 3B4OA 1CH0A 1JBTA 5AEUB 1VQ83 1JBRA 1UCIA 1BRSA 2IUJA 1CEWI 1N9EA 2YFLB 3V98A 1UDII 4R80A 2J8XB 1VQQA 3J7Yd 1TIJA 5JPUA 1BAOA 2UX0A 1PYLA 1JJ22 3A5EA 3BNEA 4LGQA 1W6YA 3F8HA 1DMQA 5AYRB 1YIT3 1AVKA 3RDEA 1GS3A 3DH2A 1ZX2A 1IQYA 3NM2A 1IVVA 2Q07A 3BNBA 3D4AA 4LEHA 5G1LA 2XR8B 1UUWB 3NBBA 2SBLA 1TFKA 3L0RA 4K90B 2KF5A 4L7KA 2BMRB 2ZDJA 2IY2A 1VQN3 1RN1A 5M18A 2BO9B 5IF6A 3EE1A 3MSOA 3G16A 1BANA 3AHWA 1K8A4 3ZG0A 3WOFB 5RNTA 2C11A 4HJLB 1LNHA 1V74A 2IUKA 1NJI4 2OTL3 4LYLB 4N6V0 2RBIA 3DM8A 4MMYB 5D81A 3AGNA 3TDGA 2Y74A 4BL2A 1OCVA 3HOHA 1JB5A 3EJVA 1GYBA 1ASKA 1RCKA 1RMSA 1LOXA 1KWIA 1MWRA 3B8LA 1DMNA 3WA3A 3GWRA 4JF8A 3KCHA 3NUVA 5EEOA 3SX1A 3V99A 4NREA 5IEOA 3KIIA 4I4KA 5AYSC 3MG2A 3N9HA 2F99A 1V57A 1FZUA 4WYKB 2RSXA 3Q1CA 3UL5A 2UGIA 1WNHA 4STDA 1IV9A 3T0UA 3X3XA 2CHCA 1Z1SA 1E3VA 2B1XB 1JZDA 2E2TA 2P0MA 3CNXA 5D82A 2OQEA 4U13A 4BTYA 1TUHA 1VQP3 1BNSA 1ULJB 5CF1A 3VGNA 1N5HA 3FH1A 2OQEC 4HBRA 1NDOB 2GEYA 3KFQC 4K1UA 3X3YA 3UB1A 4HM6B 3F40A 3N54B 3ER7A 4WFOA 1VQ43 1A2PA 1RGKA 1B2SA 3K63A 1WMNA 3VSYA 3CCE3 3BNDA 1GMPA 5DRVA 3VF1A 3HI7A 3PGBA 1D6UA 1BSCA 2CG1A 4CCVA 3CMA3 1RLSA 2H0IA 1BSAA 1FGMA 1LRAA 2W2CA 3K5TA 5FGOA 1YVSA 3LTDA 1BVIA 1BOXA 5CLKA 1MWTA 1UGHI 1STDA 1QJGA 3KSPA 1VQ63 1RN4A 1BRNL 1IYYA 3H51A 5LC7A 4HM0B 4N6LA 3NM7A 1EQKA 2D42A 4JRFA 2CWUA 3E99A 3IPTA 1J2BA 3U1WA 2GEXA 3EBTA 2CH9A 1BRKA 2P05A 4IPBA 1BSBA 1R4YA 1SQWA 4GL6A 5ELUA 1WTHA 1Y4KA 4LMIA 3NBJA 4ZM8A 1QVF2 3CD63 1BUJA 1A2VA 1GSPA 4HOHA 1EEJA 2FGTA 4N6NB 1IVUA 3LT9A 1QMAA 1MWSA 2XGLA 3JUPA 4HM5B 1K9M4 1RNBA 1BNEA 2WOFA 1YIJ3 5KP4A 2CKFB 2H0GA 1GOYA 1FW7A 3NBRA 7STDA 5ELJA 2W0QA 5CF2A 3FCSB 2ZHXB 3OW22 1PU4A 5AIFA 2CK3H 1NO3A 2GBWB 2OOVA 1M1K4 1LQGC 2CFKA 4FCZA 4FCJA 4Q53A 3CXC2 3ZG5A 1KSIA 1IQXA 2XGNA 3HZPA 1WQLB 3PYJA 1N5PA 3RNTA 1O7PB 2A15A 3B4PA 8RNTA 1FUWA 1ULIB 2KRTA 3CCQ3 3NV0A 1YNVX 1WMPA 3WDGB 1CYUA 3F9SA 1VZZA 3K0ZA 4XDVA 5CXOA 1BRHA 3MPHA 5BXQA 5IERA 1T2IA 4R9KA 2P0XA 3LOYA 3KN4A 1I0VA 4N6UA 2GBXB 3GZYB 3Q2PA 4HM8B 1E3RA 2INXA 3JUOA 3SVAA 3RGAA 1AQZA 1AR0A 4LSOA 4J5GA 1OF5B 1IVXA 4RBNA 4EV5A 1EG9B 2ZL8A 2KF4A 3UJMA 3LMLA 4WP5A 1SPUA 7GSPA 1DVCA 1D6ZA 1YJ93 4BTXA 2F4YA 1HU9A 2F5MA 1I3FA 1VQM3 1A67A 6GSPA 3CCU3 4EXRA 3DY5A 3LYGA 6STDA 2JQ5A 1NWWA 2MF7A 3EB8A 5AIHA 1O7HB 1O7NB 1GOVA 2HMOB 1TRQA 1YHQ3 1I2FA 1E97A 1PFPA 4FMCA 2HMLB 3SEDA 3CCM3 5EVHA 4HKVB 3HIIA 3EBYA 3I563 1Q824 1JV2B 1AVLA 1RNTA 5CK6A 4AKZA 3ALAA 1W6GA 1FGOA 1M1XB 1N8QA 3FZWA 2Y73A 3EX9A 2YFIB 3F7SA 4GSPA 1RHLA 4HM1B 4PEJA 1JN5B 2STDA 4X2HA 1W2B2 3NXJA 1O7WB 1ZO2A 1RCLA 4XBTA 1M904 1LNIA 4FMAA 1B2UA 2H0HA 3CC73 1KC84 1ZS7A 7RNTA 3EN1B 3LT8A 1OPYA 1MGRA 1N9JA 2UUGC 1EUIC 2W03A 5BVBA 1QALA 1FGQA 4EBGA 4IIAA 1OH0A 3LZAA 1UGIA 4GHOA 3NV0B 1Q9EA 2CFGA 3PXMA 1GY7A 2F56A 1S5AA 3N8BA 2BMOB 3FF2A 1KD14 3AHSA 2CG0A 5AEWB 1IT8A 2OWPA 3S29A 2BNGA 4ORLA 2HMJB 1ISKA 3FGYA 2K0MA 2Z7AA 3PCRA 4WWUC 1RN7A 5AI1A 5EQLA 2CWVA 5GSPA 3WHOA 2YFJB 1X1XA 2LQVA 4K1VA 1LVNA 5BIRA 3EQQB 1UI7A 1W01A 1B3SA 4AEQA 1VQK3 2RGQA 3CNMA 2RNTA 3STDA 3Q3FA 3G713 3SOYA 1FGRA 4HM4B 3FSDA 5G1KA 1AV4A 1ROAA 1RJOA 3FKAA 2CX1A 3JUNA 1RTUA 4N6TA 1STFI 2W9PA 3KSED 3WR2A 1HKXA 1I2GA 1T2HA 1W00A 4HZBB 3S67A 3NQZA 3DGYA 3X42A 1B21A 1DYUA 2QGUA 4NHFA 1OF5A 4CDLA 1IQ8A 1LQMB 3DGOA 4RZMA 1FUTA 2HMMB 4J5KA 4HVNA 3SLUA 5BU4A 4MJDA 4O8SA 4RNZA 3G4S3 3CCJ3 3CC43 3BNCA 4H3UA 1HYFA 2E2UA 1BRJA 1IT7A 1GY6A 2HMKB 2F86B 1JB2A 4MMZB 4WHAA 1SIHA 3G6E3 