1TRQA

X-ray crystallographic and calorimeric studies of the effects of the mutation trp 59 tyr in ribonuclease t1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title X-ray crystallographic and calorimetric studies of the effects of the mutation Trp59-->Tyr in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 22
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1trqA00
2C4BA 1T2IA 1G02A 1RGHA 1I3IA 1RGKA 1JBSA 3D4AA 4BIRA 3DH2A 1BRHA 1RGLA 5HOHA 1B2XA 1BGSA 1PY3A 1BRNL 2RNTA 2BU4A 1PYLA 2RBIA 1BRKA 1BNSA 9RNTA 1BSCA 3D5IA 1BUJA 4RNTA 1BRJA 1DE3A 4HOHA 1LOWA 1LNIA 6GSPA 1AY7A 1YNVX 4J5KA 1LOVA 3HOHA 1RNBA 2BIRA 1GMQA 1LOYA 2GSPA 3AHWA 3A5EA 1C54A 1UCKA 5BIRA 8RNTA 1RGGA 1X1WA 1FUSA 1B2SA 1MGWA 1AQZA 7RNTA 5BU4A 1YGWA 1RHLA 2F4YA 1FZUA 1FUTA 2SARA 3Q3FA 1GMPA 3AGOA 1BOXA 1Q9EA 1RDSA 1UCJA 2KF4A 1B2MA 1I8VA 1BNRA 1BSDA 1YVSA 1BNEA 1B2UA 1I3FA 1BAOA 6RNTA 1HYFA 1BNJA 3WHOA 1I0VA 1I2GA 3GSPA 1T2HA 1A2PA 1JBRA 1BNGA 1TRQA 2KF5A 1GOUA 1SARA 2KAAA 2KF6A 3WR2A 1X1UA 1RGAA 1BNIA 1BRSA 1GSPA 2AADA 2F5MA 1I70A 1JBTA 1GOYA 1RTUA 3BU4A 3SYUA 1RGEA 1CH0A 2HOHA 1UCIA 1BSAA 1FW7A 1I2FA 1BNFA 1GMRA 1LRAA 1BU4A 5GSPA 1BVIA 2F56A 1X1XA 1B27A 2AAEA 1RGCA 1DETA 1RGFA 1UCLA 1BRIA 1I0XA 1B21A 1BRGA 1RN1A 1IYYA 1RSNA 1RCKA 1BIRA 1TRPA 1I2EA 1RMSA 4GHOA 1RN4A 1RCLA 1RNTA 4J5GA 4BU4A 2ZA4A 3URPA 1MGRA 1TTOA 1BSEA 3AHSA 4HAAA 1FYSA 3KCHA 1B3SA 4GSPA 1R4YA 1HZ1A 5RNTA 2KF3A 1GOVA 1X1YA 1B2ZA 1B20A 2F5WA 3AGNA 3BIRA 1BSBA 1BANA 7GSPA 1ZGXA 3DGYA 3D5GA 1RLSA 3RNTA
chains in the Genus database with same CATH superfamily
2KCDA 5CXOA 1CQSA 1D6ZA 4LYLB 1M904 1G02A 2QGUA 4JRFA 2P0MA 2ZL8A 1JBSA 2P09A 5EEOA 1IV9A 3DH2A 3CNMA 4BIRA 1N8R4 1BRHA 1AVLA 3G16A 4EYCA 1KC84 1K9M4 3EQQB 4GB5A 3DGMA 1C7HA 2H0HA 4L7KA 2CWUA 1FGTA 3CCR3 2BMOB 4HM7B 3JVCA 2C11A 3H51A 1TIJA 2Z7AA 2FGTA 1W4NA 4RNZA 4BTWA 9RNTA 1N5PA 1BRJA 3AMOB 1JZOA 4HOHA 3JUNA 2LQVA 3BNEA 4HM8B 6GSPA 1YNVX 1UUWB 3ER7A 1IVXA 2BIRA 1GMQA 1LOYA 3MKIA 4K90B 3CMA3 4HM0B 1UCKA 8RNTA 5A0OB 1RGGA 2UX0A 1FUSA 1B2SA 2GBXB 1MGWA 4HM2B 1AQZA 2CX1A 1QVG2 7RNTA 1YGWA 4XDWA 1FZUA 1W6YA 1AR0A 3ECFA 3G713 3Q3FA 3CCJ3 3S27A 4FCMA 4LEHA 1IQXA 3AGOA 1Q9EA 1IK3A 1QAKA 1EQKA 1K28A 3CCV3 3JUPA 1WNHA 1RKYA 3PGBA 1UGHI 1SIIA 3L0RA 2W04A 4HM5B 3I563 1BNRA 4XDVA 1ROVA 3NQZA 1GD4A 2C10A 1JKGA 1BNEA 1EKMA 2P05A 1W02A 4FCZA 5EVHA 1KSIA 1IT7A 1G0TA 2CFKA 4WWUC 4CCVA 2QA43 1E97A 1BNJA 3WHOA 2W9QA 3G0KA 3HIGA 1OPYA 4WYKB 2BO9B 5ELUA 1Q40B 1NWWA 3CCU3 5HGRA 1E3RA 4N6LA 3PYJA 5AEUB 3S5CA 2IYJA 3WR2A 1BRSA 4BTYA 2YFLB 3Q90A 5G1KA 3QRDA 3BU4A 4NPBA 3PCRA 1MWUA 3FLJA 4HM1B 1UCIA 1MNLA 4K1UA 3PCSA 1DMNA 2Y74A 1G96A 1BU4A 1GD3A 5IG4A 1W2ZA 5IW9A 2RGQA 2F56A 3JUMA 1B27A 1RGCA 3WA2X 1RGFA 3EB8A 3KKGA 5CLKA 2R4IA 4XM4A 4EBGA 3UL5A 