1TRQA

X-ray crystallographic and calorimeric studies of the effects of the mutation trp 59 tyr in ribonuclease t1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title X-ray crystallographic and calorimetric studies of the effects of the mutation Trp59-->Tyr in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 22
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1trqA00
1BNGA 1RN1A 3AGOA 1RHLA 1RGAA 1B2ZA 1BSAA 1BVIA 1BNIA 2BU4A 3BU4A 3D4AA 1LRAA 1B20A 1UCKA 2HOHA 1FZUA 1TRPA 1JBRA 2GSPA 1RNBA 1LNIA 1I3IA 1MGWA 1B2SA 1C54A 1GOVA 1FYSA 1GOUA 1I0XA 1LOVA 5BIRA 1X1UA 5RNTA 1JBSA 1I8VA 1BAOA 1I70A 5HOHA 1BUJA 1B3SA 1I2EA 1PYLA 1BNFA 3DGYA 1FUSA 1RCLA 2F5MA 1AY7A 2KAAA 3A5EA 1BSBA 1G02A 3HOHA 7RNTA 1BSEA 1UCJA 1BRJA 2F56A 1A2PA 1RGHA 1BRKA 1BRIA 1UCIA 3AHWA 3Q3FA 1X1WA 3AGNA 1AQZA 4HOHA 5GSPA 1GOYA 3KCHA 1RLSA 2RBIA 1LOYA 4GSPA 4BU4A 9RNTA 1T2HA 3RNTA 1ZGXA 1B2MA 6RNTA 4J5KA 2AAEA 1BSDA 3D5GA 7GSPA 1B21A 1YNVX 1BOXA 3D5IA 1RGLA 1I2GA 1YVSA 1X1XA 1MGRA 2ZA4A 3WHOA 1CH0A 1BRSA 1HYFA 1BU4A 2AADA 3DH2A 2SARA 1GMQA 1GSPA 1BGSA 3BIRA 1DETA 1BSCA 4BIRA 1RGGA 8RNTA 1RGEA 3SYUA 1SARA 1IYYA 1RTUA 3AHSA 2KF5A 1DE3A 6GSPA 4RNTA 4GHOA 1HZ1A 1I2FA 1TRQA 1RCKA 1GMRA 1BNSA 1FUTA 1GMPA 1BRNL 1R4YA 1I3FA 1RGFA 1RNTA 1BRHA 2F5WA 1YGWA 1RDSA 3GSPA 1UCLA 1BIRA 5BU4A 1B2XA 1B2UA 1BNEA 2KF3A 1BNJA 1LOWA 1RN4A 1I0VA 1RSNA 1RGKA 1BRGA 1Q9EA 2KF6A 1JBTA 2C4BA 2RNTA 3WR2A 1TTOA 1B27A 4J5GA 1RMSA 4HAAA 1T2IA 2F4YA 3URPA 1RGCA 1PY3A 1X1YA 2BIRA 2KF4A 1FW7A 1BNRA 1BANA
chains in the Genus database with same CATH superfamily
1RN1A 5CXOA 4GL6A 3MYTA 1RHLA 1RGAA 3EBTA 1WMPA 5AIGA 5JPUA 1V58A 1Z1SA 4LZIA 1UCKA 1YIT3 3LYGA 3IPTA 1EA2A 3DUKA 1M1XB 3CCU3 3NM7A 3X41A 4OUQA 3V92A 1YI23 1RNBA 2D1WA 1K9M4 1A90A 4XBYA 3CPOA 1W01A 3OWSA 5BIRA 2YFIB 1DMNA 3OWYA 4HM0B 5I97A 1HU9A 1X1UA 5KP4A 1JBSA 2Y74A 2W04A 2W9QA 1M9GA 2XFTA 5HOHA 1IU7A 1NU3A 1PYLA 1BNFA 3DGYA 3Q2PA 4XB5A 4FMDA 3VF1A 1S5AA 1RCLA 1VZZA 4U13A 2F5MA 3X40A 1UI8A 1O7WB 1BSBA 3GAXA 7RNTA 3B8LA 2M7OA 1FA3A 1BSEA 1GY5A 1JZDA 3HI7A 4XM4A 4EBGA 3CCV3 1W6CA 3MHEA 1A2PA 1LQMB 4L8PA 3G4S3 2L1SA 2Q07A 2XR8B 4HM6B 1UI7A 3J7Yd 5BXQA 3BNBA 2A15A 2RBIA 3ECFA 4TX4A 1LOYA 1OCVA 2ZHXB 4GSPA 2FGTA 1N9EA 1WMNA 4GB5A 1ZGXA 4NREA 6RNTA 2FXTA 1W6YA 2YFLB 3E99A 3LXUX 3O8YA 1YNVX 3D5IA 3F14A 1SPUA 4O02B 1QVG2 2UUGC 1N5PA 2GU1A 2XSHB 3M8CA 5IG0A 2CWVA 3F9SA 3ZFZA 3GZBA 3MG1A 3LTCA 2CH9A 4FMBA 3SLUA 1CYVA 2OOVC 3LT8A 1VQL3 1JZOA 3SVAA 2XEPA 5M1AA 2ML5A 1FGTA 1GMQA 3JUPA 1BGSA 5JPPA 2HMJB 2P0MA 4JRFA 1VQK3 4O2HA 2PZVA 1ISKA 1JJ22 2H0GA 1RGGA 3N9HA 1TUHA 4R9LA 8RNTA 3CCM3 3FCSB 3JVCA 4HZBB 3DGNA 5ELJA 1WNHA 2IMJA 3DM8A 2F98A 2IUKA 3OV4A 3ROBA 1O7HB 3WOFB 4WFOA 1K41A 1ZS7A 4K61A 4BL3A 3DXOA 8CHOA 6GSPA 1YVBI 2WO0A 2XGNA 