4EYCA 3BLZA 2FXTA 2CFWA 4KVHA 3PZWA 3GRDA 4OK0A 1W2ZA 4N6OB 3RGRA 1JB4A 1B27A 1LOYA 1ROVA 2CFDA 3OWYA 5IG3A 1RGAA 1OACA 2K3DA 3JUMA 1BUQA 4J8TA 4KFEA 1W6CA 3HK4A 1YGEA 1JN5A 2WGOA 2BMQB 2XFSA 1B2XA 2HOHA 2W56B 4XBYA 5M1AA 2PZVA 2WOHA 3EHCA 2BU4A 1F8NA 1BRIA 1PY3A 3DZLA 5FW5A 1DMMA 1UUGB 1BSEA 1RDSA 2OOVC 3Q90A 1GOUA 4H61A 1VQO3 2OTJ3 1GD3A 3DGLA 1OGZA 1UCLA 3CCS3 1QAKA 1BNIA 2XF3A 4DKIA 3SYUA 1S723 2F98A 4RNTA 3CC23 2XSOB 1YI23 3D5GA 4CPKA 3JVCA 1AY7A 1W02A 3HIGA 2GU3A 4RNYA 1UI8A 3SXXA 2QEX3 1IU7A 2CFLA 1LXEA 2V1LA 5IEPA 3CPW2 2CWTA 4KFFA 1BU4A 1Q42A 1UCJA 3GZXB 1YJW3 3PS8A 3K7CA 4EV2A 3MYTA 1IV7A 3GSPA 3H3HA 5IENA 3NHXA 4FR9A 1IDPA 3G8ZA 1GD4A 2KAAA 3CCR3 2CW9A 3UL6A 1OGXA 3ECFA 1RGFA 1G96A 2D1WA 4HYZA 3SOAA 3WA2X 5IW9A 3AGOA 3MG1A 3ZFZA 1U8CB 3CCV3 1A2KA 1QAFA 1Q7HA 1T3BA 3GZBA 3OX9A 3QK9A 1JZOA 1CYVA 1O7MB 4MMXB 5HOHA 2C4BA 1TRPA 3O8YA 1WMOA 3KE7A 4R4KA 3EN8A 4OUQA 1BGSA 1BNFA 1LOWA 2XSHB 1VQ53 2GXFA 2KF3A 3V92A 1NB5I 1C7HA 1RSNA 3MKIA 5A0OB 1I2EA 1JKGA 1RRLA 1FUSA 3D9RA 1K41A 4ILFA 1T5YA 4O2HA 3CME3 1X1YA 1Q814 3LXUX 1BNGA 1OUNA 1UCKA 3DXOA 1IK3A 4CJNA 1ZGXA 8CHOA 2KCDA 2HMNB 2KXGA 1Q864 1MWUA 3AMOA 1EA2A 4L8PA 3X41A 4KFDA 2SARA 1GY5A 4NPBA 4EC6A 1W5ZA 4L8OA 1B2ZA 3M8CA 4N6MA 1BSDA 3NQYA 5HGRA 1SIIA 4J9AA 4EW5A 5G2GA 1C54A 1GMQA 3FG1A 2XEPA 2R41A 1BNJA 2QA43 1Q40B 2AAEA 2W9QA 3S5CA 1US1A 3U97A 4BL3A 3ROBA 4IT7A 2W56A 1UW1A 1N8R4 2BT3A 1KQS2 1NU3A 3EC9A 1LOVA 1TFOA 3WMDA 2O3OA 2XFTA 1B2MA 1RGLA 3I0YA
chains in the Genus database with same CATH topology
3I553 5TGNA 3FG3A 2E2VA 2BHMA 5JPPA 4R1KA 4MEIA 2WO0A 2P38A 2O9UX 1W7CA 3WOEB 2ML5A 4HM7B 3HX8A 4FMDA 4XM4A 2Z6BA 2I9WA 2RFRA 2GU1A 3S27A 3OWSA 3IMAB 1VQ73 4QWTA 1OHSA 3A76A 1JNQA 3BB9A 3FF0A 2MC8A 4HM3B 3X40A 1R4CA 4LZIA 4R9LA 4HZ9B 1SJWA 1D6YA 1NB3I 4OVMA 3KKGA 4N3VA 1JKGB 1RRHA 2Z76A 1K28A 2Z77A 4XB5A 2JDIH 5IG5A 1TP6A 1UUVB 3F7XA 2PNCA 2LYXA 2RCDA 3FLJA 2OCTA 1DVDA 3OWUA 3LTCA 2FNQA 4X2OA 3AMOB 4O02B 3X3ZA 5AIGA 4XDWA 5IG4A 3MG3A 3CCL3 3KZTA 4FCMA 2IMJA 4XBXA 1VQ93 1MOLA 3QRDA 5AIIA 4O3VA 2L4VA 3OXAA 1VQL3 2W04A 1K734 3CU3A 3D3LA 3NX0A 3DUKA 3G0KA 3MWZA 5KP3A 1Q7Y4 2P09A 4GB5A 3T8NA 3GZRA 4BTWA 2W6JH 5KP1A 1U5OA 3JUQA 1TU5A 1A90A 3T8UA 1IVWA 1L5GB 1FA3A 2CIUA 3PCSA 3LTAA 5JBSA 5DREA 4HM2B 1O7GB 1Q40A 2K54A 3CPOA 3F14A 3FG4A 2QIYA 2XRXB 2IA7A 3EF8A 3K9MC 3WODG 1MNLA 1OHOA 3S28A 1OHPA 2B24B 3DGNA 5D83A 1QVG2 2ML6A 3DMCA 1YVBI 3IJEB 3GAXA 4KZ1A 2C10A 5STDA 4AKYA 1CQSA 1JRQA 1W4NA 2XH9A 4TX4A 3B7CA 3OV4A 1FGTA 5I97A 5LC6A 3F8XA 4K61A 3DGMA 4WYKA 2WGQA 2M7OA 1YJN3 2YX9A 4G1MB 1M9GA 1EKMA 3LH4A 3MHEA 4FMBA 2R4IA 5IG0A 2CC3A 1RKYA 3LTBA 3B4OA 1VQ83 5AEUB 2IUJA 1CEWI 1N9EA 2YFLB 3V98A 4R80A 3J7Yd 1TIJA 5JPUA 2UX0A 1JJ22 4LGQA 3BNEA 1W6YA 3F8HA 1DMQA 5AYRB 1YIT3 1AVKA 3RDEA 1GS3A 1ZX2A 1IQYA 3NM2A 1IVVA 2Q07A 3BNBA 4LEHA 2XR8B 1UUWB 3NBBA 2SBLA 1TFKA 3L0RA 4K90B 4L7KA 2BMRB 2ZDJA 1VQN3 2BO9B 5IF6A 3EE1A 3MSOA 3G16A 3WOFB 2C11A 4HJLB 1LNHA 1V74A 2IUKA 1NJI4 2OTL3 4N6V0 3DM8A 4MMYB 5D81A 3TDGA 2Y74A 1OCVA 1JB5A 3EJVA 1GYBA 1ASKA 1LOXA 1KWIA 3B8LA 1DMNA 3WA3A 3GWRA 4JF8A 3NUVA 5EEOA 3SX1A 3V99A 4NREA 5IEOA 3KIIA 4I4KA 5AYSC 3MG2A 3N9HA 2F99A 4WYKB 2RSXA 3Q1CA 3UL5A 1WNHA 4STDA 1IV9A 3T0UA 3X3XA 2CHCA 1Z1SA 1E3VA 2B1XB 2P0MA 2E2TA 3CNXA 5D82A 2OQEA 4BTYA 4U13A 1TUHA 1ULJB 5CF1A 3VGNA 1N5HA 3FH1A 2OQEC 4HBRA 1NDOB 2GEYA 3KFQC 4K1UA 3X3YA 3UB1A 4HM6B 3F40A 3N54B 3ER7A 4WFOA 1VQ43 3K63A 