4WFOA 3D9RA 3CC43 2A15A 3J7Yd 3RDEA 1UCLA 2XSOB 4KFEA 1EA2A 4N6NB 4U13A 4AEQA 3CCS3 1GYBA 3WOFB 1RCKA 2WGQA 2WO0A 3PXMA 1RMSA 1RN4A 4KZ1A 1RCLA 1RNTA 2CC3A 3B8LA 1NU3A 1A2KA 1TTOA 1F8NA 1V57A 2E2UA 3AHSA 3KCHA 1OH0A 4HAAA 4N3VA 3GAXA 5ELJA 3FCSB 2GBWB 2Z76A 3N54B 3WMDA 4NREA 3CCE3 3NV0A 4MJDA 1X1YA 1VQP3 1W01A 1TU5A 3ZG5A 3AGNA 2ZDJA 2HMJB 5AIIA 1FGMA 3DGYA 3D5GA 1SIHA 2CKFB 3NBJA 2C4BA 3V98A 3X41A 3F8XA 1LOXA 3CPOA 1OF5B 4NHFA 3NM2A 3D4AA 3JUOA 2INXA 3DXOA 1UI7A 4LMIA 3SOYA 3KIIA 8CHOA 4XB5A 1RGLA 5HOHA 1PY3A 3FZWA 3DUKA 4N6TA 4HM3B 4RNYA 3CCM3 2BU4A 3Q2PA 2MF7A 3NBRA 3DGLA 3EHCA 3T8NA 3K0ZA 2XFTA 1BRKA 3LT9A 3MG1A 1N9EA 1OGZA 3F7SA 2IUKA 4HYZA 2MC8A 1VQ73 1Q824 3MPHA 1O7GB 3D5IA 1BUJA 1DE3A 2WOHA 1UDII 3WA3A 1YI23 1R4CA 5M1AA 3CC23 1HU9A 3CU3A 4J5KA 3OWUA 5CF1A 1Y4KA 2GSPA 4I4KA 3AHWA 4FMCA 2YX9A 2CFDA 3CXC2 5BIRA 2OQEA 2OTL3 3EF8A 3E99A 1OCVA 1OUNA 1X1WA 3EC9A 3OXAA 1DMMA 4O02B 5AIFA 1QALA 5IF6A 3HZPA 4LSOA 5BXQA 3GZYB 1IVUA 1NB3I 1RHLA 5DREA 5BU4A 4R4KA 4HZ9B 2OQEC 2W56A 3LXUX 2D1WA 5G2GA 4BTXA 3ZG0A 2XR8B 2ZHXB 3LOYA 3VSYA 1UCJA 4STDA 1A90A 2O9UX 2CH9A 2W03A 1HKXA 3LTBA 3S29A 1QJGA 1M1K4 5G1LA 1BAOA 2OOVA 3EJVA 1K8A4 4RZMA 2W6JH 4N6OB 3GSPA 3NHXA 1A2PA 2YFIB 1IT8A 2KAAA 2OOVC 3I0YA 4ZM8A 3K9MC 3EBYA 1X1UA 3DMCA 2BHMA 1Q864 5JBSA 2AADA 1GOYA 3T0UA 1M9GA 1WMNA 3IPTA 1JJ22 1A2VA 4I5QA 5AIHA 1VQQA 3SYUA 3OW22 2RFRA 3DGOA 3NXJA 1OHSA 1Q7HA 1FW7A 3OWSA 5M19A 1BVIA 1CYVA 2K0MA 3CME3 2R41A 2I9WA 2QIYA 1X1XA 3CPW2 2W56B 4QWTA 2PZVA 1DETA 5AI1A 1JN5A 1MOLA 1W6CA 3FG3A 5CF2A 3N9HA 1RRHA 4ORLA 2GU3A 2V1LA 1I0XA 2XEPA 3HX8A 1UGIA 1B21A 1OHPA 3KZTA 5AYSC 3HK4A 3U1WA 3X3ZA 1E3VA 2CWVA 3G4S3 1JNQA 1NJI4 1US1A 3CCL3 1RSNA 2STDA 1BIRA 4TX4A 1I2EA 3F9SA 4IPBA 3BNBA 2JDIH 4J5GA 5LC6A 3I553 3VF1A 1O7MB 4KT3B 2CWTA 3OWYA 1BSEA 3X3XA 1B3SA 1FA3A 2KF3A 3PS8A 3LMLA 3NUVA 1O7WB 3NBBA 1QMAA 2CFWA 3PZWA 1ULIB 3WDGB 1U8CB 3H3HA 3HIIA 2F5WA 2IUJA 7STDA 3LYGA 3QK9A 5FW5A 1BSBA 1BANA 2P38A 1GY5A 5KP3A 1ZO2A 4XBYA 2LYXA 1IQ8A 1YJ93 1PFPA 1RLSA 1K41A 2UGIA 3F40A 4OUQA 4PEJA 1SQWA 5D82A 3F8HA 2SBLA 2CHCA 2IMJA 1JKGB 1STDA 2BMRB 2H0GA 2KXGA 1DVCA 3LZAA 4BL3A 4BL2A 2XGLA 3NX0A 1TUHA 4Q53A 3LTDA 3RGAA 5M18A 1BRNL 1FUWA 1JZDA 3MSOA 3CC73 2F99A 3GWRA 1WQLB 1VQN3 3LTCA 2RBIA 2W0QA 3RGRA 1MWRA 1W7CA 4GL6A 4ILFA 1RRLA 3UNLA 1YJW3 4WP5A 2L4VA 4RNTA 4LZIA 3TDGA 1AV4A 2W9PA 4IIAA 1FGQA 1UI8A 1J2BA 5TGNA 1LNIA 3FG1A 3BNCA 1MWSA 1S723 1PU4A 1IVVA 1LOVA 1UW1A 3HOHA 4FMBA 4HM4B 4RBNA 1CYUA 1S5AA 3A5EA 1C54A 4IT7A 2W2CA 1FGRA 2Z6BA 2P0XA 5BVBA 1W00A 5IG3A 3MWZA 3NQYA 2ML6A 2F4YA 2XRXB 4KFDA 1TFKA 2RCDA 2Z77A 1IV7A 2CX0A 1NB5I 1KD14 1N8QA 2BT3A 1FUTA 2Q07A 2SARA 4HZBB 3VGNA 3D3LA 3BLZA 1O7HB 2L1SA 1RDSA 3FF0A 4R9LA 5DRVA 2KF4A 3UJMA 1IQYA 1VQ63 1B2MA 4LGQA 1ISKA 