1TU5A 1GY7A 4GHOA 4WWUC 1TRQA 1I2FA 2WGQA 3LZAA 1RRHA 2YFJB 2XH9A 4WYKA 1LXEA 2ML6A 1N8QA 3DGMA 2CX0A 1E97A 2F5WA 3CNMA 3EE1A 2E2VA 1JB4A 3LMLA 1QALA 1V74A 3I553 1B2UA 1BNEA 1OUNA 3ALAA 1N8R4 2CG1A 1M904 1AVLA 4O3VA 1ASKA 1BRGA 1FGQA 2OTL3 3ZG0A 1Q9EA 2QA43 3K9MC 1MWRA 5AIHA 4KZ1A 2XRXB 2BMOB 5CK6A 5M18A 1Q7Y4 4LGQA 3MPHA 1IDPA 1T2IA 4STDA 5DRVA 3I563 1PY3A 1ZX2A 2KRTA 2BIRA 2KF4A 4H61A 4EYCA 4H3UA 2CFKA 4J8TA 5BVBA 1TFOA 1BANA 3BB9A 1KWIA 3AGOA 3S67A 2F99A 5LC6A 2BMQB 4R9KA 2STDA 2XGLA 2BU4A 3D4AA 4HM7B 1B20A 1US1A 3WMDA 4ORLA 5D83A 5AYRB 2BMRB 3MG3A 1TRPA 2W0QA 3PZWA 4RNZA 1JBRA 1UUGB 1BUQA 2GSPA 1A2VA 4MMXB 3V98A 3EHCA 2CKFB 1MGWA 2LYXA 5FGOA 5G2GA 3CXC2 4R4KA 4AKYA 1VQ83 2OQEC 1FYSA 1GOUA 1LOVA 4NHFA 2F86B 2GXFA 4K1UA 1I8VA 1BAOA 1NB5I 2K0MA 1BUJA 4PEJA 1Q814 4FR9A 3LTDA 3MG2A 2MC8A 2B1XB 1CEWI 4KFFA 5STDA 1K28A 3HOHA 3GZXB 3A5EA 2RFRA 3RDEA 1FUWA 3STDA 3LT9A 1W7CA 1KQS2 1ROVA 2GBWB 3WDGB 1F8NA 4CPKA 1W6GA 2Z6BA 1VQQA 1RGHA 1JKGA 1BRKA 2JQ5A 1BRIA 1ULIB 3AHWA 4FMAA 4N6V0 1W5ZA 1AQZA 1SIIA 4AEQA 1RLSA 6STDA 5TGNA 4BU4A 9RNTA 1JNQA 1RKYA 3TDGA 4OVMA 4MJDA 3OW22 3G8ZA 3D5GA 4L7KA 1BOXA 1SIHA 2KXGA 1YVSA 1I2GA 3DGOA 1JN5B 2OTJ3 3BNEA 5FW5A 2ZA4A 2GEXA 1LVNA 1CH0A 2CFGA 1KD14 1Q42A 1BRSA 3IJEB 4IIAA 3UL5A 4DKIA 3CC73 1HYFA 1QAFA 3S29A 2WOHA 1AVKA 2AADA 4HM4B 1VQN3 2OWPA 3S28A 2BHMA 1O7GB 3OX9A 4KFEA 1BSCA 2CIUA 3FG3A 1EQKA 4BTYA 1UW1A 1W02A 3HX8A 1JV2B 2W56A 1K734 5EQLA 3WODG 1G96A 1GD3A 1Q40B 1OF5A 2R4IA 1D6YA 1NB3I 1Q864 1Q824 3KE7A 3AHSA 3PYJA 1DE3A 3ER7A 3L0RA 2QGUA 5AIFA 3NQZA 5IG3A 4RNTA 1HZ1A 3X3XA 3NBRA 1PU4A 2CK3H 4EV5A 5KP3A 1BNSA 4AKZA 4XDVA 1R4CA 1BRNL 2PNCA 1R4YA 3AMOB 3PXMA 3F7SA 4FCMA 2W2CA 1BRHA 3Q1CA 4EXRA 1YGWA 3CD63 3GSPA 3NBJA 1YIJ3 3V99A 3BNCA 3OXAA 3EB8A 4N6OB 1Y4KA 2K3DA 3A76A 1B2XA 1OHPA 5D82A 5ELUA 2HMMB 3F7XA 1VQ43 4Q53A 5KP1A 2Z7AA 1S723 2P09A 1RSNA 1A67A 1D6UA 2ZDJA 2WOFA 3T8NA 1IVVA 3CME3 1W2B2 1JBTA 3GZRA 2C4BA 1NWWA 2RNTA 5AEUB 3QK9A 5CF1A 1SJWA 3DMCA 3FGYA 2P0XA 1UGIA 2CX1A 3WA2X 4XBXA 4HAAA 3URPA 2F4YA 1KC84 3KZTA 1X1YA 2P38A 3NV0B 3FZWA 1T5YA 3PGBA 1FW7A 1BNGA 2BO9B 3RGAA 1UGHI 2OOVA 4HKVB 5IF6A 4WHAA 5DREA 1IV9A 1B2ZA 3U97A 1BNIA 2HMKB 3H3HA 1LRAA 1QJGA 2Z76A 2K54A 1IT7A 4N6TA 3U1WA 1JB5A 2I9WA 1OHSA 3EQQB 4HM2B 4R80A 3G713 1HKXA 2B24B 4HZ9B 3OWUA 1SQWA 1B3SA 1I2EA 1G0TA 3CNXA 3EN1B 3D3LA 4FCJA 2CFLA 3NXJA 2C11A 4LMIA 3CU3A 4NPBA 3X3ZA 1QAKA 1DVDA 2H0IA 1EKMA 3KSPA 4KT3B 1AY7A 1GD4A 5IEPA 1G02A 5D81A 3RGRA 2UGIA 1E3RA 4N6UA 1WMOA 3CCE3 3EN8A 1UCJA 2F56A 1O7NB 3KFQC 3CCL3 3Q3FA 4BL2A 1YJN3 1IVUA 1X1WA 3AGNA 1NO3A 1N9JA 3FKAA 2H0HA 4HYZA 4ILFA 1L5GB 3CC43 1GOYA 1W2ZA 3KCHA 5AYSC 1O7PB 1IQXA 1RJOA 5EEOA 1LOXA 2XF3A 1DYUA 1GYBA 3FSDA 1WTHA 4J5KA 1BSDA 1B21A 3K63A 4I4KA 3AMOA 4HVNA 1RGLA 