1WMNA 3VSYA 3CCE3 3BNDA 5DRVA 3VF1A 3HI7A 3PGBA 1D6UA 2CG1A 4CCVA 3CMA3 1FGMA 3K5TA 2W2CA 5FGOA 3LTDA 5CLKA 1STDA 1QJGA 3KSPA 1VQ63 3H51A 5LC7A 4HM0B 4N6LA 3NM7A 1EQKA 2D42A 4JRFA 2CWUA 3E99A 3IPTA 1J2BA 3U1WA 2GEXA 3EBTA 2CH9A 2P05A 4IPBA 1SQWA 4GL6A 5ELUA 1WTHA 1Y4KA 4LMIA 3NBJA 4ZM8A 1QVF2 3CD63 1A2VA 2FGTA 4N6NB 1IVUA 3LT9A 1QMAA 4HM5B 2XGLA 3JUPA 1K9M4 2WOFA 1YIJ3 5KP4A 2CKFB 3NBRA 7STDA 5ELJA 2W0QA 5CF2A 3FCSB 3OW22 1PU4A 5AIFA 2CK3H 1NO3A 2GBWB 2OOVA 1M1K4 2CFKA 4FCZA 4FCJA 4Q53A 3CXC2 1KSIA 1IQXA 2XGNA 3HZPA 1WQLB 3PYJA 1N5PA 3B4PA 1O7PB 2A15A 1FUWA 1ULIB 2KRTA 3CCQ3 3NV0A 1WMPA 3WDGB 1CYUA 3F9SA 1VZZA 3K0ZA 4XDVA 5CXOA 3MPHA 5BXQA 5IERA 4R9KA 2P0XA 3LOYA 3KN4A 4N6UA 2GBXB 3GZYB 3Q2PA 4HM8B 1E3RA 2INXA 3JUOA 3SVAA 3RGAA 1AR0A 4LSOA 1OF5B 1IVXA 4RBNA 4EV5A 1EG9B 2ZL8A 3UJMA 3LMLA 4WP5A 1SPUA 1DVCA 1D6ZA 1YJ93 4BTXA 1HU9A 1VQM3 1A67A 3CCU3 4EXRA 3DY5A 3LYGA 6STDA 2JQ5A 1NWWA 2MF7A 3EB8A 5AIHA 1O7HB 1O7NB 2HMOB 1YHQ3 1PFPA 1E97A 4FMCA 3CCM3 2HMLB 3SEDA 5EVHA 4HKVB 3HIIA 3EBYA 3I563 1Q824 1JV2B 1AVLA 5CK6A 4AKZA 3ALAA 1W6GA 1FGOA 1M1XB 1N8QA 3FZWA 2Y73A 3EX9A 2YFIB 3F7SA 4X2HA 4HM1B 5FW5A 4PEJA 1JN5B 2STDA 1W2B2 3NXJA 1O7WB 1ZO2A 1M904 4XBTA 4FMAA 3CC73 1KC84 3EN1B 3LT8A 1OPYA 1N9JA 2W03A 5BVBA 1QALA 1FGQA 4EBGA 4IIAA 1OH0A 3LZAA 3NV0B 2CFGA 3PXMA 1GY7A 3N8BA 1S5AA 2BMOB 3FF2A 1KD14 2CG0A 5AEWB 1IT8A 2OWPA 3S29A 2BNGA 4ORLA 2HMJB 1ISKA 3FGYA 2K0MA 2Z7AA 3PCRA 4WWUC 1RN7A 5AI1A 5EQLA 2CWVA 3UNLA 2YFJB 2LQVA 4K1VA 1LVNA 1VQK3 3EQQB 1UI7A 1W01A 4AEQA 1K8A4 2RGQA 3CNMA 3STDA 3G713 3SOYA 1FGRA 4HM4B 3FSDA 4EC6A 1AV4A 1ROAA 1RJOA 3FKAA 3JUNA 4N6TA 1STFI 2W9PA 3KSED 1HKXA 1W00A 3S67A 4HZBB 3NQZA 3X42A 1DYUA 2QGUA 4NHFA 1OF5A 4CDLA 1IQ8A 3DGOA 4RZMA 3SLUA 2HMMB 4HVNA 4MJDA 4O8SA 4RNZA 3G4S3 3CCJ3 3CC43 3BNCA 4H3UA 2E2UA 2HMKB 1IT7A 1GY6A 2F86B 1JB2A 4MMZB 4WHAA 1SIHA 3G6E3 4EYCA 3BLZA 2FXTA 2CFWA 4KVHA 3PZWA 3GRDA 4OK0A 1W2ZA 4N6OB 3RGRA 1JB4A 1ROVA 2CFDA 3OWYA 5IG3A 3JUMA 1OACA 1BUQA 4J8TA 4KFEA 1W6CA 3HK4A 1YGEA 1JN5A 2WGOA 2BMQB 2XFSA 2W56B 4XBYA 2PZVA 2WOHA 3EHCA 1F8NA 3DZLA 1DMMA 4H61A 3Q90A 2OOVC 2OTJ3 1VQO3 1GD3A 3DGLA 1OGZA 3CCS3 1QAKA 2XF3A 1S723 2F98A 3CC23 2XSOB 1YI23 3JVCA 1VQP3 1W02A 3HIGA 2GU3A 4RNYA 1UI8A 3SXXA 2QEX3 1IU7A 2CFLA 1LXEA 2V1LA 5IEPA 3CPW2 2CWTA 4KFFA 1Q42A 3GZXB 1YJW3 3PS8A 3K7CA 4EV2A 3MYTA 1IV7A 5IENA 3H3HA 3CCR3 3NHXA 4FR9A 1IDPA 3G8ZA 1GD4A 2CW9A 3UL6A 1OGXA 3ECFA 2D1WA 1G96A 4HYZA 3SOAA 3WA2X 5IW9A 3MG1A 1U8CB 3CCV3 1A2KA 1QAFA 3GZBA 3OX9A 3QK9A 1CYVA 1O7MB 4MMXB 3O8YA 1WMOA 3KE7A 4R4KA 3EN8A 4OUQA 1VQ53 2XSHB 2GXFA 3V92A 1NB5I 1C7HA 3MKIA 5A0OB 1JKGA 1RRLA 3D9RA 1K41A 1T5YA 4O2HA 3CME3 1Q814 3LXUX 1OUNA 3DXOA 1IK3A 8CHOA 2KCDA 2HMNB 2KXGA 1Q864 3AMOA 1EA2A 4L8PA 3X41A 4KFDA 1GY5A 1W5ZA 4L8OA 3M8CA 4N6MA 3NQYA 5HGRA 1SIIA 4J9AA 5G2GA 3FG1A 2XEPA 2QA43 1Q40B 2W9QA 3S5CA 1US1A 3U97A 3ROBA 4IT7A 2W56A 1UW1A 1N8R4 2BT3A 1KQS2 1NU3A 3EC9A 1TFOA 3WMDA 2O3OA 2XFTA 3I0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 3;  1M1K 4;  1YJN 3;  3I55 3;  1Q86 4;  3CXC 2;  3CCE 3;  1W2B 2;  3G6E 3;  1K8A 4;  3CCV 3;  1VQK 3;  1M90 4;  1QVF 2;  3CD6 3;  1VQ8 3;  3CMA 3;  3CC7 3;  1VQO 3;  1KC8 4;  1VQN 3;  3CCR 3;  1YJ9 3;  3CCQ 3;  3CCS 3;  3G71 3;  1VQM 3;  3CCU 3;  1S72 3;  1K9M 4;  1VQ5 3;  1VQ7 3;  3CC2 3;  1QVG 2;  3CCL 3;  2QA4 3;  1NJI 4;  1YI2 3;  2OTL 3;  1VQ6 3;  1YIJ 3;  1VQP 3;  1VQ9 3;  3CPW 2;  1JJ2 2;  2QEX 3;  2OTJ 3;  1N8R 4;  1VQL 3;  1KQS 2;  1YHQ 3;  3CME 3;  1K73 4;  3CCM 3;  1Q81 4;  1Q7Y 4;  1YJW 3;  3OW2 2;  1KD1 4;  1YIT 3;  3I56 3;  1Q82 4;  3G4S 3;  3CCJ 3;  1VQ4 3; 