1I8VA 3EX9A 3JUQA 1LQGC 1V74A 4R1KA 2UUGC 3X42A 1SPUA 3DM8A 3LT8A 3WODG 1YHQ3 3X40A 5EQLA 2KRTA 3NV0B 1OGXA 4AKYA 5CK6A 2XSHB 1YVBI 1ULJB 4WHAA 3HI7A 3SOAA 1JBRA 3KFQC 2KF5A 1SARA 2GEYA 1GS3A 5FGOA 1UUVB 2GXFA 3AMOA 1Q814 1IDPA 1OHOA 2FNQA 3NM7A 2F5MA 1GSPA 1JB4A 4H61A 4MEIA 1I70A 1VZZA 4N6MA 1L5GB 1D6YA 3F7XA 1EEJA 3T8UA 1RGEA 2HOHA 1Q42A 3DZLA 5AEWB 2XH9A 3DGNA 1I2FA 4FMAA 1VQL3 1LRAA 3GRDA 3GZRA 5AIGA 2OWPA 3GZXB 4R80A 1OACA 1YIJ3 1YIT3 1TP6A 4XBTA 5IENA 2CFGA 1GY6A 1ASKA 1ZX2A 3KN4A 1Q7Y4 3EN1B 3M8CA 5LC7A 3KE7A 1BRGA 1V58A 5IEPA 3B4PA 1RN1A 1IYYA 3OX9A 1KWIA 3SLUA 1TRPA 3KSED 4MMYB 2CFLA 4GHOA 3SVAA 3FSDA 4JF8A 1MGRA 6STDA 1FYSA 2OCTA 4O8SA 4GSPA 5IG5A 5RNTA 1W6GA 4L8PA 1EG9B 3SXXA 1QVF2 4X2HA 2WGOA 1LNHA 4WYKA 2CK3H 1Q40A 2B1XB 2D42A 4L8OA 1W5ZA 4EV2A 1D6UA 3V92A 1ZGXA 1IU7A 3G6E3 2HMKB 2F86B 3K5TA 4MMXB 3D79A 1UUGB 2CIUA 5D83A 5I97A 5IERA 1FGOA 3ZFZA 2H0IA 2QEX3 1LQMB 1T2IA 4CPKA 4K1VA 1VQO3 1RGHA 4FCJA 1I3IA 1RGKA 2XGNA 3A76A 4HM6B 3CNXA 3F14A 3ROBA 1ZS7A 1B2XA 1BGSA 1QAFA 5KP4A 1BUQA 2RNTA 5IG0A 1PYLA 3UL6A 3MG2A 3B4OA 1BNSA 4X2OA 2WOFA 1BSCA 1W2B2 2ML5A 1NO3A 1LOWA 1O7NB 3K7CA 4AKZA 3CD63 1AY7A 3CCQ3 2B24B 3GZBA 4HBRA 4J9AA 5KP1A 4KFFA 1RNBA 2HMMB 2IA7A 4MMZB 3IMAB 1VQ43 2K3DA 3OV4A 4G1MB 1JB5A 1GY7A 1DMQA 2GU1A 3B7CA 3KSPA 4EXRA 4FR9A 3S28A 1NNVA 1JN5B 4HKVB 3ALAA 2PNCA 3IJEB 3FKAA 2XF3A 3EN8A 4J8TA 2E2VA 2J8XB 2O3OA 4O2HA 4O3VA 3LTAA 3MYTA 1GMPA 2CG0A 1N5HA 1NDOB 3BNDA 5IEOA 4DKIA 3V99A 1BOXA 2BMQB 1VQM3 4K61A 4CDLA 5JPUA 1N9JA 3G8ZA 1IVWA 3FGYA 1OF5A 4H3UA 1BSDA 3STDA 1YVSA 1I3FA 1B2UA 1JV2B 4OK0A 3K63A 3MHEA 1WTHA 6RNTA 1HYFA 1U5OA 4HJLB 1VQK3 2RSXA 1I0VA 1JB2A 1I2GA 1M1XB 1T2HA 3SX1A 1BNGA 1TRQA 1T3BA 1WMPA 1GOUA 2YFJB 2FXTA 3FG4A 1AVKA 2KF6A 3X3YA 5JPPA 2XFSA 1RGAA 1BNIA 1LXEA 1RJOA 2HMLB 4EW5A 4XBXA 1DVDA 4CJNA 1JBTA 4R9KA 1RTUA 1YJN3 1A67A 1CH0A 2F98A 2OTJ3 1VQ93 1BSAA 3FH1A 1BNFA 1GMRA 1T5YA 4N6UA 5GSPA 2IY2A 3LH4A 5D81A 2K54A 3WOEB 4EC6A 2JQ5A 1ROAA 2AAEA 2M7OA 1DYUA 1TFOA 3DY5A 3FF2A 3UB1A 5STDA 3Q1CA 1K734 2Y73A 1O7PB 1CEWI 1BRIA 1STFI 3BB9A 2GEXA 1TJDA 1VQ83 2CW9A 2BNGA 1VQ53 3SEDA 4HVNA 1WMOA 2HMNB 1KQS2 4EV5A 4BU4A 2ZA4A 4OVMA 3EBTA 3URPA 3EE1A 2E2TA 1Z1SA 1R4YA 3U97A 1LVNA 1HZ1A 1YGEA 4N6V0 3N8BA 1GOVA 3MG3A 3S67A 1B2ZA 1B20A 2HMOB 3O8YA 4FMDA 1MWTA 3BIRA 5AYRB 1SJWA 1EUIC 7GSPA 2CG1A 1RN7A 4KVHA 1JRQA 3RNTA
chains in the Genus database with same CATH topology