1QVF2 1DMMA 1STFI 3K5TA 1D6ZA 1VQ53 4N3VA 2KCDA 1M1K4 5A0OB 1BU4A 1MWSA 4QWTA 3DH2A 5JBSA 2P05A 4FCZA 1VQM3 2V1LA 3B4OA 2E2TA 4OK0A 3HIIA 5AIIA 3BIRA 2J8XB 3X3YA 1T3BA 3G16A 4BTWA 1DETA 4EW5A 3F8XA 4BIRA 3H51A 2IYJA 4N6MA 4CCVA 2CHCA 3Q90A 1RGEA 3JUNA 4X2HA 2OQEA 1SARA 3NV0A 1IYYA 2CFWA 3NHXA 3CMA3 3VSYA 2INXA 2RCDA 2WGOA 1JRQA 3EF8A 1RRLA 3KIIA 2R41A 4KFDA 1E3VA 4WP5A 1FGMA 1J2BA 3G6E3 3BNDA 2LQVA 1IQYA 3S27A 3CCR3 1O7MB 2IUJA 1IVXA 2XFSA 3PCRA 1GMPA 2CW9A 4N6NB 3T8UA 1I3FA 1TFKA 3JUMA 1ULJB 2L4VA 1RN7A 1UCLA 4EV2A 1BIRA 4XDWA 4WYKB 3G0KA 4L8OA 1LOWA 1YHQ3 1RN4A 1I0VA 4KVHA 3CCJ3 3B4PA 3EC9A 1N5HA 3GWRA 3LH4A 2CFDA 4IT7A 4MMYB 5IW9A 3NM2A 5M19A 1VQO3 1KSIA 4LSOA 4LEHA 1GS3A 1W4NA 3JUOA 3WR2A 4CDLA 2CWUA 5IERA 1LNHA 1VQ63 1VQ93 3EJVA 1EUIC 2CWTA 2W03A 1MOLA 4K1VA 3FF2A 2O9UX 1WQLB 4G1MB 1BSAA 1BVIA 4ZM8A 1ZO2A 4JF8A 1VQP3 3BU4A 1IQ8A 1FGRA 3S5CA 4HM3B 1NNVA 3DGLA 2BNGA 2HOHA 3X42A 1AV4A 3NUVA 1FZUA 3CPW2 1CQSA 2MF7A 4R1KA 4RBNA 1DMQA 3UNLA 3UB1A 1FGOA 1LQGC 1LNIA 2JDIH 1JB2A 1C7HA 1B2SA 1I3IA 1C54A 1IT8A 3BLZA 4HBRA 2Z77A 1GOVA 1I0XA 5RNTA 7STDA 2W6JH 3QRDA 3K0ZA 3NBBA 1I70A 4N6LA 4LYLB 1FUSA 2IA7A 2GU3A 3EBYA 2KAAA 4MMZB 2W9PA 3UL6A 4RZMA 2IY2A 3ZG5A 1OACA 2O3OA 3KKGA 4FMCA 3SEDA 1BRJA 1VQ73 2UX0A 1IV7A 4K90B 2GEYA 3WOEB 3MWZA 1UCIA 3NX0A 1CYUA 1MWUA 1AR0A 3DY5A 4HM5B 3SOYA 4HOHA 5GSPA 5IENA 1GY6A 2BT3A 5G1KA 3GZYB 3PS8A 1JKGB 1YGEA 1OGXA 2OCTA 3B7CA 3I0YA 1PFPA 1T2HA 1UUVB 3FH1A 5IG5A 1JN5A 1U5OA 4IPBA 3RNTA 1B2MA 5AI1A 7GSPA 2AAEA 2RSXA 1TJDA 3DZLA 3LOYA 2CG0A 1IK3A 1OH0A 4XBTA 1X1XA 1MGRA 3WHOA 3SOAA 1IVWA 5CF2A 3HZPA 5EVHA 4HM8B 1UUWB 1MNLA 3D79A 3D9RA 3F40A 3HK4A 4RNYA 1ROAA 2E2UA 1A2KA 1MWTA 1GSPA 1TP6A 2SARA 4I5QA 3T0UA 1K8A4 1Q40A 2Y73A 3FF0A 2ZL8A 4X2OA 3N54B 2SBLA 3SYUA 1UDII 3PCSA 1U8CB 3FLJA 1EG9B 1W00A 1RTUA 3VGNA 5AEWB 5IEOA 1QMAA 2W56B 3SX1A 2KF5A 3N8BA 4J9AA 3CCS3 1OPYA 1OF5B 3FG4A 3GRDA 1NDOB 3UJMA 1RCKA 1OGZA 3F8HA 1GMRA 3CCQ3 3KN4A 2QEX3 4O8SA 1FUTA 2HMOB 1RGFA 3LTBA 1RNTA 5G1LA 2CC3A 1RDSA 1V57A 2HMNB 2XSOB 4EC6A 2YX9A 2D42A 1STDA 5BU4A 3K7CA 2KF3A 1BNJA 3FG1A 5CLKA 4BTXA 3EX9A 4MEIA 4CJNA 4HM1B 1RGKA 5HGRA 3WA3A 1NJI4 2RGQA 5IG4A 1YJW3 2KF6A 2QIYA 3CC23 1OHOA 3MKIA 3NQYA 1TIJA 5LC7A 3JUQA 1Q7HA 2FNQA 1TTOA 1B27A 3HIGA 4J5GA 1EEJA 3IMAB 1DVCA 1RMSA 2HMLB 1YJ93 3SXXA 1RGCA 3MSOA 2C10A 3KSED 4HJLB 1BNRA 3LTAA 2GBXB
chains in the Genus database with same CATH topology