#chains in the Genus database with same CATH topology
 1I0X A;  3I55 3;  1BRG A;  5TGN A;  3FG3 A;  2E2V A;  2BHM A;  5JPP A;  4R1K A;  4MEI A;  2WO0 A;  2P38 A;  3BU4 A;  1X1W A;  1W7C A;  2O9U X;  3WOE B;  1RGH A;  2ML5 A;  4HM7 B;  1JBS A;  1I8V A;  2KF6 A;  1I70 A;  3HX8 A;  4FMD A;  4XM4 A;  2Z6B A;  2I9W A;  2RFR A;  1RGG A;  2GU1 A;  3OWS A;  3IMA B;  3S27 A;  1TTO A;  1HZ1 A;  4QWT A;  1VQ7 3;  1OHS A;  3A76 A;  1JNQ A;  3BB9 A;  3FF0 A;  1BIR A;  2MC8 A;  4HM3 B;  9RNT A;  3X40 A;  1R4C A;  3D79 A;  4LZI A;  5M19 A;  4R9L A;  4HZ9 B;  1G0T A;  1D6Y A;  1SJW A;  1NB3 I;  4OVM A;  1G02 A;  3KKG A;  1V58 A;  1RGC A;  4N3V A;  1JKG B;  1B20 A;  1BNR A;  2L1S A;  1RRH A;  2Z76 A;  1K28 A;  2Z77 A;  4XB5 A;  1X1U A;  4BU4 A;  2JDI H;  5IG5 A;  1TP6 A;  1UUV B;  3F7X A;  2PNC A;  2LYX A;  2RCD A;  3FLJ A;  3BIR A;  4BIR A;  2OCT A;  1RGE A;  1DVD A;  3OWU A;  3LTC A;  2FNQ A;  4X2O A;  3AMO B;  4O02 B;  2GSP A;  3X3Z A;  5AIG A;  1DE3 A;  4I5Q A;  4XDW A;  5IG4 A;  3MG3 A;  3CCL 3;  1YGW A;  3KZT A;  4FCM A;  2IMJ A;  4XBX A;  1SAR A;  1VQ9 3;  1MOL A;  3QRD A;  5AII A;  4O3V A;  2L4V A;  3OXA A;  2AAD A;  1VQL 3;  2W04 A;  1K73 4;  3CU3 A;  3D3L A;  3NX0 A;  3DUK A;  3G0K A;  3MWZ A;  5KP3 A;  1Q7Y 4;  2P09 A;  4KT3 B;  4GB5 A;  3T8N A;  3GZR A;  4HAA A;  2W6J H;  4BTW A;  1U5O A;  3JUQ A;  5KP1 A;  1TU5 A;  3T8U A;  1A90 A;  1IVW A;  2IYJ A;  1L5G B;  1FA3 A;  2CIU A;  3PCS A;  2F5W A;  3LTA A;  5JBS A;  2CX0 A;  5DRE A;  4HM2 B;  3URP A;  1O7G B;  1Q40 A;  2K54 A;  3CPO A;  3F14 A;  6RNT A;  3FG4 A;  3D5I A;  2QIY A;  2XRX B;  2IA7 A;  3EF8 A;  3K9M C;  3WOD G;  1NNV A;  1MNL A;  1OHO A;  3S28 A;  1TJD A;  1OHP A;  2B24 B;  3DGN A;  5D83 A;  1QVG 2;  2ML6 A;  2ZA4 A;  1GMR A;  3DMC A;  3UNL A;  1MGW A;  1YVB I;  3GAX A;  3IJE B;  2C10 A;  4KZ1 A;  5STD A;  4AKY A;  1CQS A;  1JRQ A;  1I3I A;  1W4N A;  2XH9 A;  4TX4 A;  3B7C A;  3OV4 A;  1FGT A;  5I97 A;  5LC6 A;  3F8X A;  4K61 A;  3DGM A;  4WYK A;  2WGQ A;  2M7O A;  1YJN 3;  2YX9 A;  4G1M B;  1M9G A;  1EKM A;  3LH4 A;  3MHE A;  4FMB A;  2R4I A;  5IG0 A;  2CC3 A;  1RKY A;  1DET A;  1FYS A;  2BIR A;  3LTB A;  3B4O A;  1CH0 A;  1JBT A;  5AEU B;  1VQ8 3;  1JBR A;  1UCI A;  1BRS A;  2IUJ A;  1CEW I;  1N9E A;  2YFL B;  3V98 A;  1UDI I;  4R80 A;  2J8X B;  1VQQ A;  3J7Y d;  1TIJ A;  5JPU A;  1BAO A;  2UX0 A;  1PYL A;  1JJ2 2;  3A5E A;  3BNE A;  4LGQ A;  1W6Y A;  3F8H A;  1DMQ A;  5AYR B;  1YIT 3;  1AVK A;  3RDE A;  1GS3 A;  3DH2 A;  1ZX2 A;  1IQY A;  3NM2 A;  1IVV A;  2Q07 A;  3BNB A;  3D4A A;  4LEH A;  5G1L A;  2XR8 B;  1UUW B;  3NBB A;  2SBL A;  1TFK A;  3L0R A;  4K90 B;  2KF5 A;  4L7K A;  2BMR B;  2ZDJ A;  2IY2 A;  1VQN 3;  1RN1 A;  5M18 A;  2BO9 B;  5IF6 A;  3EE1 A;  3MSO A;  3G16 A;  1BAN A;  3AHW A;  1K8A 4;  3ZG0 A;  3WOF B;  5RNT A;  2C11 A;  4HJL B;  1LNH A;  1V74 A;  2IUK A;  1NJI 4;  2OTL 3;  4LYL B;  4N6V 0;  2RBI A;  3DM8 A;  4MMY B;  5D81 A;  3AGN A;  3TDG A;  2Y74 A;  4BL2 A;  1OCV A;  3HOH A;  1JB5 A;  3EJV A;  1GYB A;  1ASK A;  1RCK A;  1RMS A;  1LOX A;  1KWI A;  1MWR A;  3B8L A;  1DMN A;  3WA3 A;  3GWR A;  4JF8 A;  3KCH A;  3NUV A;  5EEO A;  3SX1 A;  3V99 A;  4NRE A;  5IEO A;  3KII