2C4BA 1T2IA 1G02A 1RGHA 1I3IA 1RGKA 1JBSA 3D4AA 4BIRA 3DH2A 1BRHA 1RGLA 5HOHA 1B2XA 1BGSA 1PY3A 1BRNL 2RNTA 2BU4A 1PYLA 2RBIA 1BRKA 1BNSA 9RNTA 1BSCA 3D5IA 1BUJA 4RNTA 1BRJA 1DE3A 4HOHA 1LOWA 1LNIA 6GSPA 1AY7A 1YNVX 4J5KA 1LOVA 3HOHA 1RNBA 2BIRA 1GMQA 1LOYA 2GSPA 3AHWA 3A5EA 1C54A 1UCKA 5BIRA 8RNTA 1RGGA 1X1WA 1FUSA 1B2SA 1MGWA 1AQZA 7RNTA 5BU4A 1YGWA 1RHLA 2F4YA 1FZUA 1FUTA 2SARA 3Q3FA 1GMPA 3AGOA 1BOXA 1Q9EA 1RDSA 1UCJA 2KF4A 1B2MA 1I8VA 1BNRA 1BSDA 1YVSA 1BNEA 1B2UA 1I3FA 1BAOA 6RNTA 1HYFA 1BNJA 3WHOA 1I0VA 1I2GA 3GSPA 1T2HA 1A2PA 1JBRA 1BNGA 1TRQA 2KF5A 1GOUA 1SARA 2KAAA 2KF6A 3WR2A 1X1UA 1RGAA 1BNIA 1BRSA 1GSPA 2AADA 2F5MA 1I70A 1JBTA 1GOYA 1RTUA 3BU4A 3SYUA 1RGEA 1CH0A 2HOHA 1UCIA 1BSAA 1FW7A 1I2FA 1BNFA 1GMRA 1LRAA 1BU4A 5GSPA 1BVIA 2F56A 1X1XA 1B27A 2AAEA 1RGCA 1DETA 1RGFA 1UCLA 1BRIA 1I0XA 1B21A 1BRGA 1RN1A 1IYYA 1RSNA 1RCKA 1BIRA 1TRPA 1I2EA 1RMSA 4GHOA 1RN4A 1RCLA 1RNTA 4J5GA 4BU4A 2ZA4A 3URPA 1MGRA 1TTOA 1BSEA 3AHSA 4HAAA 1FYSA 3KCHA 1B3SA 4GSPA 1R4YA 1HZ1A 5RNTA 2KF3A 1GOVA 1X1YA 1B2ZA 1B20A 2F5WA 3AGNA 3BIRA 1BSBA 1BANA 7GSPA 1ZGXA 3DGYA 3D5GA 1RLSA 3RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C4B A;  1T2I A;  1G02 A;  1RGH A;  1I3I A;  1RGK A;  1JBS A;  3D4A A;  4BIR A;  3DH2 A;  1BRH A;  1RGL A;  5HOH A;  1B2X A;  1BGS A;  1PY3 A;  1BRN L;  2RNT A;  2BU4 A;  1PYL A;  2RBI A;  1BRK A;  1BNS A;  9RNT A;  1BSC A;  3D5I A;  1BUJ A;  4RNT A;  1BRJ A;  1DE3 A;  4HOH A;  1LOW A;  1LNI A;  6GSP A;  1AY7 A;  1YNV X;  4J5K A;  1LOV A;  3HOH A;  1RNB A;  2BIR A;  1GMQ A;  1LOY A;  2GSP A;  3AHW A;  3A5E A;  1C54 A;  1UCK A;  5BIR A;  8RNT A;  1RGG A;  1X1W A;  1FUS A;  1B2S A;  1MGW A;  1AQZ A;  7RNT A;  5BU4 A;  1YGW A;  1RHL A;  2F4Y A;  1FZU A;  1FUT A;  2SAR A;  3Q3F A;  1GMP A;  3AGO A;  1BOX A;  1Q9E A;  1RDS A;  1UCJ A;  2KF4 A;  1B2M A;  1I8V A;  1BNR A;  1BSD A;  1YVS A;  1BNE A;  1B2U A;  1I3F A;  1BAO A;  6RNT A;  1HYF A;  1BNJ A;  3WHO A;  1I0V A;  1I2G A;  3GSP A;  1T2H A;  1A2P A;  1JBR A;  1BNG A;  1TRQ A;  2KF5 A;  1GOU A;  1SAR A;  2KAA A;  2KF6 A;  3WR2 A;  1X1U A;  1RGA A;  1BNI A;  1BRS A;  1GSP A;  2AAD A;  2F5M A;  1I70 A;  1JBT A;  1GOY A;  1RTU A;  3BU4 A;  3SYU A;  1RGE A;  1CH0 A;  2HOH A;  1UCI A;  1BSA A;  1FW7 A;  1I2F A;  1BNF A;  1GMR A;  1LRA A;  1BU4 A;  5GSP A;  1BVI A;  2F56 A;  1X1X A;  1B27 A;  2AAE A;  1RGC A;  1DET A;  1RGF A;  1UCL A;  1BRI A;  1I0X A;  1B21 A;  1BRG A;  1RN1 A;  1IYY A;  1RSN A;  1RCK A;  1BIR A;  1TRP A;  1I2E A;  1RMS A;  4GHO A;  1RN4 A;  1RCL A;  1RNT A;  4J5G A;  4BU4 A;  2ZA4 A;  3URP A;  1MGR A;  1TTO A;  1BSE A;  3AHS A;  4HAA A;  1FYS A;  3KCH A;  1B3S A;  4GSP A;  1R4Y A;  1HZ1 A;  5RNT A;  2KF3 A;  1GOV A;  1X1Y A;  1B2Z A;  1B20 A;  2F5W A;  3AGN A;  3BIR A;  1BSB A;  1BAN A;  7GSP A;  1ZGX A;  3DGY A;  3D5G A;  1RLS A;  3RNT A; 
#chains in the Genus database with same CATH topology