1BNGA 1RN1A 3AGOA 1RHLA 1RGAA 1B2ZA 1BSAA 1BVIA 1BNIA 2BU4A 3BU4A 3D4AA 1LRAA 1B20A 1UCKA 2HOHA 1FZUA 1TRPA 1JBRA 2GSPA 1RNBA 1LNIA 1I3IA 1MGWA 1B2SA 1C54A 1GOVA 1FYSA 1GOUA 1I0XA 1LOVA 5BIRA 1X1UA 5RNTA 1JBSA 1I8VA 1BAOA 1I70A 5HOHA 1BUJA 1B3SA 1I2EA 1PYLA 1BNFA 3DGYA 1FUSA 1RCLA 2F5MA 1AY7A 2KAAA 3A5EA 1BSBA 1G02A 3HOHA 7RNTA 1BSEA 1UCJA 1BRJA 2F56A 1A2PA 1RGHA 1BRKA 1BRIA 1UCIA 3AHWA 3Q3FA 1X1WA 3AGNA 1AQZA 4HOHA 5GSPA 1GOYA 3KCHA 1RLSA 2RBIA 1LOYA 4GSPA 4BU4A 9RNTA 1T2HA 3RNTA 1ZGXA 1B2MA 6RNTA 4J5KA 2AAEA 1BSDA 3D5GA 7GSPA 1B21A 1YNVX 1BOXA 3D5IA 1RGLA 1I2GA 1YVSA 1X1XA 1MGRA 2ZA4A 3WHOA 1CH0A 1BRSA 1HYFA 1BU4A 2AADA 3DH2A 2SARA 1GMQA 1GSPA 1BGSA 3BIRA 1DETA 1BSCA 4BIRA 1RGGA 8RNTA 1RGEA 3SYUA 1SARA 1IYYA 1RTUA 3AHSA 2KF5A 1DE3A 6GSPA 4RNTA 4GHOA 1HZ1A 1I2FA 1TRQA 1RCKA 1GMRA 1BNSA 1FUTA 1GMPA 1BRNL 1R4YA 1I3FA 1RGFA 1RNTA 1BRHA 2F5WA 1YGWA 1RDSA 3GSPA 1UCLA 1BIRA 5BU4A 1B2XA 1B2UA 1BNEA 2KF3A 1BNJA 1LOWA 1RN4A 1I0VA 1RSNA 1RGKA 1BRGA 1Q9EA 2KF6A 1JBTA 2C4BA 2RNTA 3WR2A 1TTOA 1B27A 4J5GA 1RMSA 4HAAA 1T2IA 2F4YA 3URPA 1RGCA 1PY3A 1X1YA 2BIRA 2KF4A 1FW7A 1BNRA 1BANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNG A;  1RN1 A;  3AGO A;  1RHL A;  1RGA A;  1B2Z A;  1BSA A;  1BVI A;  1BNI A;  2BU4 A;  3BU4 A;  3D4A A;  1LRA A;  1B20 A;  1UCK A;  2HOH A;  1FZU A;  1TRP A;  1JBR A;  2GSP A;  1RNB A;  1LNI A;  1I3I A;  1MGW A;  1B2S A;  1C54 A;  1GOV A;  1FYS A;  1GOU A;  1I0X A;  1LOV A;  5BIR A;  1X1U A;  5RNT A;  1JBS A;  1I8V A;  1BAO A;  1I70 A;  5HOH A;  1BUJ A;  1B3S A;  1I2E A;  1PYL A;  1BNF A;  3DGY A;  1FUS A;  1RCL A;  2F5M A;  1AY7 A;  2KAA A;  3A5E A;  1BSB A;  1G02 A;  3HOH A;  7RNT A;  1BSE A;  1UCJ A;  1BRJ A;  2F56 A;  1A2P A;  1RGH A;  1BRK A;  1BRI A;  1UCI A;  3AHW A;  3Q3F A;  1X1W A;  3AGN A;  1AQZ A;  4HOH A;  5GSP A;  1GOY A;  3KCH A;  1RLS A;  2RBI A;  1LOY A;  4GSP A;  4BU4 A;  9RNT A;  1T2H A;  3RNT A;  1ZGX A;  1B2M A;  6RNT A;  4J5K A;  2AAE A;  1BSD A;  3D5G A;  7GSP A;  1B21 A;  1YNV X;  1BOX A;  3D5I A;  1RGL A;  1I2G A;  1YVS A;  1X1X A;  1MGR A;  2ZA4 A;  3WHO A;  1CH0 A;  1BRS A;  1HYF A;  1BU4 A;  2AAD A;  3DH2 A;  2SAR A;  1GMQ A;  1GSP A;  1BGS A;  3BIR A;  1DET A;  1BSC A;  4BIR A;  1RGG A;  8RNT A;  1RGE A;  3SYU A;  1SAR A;  1IYY A;  1RTU A;  3AHS A;  2KF5 A;  1DE3 A;  6GSP A;  4RNT A;  4GHO A;  1HZ1 A;  1I2F A;  1TRQ A;  1RCK A;  1GMR A;  1BNS A;  1FUT A;  1GMP A;  1BRN L;  1R4Y A;  1I3F A;  1RGF A;  1RNT A;  1BRH A;  2F5W A;  1YGW A;  1RDS A;  3GSP A;  1UCL A;  1BIR A;  5BU4 A;  1B2X A;  1B2U A;  1BNE A;  2KF3 A;  1BNJ A;  1LOW A;  1RN4 A;  1I0V A;  1RSN A;  1RGK A;  1BRG A;  1Q9E A;  2KF6 A;  1JBT A;  2C4B A;  2RNT A;  3WR2 A;  1TTO A;  1B27 A;  4J5G A;  1RMS A;  4HAA A;  1T2I A;  2F4Y A;  3URP A;  1RGC A;  1PY3 A;  1X1Y A;  2BIR A;  2KF4 A;  1FW7 A;  1BNR A;  1BAN A; 
#chains in the Genus database with same CATH topology