A;  4I4K A;  5AYS C;  3MG2 A;  3N9H A;  2F99 A;  1V57 A;  1FZU A;  4WYK B;  2RSX A;  3Q1C A;  3UL5 A;  2UGI A;  1WNH A;  4STD A;  1IV9 A;  3T0U A;  3X3X A;  2CHC A;  1Z1S A;  1E3V A;  2B1X B;  1JZD A;  2E2T A;  2P0M A;  3CNX A;  5D82 A;  2OQE A;  4U13 A;  4BTY A;  1TUH A;  1VQP 3;  1BNS A;  1ULJ B;  5CF1 A;  3VGN A;  1N5H A;  3FH1 A;  2OQE C;  4HBR A;  1NDO B;  2GEY A;  3KFQ C;  4K1U A;  3X3Y A;  3UB1 A;  4HM6 B;  3F40 A;  3N54 B;  3ER7 A;  4WFO A;  1VQ4 3;  1A2P A;  1RGK A;  1B2S A;  3K63 A;  1WMN A;  3VSY A;  3CCE 3;  3BND A;  1GMP A;  5DRV A;  3VF1 A;  3HI7 A;  3PGB A;  1D6U A;  1BSC A;  2CG1 A;  4CCV A;  3CMA 3;  1RLS A;  2H0I A;  1BSA A;  1FGM A;  1LRA A;  2W2C A;  3K5T A;  5FGO A;  1YVS A;  3LTD A;  1BVI A;  1BOX A;  5CLK A;  1MWT A;  1UGH I;  1STD A;  1QJG A;  3KSP A;  1VQ6 3;  1RN4 A;  1BRN L;  1IYY A;  3H51 A;  5LC7 A;  4HM0 B;  4N6L A;  3NM7 A;  1EQK A;  2D42 A;  4JRF A;  2CWU A;  3E99 A;  3IPT A;  1J2B A;  3U1W A;  2GEX A;  3EBT A;  2CH9 A;  1BRK A;  2P05 A;  4IPB A;  1BSB A;  1R4Y A;  1SQW A;  4GL6 A;  5ELU A;  1WTH A;  1Y4K A;  4LMI A;  3NBJ A;  4ZM8 A;  1QVF 2;  3CD6 3;  1BUJ A;  1A2V A;  1GSP A;  4HOH A;  1EEJ A;  2FGT A;  4N6N B;  1IVU A;  3LT9 A;  1QMA A;  1MWS A;  2XGL A;  3JUP A;  4HM5 B;  1K9M 4;  1RNB A;  1BNE A;  2WOF A;  1YIJ 3;  5KP4 A;  2CKF B;  2H0G A;  1GOY A;  1FW7 A;  3NBR A;  7STD A;  5ELJ A;  2W0Q A;  5CF2 A;  3FCS B;  2ZHX B;  3OW2 2;  1PU4 A;  5AIF A;  2CK3 H;  1NO3 A;  2GBW B;  2OOV A;  1M1K 4;  1LQG C;  2CFK A;  4FCZ A;  4FCJ A;  4Q53 A;  3CXC 2;  3ZG5 A;  1KSI A;  1IQX A;  2XGN A;  3HZP A;  1WQL B;  3PYJ A;  1N5P A;  3RNT A;  1O7P B;  2A15 A;  3B4P A;  8RNT A;  1FUW A;  1ULI B;  2KRT A;  3CCQ 3;  3NV0 A;  1YNV X;  1WMP A;  3WDG B;  1CYU A;  3F9S A;  1VZZ A;  3K0Z A;  4XDV A;  5CXO A;  1BRH A;  3MPH A;  5BXQ A;  5IER A;  1T2I A;  4R9K A;  2P0X A;  3LOY A;  3KN4 A;  1I0V A;  4N6U A;  2GBX B;  3GZY B;  3Q2P A;  4HM8 B;  1E3R A;  2INX A;  3JUO A;  3SVA A;  3RGA A;  1AQZ A;  1AR0 A;  4LSO A;  4J5G A;  1OF5 B;  1IVX A;  4RBN A;  4EV5 A;  1EG9 B;  2ZL8 A;  2KF4 A;  3UJM A;  3LML A;  4WP5 A;  1SPU A;  7GSP A;  1DVC A;  1D6Z A;  1YJ9 3;  4BTX A;  2F4Y A;  1HU9 A;  2F5M A;  1I3F A;  1VQM 3;  1A67 A;  6GSP A;  3CCU 3;  4EXR A;  3DY5 A;  3LYG A;  6STD A;  2JQ5 A;  1NWW A;  2MF7 A;  3EB8 A;  5AIH A;  1O7H B;  1O7N B;  1GOV A;  2HMO B;  1TRQ A;  1YHQ 3;  1I2F A;  1E97 A;  1PFP A;  4FMC A;  2HML B;  3SED A;  3CCM 3;  5EVH A;  4HKV B;  3HII A;  3EBY A;  3I56 3;  1Q82 4;  1JV2 B;  1AVL A;  1RNT A;  5CK6 A;  4AKZ A;  3ALA A;  1W6G A;  1FGO A;  1M1X B;  1N8Q A;  3FZW A;  2Y73 A;  3EX9 A;  2YFI B;  3F7S A;  4GSP A;  1RHL A;  4HM1 B;  4PEJ A;  1JN5 B;  2STD A;  4X2H A;  1W2B 2;  3NXJ A;  1O7W B;  1ZO2 A;  1RCL A;  4XBT A;  1M90 4;  1LNI A;  4FMA A;  1B2U A;  2H0H A;  3CC7 3;  1KC8 4;  1ZS7 A;  7RNT A;  3EN1 B;  3LT8 A;  1OPY A;  1MGR A;  1N9J A;  2UUG C;  1EUI C;  2W03 A;  5BVB A;  1QAL A;  1FGQ A;  4EBG A;  4IIA A;  1OH0 A;  3LZA A;  1UGI A;  4GHO A;  3NV0 B;  1Q9E A;  2CFG A;  3PXM A;  1GY7 A;  2F56 A;  1S5A A;  3N8B A;  2BMO B;  3FF2 A;  1KD1 4;  3AHS A;  2CG0 A;  5AEW B;  1IT8 A;  2OWP A;  3S29 A;  2BNG A;  4ORL A;  2HMJ B;  1ISK A;  3FGY A;  2K0M A;  2Z7A A;  3PCR A;  4WWU C;  1RN7 A;  5AI1 A;  5EQL A;  2CWV A;  5GSP A;  3WHO A;  2YFJ B;  1X1X A;  2LQV A;  4K1V A;  1LVN A;  5BIR A;  3EQQ B;  1UI7 A;  1W01 