 2KCD A;  5CXO A;  1CQS A;  1D6Z A;  4LYL B;  1M90 4;  1G02 A;  2QGU A;  4JRF A;  2P0M A;  2ZL8 A;  1JBS A;  2P09 A;  5EEO A;  1IV9 A;  3DH2 A;  3CNM A;  4BIR A;  1N8R 4;  1BRH A;  1AVL A;  3G16 A;  4EYC A;  1KC8 4;  1K9M 4;  3EQQ B;  4GB5 A;  3DGM A;  1C7H A;  2H0H A;  4L7K A;  2CWU A;  1FGT A;  3CCR 3;  2BMO B;  4HM7 B;  3JVC A;  2C11 A;  3H51 A;  1TIJ A;  2Z7A A;  2FGT A;  1W4N A;  4RNZ A;  4BTW A;  9RNT A;  1N5P A;  1BRJ A;  3AMO B;  1JZO A;  4HOH A;  3JUN A;  2LQV A;  3BNE A;  4HM8 B;  6GSP A;  1YNV X;  1UUW B;  3ER7 A;  1IVX A;  2BIR A;  1GMQ A;  1LOY A;  3MKI A;  4K90 B;  3CMA 3;  4HM0 B;  1UCK A;  8RNT A;  5A0O B;  1RGG A;  2UX0 A;  1FUS A;  1B2S A;  2GBX B;  1MGW A;  4HM2 B;  1AQZ A;  2CX1 A;  1QVG 2;  7RNT A;  1YGW A;  4XDW A;  1FZU A;  1W6Y A;  1AR0 A;  3ECF A;  3G71 3;  3Q3F A;  3CCJ 3;  3S27 A;  4FCM A;  4LEH A;  1IQX A;  3AGO A;  1Q9E A;  1IK3 A;  1QAK A;  1EQK A;  1K28 A;  3CCV 3;  3JUP A;  1WNH A;  1RKY A;  3PGB A;  1UGH I;  1SII A;  3L0R A;  2W04 A;  4HM5 B;  3I56 3;  1BNR A;  4XDV A;  1ROV A;  3NQZ A;  1GD4 A;  2C10 A;  1JKG A;  1BNE A;  1EKM A;  2P05 A;  1W02 A;  4FCZ A;  5EVH A;  1KSI A;  1IT7 A;  1G0T A;  2CFK A;  4WWU C;  4CCV A;  2QA4 3;  1E97 A;  1BNJ A;  3WHO A;  2W9Q A;  3G0K A;  3HIG A;  1OPY A;  4WYK B;  2BO9 B;  5ELU A;  1Q40 B;  1NWW A;  3CCU 3;  5HGR A;  1E3R A;  4N6L A;  3PYJ A;  5AEU B;  3S5C A;  2IYJ A;  3WR2 A;  1BRS A;  4BTY A;  2YFL B;  3Q90 A;  5G1K A;  3QRD A;  3BU4 A;  4NPB A;  3PCR A;  1MWU A;  3FLJ A;  4HM1 B;  1UCI A;  1MNL A;  4K1U A;  3PCS A;  1DMN A;  2Y74 A;  1G96 A;  1BU4 A;  1GD3 A;  5IG4 A;  1W2Z A;  5IW9 A;  2RGQ A;  2F56 A;  3JUM A;  1B27 A;  1RGC A;  3WA2 X;  1RGF A;  3EB8 A;  3KKG A;  5CLK A;  2R4I A;  4XM4 A;  4EBG A;  3UL5 A;  4WFO A;  3D9R A;  3CC4 3;  2A15 A;  3J7Y d;  3RDE A;  1UCL A;  2XSO B;  4KFE A;  1EA2 A;  4N6N B;  4U13 A;  4AEQ A;  3CCS 3;  1GYB A;  3WOF B;  1RCK A;  2WGQ A;  2WO0 A;  3PXM A;  1RMS A;  1RN4 A;  4KZ1 A;  1RCL A;  1RNT A;  2CC3 A;  3B8L A;  1NU3 A;  1A2K A;  1TTO A;  1F8N A;  1V57 A;  2E2U A;  3AHS A;  3KCH A;  1OH0 A;  4HAA A;  4N3V A;  3GAX A;  5ELJ A;  3FCS B;  2GBW B;  2Z76 A;  3N54 B;  3WMD A;  4NRE A;  3CCE 3;  3NV0 A;  4MJD A;  1X1Y A;  1VQP 3;  1W01 A;  1TU5 A;  3ZG5 A;  3AGN A;  2ZDJ A;  2HMJ B;  5AII A;  1FGM A;  3DGY A;  3D5G A;  1SIH A;  2CKF B;  3NBJ A;  2C4B A;  3V98 A;  3X41 A;  3F8X A;  1LOX A;  3CPO A;  1OF5 B;  4NHF A;  3NM2 A;  3D4A A;  3JUO A;  2INX A;  3DXO A;  1UI7 A;  4LMI A;  3SOY A;  3KII A;  8CHO A;  4XB5 A;  1RGL A;  5HOH A;  1PY3 A;  3FZW A;  3DUK A;  4N6T A;  4HM3 B;  4RNY A;  3CCM 3;  2BU4 A;  3Q2P A;  2MF7 A;  3NBR A;  3DGL A;  3EHC A;  3T8N A;  3K0Z A;  2XFT A;  1BRK A;  3LT9 A;  3MG1 A;  1N9E A;  1OGZ A;  3F7S A;  2IUK A;  4HYZ A;  2MC8 A;  1VQ7 3;  1Q82 4;  3MPH A;  1O7G B;  3D5I A;  1BUJ A;  1DE3 A;  2WOH A;  1UDI I;  3WA3 A;  1YI2 3;  1R4C A;  5M1A A;  3CC2 3;  1HU9 A;  3CU3 A;  4J5K A;  