 1RN1 A;  5CXO A;  4GL6 A;  3MYT A;  1RHL A;  1RGA A;  3EBT A;  1WMP A;  5AIG A;  5JPU A;  1V58 A;  1Z1S A;  4LZI A;  1UCK A;  1YIT 3;  3LYG A;  3IPT A;  1EA2 A;  3DUK A;  1M1X B;  3CCU 3;  3NM7 A;  3X41 A;  4OUQ A;  3V92 A;  1YI2 3;  1RNB A;  2D1W A;  1K9M 4;  1A90 A;  4XBY A;  3CPO A;  1W01 A;  3OWS A;  5BIR A;  2YFI B;  1DMN A;  3OWY A;  4HM0 B;  5I97 A;  1HU9 A;  1X1U A;  5KP4 A;  1JBS A;  2Y74 A;  2W04 A;  2W9Q A;  1M9G A;  2XFT A;  5HOH A;  1IU7 A;  1NU3 A;  1PYL A;  1BNF A;  3DGY A;  3Q2P A;  4XB5 A;  4FMD A;  3VF1 A;  1S5A A;  1RCL A;  1VZZ A;  4U13 A;  2F5M A;  3X40 A;  1UI8 A;  1O7W B;  1BSB A;  3GAX A;  7RNT A;  3B8L A;  2M7O A;  1FA3 A;  1BSE A;  1GY5 A;  1JZD A;  3HI7 A;  4XM4 A;  4EBG A;  3CCV 3;  1W6C A;  3MHE A;  1A2P A;  1LQM B;  4L8P A;  3G4S 3;  2L1S A;  2Q07 A;  2XR8 B;  4HM6 B;  1UI7 A;  3J7Y d;  5BXQ A;  3BNB A;  2A15 A;  2RBI A;  3ECF A;  4TX4 A;  1LOY A;  1OCV A;  2ZHX B;  4GSP A;  2FGT A;  1N9E A;  1WMN A;  4GB5 A;  1ZGX A;  4NRE A;  6RNT A;  2FXT A;  1W6Y A;  2YFL B;  3E99 A;  3LXU X;  3O8Y A;  1YNV X;  3D5I A;  3F14 A;  1SPU A;  4O02 B;  1QVG 2;  2UUG C;  1N5P A;  2GU1 A;  2XSH B;  3M8C A;  5IG0 A;  2CWV A;  3F9S A;  3ZFZ A;  3GZB A;  3MG1 A;  3LTC A;  2CH9 A;  4FMB A;  3SLU A;  1CYV A;  2OOV C;  3LT8 A;  1VQL 3;  1JZO A;  3SVA A;  2XEP A;  5M1A A;  2ML5 A;  1FGT A;  1GMQ A;  3JUP A;  1BGS A;  5JPP A;  2HMJ B;  2P0M A;  4JRF A;  1VQK 3;  4O2H A;  2PZV A;  1ISK A;  1JJ2 2;  2H0G A;  1RGG A;  3N9H A;  1TUH A;  4R9L A;  8RNT A;  3CCM 3;  3FCS B;  3JVC A;  4HZB B;  3DGN A;  5ELJ A;  1WNH A;  2IMJ A;  3DM8 A;  2F98 A;  2IUK A;  3OV4 A;  3ROB A;  1O7H B;  3WOF B;  4WFO A;  1K41 A;  1ZS7 A;  4K61 A;  4BL3 A;  3DXO A;  8CHO A;  6GSP A;  1YVB I;  2WO0 A;  2XGN A;  1TU5 A;  1GY7 A;  4GHO A;  4WWU C;  1TRQ A;  1I2F A;  2WGQ A;  3LZA A;  1RRH A;  2YFJ B;  2XH9 A;  4WYK A;  1LXE A;  2ML6 A;  1N8Q A;  3DGM A;  2CX0 A;  1E97 A;  2F5W A;  3CNM A;  3EE1 A;  2E2V A;  1JB4 A;  3LML A;  1QAL A;  1V74 A;  3I55 3;  1B2U A;  1BNE A;  1OUN A;  3ALA A;  1N8R 4;  2CG1 A;  1M90 4;  1AVL A;  4O3V A;  1ASK A;  1BRG A;  1FGQ A;  2OTL 3;  3ZG0 A;  1Q9E A;  2QA4 3;  3K9M C;  1MWR A;  5AIH A;  4KZ1 A;  2XRX B;  2BMO B;  5CK6 A;  5M18 A;  1Q7Y 4;  4LGQ A;  3MPH A;  1IDP A;  1T2I A;  4STD A;  5DRV A;  3I56 3;  1PY3 A;  1ZX2 A;  2KRT A;  2BIR A;  2KF4 A;  4H61 A;  4EYC A;  4H3U A;  2CFK A;  4J8T A;  5BVB A;  1TFO A;  1BAN A;  3BB9 A;  1KWI A;  3AGO A;  3S67 A;  2F99 A;  5LC6 A;  2BMQ B;  4R9K A;  2STD A;  2XGL A;  2BU4 A;  3D4A A;  4HM7 B;  1B20 A;  1US1 A;  3WMD A;  4ORL A;  5D83 A;  5AYR B;  2BMR B;  3MG3 A;  1TRP A;  2W0Q A;  3PZW A;  4RNZ A;  1JBR A;  1UUG B;  1BUQ A;  2GSP A;  1A2V A;  4MMX B;  3V98 A;  3EHC A;  2CKF B;  1MGW A;  2LYX A;  5FGO A;  5G2G A;  3CXC 2;  4R4K A;  4AKY A;  1VQ8 3;  2OQE C;  1FYS A;  1GOU A;  1LOV A;  4NHF A;  2F86 B;  2GXF A;  4K1U A;  1I8V A;  1BAO A;  1NB5 I;  2K0M A;  1BUJ A;  