A;  1B3S A;  4AEQ A;  1VQK 3;  2RGQ A;  3CNM A;  2RNT A;  3STD A;  3Q3F A;  3G71 3;  3SOY A;  1FGR A;  4HM4 B;  3FSD A;  5G1K A;  1AV4 A;  1ROA A;  1RJO A;  3FKA A;  2CX1 A;  3JUN A;  1RTU A;  4N6T A;  1STF I;  2W9P A;  3KSE D;  3WR2 A;  1HKX A;  1I2G A;  1T2H A;  1W00 A;  4HZB B;  3S67 A;  3NQZ A;  3DGY A;  3X42 A;  1B21 A;  1DYU A;  2QGU A;  4NHF A;  1OF5 A;  4CDL A;  1IQ8 A;  1LQM B;  3DGO A;  4RZM A;  1FUT A;  2HMM B;  4J5K A;  4HVN A;  3SLU A;  5BU4 A;  4MJD A;  4O8S A;  4RNZ A;  3G4S 3;  3CCJ 3;  3CC4 3;  3BNC A;  4H3U A;  1HYF A;  2E2U A;  1BRJ A;  1IT7 A;  1GY6 A;  2HMK B;  2F86 B;  1JB2 A;  4MMZ B;  4WHA A;  1SIH A;  3G6E 3;  4EYC A;  3BLZ A;  2FXT A;  2CFW A;  4KVH A;  3PZW A;  3GRD A;  4OK0 A;  1W2Z A;  4N6O B;  3RGR A;  1JB4 A;  1B27 A;  1LOY A;  1ROV A;  2CFD A;  3OWY A;  5IG3 A;  1RGA A;  1OAC A;  2K3D A;  3JUM A;  1BUQ A;  4J8T A;  4KFE A;  1W6C A;  3HK4 A;  1YGE A;  1JN5 A;  2WGO A;  2BMQ B;  2XFS A;  1B2X A;  2HOH A;  2W56 B;  4XBY A;  5M1A A;  2PZV A;  2WOH A;  3EHC A;  2BU4 A;  1F8N A;  1BRI A;  1PY3 A;  3DZL A;  5FW5 A;  1DMM A;  1UUG B;  1BSE A;  1RDS A;  2OOV C;  3Q90 A;  1GOU A;  4H61 A;  1VQO 3;  2OTJ 3;  1GD3 A;  3DGL A;  1OGZ A;  1UCL A;  3CCS 3;  1QAK A;  1BNI A;  2XF3 A;  4DKI A;  3SYU A;  1S72 3;  2F98 A;  4RNT A;  3CC2 3;  2XSO B;  1YI2 3;  3D5G A;  4CPK A;  3JVC A;  1AY7 A;  1W02 A;  3HIG A;  2GU3 A;  4RNY A;  1UI8 A;  3SXX A;  2QEX 3;  1IU7 A;  2CFL A;  1LXE A;  2V1L A;  5IEP A;  3CPW 2;  2CWT A;  4KFF A;  1BU4 A;  1Q42 A;  1UCJ A;  3GZX B;  1YJW 3;  3PS8 A;  3K7C A;  4EV2 A;  3MYT A;  1IV7 A;  3GSP A;  3H3H A;  5IEN A;  3NHX A;  4FR9 A;  1IDP A;  3G8Z A;  1GD4 A;  2KAA A;  3CCR 3;  2CW9 A;  3UL6 A;  1OGX A;  3ECF A;  1RGF A;  1G96 A;  2D1W A;  4HYZ A;  3SOA A;  3WA2 X;  5IW9 A;  3AGO A;  3MG1 A;  3ZFZ A;  1U8C B;  3CCV 3;  1A2K A;  1QAF A;  1Q7H A;  1T3B A;  3GZB A;  3OX9 A;  3QK9 A;  1JZO A;  1CYV A;  1O7M B;  4MMX B;  5HOH A;  2C4B A;  1TRP A;  3O8Y A;  1WMO A;  3KE7 A;  4R4K A;  3EN8 A;  4OUQ A;  1BGS A;  1BNF A;  1LOW A;  2XSH B;  1VQ5 3;  2GXF A;  2KF3 A;  3V92 A;  1NB5 I;  1C7H A;  1RSN A;  3MKI A;  5A0O B;  1I2E A;  1JKG A;  1RRL A;  1FUS A;  3D9R A;  1K41 A;  4ILF A;  1T5Y A;  4O2H A;  3CME 3;  1X1Y A;  1Q81 4;  3LXU X;  1BNG A;  1OUN A;  1UCK A;  3DXO A;  1IK3 A;  4CJN A;  1ZGX A;  8CHO A;  2KCD A;  2HMN B;  2KXG A;  1Q86 4;  1MWU A;  3AMO A;  1EA2 A;  4L8P A;  3X41 A;  4KFD A;  2SAR A;  1GY5 A;  4NPB A;  4EC6 A;  1W5Z A;  4L8O A;  1B2Z A;  3M8C A;  4N6M A;  1BSD A;  3NQY A;  5HGR A;  1SII A;  4J9A A;  4EW5 A;  5G2G A;  1C54 A;  1GMQ A;  3FG1 A;  2XEP A;  2R41 A;  1BNJ A;  2QA4 3;  1Q40 B;  2AAE A;  2W9Q A;  3S5C A;  1US1 A;  3U97 A;  4BL3 A;  3ROB A;  4IT7 A;  2W56 A;  1UW1 A;  1N8R 4;  2BT3 A;  1KQS 2;  1NU3 A;  3EC9 A;  1LOV A;  1TFO A;  3WMD A;  2O3O A;  2XFT A;  1B2M A;  1RGL A;  3I0Y A; 
#chains in the Genus database with same CATH homology