3OWU A;  5CF1 A;  1Y4K A;  2GSP A;  4I4K A;  3AHW A;  4FMC A;  2YX9 A;  2CFD A;  3CXC 2;  5BIR A;  2OQE A;  2OTL 3;  3EF8 A;  3E99 A;  1OCV A;  1OUN A;  1X1W A;  3EC9 A;  3OXA A;  1DMM A;  4O02 B;  5AIF A;  1QAL A;  5IF6 A;  3HZP A;  4LSO A;  5BXQ A;  3GZY B;  1IVU A;  1NB3 I;  1RHL A;  5DRE A;  5BU4 A;  4R4K A;  4HZ9 B;  2OQE C;  2W56 A;  3LXU X;  2D1W A;  5G2G A;  4BTX A;  3ZG0 A;  2XR8 B;  2ZHX B;  3LOY A;  3VSY A;  1UCJ A;  4STD A;  1A90 A;  2O9U X;  2CH9 A;  2W03 A;  1HKX A;  3LTB A;  3S29 A;  1QJG A;  1M1K 4;  5G1L A;  1BAO A;  2OOV A;  3EJV A;  1K8A 4;  4RZM A;  2W6J H;  4N6O B;  3GSP A;  3NHX A;  1A2P A;  2YFI B;  1IT8 A;  2KAA A;  2OOV C;  3I0Y A;  4ZM8 A;  3K9M C;  3EBY A;  1X1U A;  3DMC A;  2BHM A;  1Q86 4;  5JBS A;  2AAD A;  1GOY A;  3T0U A;  1M9G A;  1WMN A;  3IPT A;  1JJ2 2;  1A2V A;  4I5Q A;  5AIH A;  1VQQ A;  3SYU A;  3OW2 2;  2RFR A;  3DGO A;  3NXJ A;  1OHS A;  1Q7H A;  1FW7 A;  3OWS A;  5M19 A;  1BVI A;  1CYV A;  2K0M A;  3CME 3;  2R41 A;  2I9W A;  2QIY A;  1X1X A;  3CPW 2;  2W56 B;  4QWT A;  2PZV A;  1DET A;  5AI1 A;  1JN5 A;  1MOL A;  1W6C A;  3FG3 A;  5CF2 A;  3N9H A;  1RRH A;  4ORL A;  2GU3 A;  2V1L A;  1I0X A;  2XEP A;  3HX8 A;  1UGI A;  1B21 A;  1OHP A;  3KZT A;  5AYS C;  3HK4 A;  3U1W A;  3X3Z A;  1E3V A;  2CWV A;  3G4S 3;  1JNQ A;  1NJI 4;  1US1 A;  3CCL 3;  1RSN A;  2STD A;  1BIR A;  4TX4 A;  1I2E A;  3F9S A;  4IPB A;  3BNB A;  2JDI H;  4J5G A;  5LC6 A;  3I55 3;  3VF1 A;  1O7M B;  4KT3 B;  2CWT A;  3OWY A;  1BSE A;  3X3X A;  1B3S A;  1FA3 A;  2KF3 A;  3PS8 A;  3LML A;  3NUV A;  1O7W B;  3NBB A;  1QMA A;  2CFW A;  3PZW A;  1ULI B;  3WDG B;  1U8C B;  3H3H A;  3HII A;  2F5W A;  2IUJ A;  7STD A;  3LYG A;  3QK9 A;  5FW5 A;  1BSB A;  1BAN A;  2P38 A;  1GY5 A;  5KP3 A;  1ZO2 A;  4XBY A;  2LYX A;  1IQ8 A;  1YJ9 3;  1PFP A;  1RLS A;  1K41 A;  2UGI A;  3F40 A;  4OUQ A;  4PEJ A;  1SQW A;  5D82 A;  3F8H A;  2SBL A;  2CHC A;  2IMJ A;  1JKG B;  1STD A;  2BMR B;  2H0G A;  2KXG A;  1DVC A;  3LZA A;  4BL3 A;  4BL2 A;  2XGL A;  3NX0 A;  1TUH A;  4Q53 A;  3LTD A;  3RGA A;  5M18 A;  1BRN L;  1FUW A;  1JZD A;  3MSO A;  3CC7 3;  2F99 A;  3GWR A;  1WQL B;  1VQN 3;  3LTC A;  2RBI A;  2W0Q A;  3RGR A;  1MWR A;  1W7C A;  4GL6 A;  4ILF A;  1RRL A;  3UNL A;  1YJW 3;  4WP5 A;  2L4V A;  4RNT A;  4LZI A;  3TDG A;  1AV4 A;  2W9P A;  4IIA A;  1FGQ A;  1UI8 A;  1J2B A;  5TGN A;  1LNI A;  3FG1 A;  3BNC A;  1MWS A;  1S72 3;  1PU4 A;  1IVV A;  1LOV A;  1UW1 A;  3HOH A;  4FMB A;  4HM4 B;  4RBN A;  1CYU A;  1S5A A;  3A5E A;  1C54 A;  4IT7 A;  2W2C A;  1FGR A;  2Z6B A;  2P0X A;  5BVB A;  1W00 A;  5IG3 A;  3MWZ A;  3NQY A;  2ML6 A;  2F4Y A;  2XRX B;  4KFD A;  1TFK A;  2RCD A;  2Z77 A;  1IV7 A;  2CX0 A;  1NB5 I;  1KD1 4;  1N8Q A;  