4PEJ A;  1Q81 4;  4FR9 A;  3LTD A;  3MG2 A;  2MC8 A;  2B1X B;  1CEW I;  4KFF A;  5STD A;  1K28 A;  3HOH A;  3GZX B;  3A5E A;  2RFR A;  3RDE A;  1FUW A;  3STD A;  3LT9 A;  1W7C A;  1KQS 2;  1ROV A;  2GBW B;  3WDG B;  1F8N A;  4CPK A;  1W6G A;  2Z6B A;  1VQQ A;  1RGH A;  1JKG A;  1BRK A;  2JQ5 A;  1BRI A;  1ULI B;  3AHW A;  4FMA A;  4N6V 0;  1W5Z A;  1AQZ A;  1SII A;  4AEQ A;  1RLS A;  6STD A;  5TGN A;  4BU4 A;  9RNT A;  1JNQ A;  1RKY A;  3TDG A;  4OVM A;  4MJD A;  3OW2 2;  3G8Z A;  3D5G A;  4L7K A;  1BOX A;  1SIH A;  2KXG A;  1YVS A;  1I2G A;  3DGO A;  1JN5 B;  2OTJ 3;  3BNE A;  5FW5 A;  2ZA4 A;  2GEX A;  1LVN A;  1CH0 A;  2CFG A;  1KD1 4;  1Q42 A;  1BRS A;  3IJE B;  4IIA A;  3UL5 A;  4DKI A;  3CC7 3;  1HYF A;  1QAF A;  3S29 A;  2WOH A;  1AVK A;  2AAD A;  4HM4 B;  1VQN 3;  2OWP A;  3S28 A;  2BHM A;  1O7G B;  3OX9 A;  4KFE A;  1BSC A;  2CIU A;  3FG3 A;  1EQK A;  4BTY A;  1UW1 A;  1W02 A;  3HX8 A;  1JV2 B;  2W56 A;  1K73 4;  5EQL A;  3WOD G;  1G96 A;  1GD3 A;  1Q40 B;  1OF5 A;  2R4I A;  1D6Y A;  1NB3 I;  1Q86 4;  1Q82 4;  3KE7 A;  3AHS A;  3PYJ A;  1DE3 A;  3ER7 A;  3L0R A;  2QGU A;  5AIF A;  3NQZ A;  5IG3 A;  4RNT A;  1HZ1 A;  3X3X A;  3NBR A;  1PU4 A;  2CK3 H;  4EV5 A;  5KP3 A;  1BNS A;  4AKZ A;  4XDV A;  1R4C A;  1BRN L;  2PNC A;  1R4Y A;  3AMO B;  3PXM A;  3F7S A;  4FCM A;  2W2C A;  1BRH A;  3Q1C A;  4EXR A;  1YGW A;  3CD6 3;  3GSP A;  3NBJ A;  1YIJ 3;  3V99 A;  3BNC A;  3OXA A;  3EB8 A;  4N6O B;  1Y4K A;  2K3D A;  3A76 A;  1B2X A;  1OHP A;  5D82 A;  5ELU A;  2HMM B;  3F7X A;  1VQ4 3;  4Q53 A;  5KP1 A;  2Z7A A;  1S72 3;  2P09 A;  1RSN A;  1A67 A;  1D6U A;  2ZDJ A;  2WOF A;  3T8N A;  1IVV A;  3CME 3;  1W2B 2;  1JBT A;  3GZR A;  2C4B A;  1NWW A;  2RNT A;  5AEU B;  3QK9 A;  5CF1 A;  1SJW A;  3DMC A;  3FGY A;  2P0X A;  1UGI A;  2CX1 A;  3WA2 X;  4XBX A;  4HAA A;  3URP A;  2F4Y A;  1KC8 4;  3KZT A;  1X1Y A;  2P38 A;  3NV0 B;  3FZW A;  1T5Y A;  3PGB A;  1FW7 A;  1BNG A;  2BO9 B;  3RGA A;  1UGH I;  2OOV A;  4HKV B;  5IF6 A;  4WHA A;  5DRE A;  1IV9 A;  1B2Z A;  3U97 A;  1BNI A;  2HMK B;  3H3H A;  1LRA A;  1QJG A;  2Z76 A;  2K54 A;  1IT7 A;  4N6T A;  3U1W A;  1JB5 A;  2I9W A;  1OHS A;  3EQQ B;  4HM2 B;  4R80 A;  3G71 3;  1HKX A;  2B24 B;  4HZ9 B;  3OWU A;  1SQW A;  1B3S A;  1I2E A;  1G0T A;  3CNX A;  3EN1 B;  3D3L A;  4FCJ A;  2CFL A;  3NXJ A;  2C11 A;  4LMI A;  3CU3 A;  4NPB A;  3X3Z A;  1QAK A;  1DVD A;  2H0I A;  1EKM A;  3KSP A;  4KT3 B;  1AY7 A;  1GD4 A;  5IEP A;  1G02 A;  5D81 A;  3RGR A;  2UGI A;  1E3R A;  4N6U A;  1WMO A;  3CCE 3;  3EN8 A;  1UCJ A;  2F56 A;  1O7N B;  3KFQ C;  3CCL 3;  3Q3F A;  4BL2 A;  1YJN 3;  1IVU A;  1X1W A;  3AGN A;  1NO3 A;  1N9J A;  3FKA A;  2H0H A;  4HYZ A;  4ILF A;  1L5G B;  3CC4 3;  1GOY A;  