 3I55 3;  5TGN A;  3FG3 A;  2E2V A;  2BHM A;  5JPP A;  4R1K A;  4MEI A;  2WO0 A;  2P38 A;  2O9U X;  1W7C A;  3WOE B;  2ML5 A;  4HM7 B;  3HX8 A;  4FMD A;  4XM4 A;  2Z6B A;  2I9W A;  2RFR A;  2GU1 A;  3S27 A;  3OWS A;  3IMA B;  1VQ7 3;  4QWT A;  1OHS A;  3A76 A;  1JNQ A;  3BB9 A;  3FF0 A;  2MC8 A;  4HM3 B;  3X40 A;  1R4C A;  4LZI A;  4R9L A;  4HZ9 B;  1SJW A;  1D6Y A;  1NB3 I;  4OVM A;  3KKG A;  4N3V A;  1JKG B;  1RRH A;  2Z76 A;  1K28 A;  2Z77 A;  4XB5 A;  2JDI H;  5IG5 A;  1TP6 A;  1UUV B;  3F7X A;  2PNC A;  2LYX A;  2RCD A;  3FLJ A;  2OCT A;  1DVD A;  3OWU A;  3LTC A;  2FNQ A;  4X2O A;  3AMO B;  4O02 B;  3X3Z A;  5AIG A;  4XDW A;  5IG4 A;  3MG3 A;  3CCL 3;  3KZT A;  4FCM A;  2IMJ A;  4XBX A;  1VQ9 3;  1MOL A;  3QRD A;  5AII A;  4O3V A;  2L4V A;  3OXA A;  1VQL 3;  2W04 A;  1K73 4;  3CU3 A;  3D3L A;  3NX0 A;  3DUK A;  3G0K A;  3MWZ A;  5KP3 A;  1Q7Y 4;  2P09 A;  4GB5 A;  3T8N A;  3GZR A;  4BTW A;  2W6J H;  5KP1 A;  1U5O A;  3JUQ A;  1TU5 A;  1A90 A;  3T8U A;  1IVW A;  1L5G B;  1FA3 A;  2CIU A;  3PCS A;  3LTA A;  5JBS A;  5DRE A;  4HM2 B;  1O7G B;  1Q40 A;  2K54 A;  3CPO A;  3F14 A;  3FG4 A;  2QIY A;  2XRX B;  2IA7 A;  3EF8 A;  3K9M C;  3WOD G;  1MNL A;  1OHO A;  3S28 A;  1OHP A;  2B24 B;  3DGN A;  5D83 A;  1QVG 2;  2ML6 A;  3DMC A;  1YVB I;  3IJE B;  3GAX A;  4KZ1 A;  2C10 A;  5STD A;  4AKY A;  1CQS A;  1JRQ A;  1W4N A;  2XH9 A;  4TX4 A;  3B7C A;  3OV4 A;  1FGT A;  5I97 A;  5LC6 A;  3F8X A;  4K61 A;  3DGM A;  4WYK A;  2WGQ A;  2M7O A;  1YJN 3;  2YX9 A;  4G1M B;  1M9G A;  1EKM A;  3LH4 A;  3MHE A;  4FMB A;  2R4I A;  5IG0 A;  2CC3 A;  1RKY A;  3LTB A;  3B4O A;  1VQ8 3;  5AEU B;  2IUJ A;  1CEW I;  1N9E A;  2YFL B;  3V98 A;  4R80 A;  3J7Y d;  1TIJ A;  5JPU A;  2UX0 A;  1JJ2 2;  4LGQ A;  3BNE A;  1W6Y A;  3F8H A;  1DMQ A;  5AYR B;  1YIT 3;  1AVK A;  3RDE A;  1GS3 A;  1ZX2 A;  1IQY A;  3NM2 A;  1IVV A;  2Q07 A;  3BNB A;  4LEH A;  2XR8 B;  1UUW B;  3NBB A;  2SBL A;  1TFK A;  3L0R A;  4K90 B;  4L7K A;  2BMR B;  2ZDJ A;  1VQN 3;  2BO9 B;  5IF6 A;  3EE1 A;  3MSO A;  3G16 A;  3WOF B;  2C11 A;  4HJL B;  1LNH A;  1V74 A;  2IUK A;  1NJI 4;  2OTL 3;  4N6V 0;  3DM8 A;  4MMY B;  5D81 A;  3TDG A;  2Y74 A;  1OCV A;  1JB5 A;  3EJV A;  1GYB A;  1ASK A;  1LOX A;  1KWI A;  3B8L A;  1DMN A;  3WA3 A;  3GWR A;  4JF8 A;  3NUV A;  5EEO A;  3SX1 A;  3V99 A;  4NRE A;  5IEO A;  3KII A;  4I4K A;  5AYS C;  3MG2 A;  3N9H A;  2F99 A;  4WYK B;  2RSX A;  3Q1C A;  3UL5 A;  1WNH A;  4STD A;  1IV9 A;  3T0U A;  3X3X A;  2CHC A;  1Z1S A;  1E3V A;  2B1X B;  2P0M A;  2E2T A;  3CNX A;  5D82 A;  2OQE A;  4BTY A;  4U13 A;  1TUH A;  1ULJ B;  5CF1 A;  3VGN A;  1N5H A;  3FH1 A;  2OQE C;  4HBR A;  1NDO B;  2GEY A;  3KFQ C;  4K1U A;  3X3Y A;  3UB1 A;  4HM6 B;  3F40 A;  3N54 B;  3ER7 A;  4WFO A;  1VQ4 3;  3K63 A;  1WMN A;  3VSY A;  3CCE 3;  3BND A;  5DRV A;  3VF1 A;  3HI7 A;  3PGB A;  1D6U A;  2CG1 A;  4CCV A;  3CMA 3;  1FGM A;  3K5T A;  2W2C A;  5FGO A;  3LTD A;  5CLK A;  1STD A;  1QJG A;  3KSP A;  1VQ6 3;  3H51 A;  5LC7 A;  4HM0 B;  4N6L A;  3NM7 A;  1EQK A;  2D42 A;  4JRF A;  2CWU A;  3E99 A;  3IPT A;  1J2B A;  3U1W A;  2GEX A;  3EBT A;  2CH9 A;  2P05 A;  4IPB A;  1SQW A;  4GL6 A;  5ELU A;  1WTH A;  1Y4K A;  4LMI A;  3NBJ A;  4ZM8 A;  1QVF 2;  3CD6 3;  1A2V A;  2FGT A;  4N6N B;  1IVU A;  3LT9 A;  1QMA A;  4HM5 B;  2XGL A;  3JUP A;  1K9M 4;  2WOF A;  1YIJ 3;  5KP4 A;  2CKF B;  3NBR A;  7STD A;  5ELJ A;  2W0Q A;  5CF2 A;  3FCS B;  3OW2 2;  1PU4 A;  5AIF A;  2CK3 H;  1NO3 A;  2GBW B;  2OOV A;  1M1K 4;  2CFK A;  4FCZ A;  4FCJ A;  4Q53 A;  3CXC 2;  1KSI A;  1IQX A;  2XGN A;  3HZP A;  1WQL B;  3PYJ A;  1N5P A;  3B4P A;  1O7P B;  2A15 A;  1FUW A;  1ULI B;  2KRT A;  3CCQ 3;  3NV0 A;  1WMP A;  3WDG B;  1CYU A;  3F9S A;  1VZZ A;  3K0Z A;  4XDV A;  5CXO A;  3MPH A;  5BXQ A;  5IER A;  4R9K A;  2P0X A;  3LOY A;  3KN4 A;  4N6U A;  