2BT3 A;  1FUT A;  2Q07 A;  2SAR A;  4HZB B;  3VGN A;  3D3L A;  3BLZ A;  1O7H B;  2L1S A;  1RDS A;  3FF0 A;  4R9L A;  5DRV A;  2KF4 A;  3UJM A;  1IQY A;  1VQ6 3;  1B2M A;  4LGQ A;  1ISK A;  1I8V A;  3EX9 A;  3JUQ A;  1LQG C;  1V74 A;  4R1K A;  2UUG C;  3X42 A;  1SPU A;  3DM8 A;  3LT8 A;  3WOD G;  1YHQ 3;  3X40 A;  5EQL A;  2KRT A;  3NV0 B;  1OGX A;  4AKY A;  5CK6 A;  2XSH B;  1YVB I;  1ULJ B;  4WHA A;  3HI7 A;  3SOA A;  1JBR A;  3KFQ C;  2KF5 A;  1SAR A;  2GEY A;  1GS3 A;  5FGO A;  1UUV B;  2GXF A;  3AMO A;  1Q81 4;  1IDP A;  1OHO A;  2FNQ A;  3NM7 A;  2F5M A;  1GSP A;  1JB4 A;  4H61 A;  4MEI A;  1I70 A;  1VZZ A;  4N6M A;  1L5G B;  1D6Y A;  3F7X A;  1EEJ A;  3T8U A;  1RGE A;  2HOH A;  1Q42 A;  3DZL A;  5AEW B;  2XH9 A;  3DGN A;  1I2F A;  4FMA A;  1VQL 3;  1LRA A;  3GRD A;  3GZR A;  5AIG A;  2OWP A;  3GZX B;  4R80 A;  1OAC A;  1YIJ 3;  1YIT 3;  1TP6 A;  4XBT A;  5IEN A;  2CFG A;  1GY6 A;  1ASK A;  1ZX2 A;  3KN4 A;  1Q7Y 4;  3EN1 B;  3M8C A;  5LC7 A;  3KE7 A;  1BRG A;  1V58 A;  5IEP A;  3B4P A;  1RN1 A;  1IYY A;  3OX9 A;  1KWI A;  3SLU A;  1TRP A;  3KSE D;  4MMY B;  2CFL A;  4GHO A;  3SVA A;  3FSD A;  4JF8 A;  1MGR A;  6STD A;  1FYS A;  2OCT A;  4O8S A;  4GSP A;  5IG5 A;  5RNT A;  1W6G A;  4L8P A;  1EG9 B;  3SXX A;  1QVF 2;  4X2H A;  2WGO A;  1LNH A;  4WYK A;  2CK3 H;  1Q40 A;  2B1X B;  2D42 A;  4L8O A;  1W5Z A;  4EV2 A;  1D6U A;  3V92 A;  1ZGX A;  1IU7 A;  3G6E 3;  2HMK B;  2F86 B;  3K5T A;  4MMX B;  3D79 A;  1UUG B;  2CIU A;  5D83 A;  5I97 A;  5IER A;  1FGO A;  3ZFZ A;  2H0I A;  2QEX 3;  1LQM B;  1T2I A;  4CPK A;  4K1V A;  1VQO 3;  1RGH A;  4FCJ A;  1I3I A;  1RGK A;  2XGN A;  3A76 A;  4HM6 B;  3CNX A;  3F14 A;  3ROB A;  1ZS7 A;  1B2X A;  1BGS A;  1QAF A;  5KP4 A;  1BUQ A;  2RNT A;  5IG0 A;  1PYL A;  3UL6 A;  3MG2 A;  3B4O A;  1BNS A;  4X2O A;  2WOF A;  1BSC A;  1W2B 2;  2ML5 A;  1NO3 A;  1LOW A;  1O7N B;  3K7C A;  4AKZ A;  3CD6 3;  1AY7 A;  3CCQ 3;  2B24 B;  3GZB A;  4HBR A;  4J9A A;  5KP1 A;  4KFF A;  1RNB A;  2HMM B;  2IA7 A;  4MMZ B;  3IMA B;  1VQ4 3;  2K3D A;  3OV4 A;  4G1M B;  1JB5 A;  1GY7 A;  1DMQ A;  2GU1 A;  3B7C A;  3KSP A;  4EXR A;  4FR9 A;  3S28 A;  1NNV A;  1JN5 B;  4HKV B;  3ALA A;  2PNC A;  3IJE B;  3FKA A;  2XF3 A;  3EN8 A;  4J8T A;  2E2V A;  2J8X B;  2O3O A;  4O2H A;  4O3V A;  3LTA A;  3MYT A;  1GMP A;  2CG0 A;  1N5H A;  1NDO B;  3BND A;  5IEO A;  4DKI A;  3V99 A;  1BOX A;  2BMQ B;  1VQM 3;  4K61 A;  4CDL A;  5JPU A;  1N9J A;  3G8Z A;  1IVW A;  3FGY A;  1OF5 A;  4H3U A;  1BSD A;  3STD A;  1YVS A;  1I3F A;  1B2U A;  1JV2 B;  4OK0 A;  3K63 A;  3MHE A;  1WTH A;  6RNT A;  1HYF A;  1U5O A;  4HJL B;  1VQK 3;  2RSX A;  1I0V A;  1JB2 A;  1I2G A;  1M1X B;  1T2H A;  3SX1 A;  1BNG A;  1TRQ A;  1T3B A;  1WMP A;  1GOU