1W2Z A;  3KCH A;  5AYS C;  1O7P B;  1IQX A;  1RJO A;  5EEO A;  1LOX A;  2XF3 A;  1DYU A;  1GYB A;  3FSD A;  1WTH A;  4J5K A;  1BSD A;  1B21 A;  3K63 A;  4I4K A;  3AMO A;  4HVN A;  1RGL A;  1QVF 2;  1DMM A;  1STF I;  3K5T A;  1D6Z A;  1VQ5 3;  4N3V A;  2KCD A;  1M1K 4;  5A0O B;  1BU4 A;  1MWS A;  4QWT A;  3DH2 A;  5JBS A;  2P05 A;  4FCZ A;  1VQM 3;  2V1L A;  3B4O A;  2E2T A;  4OK0 A;  3HII A;  5AII A;  3BIR A;  2J8X B;  3X3Y A;  1T3B A;  3G16 A;  4BTW A;  1DET A;  4EW5 A;  3F8X A;  4BIR A;  3H51 A;  2IYJ A;  4N6M A;  4CCV A;  2CHC A;  3Q90 A;  1RGE A;  3JUN A;  4X2H A;  2OQE A;  1SAR A;  3NV0 A;  1IYY A;  2CFW A;  3NHX A;  3CMA 3;  3VSY A;  2INX A;  2RCD A;  2WGO A;  1JRQ A;  3EF8 A;  1RRL A;  3KII A;  2R41 A;  4KFD A;  1E3V A;  4WP5 A;  1FGM A;  1J2B A;  3G6E 3;  3BND A;  2LQV A;  1IQY A;  3S27 A;  3CCR 3;  1O7M B;  2IUJ A;  1IVX A;  2XFS A;  3PCR A;  1GMP A;  2CW9 A;  4N6N B;  3T8U A;  1I3F A;  1TFK A;  3JUM A;  1ULJ B;  2L4V A;  1RN7 A;  1UCL A;  4EV2 A;  1BIR A;  4XDW A;  4WYK B;  3G0K A;  4L8O A;  1LOW A;  1YHQ 3;  1RN4 A;  1I0V A;  4KVH A;  3CCJ 3;  3B4P A;  3EC9 A;  1N5H A;  3GWR A;  3LH4 A;  2CFD A;  4IT7 A;  4MMY B;  5IW9 A;  3NM2 A;  5M19 A;  1VQO 3;  1KSI A;  4LSO A;  4LEH A;  1GS3 A;  1W4N A;  3JUO A;  3WR2 A;  4CDL A;  2CWU A;  5IER A;  1LNH A;  1VQ6 3;  1VQ9 3;  3EJV A;  1EUI C;  2CWT A;  2W03 A;  1MOL A;  4K1V A;  3FF2 A;  2O9U X;  1WQL B;  4G1M B;  1BSA A;  1BVI A;  4ZM8 A;  1ZO2 A;  4JF8 A;  1VQP 3;  3BU4 A;  1IQ8 A;  1FGR A;  3S5C A;  4HM3 B;  1NNV A;  3DGL A;  2BNG A;  2HOH A;  3X42 A;  1AV4 A;  3NUV A;  1FZU A;  3CPW 2;  1CQS A;  2MF7 A;  4R1K A;  4RBN A;  1DMQ A;  3UNL A;  3UB1 A;  1FGO A;  1LQG C;  1LNI A;  2JDI H;  1JB2 A;  1C7H A;  1B2S A;  1I3I A;  1C54 A;  1IT8 A;  3BLZ A;  4HBR A;  2Z77 A;  1GOV A;  1I0X A;  5RNT A;  7STD A;  2W6J H;  3QRD A;  3K0Z A;  3NBB A;  1I70 A;  4N6L A;  4LYL B;  1FUS A;  2IA7 A;  2GU3 A;  3EBY A;  2KAA A;  4MMZ B;  2W9P A;  3UL6 A;  4RZM A;  2IY2 A;  3ZG5 A;  1OAC A;  2O3O A;  3KKG A;  4FMC A;  3SED A;  1BRJ A;  1VQ7 3;  2UX0 A;  1IV7 A;  4K90 B;  2GEY A;  3WOE B;  3MWZ A;  1UCI A;  3NX0 A;  1CYU A;  1MWU A;  1AR0 A;  3DY5 A;  4HM5 B;  3SOY A;  4HOH A;  5GSP A;  5IEN A;  1GY6 A;  2BT3 A;  5G1K A;  3GZY B;  3PS8 A;  1JKG B;  1YGE A;  1OGX A;  2OCT A;  3B7C A;  3I0Y A;  1PFP A;  1T2H A;  1UUV B;  3FH1 A;  5IG5 A;  1JN5 A;  1U5O A;  4IPB A;  3RNT A;  1B2M A;  5AI1 A;  7GSP A;  2AAE A;  2RSX A;  1TJD A;  3DZL A;  3LOY A;  2CG0 A;  1IK3 A;  1OH0 A;  4XBT A;  1X1X A;  1MGR A;  3WHO A;  3SOA A;  1IVW A;  5CF2 A;  3HZP A;  5EVH A;  4HM8 B;  1UUW B;  1MNL A;  3D79 A;  3D9R A;  3F40 A;  3HK4 A;  4RNY A;  1ROA A;  2E2U A;  1A2K A;  1MWT A;  1GSP A;  1TP6 A;  2SAR A;  4I5Q A;  3T0U