2GBX B;  3GZY B;  3Q2P A;  4HM8 B;  1E3R A;  2INX A;  3JUO A;  3SVA A;  3RGA A;  1AR0 A;  4LSO A;  1OF5 B;  1IVX A;  4RBN A;  4EV5 A;  1EG9 B;  2ZL8 A;  3UJM A;  3LML A;  4WP5 A;  1SPU A;  1DVC A;  1D6Z A;  1YJ9 3;  4BTX A;  1HU9 A;  1VQM 3;  1A67 A;  3CCU 3;  4EXR A;  3DY5 A;  3LYG A;  6STD A;  2JQ5 A;  1NWW A;  2MF7 A;  3EB8 A;  5AIH A;  1O7H B;  1O7N B;  2HMO B;  1YHQ 3;  1PFP A;  1E97 A;  4FMC A;  3CCM 3;  2HML B;  3SED A;  5EVH A;  4HKV B;  3HII A;  3EBY A;  3I56 3;  1Q82 4;  1JV2 B;  1AVL A;  5CK6 A;  4AKZ A;  3ALA A;  1W6G A;  1FGO A;  1M1X B;  1N8Q A;  3FZW A;  2Y73 A;  3EX9 A;  2YFI B;  3F7S A;  4X2H A;  4HM1 B;  5FW5 A;  4PEJ A;  1JN5 B;  2STD A;  1W2B 2;  3NXJ A;  1O7W B;  1ZO2 A;  1M90 4;  4XBT A;  4FMA A;  3CC7 3;  1KC8 4;  3EN1 B;  3LT8 A;  1OPY A;  1N9J A;  2W03 A;  5BVB A;  1QAL A;  1FGQ A;  4EBG A;  4IIA A;  1OH0 A;  3LZA A;  3NV0 B;  2CFG A;  3PXM A;  1GY7 A;  3N8B A;  1S5A A;  2BMO B;  3FF2 A;  1KD1 4;  2CG0 A;  5AEW B;  1IT8 A;  2OWP A;  3S29 A;  2BNG A;  4ORL A;  2HMJ B;  1ISK A;  3FGY A;  2K0M A;  2Z7A A;  3PCR A;  4WWU C;  1RN7 A;  5AI1 A;  5EQL A;  2CWV A;  3UNL A;  2YFJ B;  2LQV A;  4K1V A;  1LVN A;  1VQK 3;  3EQQ B;  1UI7 A;  1W01 A;  4AEQ A;  1K8A 4;  2RGQ A;  3CNM A;  3STD A;  3G71 3;  3SOY A;  1FGR A;  4HM4 B;  3FSD A;  4EC6 A;  1AV4 A;  1ROA A;  1RJO A;  3FKA A;  3JUN A;  4N6T A;  1STF I;  2W9P A;  3KSE D;  1HKX A;  1W00 A;  3S67 A;  4HZB B;  3NQZ A;  3X42 A;  1DYU A;  2QGU A;  4NHF A;  1OF5 A;  4CDL A;  1IQ8 A;  3DGO A;  4RZM A;  3SLU A;  2HMM B;  4HVN A;  4MJD A;  4O8S A;  4RNZ A;  3G4S 3;  3CCJ 3;  3CC4 3;  3BNC A;  4H3U A;  2E2U A;  2HMK B;  1IT7 A;  1GY6 A;  2F86 B;  1JB2 A;  4MMZ B;  4WHA A;  1SIH A;  3G6E 3;  4EYC A;  3BLZ A;  2FXT A;  2CFW A;  4KVH A;  3PZW A;  3GRD A;  4OK0 A;  1W2Z A;  4N6O B;  3RGR A;  1JB4 A;  1ROV A;  2CFD A;  3OWY A;  5IG3 A;  3JUM A;  1OAC A;  1BUQ A;  4J8T A;  4KFE A;  1W6C A;  3HK4 A;  1YGE A;  1JN5 A;  2WGO A;  2BMQ B;  2XFS A;  2W56 B;  4XBY A;  2PZV A;  2WOH A;  3EHC A;  1F8N A;  3DZL A;  1DMM A;  4H61 A;  3Q90 A;  2OOV C;  2OTJ 3;  1VQO 3;  1GD3 A;  3DGL A;  1OGZ A;  3CCS 3;  1QAK A;  2XF3 A;  1S72 3;  2F98 A;  3CC2 3;  2XSO B;  1YI2 3;  3JVC A;  1VQP 3;  1W02 A;  3HIG A;  2GU3 A;  4RNY A;  1UI8 A;  3SXX A;  2QEX 3;  1IU7 A;  2CFL A;  1LXE A;  2V1L A;  5IEP A;  3CPW 2;  2CWT A;  4KFF A;  1Q42 A;  3GZX B;  1YJW 3;  3PS8 A;  3K7C A;  4EV2 A;  3MYT A;  1IV7 A;  5IEN A;  3H3H A;  3CCR 3;  3NHX A;  4FR9 A;  1IDP A;  3G8Z A;  1GD4 A;  2CW9 A;  3UL6 A;  1OGX A;  3ECF A;  2D1W A;  1G96 A;  4HYZ A;  3SOA A;  3WA2 X;  5IW9 A;  3MG1 A;  1U8C B;  3CCV 3;  1A2K A;  1QAF A;  3GZB A;  3OX9 A;  3QK9 A;  1CYV A;  1O7M B;  4MMX B;  3O8Y A;  1WMO A;  3KE7 A;  4R4K A;  3EN8 A;  4OUQ A;  1VQ5 3;  2XSH B;  2GXF A;  3V92 A;  1NB5 I;  1C7H A;  3MKI A;  5A0O B;  1JKG A;  1RRL A;  3D9R A;  1K41 A;  1T5Y A;  4O2H A;  3CME 3;  1Q81 4;  3LXU X;  1OUN A;  3DXO A;  1IK3 A;  8CHO A;  2KCD A;  2HMN B;  2KXG A;  1Q86 4;  3AMO A;  1EA2 A;  4L8P A;  3X41 A;  4KFD A;  1GY5 A;  1W5Z A;  4L8O A;  3M8C A;  4N6M A;  3NQY A;  5HGR A;  1SII A;  4J9A A;  5G2G A;  3FG1 A;  2XEP A;  2QA4 3;  1Q40 B;  2W9Q A;  3S5C A;  1US1 A;  3U97 A;  3ROB A;  4IT7 A;  2W56 A;  1UW1 A;  1N8R 4;  2BT3 A;  1KQS 2;  1NU3 A;  3EC9 A;  1TFO A;  3WMD A;  2O3O A;  2XFT A;  3I0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...