A;  2YFJ B;  2FXT A;  3FG4 A;  1AVK A;  2KF6 A;  3X3Y A;  5JPP A;  2XFS A;  1RGA A;  1BNI A;  1LXE A;  1RJO A;  2HML B;  4EW5 A;  4XBX A;  1DVD A;  4CJN A;  1JBT A;  4R9K A;  1RTU A;  1YJN 3;  1A67 A;  1CH0 A;  2F98 A;  2OTJ 3;  1VQ9 3;  1BSA A;  3FH1 A;  1BNF A;  1GMR A;  1T5Y A;  4N6U A;  5GSP A;  2IY2 A;  3LH4 A;  5D81 A;  2K54 A;  3WOE B;  4EC6 A;  2JQ5 A;  1ROA A;  2AAE A;  2M7O A;  1DYU A;  1TFO A;  3DY5 A;  3FF2 A;  3UB1 A;  5STD A;  3Q1C A;  1K73 4;  2Y73 A;  1O7P B;  1CEW I;  1BRI A;  1STF I;  3BB9 A;  2GEX A;  1TJD A;  1VQ8 3;  2CW9 A;  2BNG A;  1VQ5 3;  3SED A;  4HVN A;  1WMO A;  2HMN B;  1KQS 2;  4EV5 A;  4BU4 A;  2ZA4 A;  4OVM A;  3EBT A;  3URP A;  3EE1 A;  2E2T A;  1Z1S A;  1R4Y A;  3U97 A;  1LVN A;  1HZ1 A;  1YGE A;  4N6V 0;  3N8B A;  1GOV A;  3MG3 A;  3S67 A;  1B2Z A;  1B20 A;  2HMO B;  3O8Y A;  4FMD A;  1MWT A;  3BIR A;  5AYR B;  1SJW A;  1EUI C;  7GSP A;  2CG1 A;  1RN7 A;  4KVH A;  1JRQ A;  3RNT A; 
#chains in the Genus database with same CATH homology
 2C4B A;  1T2I A;  1G02 A;  1RGH A;  1I3I A;  1RGK A;  1JBS A;  3D4A A;  4BIR A;  3DH2 A;  1BRH A;  1RGL A;  5HOH A;  1B2X A;  1BGS A;  1PY3 A;  1BRN L;  2RNT A;  2BU4 A;  1PYL A;  2RBI A;  1BRK A;  1BNS A;  9RNT A;  1BSC A;  3D5I A;  1BUJ A;  4RNT A;  1BRJ A;  1DE3 A;  4HOH A;  1LOW A;  1LNI A;  6GSP A;  1AY7 A;  1YNV X;  4J5K A;  1LOV A;  3HOH A;  1RNB A;  2BIR A;  1GMQ A;  1LOY A;  2GSP A;  3AHW A;  3A5E A;  1C54 A;  1UCK A;  5BIR A;  8RNT A;  1RGG A;  1X1W A;  1FUS A;  1B2S A;  1MGW A;  1AQZ A;  7RNT A;  5BU4 A;  1YGW A;  1RHL A;  2F4Y A;  1FZU A;  1FUT A;  2SAR A;  3Q3F A;  1GMP A;  3AGO A;  1BOX A;  1Q9E A;  1RDS A;  1UCJ A;  2KF4 A;  1B2M A;  1I8V A;  1BNR A;  1BSD A;  1YVS A;  1BNE A;  1B2U A;  1I3F A;  1BAO A;  6RNT A;  1HYF A;  1BNJ A;  3WHO A;  1I0V A;  1I2G A;  3GSP A;  1T2H A;  1A2P A;  1JBR A;  1BNG A;  1TRQ A;  2KF5 A;  1GOU A;  1SAR A;  2KAA A;  2KF6 A;  3WR2 A;  1X1U A;  1RGA A;  1BNI A;  1BRS A;  1GSP A;  2AAD A;  2F5M A;  1I70 A;  1JBT A;  1GOY A;  1RTU A;  3BU4 A;  3SYU A;  1RGE A;  1CH0 A;  2HOH A;  1UCI A;  1BSA A;  1FW7 A;  1I2F A;  1BNF A;  1GMR A;  1LRA A;  1BU4 A;  5GSP A;  1BVI A;  2F56 A;  1X1X A;  1B27 A;  2AAE A;  1RGC A;  1DET A;  1RGF A;  1UCL A;  1BRI A;  1I0X A;  1B21 A;  1BRG A;  1RN1 A;  1IYY A;  1RSN A;  1RCK A;  1BIR A;  1TRP A;  1I2E A;  1RMS A;  4GHO A;  1RN4 A;  1RCL A;  1RNT A;  4J5G A;  4BU4 A;  2ZA4 A;  3URP A;  1MGR A;  1TTO A;  1BSE A;  3AHS A;  4HAA A;  1FYS A;  3KCH A;  1B3S A;  4GSP A;  1R4Y A;  1HZ1 A;  5RNT A;  2KF3 A;  1GOV A;  1X1Y A;  1B2Z A;  1B20 A;  2F5W A;  3AGN A;  3BIR A;  1BSB A;  1BAN A;  7GSP A;  1ZGX A;  3DGY A;  3D5G A;  1RLS A;  3RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...