A;  1K8A 4;  1Q40 A;  2Y73 A;  3FF0 A;  2ZL8 A;  4X2O A;  3N54 B;  2SBL A;  3SYU A;  1UDI I;  3PCS A;  1U8C B;  3FLJ A;  1EG9 B;  1W00 A;  1RTU A;  3VGN A;  5AEW B;  5IEO A;  1QMA A;  2W56 B;  3SX1 A;  2KF5 A;  3N8B A;  4J9A A;  3CCS 3;  1OPY A;  1OF5 B;  3FG4 A;  3GRD A;  1NDO B;  3UJM A;  1RCK A;  1OGZ A;  3F8H A;  1GMR A;  3CCQ 3;  3KN4 A;  2QEX 3;  4O8S A;  1FUT A;  2HMO B;  1RGF A;  3LTB A;  1RNT A;  5G1L A;  2CC3 A;  1RDS A;  1V57 A;  2HMN B;  2XSO B;  4EC6 A;  2YX9 A;  2D42 A;  1STD A;  5BU4 A;  3K7C A;  2KF3 A;  1BNJ A;  3FG1 A;  5CLK A;  4BTX A;  3EX9 A;  4MEI A;  4CJN A;  4HM1 B;  1RGK A;  5HGR A;  3WA3 A;  1NJI 4;  2RGQ A;  5IG4 A;  1YJW 3;  2KF6 A;  2QIY A;  3CC2 3;  1OHO A;  3MKI A;  3NQY A;  1TIJ A;  5LC7 A;  3JUQ A;  1Q7H A;  2FNQ A;  1TTO A;  1B27 A;  3HIG A;  4J5G A;  1EEJ A;  3IMA B;  1DVC A;  1RMS A;  2HML B;  1YJ9 3;  3SXX A;  1RGC A;  3MSO A;  2C10 A;  3KSE D;  4HJL B;  1BNR A;  3LTA A;  2GBX B; 
#chains in the Genus database with same CATH homology
 1BNG A;  1RN1 A;  3AGO A;  1RHL A;  1RGA A;  1B2Z A;  1BSA A;  1BVI A;  1BNI A;  2BU4 A;  3BU4 A;  3D4A A;  1LRA A;  1B20 A;  1UCK A;  2HOH A;  1FZU A;  1TRP A;  1JBR A;  2GSP A;  1RNB A;  1LNI A;  1I3I A;  1MGW A;  1B2S A;  1C54 A;  1GOV A;  1FYS A;  1GOU A;  1I0X A;  1LOV A;  5BIR A;  1X1U A;  5RNT A;  1JBS A;  1I8V A;  1BAO A;  1I70 A;  5HOH A;  1BUJ A;  1B3S A;  1I2E A;  1PYL A;  1BNF A;  3DGY A;  1FUS A;  1RCL A;  2F5M A;  1AY7 A;  2KAA A;  3A5E A;  1BSB A;  1G02 A;  3HOH A;  7RNT A;  1BSE A;  1UCJ A;  1BRJ A;  2F56 A;  1A2P A;  1RGH A;  1BRK A;  1BRI A;  1UCI A;  3AHW A;  3Q3F A;  1X1W A;  3AGN A;  1AQZ A;  4HOH A;  5GSP A;  1GOY A;  3KCH A;  1RLS A;  2RBI A;  1LOY A;  4GSP A;  4BU4 A;  9RNT A;  1T2H A;  3RNT A;  1ZGX A;  1B2M A;  6RNT A;  4J5K A;  2AAE A;  1BSD A;  3D5G A;  7GSP A;  1B21 A;  1YNV X;  1BOX A;  3D5I A;  1RGL A;  1I2G A;  1YVS A;  1X1X A;  1MGR A;  2ZA4 A;  3WHO A;  1CH0 A;  1BRS A;  1HYF A;  1BU4 A;  2AAD A;  3DH2 A;  2SAR A;  1GMQ A;  1GSP A;  1BGS A;  3BIR A;  1DET A;  1BSC A;  4BIR A;  1RGG A;  8RNT A;  1RGE A;  3SYU A;  1SAR A;  1IYY A;  1RTU A;  3AHS A;  2KF5 A;  1DE3 A;  6GSP A;  4RNT A;  4GHO A;  1HZ1 A;  1I2F A;  1TRQ A;  1RCK A;  1GMR A;  1BNS A;  1FUT A;  1GMP A;  1BRN L;  1R4Y A;  1I3F A;  1RGF A;  1RNT A;  1BRH A;  2F5W A;  1YGW A;  1RDS A;  3GSP A;  1UCL A;  1BIR A;  5BU4 A;  1B2X A;  1B2U A;  1BNE A;  2KF3 A;  1BNJ A;  1LOW A;  1RN4 A;  1I0V A;  1RSN A;  1RGK A;  1BRG A;  1Q9E A;  2KF6 A;  1JBT A;  2C4B A;  2RNT A;  3WR2 A;  1TTO A;  1B27 A;  4J5G A;  1RMS A;  4HAA A;  1T2I A;  2F4Y A;  3URP A;  1RGC A;  1PY3 A;  1X1Y A;  2BIR A;  2KF4 A;  1FW7 A;  1BNR A;  1BAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...